1FTAA

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate, 1-phosphohydrolase) (e.c.3.1.3.11) complexed with the allosteric inhibitor amp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
327
structure length
319
Chain Sequence
DVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (phosphoric monoester)
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE
publication title The allosteric site of human liver fructose-1,6-bisphosphatase. Analysis of six AMP site mutants based on the crystal structure.
pubmed rcsb
source organism Homo sapiens
total genus 100
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1ftaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1ftaA02
1NI9A 2QFLA 1FJ6A 1G0HA 3LUZA 1INPA 5EYHA 2Y5KA 2PCRA 5IZ1A 4GWXA 5FBPA 1G0IA 2F3DA 4H45A 1LEVA 2FHYA 1RDYA 3KBZA 1QGXA 5T3JA 4HXVA 3BIHA 5EYGA 1NV1A 5J16A 3RYDA 1KA0A 1FJ9A 1FTAA 4GX6A 1FPBA 1RDXA 5ET5A 1FBCA 1NUYA 4MJOA 4IR8A 3IFCA 2CZHA 3FBPA 1FPLA 1IMFA 2JJKA 1FRPA 1FBHA 4AS4A 1NV6A 2Q74A 1DCUA 1IMBA 3B8BA 4KXPA 2Y5LA 3D1RA 5ET7A 2WBBA 1FSAA 1VDWA 3ROJA 1BK4A 2HHMA 2P3NA 4HE2A 1EYIA 3KC0A 1NV5A 5ET8A 2Q8MA 1D9QA 1FPJA 1FPKA 4I3YA 1IMDA 1FBDA 5I3SA 3IFAA 1FBFA 1NV7A 2CZKA 4AS5A 1EYKA 1NUZA 1IMEA 4O7IA 2FBPA 2GQ1A 5IZ3B 2VT5A 1IMCA 2OWZA 4GWYA 2R8TA 2FVZA 1Q9DA 1K9YA 1FBEA 5F24A 1KA1A 4QXDA 4GX3A 3RPLB 2FIEA 4GWUA 1NV2A 3BIGA 5A5LA 1LBZA 1NUXA 3QMFA 4GBVA 2OX3A 1AWBA 4I3EA 5DW8A 4H46A 4I40A 1IMAA 3LV0A 1FPEA 1LBWA 3KC1A 1K9ZA 3T0JA 2WEFA 1DBZA 4GBWA 5EQ8A 1LBXA 2QVRA 2BJIA 4GWSA 5EQ7A 1FPFA 4HE1A 1KZ8A 1LBVA 1EYJA 1FPIA 2CZIA 1FBGA 1NV0A 1RDZA 5LDZA 5ET6A 1FPGA 5IZ3A 1LBYA 2P3VA 1JP4A 2WBDA 1NV4A 4GWWA 5EQ9A 1YZ0A 1SPIA 2F3BA 2FIXA 1XI6A 1YYZA 5EQAA 1YXIA 1DK4A 2QVUA 3RPLA 1CNQA 3A29A 4HE0A 1FPDA 1NUWA 4GX4A 2QVVA 5ESYA 4PTKA 4G61A 1FBPA 4N81A 2DDKA 1NV3A 4FBPA 4GWZA
chains in the Genus database with same CATH superfamily
3KFMA 2Y7KA 5I56A 1P99A 3E9XA 3OO7A 3QYTA 1D9YA 3OSRA 2H99A 4ZS9A 4N91A 3C33A 4G8HA 2F8DA 3L6GA 3FVOA 3SEVA 3UP9A 2DVCA 5TPAB 3K1NA 4Q8RA 1Y3NA 4GQOA 3VFJA 2WKYA 2V4CA 1FQCA 4NTLA 3B8BA 1A55A 2PVUA 1US5A 4OHNA 3LSWA 2Q8MA 4GXSB 4N07A 1B32A 2V93A 4F1UA 3OMBA 4OETA 4O7IA 1N0TA 4WEDA 2QRYA 3MP1A 4G68A 3EN3A 4OVRA 1M5FA 5HPQA 4YKJA 1Y4TA 4ZZEA 1BTJA 1R1NA 3RPLB 5L9MA 2DS9A 2DWAA 5DW8A 2X7PA 4IO3A 3WAEA 4QF9A 1QUIA 2MKZA 4GFRA 1Z7ME 2BJIA 1FPIA 4PFYA 3TTNA 4EF2A 1LBYA 1SW4A 2L5VA 1ZJLA 1P1UA 3FJMA 5F7VA 4ZEIA 4JVCA 1EZPA 3JYRA 3MPLA 2I4CA 5L8DA 2XXIA 1LGBC 4GX4A 5JTYA 1LAGE 1S50A 3LSFB 3R6UA 4N17A 3G7WA 3VLWA 3KN7A 4F29A 2A5SA 2Y7RA 4X04A 4GRKA 1SI0A 5IAIA 4LVQA 1A99A 4EQBA 3PUXE 3V89B 4GL8A 2AYSA 1POY1 1DTZA 1LB8A 2CEYA 5CMKA 1KWHA 4R2FA 2QMXA 4ELOA 2CZHA 1FPLA 2OZZA 4G77A 1FRPA 1OIBA 3LUYA 4FJPA 3FXRA 1FQDA 1DCUA 2IEEA 4KYEA 4NF8B 4UABA 2DWHA 1I69A 4QFPA 3Q25A 4I3YA 2XXKA 4F39A 1IMEA 1IZ1A 1HSLA 3FV2A 4PFUA 1ZLQA 4DZ1A 1FBEA 4LZ8A 1FW0A 1Y9UA 4NF6B 5CC2A 2O7IA 5DEXA 4OZ9A 2FIEA 1NMUA 3TQLA 1JVXA 1ANFA 3PMVA 4LA9A 1MY3A 3DM0A 4I8CA 1K9ZA 2ALUA 5FHMA 3FV1A 5IZ3A 3IX1A 2H25A 3T22A 5B70A 2P3VA 2O1MA 4ZE9A 1P1QA 4FEDA 2ZNUA 2GHAA 3D4CA 3TPAA 1MH3A 4ZEKA 4XFEA 1MS7A 4N6KA 1B46A 2YPNA 4FEBA 4H45A 4Z0IA 4JVIA 4LATA 3FVKA 5I2KA 1B3FA 5KCJB 4P0GA 3SEXA 5J16A 1OMPA 4QSEA 5IZZA 3CSGA 4PFIA 2DQVA 3L6HA 4K3FA 4MJOA 2PX1A 2XXVA 3MJNA 1MQGA 2VD3A 3E79A 1XS5A 3H7MA 1R6ZA 1A8FA 5CRYA 2DP8A 3RPWA 3IJOB 1M5EA 3ONMA 1FSAA 4QHQA 2FBPA 4F3SA 4HCYA 3C4MA 1Q9DA 3IORA 1F9BA 3V83A 2YLNA 3BIGA 1BIYA 4F31B 1S9TA 3IB2A 2OX3A 1FQEA 2FA7A 1M5CA 3K6XA 3IJXB 2F7AA 1BKAA 2DWIA 3MZ1A 3O29A 3Q28A 4RY1A 4YMBA 2I58A 2OWTA 1YPNA 2DSFA 2QVUA 2D3IA 4U2RA 1OQGA 4N81A 1USYE 2V3QA 4N8GA 3SDFA 2F36A 4BLAA 2F78A 4GWXA 5FBPA 4L17A 2F3DA 3CG1A 3IOUA 3DLNA 4DI3D 4F3GA 2DE4A 4Z7EA 4PE3A 3KSJA 1H3DA 3EHTA 1DTGA 4KCCA 3B7DA 4HW8A 2JJKA 4DE8A 1B4ZA 3G3JA 4E0WA 3PUVE 2G93A 3Q27A 5AA1A 4RPNA 4HE2A 4RPOA 1LFIA 3FUZA 3PPRA 1FBFA 5HM4B 5ICTA 2QS1A 4NHBA 2GQ1A 4H0WA 3U65A 1P1OA 2AL4A 4H5GA 3ECRA 1I6BA 1N84A 2PBWA 1XVYA 1LAHE 2X26A 3USDA 4GX3A 4BDNA 4ESXA 1JEUA 5JTYB 1LCFA 4OYVA 5A5LA 2XXUA 1NUXA 1NFTA 3VLVA 4ZECA 2ZNTA 4NF4A 1AWBA 5H8HA 4PAIA 3M3KA 3KOSA 1NKXA 2HXWA 1LBXA 3ZKKA 3IL1B 2QVRA 4BDQA 3OO6A 2RC8A 5ET6A 1MM6A 3MWBA 1S7YA 2WBDA 2XXWA 4PFWA 