2P3NA

Thermotoga maritima impase tm1415
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
256
Chain Sequence
MDRLDFSIKLLRKVGHLLMIHWGRVDNVEKKTGFKDIVTEIDREAQRMIVDEIRKFFPDENIMAEEGIFEKGDRLWIIDPIDGTINFVHGLPNFSISLAYVENGEVKLGVVHAPALNETLYAEEGSGAFFNGERIRVSENASLEECVGSTGSYVDFTGKFIERMEKRTRRIRILGSAALNAAYVGAGRVDFFVTWRINPWDIAAGLIIVKEAGGMVTDFSGKEANAFSKNFIFSNGLIHDEVVKVVNEVVEEIGGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol-1-monophosphatase
publication title Crystal structure of the tetrameric inositol 1-phosphate phosphatase (TM1415) from the hyperthermophile, Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 73
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2p3nA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2p3nA02
1FPEA 1VDWA 1NV5A 3RPLB 4GWWA 4I3YA 2P3NA 3IFAA 1FBFA 4O7IA 4AS5A 1FBEA 2QVRA 3QMFA 1DK4A 4GX6A 1KZ8A 1IMAA 3B8BA 3ROJA 1NI9A 5LDZA 2HHMA 1RDZA 5IZ1A 4GX4A 4KXPA 4GBVA 1FPGA 4GBWA 1RDYA 1KA0A 1FPDA 1G0IA 1FPFA 1LBVA 3KC1A 1CNQA 2OX3A 5EQ7A 1G0HA 4FBPA 5FBPA 1YXIA 1FTAA 1LEVA 2FIEA 1IMCA 1FBDA 4PTKA 2CZHA 3BIGA 4GWXA 1DCUA 1EYIA 4IR8A 1YYZA 1FSAA 4H46A 1AWBA 1LBWA 3BIHA 3LUZA 2DDKA 4G61A 3KBZA 2FIXA 4GWSA 1K9ZA 4GWZA 1FPJA 1LBZA 3KC0A 2OWZA 2QVUA 2Y5LA 1LBXA 2FBPA 1FBGA 1BK4A 1LBYA 1NUXA 1Q9DA 3LV0A 1IMEA 1EYJA 1IMFA 2WBBA 4GX3A 4GWUA 5F24A 5I3SA 5T3JA 4HE1A 5J16A 4QXDA 1NV3A 1NV2A 5A5LA 1FPIA 2FHYA 1FJ6A 2Y5KA 1QGXA 2JJKA 3RYDA 1INPA 5ET6A 4I3EA 5ET8A 1DBZA 1NUYA 1NV7A 5DW8A 4GWYA 2BJIA 1EYKA 5IZ3B 5ET7A 2F3DA 1FBPA 1NV1A 4MJOA 5EYGA 3D1RA 4I40A 2R8TA 1NUZA 2CZKA 2GQ1A 4H45A 2Q8MA 4N81A 1IMBA 2QVVA 4AS4A 1FBHA 5IZ3A 1IMDA 1FPKA 2PCRA 1FBCA 3IFCA 4HE0A 4HXVA 2P3VA 1SPIA 2QFLA 5EQAA 5ET5A 1FPLA 3FBPA 2WBDA 1JP4A 2FVZA 1K9YA 1KA1A 2CZIA 2Q74A 1RDXA 3RPLA 1NV4A 4HE2A 5ESYA 3A29A 1FJ9A 3T0JA 1NV0A 2VT5A 1YZ0A 2WEFA 1FPBA 1D9QA 5EQ8A 1NV6A 5EYHA 1NUWA 1FRPA 1XI6A 2F3BA 5EQ9A
chains in the Genus database with same CATH superfamily