1PB7A 2XWKA 1TWYA 3TQWA 4OTEA 1MRPA 2Z22A 1FJ6A 1BLFA 4MBPA 4X1BA 3W9VA 3EHUA 2AL5A 4LP2B 2HAUA 1H45A 2R6GE 4P3LA 4DXUA 3T1BA 2HXRA 2P2AA 4GXAA 5FTIA 2XXQA 1P1WA 4GF8A 4EQ7A 3FBPA 2O69A 2PMSA 2UYFA 3RLFE 3H03A 3TEPA 5DEXB 3E78A 4NX1A 2NUVA 2Y84A 3W9WA 4NF5B 4U23A 4PP0A 3U1OA 5JK4A 1MPCA 1VE4A 1IXHA 1JW1A 3K00A 3OD7A 4KQPA 1HSJA 3KN3A 1MXXA 3FJGA 5IZ3B 2CEXA 3QXMA 3PUWE 1KA1A 4P9KA 5CMMA 2OJTA 1EU8A 3HHGA 4O8MA 3TUSA 1B58A 2BJJX 1AL3A 1VFDA 3R7XA 4H67A 2O1LA 4GBVA 4IB2A 3HHFA 4KR5A 4MCOA 3THIA 3DP8A 1LBWA 5EQ7A 3UORA 1KZ8A 3FGSA 2ZNSA 5LDZA 5I2KB 3SETA 2HFBA 3FXUA 3LR1A 4M1VA 4ONYA 4TLLB 4OFJA 4PFRA 4R9GA 1MPBA 5EQAA 2O68A 3BKIB 1NUWA 1B7ZA 4ELPA 3PMXA 3OOAA 4BDOA 3GZGA 1NV3A 4FBPA 3E3KA 1NI9A 4ND9A 4WEPA 5B7DA 4OERA 1RYOA 3VLUA 1MY4A 3KSXA 3E4RA 2Q88A 1B0LA 2FHYA 2WYKA 4YMAA 1R9QA 1N3XA 2Z23A 2HPGA 3CFXA 4YKIA 3B50A 3W15C 1A40A 1FTAA 1LBBA 2X7QA 3T9VA 1A8EA 3OEKA 3CG3A 3HO7A 4PFTA 1XT8A 3MPKA 3D1RA 1PBQA 4DI4B 3HFUA 1EYIA 2F35A 4NEDA 2P0SA 3FIRA 3FXBA 4O3BA 1UQWA 4KYDA 2VT5A 2Q9TA 3M3LA 1N3WA 1XC1A 1NNKA 3U93A 4N15A 4KI0E 3PPNA 3RGYA 5LTCA 4GWUA 2XX8A 4P1LA 5FHNA 2ANJA 1ZKBA 4MEVA 5KDTA 3QSLA 1UTHA 3BFUA 4PCDA 4PDHA 4KCDA 1ZMGA 3C36A 3K2DA 2F34A 4YB7A 1H76A 3FVNA 2OPDA 3MUQA 4F3BA 3CR9A 2HEUA 2QS3A 3UGWA 1DSNA 3U8QA 3UIFA 1XI6A 4RK9A 3UK4A 1SDXA 1DK4A 5ESYA 2QL3A 4KPTA 1O63A 4O94A 2GHBA 4U4XA 3G3FA 3B6TA 3C32A 4QFNA 3CHGA 1POTA 4BDLA 3HV1A 1NNFA 1B1XA 5JEIA 2OPEA 1IIWA 3O28A 1A54A 4R2BA 5DYHA 4N8YA 1XVXA 4AS4A 2HQ0A 3VVEA 4Q5TA 2V3UA 2XXTA 4NF4B 4Q30B 1VDWA 1BK4A 4DDDA 1FPJA 1FPKA 2R9JA 4QSCA 5H8QA 1FBDA 1NV7A 4RNSA 2KQZA 3O9PA 3T9XB 4OFLA 2XHDA 3D4GA 1Y3QA 4R72A 3DP4A 4ZEFA 4FAJA 2R8TA 3VVFA 2FVZA 3IB0A 2B3FA 3TZAA 4QXDA 1FTJA 3VV5A 3RTFB 4AB6A 1QJMA 4NQ8A 3CI8A 4H65A 4OESA 2B3BA 1B52A 4P0IA 3IO4A 4IO2A 4THIA 4LQ2A 4PDDA 5BWJA 2RC9A 2F7BA 1NV0A 3A3CA 2XD3A 4NWDA 3IB1A 3TELA 1NV4A 1PB9A 1GTKA 1YZ0A 1FCKA 3KEIA 3IOWA 3QAXA 2P1SA 4AB5A 2ZZVA 3JV9A 5EHMA 2I3WA 4G61A 3PUZE 5F1QA 2DDKA 3TTMA 3DELB 4GLIA 4IY5A 2PCRA 5I59A 3K01A 4R6KA 1URGA 3MW0A 2XXYA 4OFOA 3PPQA 3CIJA 3K4UA 3HSTA 1QGXA 1B2HA 4HXVA 5A5XA 2D5WA 2DXYA 3TCFA 3NOHA 3MAMA 3ILUB 4OVJA 1FJ9A 1RDXA 3H6TA 4F22A 3IFCA 3MC2A 4JWOA 4U21A 2RKMA 2Q74A 1EH3A 2NWJA 1SVXB 5I84A 4NF0A 3JZJA 5TP9A 2R71A 4MMPA 4ECFA 4POXA 3GBAA 2DVZA 1QUJA 1JQFA 2ZZXA 3MVYA 2CZLA 2I49A 2OWZA 2PFZA 4JVDA 1K9YA 4G8MA 3FJ7A 4FIMA 2ABHA 4HS7A 3IO6A 1UIUA 3MYUA 5J1DA 3G3IA 4OWDA 1LSTA 3G3HA 4XKQA 2I6EA 3B6QA 4MLQA 2HZKA 5EQ8A 3ZKLA 1LBVA 4BDMA 1MXYA 5EHSA 2REGA 2XXXA 4FE8A 1SI1A 1SD3A 1TXFA 3HN0A 1LAFE 2V25A 5I56B 3R26A 4QFOA 1MDQA 3M8UA 4R74A 4KFQA 3QUJA 3LUZA 3MVWA 5IZ1A 4DXCA 3E13X 3QIMA 5T3JA 5EYGA 3PU5A 2Q2AA 3RYDA 2GRVA 1JETA 4GX6A 4MFIA 3A09A 3FXQA 4ZEBA 3RY3A 1LFHA 5TPAA 2XX9A 3G3KA 4PGNA 3OO9A 3HCQA 1Y1MA 1N04A 4NMYA 5EYFA 3LSLA 1UTHB 2CMOA 3O66A 4P1EA 3SEYA 2XXPA 1B5JA 5L9OA 2WBBA 3ROJA 3K6WA 2P3NA 2VOZA 4KYSA 4G68B 5M2VA 1BP5A 2I0BA 4OVQA 4NAPA 2UVIA 3TAJA 1DMBA 1LBZA 4LN5A 4YAHX 2WYPA 4OXVA 1H43A 3KC1A 2VGQA 3MVZA 2UVHA 2PYYA 5IM2A 3WAFA 5ELVA 5I2NA 4OANA 1FPFA 2CZIA 4WXJA 4EF1A 1AOVA 3BBRA 2B65A 3T93B 3K02A 3VDFA 3IR1A 2F3BA 4H8JA 3TYHA 3P7IA 4PF8A 2Y7PA 2Q2CA 4F2OA 4R73A 5DVFA 3I5OA 1PC3A 1MY1A 1Q1KA 4YB6A 1ELJA 1JNFA 1Y4CA 3FZVA 5DT6A 1D9VA 4OVTA 4XF5A 2QS4A 5IGAA 1D3KA 2VPNA 4ZDMA 2FYIA 3PMWA 4IGRA 4EQ9A 1NV1A 1B40A 1JW4A 1ZBMA 3EQ1A 5ET5A 1PDAA 4MHFA 4PC9A 3IK6B 4PF6A 2DWJA 1FBHA 1QULA 4BDRA 3K0VA 5CMBA 3RT6B 3ODBA 1B05A 3TCHA 1SW5A 1DOTA 1UTBA 2HHMA 4TOZA 4U4SA 2D21A 4NF8A 4LZ7A 3B6WA 5I3SA 1R9LA 1NH8A 3PPPA 1B4HA 1CE2A 2VD2A 3K1MA 4PAKA 1ZIUA 2V84A 4DCXA 4O7MA 1URDA 1XHYA 4R9FA 3N94A 4OVPA 1SYHA 5IKBA 3SEUA 4IO5A 2O6AA 1MXUA 4YU0A 3QMFA 4ELQA 1MXWA 3GBBA 3ZS6A 4I3EA 1MM7A 1YTVA 3LV0A 4C1TA 5I59B 1FQFA 1P1NA 3RNNA 2ONRA 4GWSA 3C35A 1FTKA 4DLDA 2RCAA 4H8IA 4MAGA 1JP4A 1MQJA 4GWWA 1TFAA 1B1HA 3CFLA 4AQ4A 3K6UA 3FD3A 3EPEA 1YXIA 2O51A 4LQ5A 4GIZA 1FTMA 1OVTA 3N6TA 3IOTA 3H6VA 2HAVA 3BFTA 1SW1A 1M5BA 2PT1A 2OBGA 4MF3A 4PBHA 1AIVA 1SQYA 1IXIA 5AA4A 4R6HA 2H98A 5L9SA 1IQ7A 3SEWA 3O2AA 1JEVA 4KD5A 3U92A 1B9JA 4IO6A 3PV0E 3OO8A 1MQHA 5ET7A 1MH4A 1USYH 2HCAA 4EXLA 1O64A 3N6UA 3FVGA 3EF7A 3SKPA 3IAZA 2A5TA 2ZYKA 4ZZAA 4NG7A 3ZSFA 1EYKA 2Q89A 2E1SA 3RTWB 3PGFA 1L5TA 2ZMBA 4PFBA 5I57A 1LAXA 2PT2A 2THIA 4PETA 3V8XB 4YKPA 4NE4A 4H1XA 3TTKA 3SERA 2QJEA 4OVSA 4I40A 4LONB 4UA8A 5DTBA 3ILTB 5CBRA 4I62A 1MY2A 4HE1A 4GOTA 1RDZA 1NNTA 2ZYNA 2Z8FA 1J1NA 4HE0A 3F11A 3KN8A 3O97A 4MNPA 1JW5A 2Y7WA 4FORA 2B4MA 1G0IA 1MY0A 4NWCA 4QBAA 4WKMA 1QKBA 1QVSA 3MP6A 2F97A 4IY6A 1VR5A 1MXZA 1NUYA 1NL5A 2DE2A 5ISUA 3CVGA 4XTCQ 1IMFA 1AMFA 4X1DA 3TFLA 1GGGA 3U94A 4X8RA 3MSTA 3EHSA 4HCWA 4RXLA 2F6PA 4RK2A 5DVIA 2KLFA 1A7LA 4U22A 3KC0A 5ITOA 1B5HA 1MPDA 5I2NB 3O6HA 3IFAA 2IA4A 2CZKA 4AS5A 4I9DA 2F5XA 5K2XA 2ZYMA 1XOCA 2RC7A 3Q26A 1B3HA 4N6DA 3TODA 2RF1A 4JWXA 2PFYA 5H8HB 1EZ9A 2NVUB 1B3LA 3T9HB 3PD8A 1IMAA 1LBCA 4OEVA 3PTYA 1I6AA 3KJTA 5CMCA 3UN6A 1N7XA 3CFZA 5FHOA 1B7UA 1NNPA 2LAOA 1Y20A 3TCGA 3M3FA 3VE1B 3TTRA 1PBPA 5EQ9A 2I3VA 4I1DA 4OA4A 2GFEA 2VP1A 1Y1ZA 3CSBA 2QVVA 1TT1A 4PTKA 4Q0CA 5AE4A 1FBPA 3KOTA 5TU0A 2DE3A 3ISPA 2QSXA 3V5AA 5AA3A 2GH9A 4JBZA 2M8CA 2Y5KA 2FNCA 3QK6A 4HTGA 1UTBB 1LCTA 3I6VA 2F7CA 4OMBA 4P11A 2H5YA 2I48A 1B3GA 4ELRA 2E0SA 1Q35A 2KR0A 4QRZA 2REJA 4MLVA 5H8NA 1YAEA 4KXPA 1RYXA 1GV8A 4NF5A 2QMWA 2XX7A 3N5LA 3TMGA 1B5IA 1N76A 1IMDA 4OEUA 5I58A 1GR2A 1NUZA 4DIGA 1FTOA 3O6IA 4IO7A 4PQJA 1TFDA 2RINA 2WX9A 4ZEDA 3U72A 2ONKE 3T9UA 4LZ5A 4P56A 2RCBA 1IEJA 4R75A 4MH5A 1B0HA 4LUBA 4PAFA 1DBZA 1T0KA 1US4A 1URSA 5AA4B 4YICA 4ESWA 3H6UA 4O3AA 2Q8JA 1FPGA 2AIXA 2XWVA 2XXRA 3KJ7A 1B6HA 1OVBA 4PBQA 3GLBA 3T66A 4P47A 3OELA 5H8FA 2XWIA 4IGTA 4ZE8A 1WDNA 1FTLA 3KBRA 2I4BA 4QFLA 4GWZA 4JXIA 3RN8A 2F6GA 4DXBA 2G29A 1INPA 3VXBA 2OWSA 4RJZA 3DP6A 4MNCA 3TTLA 1QKAA 2A5TB 3LBSA 4UACA 4XKRA 3AXFA 1IXGA 5I57B 4XXUA 1WVJA 3EKIA 5KZTA 1OLAA 2Z8EA 5I5PA 4ISUA 4TLMB 5AA2A 1B3EA 4PGPA 2UVJA 1NV6A 3S9MC 2O7UA 3UA8A 1IMBA 4F1VA 2VHAA 1SBPA 5CBSA 1MDP1 2ZXTA 3KG2A 5ET8A 2ESNA 1D9QA 4X9TA 3RQTA 1IUDA 1FQBA 2Y7IA 3C31A 3OSQA 1IMCA 1HSEA 4N13A 4GWYA 5K2YA 1PB8A 4NN3A 2NOOA 3MZ9A 3H4ZA 5KDTB 4F2QA 1NV2A 3LC8A 2YJPA 4H46A 3IOVA 1Y3PA 1FPEA 3SESA 3HPIA 4JSOA 3GXAA 4O3CA 4QFKA 3N26A 1ZU0A 4FECA 4X48A 3MBPA 1FQAA 1OLCA 4OQOA 1SW2A 1SPIA 3H3GA 2Z8DA 4XKPA 2VPOA 3RPLA 3PD9A 2O84X 1CNQA 4JSDA 3CRBA 4F19A 3VVDA 2ONSA 5CM6A 4M4GA 1G0HA 4H6DA 5EYHA 3S9EA 2DOJA 1VFEA 1LEVA 1QUKA 1WODA 1RDYA 3G3GA 1M5DA 2NXOA 3I3VA 4PE5B 1KA0A 1SYIA 2ZZWA 2OLBA 1YCJA 1MG1A 2XA5A 2DXRA 4IR8A 4H5FA 4KHZE 3MQ9A 2QS2A 4F1YA 1H44A 4P8BA 1LFGA 1MXVA 3PUYE 1MQIA 3TDJA 2Y5LA 2UYEA 1GVCA 1UIVA 4C1UA 4NGUA 4RA1A 4N6PA 3H06B 5H8QB 5BUUA 4EDPA 4XEQA 2H4IA 1N7WA 2OCUA 2XWOA 4JDFA 4QSDA 4XIGQ 1B7HA 2H9BA 4MIJA 3S2VA 3K1PA 4RYAA 4G8NA 3FATA 4GL0A 1VSOA 4YKKA 3FASA 4DCYA 1OQHA 3S4UA 2WEFA 4GBWA 4F18A 3C34A 3LSXA 3K6VA 4F3PA 2UVGA 5HBCA 1RKMA 3SZPA 4G68C 1JVYA 4E0XA 3OEMA 2FIXA 4NF6A 5DVJA 1DPPA 4JWYA 2W7YA 1LLSA 3A29A 1Z7NE 1FPDA 4GD5A 5LOMA 3RT8A 5ITPA 5H8NB 2QFLA 1QW0A 4EUOA 1O7TA 4G2ZA 5AA2D 4EXKA 4R6YA 5A5XB 1B51A 2B4LA 3KBZA 4GVOA 3Q29A 4C0RA 1AH5A 1ZTYA 1CB6A 5I58B 1IXCA 3BIHA 3O6GA 3T96B 2XXHA 1EZOA 5ICQA 3C9HA 1FPBA 1II5A 1FBCA 4N4UA 4U1OA 5CI5A 4YB5A 1NH7A 1IITA 5I7IA 5TP9B 4GWOA 1LB9A 1DPEA 3PPOA 1PEBA 3GYYA 1NV5A 3A3UA 3MZBA 2XD2A 1I6QA 2QPQA 2DYXA 4MNIA 5KCJA 3VXCA 1MQDA 2HZLA 5H8SA 5F24A 3OXNA 3RUMA 4FATA 5H8FB 3KZGA 2V3TA 3OENA 4MX6A 2OK2A 4XKNA 3T0JA 2UXAA 2ZYOA 3QUFA 1EYJA 3S9LC 1FBGA 4U1ZA 4OENA 3S9NC 1ATGA 5FTHA 3H6WA 4IO4A 3TKDA 4JB7A 1D4NA 4YZZA 1YYZA 4POWA 4TQUQ 4G4PA 2I0CA 5AA2B 3MP8A 3KGCA 3MVXA
chains in the Genus database with same CATH topology
3LUZA 1FJ6A 2Y5KA 5IZ1A 3W9VA 5T3JA 4N91A 4P3LA 5EYGA 3RYDA 3T1BA 2HXRA 4GX6A 3FBPA 2KR0A 4PGNA 3E78A 4NX1A 2V4CA 3W9WA 3B8BA 4KXPA 4P1EA 2WBBA 5JK4A 3ROJA 2P3NA 2Q8MA 1IMDA 4F1UA 1NUZA 4O7IA 5IZ3B 2CEXA 4OVRA 1KA1A 2WX9A 4P9KA 4OVQA 4NAPA 3RPLB 4O8MA 4P56A 1LBZA 4LN5A 2WYPA 4GBVA 5DW8A 4MCOA 1LBWA 3KC1A 4PAFA 2MKZA 1DBZA 5IM2A 2BJIA 5EQ7A 1FPFA 4OANA 1KZ8A 1FPIA 4YICA 2CZIA 5LDZA 1FPGA 1LBYA 2L5VA 2XWVA 4M1VA 4JVCA 4PBQA 2F3BA 4P47A 4PFRA 4PF8A 5EQAA 2XWIA 1NUWA 4GX4A 1NV3A 4FBPA 4N17A 4GWZA 1NI9A 1INPA 4OVTA 4X04A 4XF5A 4MNCA 5IGAA 2VPNA 2FHYA 2WYKA 2HPGA 3B50A 1NV1A 2CEYA 1FTAA 3EKIA 5ET5A 5I5PA 4MHFA 4PC9A 2CZHA 1FPLA 4PF6A 1FRPA 4PGPA 1FBHA 1NV6A 1DCUA 1IMBA 4F1VA 3D1RA 4DI4B 4UABA 2HHMA 3HFUA 1EYIA 5ET8A 1D9QA 4X9TA 4I3YA 2XXKA 5I3SA 3FXBA 1IMEA 4PAKA 