2QMWA 2P3NA 5J1DA 3G3GA 3KGCA 4NF5A 1P1OA 5ICTA 1SDXA 4F1YA 3SERA 3TQWA 4U1ZA 4QFKA 3FV1A 4OXVA 5I59B 2QS2A 3O29A 5AA2A 3PTYA 2VOZA 2XXWA 3PUVE 1IZ1A 3IB0A 3LC8A 3S2VA 2VHAA 2RKMA 5TPAA 4R6HA 1LBWA 1TFDA 3ZKKA 3IJXB 4GWSA 2DVCA 3GXAA 1MXWA 3SEXA 4EDPA 2RF1A 1D9VA 2ESNA 1NUXA 5CMCA 1O64A 2QRYA 3LV0A 1IMEA 2V3TA 5IGAA 4NF6B 3HCQA 3U93A 2D3IA 3EQ1A 2D5WA 1QGXA 2JJKA 3U92A 3K02A 1PC3A 3FZVA 4FIMA 3C33A 3IOUA 4OVRA 4N15A 4GWYA 1MPDA 1B3HA 3PUWE 2YLNA 1FTMA 2HXRA 1IMBA 2O84X 3VVFA 1CB6A 1HSLA 5HM4B 4P8BA 1QVSA 4HXVA 2XD2A 2GFEA 3DM0A 3FBPA 1LCTA 2WBDA 3IB2A 3K1PA 2Y84A 2Q74A 4NG7A 1SYHA 2X7QA 2OWSA 4Q30B 1OLCA 2QSXA 1Y4TA 2O68A 1MXZA 2B3BA 4MLVA 4O3BA 1FBFA 1FBEA 1MQJA 2UVHA 1KZ8A 4PGNA 5LDZA 4KI0E 4X8RA 3N94A 1FPFA 2H5YA 2RCAA 3HSTA 1JW5A 3H6TA 4MLQA 2H99A 3LBSA 4PTKA 3SEWA 3TCGA 3H03A 1A55A 4G8MA 1USYE 4IR8A 3LUYA 1B32A 2R6GE 4IGRA 3U65A 4O3AA 4XTCQ 2XXYA 4RK2A 4NE4A 1K9ZA 1IXGA 1OIBA 4F31B 5KCJA 2ONRA 4PGPA 4UABA 2Z23A 4QFOA 4HE1A 3OENA 3T9UA 5CMKA 1NV2A 4LUBA 3DP4A 1LLSA 4I3EA 4G2ZA 3C31A 4G4PA 1N3WA 5ELVA 2H98A 2BJIA 2I4BA 4LZ8A 1EYKA 5AA2D 3VLUA 3I5OA 1DSNA 2ZYKA 2I3WA 5I57A 1A8EA 3TAJA 4EF1A 1I69A 1LAFE 4ZS9A 3KJTA 2F36A 4RA1A 2VD2A 2QFLA 5I2KB 3B6QA 2FNCA 3FXQA 4ZE9A 4HS7A 1EH3A 3UGWA 4LA9A 1B0LA 2L5VA 4EQBA 2B4MA 2P0SA 3ODBA 3OO8A 1LBCA 4AB6A 4GIZA 4ESWA 1FRPA 4XKPA 3MW0A 1PB9A 3PD9A 3GBBA 1MQHA 4KHZE 1XVYA 1MQIA 4YKIA 4R9FA 3MPLA 2F7CA 5BWJA 5L9MA 1UTHA 4OFOA 2DXRA 3FVKA 1ATGA 4JSOA 3AXFA 1DOTA 3KBZA 4MBPA 1RYXA 1FQFA 2DWAA 1OVTA 4R2BA 1B4HA 3O6HA 3I6VA 1LBYA 1MPCA 4THIA 5FHOA 3M8UA 1B52A 4X1DA 1IXIA 3H06B 1B51A 2P1SA 4OVQA 1DBZA 2AYSA 4R75A 4LONB 1PBPA 1MH4A 1A7LA 1IQ7A 4MJOA 2Q8MA 3TMGA 4N6KA 3O97A 4KCCA 1LB9A 1FPKA 2UYEA 3G7WA 4HE0A 3FD3A 5FTIA 3FXBA 5FTHA 1O7TA 4N91A 4O94A 1DTZA 3RPLA 3C9HA 1UTBA 3SEUA 4MEVA 3SEVA 3PU5A 1MY2A 4X04A 1XI6A 3FJMA 4HCWA 5JK4A 2HZLA 3B8BA 2Y7IA 5DVJA 2HHMA 4OESA 4GOTA 4TOZA 3H6VA 4OERA 3TDJA 4POWA 2NVUB 1YCJA 2LAOA 1R9LA 1G0HA 5FBPA 4OETA 4DI3D 4F18A 