2VT5A 1IMCA 4GWYA 2Q9TA 4O7MA 1FBEA 4NN3A 4N15A 4OVPA 2FIEA 5LTCA 4GWUA 1NV2A 4P1LA 4MEVA 3QMFA 4PCDA 4PDHA 4I3EA 4H46A 3LV0A 1FPEA 1K9ZA 4GWSA 4MAGA 5IZ3A 2P3VA 1JP4A 4GWWA 1SPIA 1XI6A 2VPOA 1YXIA 1DK4A 3RPLA 1CNQA 5ESYA 4F19A 5CM6A 1G0HA 4O94A 4XFEA 4N6KA 5EYHA 4PBHA 4H45A 3CHGA 4JVIA 1LEVA 1RDYA 5J16A 1KA0A 2ZZWA 5IZZA 4PFIA 2XA5A 4MJOA 4IR8A 3E79A 4N8YA 4AS4A 4P8BA 2Y5LA 5ET7A 4NGUA 1FSAA 1VDWA 1BK4A 1FPJA 1FPKA 4XEQA 1FBDA 1NV7A 2XWOA 4NG7A 1EYKA 2KQZA 2FBPA 4PFBA 4HCYA 4PETA 2R8TA 2FVZA 1Q9DA 4MIJA 4QXDA 3BIGA 4NQ8A 2OX3A 4OVSA 4I40A 2WEFA 4GBWA 4PDDA 4F18A 4HE1A 1NV0A 1RDZA 3SZPA 1NV4A 1YZ0A 2FIXA 2ZZVA 2QVUA 3A29A 4HE0A 1FPDA 4MNPA 4G61A 4N81A 2DDKA 2V3QA 4N8GA 2QFLA 2B4MA 2PCRA 4GWXA 5FBPA 1G0IA 2F3DA 4QBAA 4DI3D 2B4LA 3KBZA 1QGXA 2DE4A 4HXVA 4PE3A 3BIHA 3NOHA 1FJ9A 1FPBA 1RDXA 4N4UA 1FBCA 1NUYA 2DE2A 3IFCA 1IMFA 2JJKA 2Q74A 5I7IA 4X8RA 3MSTA 4HCWA 4NF0A 4MMPA 4HE2A 3GYYA 3KC0A 1NV5A 2DVZA 2QPQA 3IFAA 1FBFA 4MNIA 2CZKA 4AS5A 2ZZXA 2F5XA 4NHBA 2GQ1A 2OWZA 3U65A 2PFZA 2HZLA 4JVDA 1K9YA 5F24A 4N6DA 4GX3A 3MYUA 2PFYA 5A5LA 4MX6A 5J1DA 1NUXA 1AWBA 1IMAA 3PTYA 4PAIA 3T0JA 2HZKA 5EQ8A 1LBXA 2QVRA 1LBVA 1EYJA 1FBGA 5ET6A 2WBDA 5EQ9A 4OA4A 4YZZA 1YYZA 2XWKA 2QVVA 4PTKA 1FBPA 2DE3A 3ISPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI9 A;  2QFL A;  1FJ6 A;  1G0H A;  3LUZ A;  1INP A;  5EYH A;  2Y5K A;  2PCR A;  5IZ1 A;  4GWX A;  5FBP A;  1G0I A;  2F3D A;  4H45 A;  1LEV A;  2FHY A;  1RDY A;  3KBZ A;  1QGX A;  5T3J A;  4HXV A;  3BIH A;  5EYG A;  1NV1 A;  5J16 A;  3RYD A;  1KA0 A;  1FJ9 A;  1FTA A;  4GX6 A;  1FPB A;  1RDX A;  5ET5 A;  1FBC A;  1NUY A;  4MJO A;  4IR8 A;  3IFC A;  2CZH A;  3FBP A;  1FPL A;  1IMF A;  2JJK A;  1FRP A;  1FBH A;  4AS4 A;  1NV6 A;  2Q74 A;  1DCU A;  1IMB A;  3B8B A;  4KXP A;  2Y5L A;  3D1R A;  5ET7 A;  2WBB A;  1FSA A;  1VDW A;  3ROJ A;  1BK4 A;  2HHM A;  2P3N A;  4HE2 A;  1EYI A;  3KC0 A;  1NV5 A;  5ET8 A;  2Q8M A;  1D9Q A;  1FPJ A;  1FPK A;  4I3Y A;  1IMD A;  1FBD A;  5I3S A;  3IFA A;  1FBF A;  1NV7 A;  2CZK A;  4AS5 A;  1EYK A;  1NUZ A;  1IME A;  4O7I A;  2FBP A;  2GQ1 A;  5IZ3 B;  2VT5 A;  1IMC A;  2OWZ A;  4GWY A;  2R8T A;  2FVZ A;  1Q9D A;  1K9Y A;  1FBE A;  5F24 A;  1KA1 A;  4QXD A;  4GX3 A;  3RPL B;  2FIE A;  4GWU A;  1NV2 A;  3BIG A;  5A5L A;  1LBZ A;  1NUX A;  3QMF A;  4GBV A;  2OX3 A;  1AWB A;  4I3E A;  5DW8 A;  4H46 A;  4I40 A;  1IMA A;  3LV0 A;  1FPE A;  1LBW A;  3KC1 A;  1K9Z A;  3T0J A;  2WEF A;  1DBZ A;  4GBW A;  5EQ8 A;  1LBX A;  2QVR A;  2BJI A;  4GWS A;  5EQ7 A;  1FPF A;  4HE1 A;  1KZ8 A;  1LBV A;  1EYJ A;  1FPI A;  2CZI A;  1FBG A;  1NV0 A;  1RDZ A;  5LDZ A;  5ET6 A;  1FPG A;  5IZ3 A;  1LBY A;  2P3V A;  1JP4 A;  2WBD A;  1NV4 A;  4GWW A;  5EQ9 A;  1YZ0 A;  1SPI A;  2F3B A;  2FIX A;  1XI6 A;  1YYZ A;  5EQA A;  1YXI A;  1DK4 A;  2QVU A;  3RPL A;  1CNQ A;  3A29 A;  4HE0 A;  1FPD A;  1NUW A;  4GX4 A;  2QVV A;  5ESY A;  4PTK A;  4G61 A;  1FBP A;  4N81 A;  2DDK A;  1NV3 A;  4FBP A;  4GWZ A; 
#chains in the Genus database with same CATH topology
 3KFM A;  2Y7K A;  5I56 A;  1P99 A;  3E9X A;  3OO7 A;  3QYT A;  1D9Y A;  3OSR A;  2H99 A;  4ZS9 A;  4N91 A;  3C33 A;  4G8H A;  2F8D A;  3L6G A;  3FVO A;  3SEV A;  3UP9 A;  2DVC A;  5TPA B;  3K1N A;  4Q8R A;  1Y3N A;  4GQO A;  3VFJ A;  2WKY A;  2V4C A;  1FQC A;  4NTL A;  3B8B A;  1A55 A;  2PVU A;  1US5 A;  4OHN A;  3LSW A;  2Q8M A;  4GXS B;  4N07 A;  1B32 A;  2V93 A;  4F1U A;  3OMB A;  4OET A;  4O7I A;  1N0T A;  4WED A;  2QRY A;  3MP1 A;  4G68 A;  3EN3 A;  4OVR A;  1M5F A;  5HPQ A;  4YKJ A;  1Y4T A;  4ZZE A;  1BTJ A;  1R1N A;  3RPL B;  5L9M A;  2DS9 A;  2DWA A;  5DW8 A;  2X7P A;  4IO3 A;  3WAE A;  4QF9 A;  1QUI A;  2MKZ A;  4GFR A;  1Z7M E;  2BJI A;  1FPI A;  4PFY A;  3TTN A;  4EF2 A;  1LBY A;  1SW4 A;  2L5V A;  1ZJL A;  1P1U A;  3FJM A;  5F7V A;  4ZEI A;  4JVC A;  1EZP A;  3JYR A;  3MPL A;  2I4C A;  5L8D A;  2XXI A;  1LGB C;  4GX4 A;  5JTY A;  1LAG E;  1S50 A;  3LSF B;  3R6U A;  4N17 A;  3G7W A;  3VLW A;  3KN7 A;  4F29 A;  2A5S A;  2Y7R A;  4X04 A;  4GRK A;  1SI0 A;  5IAI A;  4LVQ A;  1A99 A;  4EQB A;  3PUX E;  3V89 B;  4GL8 A;  2AYS A;  1POY 1;  1DTZ A;  1LB8 A;  2CEY A;  5CMK A;  1KWH A;  4R2F A;  2QMX A;  4ELO A;  2CZH A;  1FPL A;  2OZZ A;  4G77 A;  1FRP A;  1OIB A;  3LUY A;  4FJP A;  3FXR A;  1FQD A;  1DCU A;  2IEE A;  4KYE A;  4NF8 B;  4UAB A;  2DWH A;  1I69 A;  4QFP A;  3Q25 A;  4I3Y A;  2XXK A;  4F39 A;  1IME A;  1IZ1 A;  1HSL A;  3FV2 A;  4PFU A;  1ZLQ A;  4DZ1 A;  1FBE A;  4LZ8 A;  1FW0 A;  1Y9U A;  4NF6 B;  5CC2 A;  2O7I A;  5DEX A;  4OZ9 A;  2FIE A;  1NMU A;  3TQL A;  1JVX A;  1ANF A;  3PMV A;  4LA9 A;  1MY3 A;  3DM0 A;  4I8C A;  1K9Z A;  2ALU A;  5FHM A;  3FV1 A;  5IZ3 A;  3IX1 A;  2H25 A;  3T22 A;  5B70 A;  2P3V A;  2O1M A;  4ZE9 A;  1P1Q A;  4FED A;  2ZNU A;  2GHA A;  3D4C A;  3TPA A;  1MH3 A;  4ZEK A;  4XFE A;  1MS7 A;  4N6K A;  1B46 A;  2YPN A;  4FEB A;  4H45 A;  4Z0I A;  4JVI A;  4LAT A;  3FVK A;  5I2K A;  1B3F A;  5KCJ B;  4P0G A;  3SEX A;  5J16 A;  1OMP A;  4QSE A;  5IZZ A;  3CSG A;  4PFI A;  2DQV A;  3L6H A;  4K3F A;  4MJO A;  2PX1 A;  2XXV A;  3MJN A;  1MQG A;  2VD3 A;  3E79 A;  1XS5 A;  3H7M A;  1R6Z A;  1A8F A;  5CRY A;  2DP8 A;  3RPW A;  3IJO B;  1M5E A;  3ONM A;  1FSA A;  4QHQ A;  2FBP A;  4F3S A;  4HCY A;  3C4M A;  1Q9D A;  3IOR A;  1F9B A;  3V83 A;  2YLN A;  3BIG A;  1BIY A;  4F31 B;  1S9T A;  3IB2 A;  2OX3 A;  1FQE A;  2FA7 A;  1M5C A;  3K6X A;  3IJX B;  2F7A A;  1BKA A;  2DWI A;  3MZ1 A;  3O29 A;  3Q28 A;  4RY1 A;  4YMB A;  2I58 A;  2OWT A;  1YPN A;  2DSF A;  2QVU A;  2D3I A;  4U2R A;  1OQG A;  4N81 A;  1USY E;  2V3Q A;  4N8G A;  3SDF A;  2F36 A;  4BLA A;  2F78 A;  4GWX A;  5FBP A;  4L17 A;  2F3D A;  3CG1 A;  3IOU A;  3DLN A;  4DI3 D;  4F3G A;  2DE4 A;  4Z7E A;  4PE3 A;  3KSJ A;  1H3D A;  3EHT A;  1DTG A;  4KCC A;  3B7D A;  4HW8 A;  2JJK A;  4DE8 A;  1B4Z A;  3G3J A;  4E0W A;  3PUV E;  2G93 A;  3Q27 A;  5AA1 A;  4RPN A;  4HE2 A;  4RPO A;  1LFI A;  3FUZ A;  3PPR A;  1FBF A;  5HM4 B;  5ICT A;  2QS1 A;  4NHB A;  2GQ1 A;  4H0W A;  3U65 A;  1P1O A;  2AL4 A;  4H5G A;  3ECR A;  1I6B A;  1N84 A;  2PBW A;  1XVY A;  1LAH E;  2X26 A;  3USD A;  4GX3 A;  4BDN A;  4ESX A;  1JEU A;  5JTY B;  1LCF A;  4OYV A;  5A5L A;  2XXU A;  1NUX A;  1NFT A;  3VLV A;  4ZEC A;  2ZNT A;  4NF4 A;  1AWB A;  5H8H A;  4PAI A;  3M3K A;  3KOS A;  1NKX A;  2HXW A;  1LBX A;  3ZKK A;  3IL1 B;  2QVR A;  4BDQ A;  3OO6 A;  2RC8 A;  5ET6 A;  1MM6 A;  3MWB A;  1S7Y A;  2WBD A;  2XXW A;  4PFW A;  1PB7 A;  2XWK A;  1TWY A;  3TQW A;  4OTE A;  1MRP A;  2Z22 A;  1FJ6 A;  1BLF A;  4MBP A;  4X1B A;  3W9V A;  3EHU A;  2AL5 A;  4LP2 B;  2HAU A;  1H45 A;  2R6G E;  4P3L A;  4DXU A;  3T1B A;  2HXR A;  2P2A A;  4GXA A;  5FTI A;  2XXQ A;  1P1W A;  4GF8 A;  4EQ7 A;  3FBP A;  2O69 A;  2PMS A;  2UYF A;  3RLF E;  3H03 A;  3TEP A;  5DEX B;  3E78 A;  4NX1 A;  2NUV A;  2Y84 A;  3W9W A;  4NF5 B;  4U23 A;  4PP0 A;  3U1O A;  5JK4 A;  1MPC A;  1VE4 A;  1IXH A;  1JW1 A;  3K00 A;  3OD7 A;  4KQP A;  1HSJ A;  3KN3 A;  1MXX A;  3FJG A;  5IZ3 B;  2CEX A;  3QXM A;  3PUW E;  1KA1 A;  4P9K A;  5CMM A;  2OJT A;  1EU8 A;  3HHG A;  4O8M A;  3TUS A;  1B58 A;  2BJJ X;  1AL3 A;  1VFD A;  3R7X A;  4H67 A;  2O1L A;  4GBV A;  4IB2 A;  3HHF A;  4KR5 A;  4MCO A;  3THI A;  3DP8 A;  1LBW A;  5EQ7 A;  3UOR A;  1KZ8 A;  3FGS A;  2ZNS A;  5LDZ A;  5I2K B;  3SET A;  2HFB A;  3FXU A;  3LR1 A;  4M1V A;  4ONY A;  4TLL B;  4OFJ A;  4PFR A;  4R9G A;  1MPB A;  5EQA A;  2O68 A;  3BKI B;  1NUW A;  1B7Z A;  4ELP A;  3PMX A;  3OOA A;  4BDO A;  3GZG A;  1NV3 A;  4FBP A;  3E3K A;  1NI9 A;  4ND9 A;  4WEP A;  5B7D A;  4OER A;  1RYO A;  3VLU A;  1MY4 A;  3KSX A;  3E4R A;  2Q88 A;  1B0L A;  2FHY A;  2WYK A;  4YMA A;  1R9Q A;  1N3X A;  2Z23 A;  2HPG A;  3CFX A;  4YKI A;  3B50 A;  3W15 C;  1A40 A;  1FTA A;  1LBB A;  2X7Q A;  3T9V A;  1A8E A;  3OEK A;  3CG3 A;  3HO7 A;  4PFT A;  1XT8 A;  3MPK A;  3D1R A;  1PBQ A;  4DI4 B;  3HFU A;  1EYI A;  2F35 A;  4NED A;  2P0S A;  3FIR A;  3FXB A;  4O3B A;  1UQW A;  4KYD A;  2VT5 A;  2Q9T A;  3M3L A;  1N3W A;  1XC1 A;  1NNK A;  3U93 A;  4N15 A;  4KI0 E;  3PPN A;  3RGY A;  5LTC A;  4GWU A;  2XX8 A;  4P1L A;  5FHN A;  2ANJ A;  1ZKB A;  4MEV A;  5KDT A;  3QSL A;  1UTH A;  3BFU A;  4PCD A;  4PDH A;  4KCD A;  1ZMG A;  3C36 A;  3K2D A;  2F34 A;  4YB7 A;  1H76 A;  3FVN A;  2OPD A;  3MUQ A;  4F3B A;  3CR9 A;  2HEU A;  2QS3 A;  3UGW A;  