1FBDA 1GV8A 3SDFA 4YAHX 3QXMA 4X48A 3UP9A 1QUJA 2NXOA 4QFLA 1JVYA 1B0HA 5IAIA 5EYFA 3O2AA 5I58A 4XFEA 1PBQA 4P1EA 3KN3A 4QF9A 2Y5KA 3IOVA 4ND9A 1TFAA 1B58A 4NX1A 5DT6A 3O66A 4C1TA 5EYGA 1FBPA 5CBSA 1M5DA 3EN3A 4H5FA 3MVXA 4JXIA 3V83A 2RCBA 1R9QA 2Y7PA 3OOAA 3T66A 4TLLB 2V3QA 3EKIA 4RXLA 4OA4A 4GL8A 4LQ2A 3W15C 1FQAA 1BP5A 2QS1A 2VT5A 4PFYA 3G3KA 3IOWA 1MS7A 3RYDA 4R9GA 5EQ9A 4PAKA 3CG3A 3PMVA 5H8HA 3JZJA 3UIFA 3ZKLA 2G93A 4KD5A 4O3CA 1RYOA 2F78A 4GBVA 4EQ7A 1B5JA 1UTHB 2VPOA 2F97A 2XXKA 2A5TA 3MYUA 5HPQA 2KLFA 3CIJA 2NWJA 3RNNA 1EYIA 2DYXA 1H45A 3IO4A 3KBRA 4NF8B 2KR0A 2NOOA 5EHMA 5F1QA 3K01A 3MWBA 3OXNA 3DP6A 3PPOA 3R26A 3MP6A 3EHTA 2ANJA 4QBAA 1POTA 1PB7A 4P56A 4N07A 2HXWA 4Q5TA 4I62A 3MC2A 1RKMA 3T9HB 1PB8A 4MNIA 2F7BA 5ET7A 3UK4A 1B40A 3JYRA 1B5HA 4PE5B 4PF8A 4NAPA 2VD3A 2V3UA 1UTBB 3FJ7A 1XS5A 2O69A 1QKBA 1DPEA 2ZNSA 1OLAA 3OMBA 1JW4A 3ZS6A 4IO4A 3KG2A 4OFJA 4NQ8A 1LAXA 1P99A 3CSGA 3TKDA 3G3JA 2V84A 3VVDA 5H8QA 2F3BA 1EU8A 4JSDA 3I3VA 1Y9UA 3MP1A 2NUVA 4O7IA 5I56B 3PMXA 2HPGA 1B3GA 4ONYA 1Z7ME 1RDZA 2ONKE 4PC9A 1IIWA 2I58A 4JWOA 1VR5A 4BDLA 1KA0A 1IXCA 1LBVA 1SW5A 2W7YA 1P1WA 1NKXA 5EQ7A 2Z8DA 4JBZA 3T9VA 2CZHA 4GWOA 3IJOB 1DTGA 1II5A 3HHGA 4LVQA 3BIHA 5I58B 1HSJA 3O6IA 2XWIA 2GH9A 3KC0A 1H76A 1Y1ZA 3ZSFA 1SYIA 3S9LC 5T3JA 2F8DA 2QMXA 4XIGQ 3SETA 5A5LA 2DVZA 4GF8A 5AA3A 3O6GA 4U2RA 4P1LA 2X7PA 3N5LA 4ZEBA 3TZAA 3UA8A 4RJZA 3IK6B 2F7AA 2DE2A 4I40A 4XF5A 3K6VA 1FQCA 4GVOA 4N81A 1BTJA 4PFIA 1FBHA 1SI0A 1DMBA 1Z7NE 5DTBA 2I49A 3EHSA 4LATA 4HE2A 4PFRA 3Q26A 3MVYA 3VDFA 4MIJA 5CRYA 3RTWB 4F29A 3TFLA 1ZKBA 1YZ0A 3DP8A 2WEFA 4N6DA 5H8HB 4F2QA 4IGTA 3CFXA 4YZZA 1D4NA 1AIVA 4H8JA 2RINA 2HZKA 4GWWA 1US4A 3ILTB 1Y4CA 2RC7A 1JEUA 3UORA 4U22A 5L9OA 3KFMA 5H8NB 2XX8A 1Q35A 3S9NC 1URGA 1FPDA 3KC1A 3PV0E 3R6UA 4HTGA 3MPKA 4MCOA 3W9WA 5LOMA 2ZNTA 1YXIA 2FIEA 1IMCA 2DXYA 1Y3QA 4PBHA 2WYKA 1FCKA 5AE4A 1IUDA 3TEPA 1IXHA 3Q27A 5B70A 3LUZA 2XWOA 3OSRA 2FIXA 1MM6A 3EHUA 4GRKA 3H6WA 2VPNA 