1DSN A;  3U8Q A;  3UIF A;  1XI6 A;  4RK9 A;  3UK4 A;  1SDX A;  1DK4 A;  5ESY A;  2QL3 A;  4KPT A;  1O63 A;  4O94 A;  2GHB A;  4U4X A;  3G3F A;  3B6T A;  3C32 A;  4QFN A;  3CHG A;  1POT A;  4BDL A;  3HV1 A;  1NNF A;  1B1X A;  5JEI A;  2OPE A;  1IIW A;  3O28 A;  1A54 A;  4R2B A;  5DYH A;  4N8Y A;  1XVX A;  4AS4 A;  2HQ0 A;  3VVE A;  4Q5T A;  2V3U A;  2XXT A;  4NF4 B;  4Q30 B;  1VDW A;  1BK4 A;  4DDD A;  1FPJ A;  1FPK A;  2R9J A;  4QSC A;  5H8Q A;  1FBD A;  1NV7 A;  4RNS A;  2KQZ A;  3O9P A;  3T9X B;  4OFL A;  2XHD A;  3D4G A;  1Y3Q A;  4R72 A;  3DP4 A;  4ZEF A;  4FAJ A;  2R8T A;  3VVF A;  2FVZ A;  3IB0 A;  2B3F A;  3TZA A;  4QXD A;  1FTJ A;  3VV5 A;  3RTF B;  4AB6 A;  1QJM A;  4NQ8 A;  3CI8 A;  4H65 A;  4OES A;  2B3B A;  1B52 A;  4P0I A;  3IO4 A;  4IO2 A;  4THI A;  4LQ2 A;  4PDD A;  5BWJ A;  2RC9 A;  2F7B A;  1NV0 A;  3A3C A;  2XD3 A;  4NWD A;  3IB1 A;  3TEL A;  1NV4 A;  1PB9 A;  1GTK A;  1YZ0 A;  1FCK A;  3KEI A;  3IOW A;  3QAX A;  2P1S A;  4AB5 A;  2ZZV A;  3JV9 A;  5EHM A;  2I3W A;  4G61 A;  3PUZ E;  5F1Q A;  2DDK A;  3TTM A;  3DEL B;  4GLI A;  4IY5 A;  2PCR A;  5I59 A;  3K01 A;  4R6K A;  1URG A;  3MW0 A;  2XXY A;  4OFO A;  3PPQ A;  3CIJ A;  3K4U A;  3HST A;  1QGX A;  1B2H A;  4HXV A;  5A5X A;  2D5W A;  2DXY A;  3TCF A;  3NOH A;  3MAM A;  3ILU B;  4OVJ A;  1FJ9 A;  1RDX A;  3H6T A;  4F22 A;  3IFC A;  3MC2 A;  4JWO A;  4U21 A;  2RKM A;  2Q74 A;  1EH3 A;  2NWJ A;  1SVX B;  5I84 A;  4NF0 A;  3JZJ A;  5TP9 A;  2R71 A;  4MMP A;  4ECF A;  4POX A;  3GBA A;  2DVZ A;  1QUJ A;  1JQF A;  2ZZX A;  3MVY A;  2CZL A;  2I49 A;  2OWZ A;  2PFZ A;  4JVD A;  1K9Y A;  4G8M A;  3FJ7 A;  4FIM A;  2ABH A;  4HS7 A;  3IO6 A;  1UIU A;  3MYU A;  5J1D A;  3G3I A;  4OWD A;  1LST A;  3G3H A;  4XKQ A;  2I6E A;  3B6Q A;  4MLQ A;  2HZK A;  5EQ8 A;  3ZKL A;  1LBV A;  4BDM A;  1MXY A;  5EHS A;  2REG A;  2XXX A;  4FE8 A;  1SI1 A;  1SD3 A;  1TXF A;  3HN0 A;  1LAF E;  2V25 A;  5I56 B;  3R26 A;  4QFO A;  1MDQ A;  3M8U A;  4R74 A;  4KFQ A;  3QUJ A;  3LUZ A;  3MVW A;  5IZ1 A;  4DXC A;  3E13 X;  3QIM A;  5T3J A;  5EYG A;  3PU5 A;  2Q2A A;  3RYD A;  2GRV A;  1JET A;  4GX6 A;  4MFI A;  3A09 A;  3FXQ A;  4ZEB A;  3RY3 A;  1LFH A;  5TPA A;  2XX9 A;  3G3K A;  4PGN A;  3OO9 A;  3HCQ A;  1Y1M A;  1N04 A;  4NMY A;  5EYF A;  3LSL A;  1UTH B;  2CMO A;  3O66 A;  4P1E A;  3SEY A;  2XXP A;  1B5J A;  5L9O A;  2WBB A;  3ROJ A;  3K6W A;  2P3N A;  2VOZ A;  4KYS A;  4G68 B;  5M2V A;  1BP5 A;  2I0B A;  4OVQ A;  4NAP A;  2UVI A;  3TAJ A;  1DMB A;  1LBZ A;  4LN5 A;  4YAH X;  2WYP A;  4OXV A;  1H43 A;  3KC1 A;  2VGQ A;  3MVZ A;  2UVH A;  2PYY A;  5IM2 A;  3WAF A;  5ELV A;  5I2N A;  4OAN A;  1FPF A;  2CZI A;  4WXJ A;  4EF1 A;  1AOV A;  3BBR A;  2B65 A;  3T93 B;  3K02 A;  3VDF A;  3IR1 A;  2F3B A;  4H8J A;  3TYH A;  3P7I A;  4PF8 A;  2Y7P A;  2Q2C A;  4F2O A;  4R73 A;  5DVF A;  3I5O A;  1PC3 A;  1MY1 A;  1Q1K A;  4YB6 A;  1ELJ A;  1JNF A;  1Y4C A;  3FZV A;  5DT6 A;  1D9V A;  4OVT A;  4XF5 A;  2QS4 A;  5IGA A;  1D3K A;  2VPN A;  4ZDM A;  2FYI A;  3PMW A;  4IGR A;  4EQ9 A;  1NV1 A;  1B40 A;  1JW4 A;  1ZBM A;  3EQ1 A;  5ET5 A;  1PDA A;  4MHF A;  4PC9 A;  3IK6 B;  4PF6 A;  2DWJ A;  1FBH A;  1QUL A;  4BDR A;  3K0V A;  5CMB A;  3RT6 B;  3ODB A;  1B05 A;  3TCH A;  1SW5 A;  1DOT A;  1UTB A;  2HHM A;  4TOZ A;  4U4S A;  2D21 A;  4NF8 A;  4LZ7 A;  3B6W A;  5I3S A;  1R9L A;  1NH8 A;  3PPP A;  1B4H A;  1CE2 A;  2VD2 A;  3K1M A;  4PAK A;  1ZIU A;  2V84 A;  4DCX A;  4O7M A;  1URD A;  1XHY A;  4R9F A;  3N94 A;  4OVP A;  1SYH A;  5IKB A;  3SEU A;  4IO5 A;  2O6A A;  1MXU A;  4YU0 A;  3QMF A;  4ELQ A;  1MXW A;  3GBB A;  3ZS6 A;  4I3E A;  1MM7 A;  1YTV A;  3LV0 A;  4C1T A;  5I59 B;  1FQF A;  1P1N A;  3RNN A;  2ONR A;  4GWS A;  3C35 A;  1FTK A;  4DLD A;  2RCA A;  4H8I A;  4MAG A;  1JP4 A;  1MQJ A;  4GWW A;  1TFA A;  1B1H A;  3CFL A;  4AQ4 A;  3K6U A;  3FD3 A;  3EPE A;  1YXI A;  2O51 A;  4LQ5 A;  4GIZ A;  1FTM A;  1OVT A;  3N6T A;  3IOT A;  3H6V A;  2HAV A;  3BFT A;  1SW1 A;  1M5B A;  2PT1 A;  2OBG A;  4MF3 A;  4PBH A;  1AIV A;  1SQY A;  1IXI A;  5AA4 A;  4R6H A;  2H98 A;  5L9S A;  1IQ7 A;  3SEW A;  3O2A A;  1JEV A;  4KD5 A;  3U92 A;  1B9J A;  4IO6 A;  3PV0 E;  3OO8 A;  1MQH A;  5ET7 A;  1MH4 A;  1USY H;  2HCA A;  4EXL A;  1O64 A;  3N6U A;  3FVG A;  3EF7 A;  3SKP A;  3IAZ A;  2A5T A;  2ZYK A;  4ZZA A;  4NG7 A;  3ZSF A;  1EYK A;  2Q89 A;  2E1S A;  3RTW B;  3PGF A;  1L5T A;  2ZMB A;  4PFB A;  5I57 A;  1LAX A;  2PT2 A;  2THI A;  4PET A;  3V8X B;  4YKP A;  4NE4 A;  4H1X A;  3TTK A;  3SER A;  2QJE A;  4OVS A;  4I40 A;  4LON B;  4UA8 A;  5DTB A;  3ILT B;  5CBR A;  4I62 A;  1MY2 A;  4HE1 A;  4GOT A;  1RDZ A;  1NNT A;  2ZYN A;  2Z8F A;  1J1N A;  4HE0 A;  3F11 A;  3KN8 A;  3O97 A;  4MNP A;  1JW5 A;  2Y7W A;  4FOR A;  2B4M A;  1G0I A;  1MY0 A;  4NWC A;  4QBA A;  4WKM A;  1QKB A;  1QVS A;  3MP6 A;  2F97 A;  4IY6 A;  1VR5 A;  1MXZ A;  1NUY A;  1NL5 A;  2DE2 A;  5ISU A;  3CVG A;  4XTC Q;  1IMF A;  1AMF A;  4X1D A;  3TFL A;  1GGG A;  3U94 A;  4X8R A;  3MST A;  3EHS A;  4HCW A;  4RXL A;  2F6P A;  4RK2 A;  5DVI A;  2KLF A;  1A7L A;  4U22 A;  3KC0 A;  5ITO A;  1B5H A;  1MPD A;  5I2N B;  3O6H A;  3IFA A;  2IA4 A;  2CZK A;  4AS5 A;  4I9D A;  2F5X A;  5K2X A;  2ZYM A;  1XOC A;  2RC7 A;  3Q26 A;  1B3H A;  4N6D A;  3TOD A;  2RF1 A;  4JWX A;  2PFY A;  5H8H B;  1EZ9 A;  2NVU B;  1B3L A;  3T9H B;  3PD8 A;  1IMA A;  1LBC A;  4OEV A;  3PTY A;  1I6A A;  3KJT A;  5CMC A;  3UN6 A;  1N7X A;  3CFZ A;  5FHO A;  1B7U A;  1NNP A;  2LAO A;  1Y20 A;  3TCG A;  3M3F A;  3VE1 B;  3TTR A;  1PBP A;  5EQ9 A;  2I3V A;  4I1D A;  4OA4 A;  2GFE A;  2VP1 A;  1Y1Z A;  3CSB A;  2QVV A;  1TT1 A;  4PTK A;  4Q0C A;  5AE4 A;  1FBP A;  3KOT A;  5TU0 A;  2DE3 A;  3ISP A;  2QSX A;  3V5A A;  5AA3 A;  2GH9 A;  4JBZ A;  2M8C A;  2Y5K A;  2FNC A;  3QK6 A;  4HTG A;  1UTB B;  1LCT A;  3I6V A;  2F7C A;  4OMB A;  4P11 A;  2H5Y A;  2I48 A;  1B3G A;  4ELR A;  2E0S A;  1Q35 A;  2KR0 A;  4QRZ A;  2REJ A;  4MLV A;  5H8N A;  1YAE A;  4KXP A;  1RYX A;  1GV8 A;  4NF5 A;  2QMW A;  2XX7 A;  3N5L A;  3TMG A;  1B5I A;  1N76 A;  1IMD A;  4OEU A;  5I58 A;  1GR2 A;  1NUZ A;  4DIG A;  1FTO A;  3O6I A;  4IO7 A;  4PQJ A;  1TFD A;  2RIN A;  2WX9 A;  4ZED A;  3U72 A;  2ONK E;  3T9U A;  4LZ5 A;  4P56 A;  2RCB A;  1IEJ A;  4R75 A;  4MH5 A;  1B0H A;  4LUB A;  4PAF A;  1DBZ A;  1T0K A;  1US4 A;  1URS A;  5AA4 B;  4YIC A;  4ESW A;  3H6U A;  4O3A A;  2Q8J A;  1FPG A;  2AIX A;  2XWV A;  2XXR A;  3KJ7 A;  1B6H A;  1OVB A;  4PBQ A;  3GLB A;  3T66 A;  4P47 A;  3OEL A;  5H8F A;  2XWI A;  4IGT A;  4ZE8 A;  1WDN A;  1FTL A;  3KBR A;  2I4B A;  4QFL A;  4GWZ A;  4JXI A;  3RN8 A;  2F6G A;  4DXB A;  2G29 A;  1INP A;  3VXB A;  2OWS A;  4RJZ A;  3DP6 A;  4MNC A;  3TTL A;  1QKA A;  2A5T B;  3LBS A;  4UAC A;  4XKR A;  3AXF A;  1IXG A;  5I57 B;  4XXU A;  1WVJ A;  3EKI A;  5KZT A;  1OLA A;  2Z8E A;  5I5P A;  4ISU A;  4TLM B;  5AA2 A;  1B3E A;  4PGP A;  2UVJ A;  1NV6 A;  3S9M C;  2O7U A;  3UA8 A;  1IMB A;  4F1V A;  2VHA A;  1SBP A;  5CBS A;  1MDP 1;  2ZXT A;  3KG2 A;  5ET8 A;  2ESN A;  1D9Q A;  4X9T A;  3RQT A;  1IUD A;  1FQB A;  2Y7I A;  3C31 A;  3OSQ A;  1IMC A;  1HSE A;  4N13 A;  4GWY A;  5K2Y A;  1PB8 A;  4NN3 A;  2NOO A;  3MZ9 A;  3H4Z A;  5KDT B;  4F2Q A;  1NV2 A;  3LC8 A;  2YJP A;  4H46 A;  3IOV A;  1Y3P A;  1FPE A;  3SES A;  3HPI A;  4JSO A;  3GXA A;  4O3C A;  4QFK A;  3N26 A;  1ZU0 A;  4FEC A;  4X48 A;  3MBP A;  1FQA A;  1OLC A;  4OQO A;  1SW2 A;  1SPI A;  3H3G A;  2Z8D A;  4XKP A;  2VPO A;  3RPL A;  3PD9 A;  2O84 X;  1CNQ A;  4JSD A;  3CRB A;  4F19 A;  3VVD A;  2ONS A;  5CM6 A;  4M4G A;  1G0H A;  4H6D A;  5EYH A;  3S9E A;  2DOJ A;  1VFE A;  1LEV A;  1QUK A;  1WOD A;  1RDY A;  3G3G A;  1M5D A;  2NXO A;  3I3V A;  4PE5 B;  1KA0 A;  1SYI A;  2ZZW A;  2OLB A;  1YCJ A;  1MG1 A;  2XA5 A;  2DXR A;  4IR8 A;  4H5F A;  4KHZ E;  3MQ9 A;  2QS2 A;  4F1Y A;  1H44 A;  4P8B A;  1LFG A;  1MXV A;  3PUY E;  1MQI A;  3TDJ A;  2Y5L A;  2UYE A;  1GVC A;  1UIV A;  4C1U A;  4NGU A;  4RA1 A;  4N6P A;  3H06 B;  5H8Q B;  5BUU A;  4EDP A;  4XEQ A;  2H4I A;  1N7W A;  2OCU A;  2XWO A;  4JDF A;  4QSD A;  4XIG Q;  1B7H A;  2H9B A;  4MIJ A;  3S2V A;  3K1P A;  4RYA A;  4G8N A;  3FAT A;  4GL0 A;  1VSO A;  4YKK A;  3FAS A;  4DCY A;  1OQH A;  3S4U A;  2WEF A;  4GBW A;  4F18 A;  3C34 A;  3LSX A;  3K6V A;  4F3P A;  2UVG A;  5HBC A;  1RKM A;  3SZP A;  4G68 C;  1JVY A;  4E0X A;  3OEM A;  