1LBXA 1Y1MA 1BK4A 5I5PA 4MX6A 4Z0IA 2I4CA 4GWUA 3FVNA 3V5AA 4PQJA 1LAGE 4P3LA 3GZGA 3FVOA 3C32A 3RGYA 4EXLA 4F2OA 4E0WA 3ONMA 4PAIA 4WKMA 5CM6A 2ZZVA 2HQ0A 4XKQA 1SBPA 3TQLA 1N0TA 1N76A 5I7IA 2CZIA 2HAUA 3MSTA 1SQYA 4FJPA 5H8QB 1LFGA 1ZMGA 3T0JA 3M3LA 2CEYA 4QSCA 3RQTA 4NF4A 1JQFA 1NV5A 1SVXB 3Q25A 3PMWA 4GL0A 2I0BA 4ZZEA 1Q1KA 1B4ZA 4GFRA 5IZ1A 2OBGA 3CRBA 4MNPA 1A40A 4R2FA 4ELOA 4NTLA 3RN8A 4PFUA 2F35A 2F6PA 2D21A 5ICQA 2WKYA 1N84A 4ZEKA 3C35A 4ELPA 1B3FA 1BKAA 4ESXA 4NF5B 2FA7A 4DXCA 1MY0A 1NNFA 4OTEA 2DDKA 1KWHA 4N6PA 4DZ1A 5AA2B 1FPJA 4WXJA 2VGQA 4OVPA 3FASA 1FBGA 1FW0A 1EYJA 5TPAB 2GHBA 2QS3A 4OWDA 3USDA 4H5GA 4BDOA 1FPIA 3CHGA 1FJ6A 1JNFA 1ZIUA 2UVJA 1QW0A 2REGA 3B6WA 3ILUB 3NOHA 3G3FA 1NNTA 2QVVA 3SESA 5H8FA 4RK9A 4HW8A 4N8GA 4KCDA 4QSEA 1MXUA 4YB7A 2X26A 5EQAA 3M3KA 3IX1A 1JP4A 1MH3A 4P47A 3A29A 4C0RA 1NV6A 4JWYA 3K1MA 4JWXA 3IORA 3U8QA 4DCYA 2ZZXA 2GHAA 4RPOA 3FATA 4ZECA 2XXVA 3QUJA 3T93B 3PUYE 2DS9A 4P0GA 4GX4A 2OZZA 1FTOA 4G8NA 4DI4B 4M1VA 4I1DA 1CNQA 2I6EA 2OWTA 3WAEA 1NH7A 1CE2A 4N13A 4NWDA 4NWCA 4RNSA 4OVSA 3VV5A 5TP9A 5L8DA 4QFNA 2DQVA 2G29A 1GTKA 1ZU0A 5IKBA 4L17A 4JDFA 3UN6A 1GR2A 4AB5A 2MKZA 5TU0A 2PMSA 2OK2A 3FJGA 5J16A 1OQGA 3V8XB 2XXIA 3T22A 1QUKA 5ET8A 5KCJB 4K3FA 5ITOA 1B5IA 2H25A 4R72A 3MP8A 4ZZAA 2AIXA 1XT8A 4PFWA 3D1RA 4BDQA 4LP2B 2CZKA 2Q88A 5IZ3A 3KN7A 1YAEA 3RPWA 4NGUA 3U72A 2Y7KA 1I6BA 1SPIA 1FPLA 4G68C 1GVCA 5I57B 4YKKA 4F3BA 2E1SA 3GYYA 4PP0A 4ZEIA 1VFEA 4NF4B 4ECFA 1WDNA 3KEIA 5B7DA 4OEUA 2Q2AA 3E79A 5EYHA 2PYYA 1NMUA 1P1NA 2HEUA 5I59A 1WODA 3QYTA 2QVRA 3TTMA 2V4CA 2XWKA 5EHSA 1RDYA 1EZOA 2YPNA 4FAJA 1ZTYA 1FTAA 1PDAA 2H4IA 5BUUA 2KQZA 4GWXA 1OMPA 4IO6A 4PF6A 3A09A 4PDHA 4YKPA 1H3DA 4G61A 4PBQA 3VXBA 4GWZA 2XXHA 3IAZA 1FTJA 4PFBA 3W9VA 1MQDA 4AS5A 1XVXA 3TTNA 4I8CA 3E3KA 4QXDA 3E13X 4N17A 1R1NA 1UIVA 5F7VA 3KOTA 2YJPA 5DVFA 3O9PA 2DWHA 4OVTA 3T9XB 2UXAA 4PFTA 1QJMA 1NUYA 5H8FB 1XC1A 4M4GA 4P9KA 1PEBA 4ZEDA 3N6TA 3MAMA 1UQWA 4H45A 3QAXA 