2FIX A;  4NF6 A;  5DVJ A;  1DPP A;  4JWY A;  2W7Y A;  1LLS A;  3A29 A;  1Z7N E;  1FPD A;  4GD5 A;  5LOM A;  3RT8 A;  5ITP A;  5H8N B;  2QFL A;  1QW0 A;  4EUO A;  1O7T A;  4G2Z A;  5AA2 D;  4EXK A;  4R6Y A;  5A5X B;  1B51 A;  2B4L A;  3KBZ A;  4GVO A;  3Q29 A;  4C0R A;  1AH5 A;  1ZTY A;  1CB6 A;  5I58 B;  1IXC A;  3BIH A;  3O6G A;  3T96 B;  2XXH A;  1EZO A;  5ICQ A;  3C9H A;  1FPB A;  1II5 A;  1FBC A;  4N4U A;  4U1O A;  5CI5 A;  4YB5 A;  1NH7 A;  1IIT A;  5I7I A;  5TP9 B;  4GWO A;  1LB9 A;  1DPE A;  3PPO A;  1PEB A;  3GYY A;  1NV5 A;  3A3U A;  3MZB A;  2XD2 A;  1I6Q A;  2QPQ A;  2DYX A;  4MNI A;  5KCJ A;  3VXC A;  1MQD A;  2HZL A;  5H8S A;  5F24 A;  3OXN A;  3RUM A;  4FAT A;  5H8F B;  3KZG A;  2V3T A;  3OEN A;  4MX6 A;  2OK2 A;  4XKN A;  3T0J A;  2UXA A;  2ZYO A;  3QUF A;  1EYJ A;  3S9L C;  1FBG A;  4U1Z A;  4OEN A;  3S9N C;  1ATG A;  5FTH A;  3H6W A;  4IO4 A;  3TKD A;  4JB7 A;  1D4N A;  4YZZ A;  1YYZ A;  4POW A;  4TQU Q;  4G4P A;  2I0C A;  5AA2 B;  3MP8 A;  3KGC A;  3MVX A; 
#chains in the Genus database with same CATH homology
 3LUZ A;  1FJ6 A;  2Y5K A;  5IZ1 A;  3W9V A;  5T3J A;  4N91 A;  4P3L A;  5EYG A;  3RYD A;  3T1B A;  2HXR A;  4GX6 A;  3FBP A;  2KR0 A;  4PGN A;  3E78 A;  4NX1 A;  2V4C A;  3W9W A;  3B8B A;  4KXP A;  4P1E A;  2WBB A;  5JK4 A;  3ROJ A;  2P3N A;  2Q8M A;  1IMD A;  4F1U A;  1NUZ A;  4O7I A;  5IZ3 B;  2CEX A;  4OVR A;  1KA1 A;  2WX9 A;  4P9K A;  4OVQ A;  4NAP A;  3RPL B;  4O8M A;  4P56 A;  1LBZ A;  4LN5 A;  2WYP A;  4GBV A;  5DW8 A;  4MCO A;  1LBW A;  3KC1 A;  4PAF A;  2MKZ A;  1DBZ A;  5IM2 A;  2BJI A;  5EQ7 A;  1FPF A;  4OAN A;  1KZ8 A;  1FPI A;  4YIC A;  2CZI A;  5LDZ A;  1FPG A;  1LBY A;  2L5V A;  2XWV A;  4M1V A;  4JVC A;  4PBQ A;  2F3B A;  4P47 A;  4PFR A;  4PF8 A;  5EQA A;  2XWI A;  1NUW A;  4GX4 A;  1NV3 A;  4FBP A;  4N17 A;  4GWZ A;  1NI9 A;  1INP A;  4OVT A;  4X04 A;  4XF5 A;  4MNC A;  5IGA A;  2VPN A;  2FHY A;  2WYK A;  2HPG A;  3B50 A;  1NV1 A;  2CEY A;  1FTA A;  3EKI A;  5ET5 A;  5I5P A;  4MHF A;  4PC9 A;  2CZH A;  1FPL A;  4PF6 A;  1FRP A;  4PGP A;  1FBH A;  1NV6 A;  1DCU A;  1IMB A;  4F1V A;  3D1R A;  4DI4 B;  4UAB A;  2HHM A;  3HFU A;  1EYI A;  5ET8 A;  1D9Q A;  4X9T A;  4I3Y A;  2XXK A;  5I3S A;  3FXB A;  1IME A;  4PAK A;  2VT5 A;  1IMC A;  4GWY A;  2Q9T A;  4O7M A;  1FBE A;  4NN3 A;  4N15 A;  4OVP A;  2FIE A;  5LTC A;  4GWU A;  1NV2 A;  4P1L A;  4MEV A;  3QMF A;  4PCD A;  4PDH A;  4I3E A;  4H46 A;  3LV0 A;  1FPE A;  1K9Z A;  4GWS A;  4MAG A;  5IZ3 A;  2P3V A;  1JP4 A;  4GWW A;  1SPI A;  1XI6 A;  2VPO A;  1YXI A;  1DK4 A;  3RPL A;  1CNQ A;  5ESY A;  4F19 A;  5CM6 A;  1G0H A;  4O94 A;  4XFE A;  4N6K A;  5EYH A;  4PBH A;  4H45 A;  3CHG A;  4JVI A;  1LEV A;  1RDY A;  5J16 A;  1KA0 A;  2ZZW A;  5IZZ A;  4PFI A;  2XA5 A;  4MJO A;  4IR8 A;  3E79 A;  4N8Y A;  4AS4 A;  4P8B A;  2Y5L A;  5ET7 A;  4NGU A;  1FSA A;  1VDW A;  1BK4 A;  1FPJ A;  1FPK A;  4XEQ A;  1FBD A;  1NV7 A;  2XWO A;  4NG7 A;  1EYK A;  2KQZ A;  2FBP A;  4PFB A;  4HCY A;  4PET A;  2R8T A;  2FVZ A;  1Q9D A;  4MIJ A;  4QXD A;  3BIG A;  4NQ8 A;  2OX3 A;  4OVS A;  4I40 A;  2WEF A;  4GBW A;  4PDD A;  4F18 A;  4HE1 A;  1NV0 A;  1RDZ A;  3SZP A;  1NV4 A;  1YZ0 A;  2FIX A;  2ZZV A;  2QVU A;  3A29 A;  4HE0 A;  1FPD A;  4MNP A;  4G61 A;  4N81 A;  2DDK A;  2V3Q A;  4N8G A;  2QFL A;  2B4M A;  2PCR A;  4GWX A;  5FBP A;  1G0I A;  2F3D A;  4QBA A;  4DI3 D;  2B4L A;  3KBZ A;  1QGX A;  2DE4 A;  4HXV A;  4PE3 A;  3BIH A;  3NOH A;  1FJ9 A;  1FPB A;  1RDX A;  4N4U A;  1FBC A;  1NUY A;  2DE2 A;  3IFC A;  1IMF A;  2JJK A;  2Q74 A;  5I7I A;  4X8R A;  3MST A;  4HCW A;  4NF0 A;  4MMP A;  4HE2 A;  3GYY A;  3KC0 A;  1NV5 A;  2DVZ A;  2QPQ A;  3IFA A;  1FBF A;  4MNI A;  2CZK A;  4AS5 A;  2ZZX A;  2F5X A;  4NHB A;  2GQ1 A;  2OWZ A;  3U65 A;  2PFZ A;  2HZL A;  4JVD A;  1K9Y A;  5F24 A;  4N6D A;  4GX3 A;  3MYU A;  2PFY A;  5A5L A;  4MX6 A;  5J1D A;  1NUX A;  1AWB A;  1IMA A;  3PTY A;  4PAI A;  3T0J A;  2HZK A;  5EQ8 A;  1LBX A;  2QVR A;  1LBV A;  1EYJ A;  1FBG A;  5ET6 A;  2WBD A;  5EQ9 A;  4OA4 A;  4YZZ A;  1YYZ A;  2XWK A;  2QVV A;  4PTK A;  1FBP A;  2DE3 A;  3ISP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...