4KYDA 5JEIA 1IMDA 2H9BA 4U21A 4MAGA 3IFCA 4OVJA 2PX1A 5ET5A 3L6GA 1S50A 3OELA 1ZBMA 3OO9A 3C36A 3VFJA 1MG1A 1NL5A 4F39A 5ESYA 5CBRA 1B7HA 3C34A 1B7UA 4BDRA 4G68A 4QRZA 1AOVA 3RT6B 3KZGA 4MH5A 1P1QA 4X9TA 3RPLB 4JVIA 2ZMBA 1BLFA 2QL3A 3FV2A 4R73A 4DIGA 4KR5A 3EF7A 5AA1A 1Y3NA 4U4XA 4Q8RA 4KPTA 1UIUA 4H67A 4OYVA 3RLFE 1IEJA 3TYHA 1FQBA 3TTKA 4Z7EA 4IO7A 1H43A 4JB7A 3H6UA 4PDDA 5I84A 1EZPA 2OPDA 2HCAA 1WVJA 2XXQA 3H3GA 4GX3A 2O7UA 2WBBA 4MNCA 2QPQA 1VFDA 4YMAA 2QS4A 4AQ4A 1B1XA 2DWIA 1A8FA 4GXSB 1NV7A 3CFLA 3K6WA 1M5FA 5IZ3B 2ZZWA 4GQOA 4I9DA 4FECA 4H8IA 2XXUA 3FGSA 1J1NA 3K6UA 4FATA 2XX7A 2XXRA 3KOSA 3TCHA 2F5XA 1FBCA 3PPPA 5K2XA 2P3VA 2IA4A 5A5XA 1LBBA 3MZBA 2FVZA 1KA1A 5DYHA 3M3FA 1NV4A 3CSBA 3CFZA 2Z8EA 5M2VA 2RC8A 1S7YA 1OQHA 1R6ZA 4OEVA 2Q9TA 4IO2A 3BFUA 5CC2A 5ITPA 1S9TA 4DCXA 1VDWA 4I3YA 3IFAA 5I2NA 2P2AA 4F3PA 4KYEA 4KXPA 2XXXA 3HV1A 5AA4A 3LSFB 2UVIA 2B65A 3D4CA 4DXUA 1DPPA 4R74A 1GGGA 4EF2A 3BIGA 3HFUA 1DCUA 4H1XA 2QJEA 3FXUA 3VXCA 4XKRA 4RYAA 3CG1A 1SD3A 1SW4A 2VP1A 1LSTA 5CMBA 2A5TB 3FUZA 2WX9A 3HO7A 4O8MA 3B6TA 3ISPA 4GLIA 1SW1A 2XX9A 3FIRA 2I48A 3PUZE 5DVIA 2B3FA 5DEXA 1INPA 1N04A 1MXVA 4OANA 3E4RA 4LZ5A 1USYH 5IZZA 4ELQA 1D9YA 4FEDA 3QSLA 4RPNA 2GQ1A 2DP8A 2XD3A 4OZ9A 3O28A 5KDTA 2Q2CA 1MY1A 5CI5A 2PCRA 2CMOA 1HSEA 1L5TA 4G77A 1MM7A 3G3IA 3K00A 4NF0A 2DE4A 4G68B 4RY1A 4GXAA 1FQDA 3IL1B 4HCYA 4NHBA 3K2DA 4G8HA 1NV0A 4IB2A 3DELB 4H6DA 3JV9A 3OO7A 1FPEA 1D3KA 4Q0CA 3TELA 2O1MA 1N7XA 3OEMA 3QMFA 4H65A 4E0XA 4YU0A 1Y20A 2HFBA 4NMYA 3D4GA 2Y7WA 4F19A 1M5BA 1FQEA 1LEVA 3MQ9A 2PVUA 3TPAA 5JTYA 1F9BA 1MQGA 3PGFA 3F11A 1LFHA 3CI8A 4PE3A 4F1VA 1AWBA 1MDQA 2ZNUA 4FORA 3R7XA 3PPRA 3GBAA 3G3HA 4FEBA 5LTCA 2UYFA 4DE8A 1NH8A 5HBCA 3KJ7A 4YB5A 4IO3A 4F22A 4MHFA 2PT1A 3K4UA 1LB8A 2DSFA 3MJNA 2OPEA 2Z8FA 4LQ5A 3MVZA 4OENA 3VLWA 3S9MC 1B7ZA 1OVBA 1T0KA 4YB6A 5A5XB 4AS4A 3MBPA 1FTKA 5CMMA 3MZ1A 2XXPA 4NN3A 1B3EA 3FXRA 1TT1A 2RC9A 3MZ9A 4F3GA 3RT8A 4ZDMA 3A3UA 2Z22A 2PBWA 4PAFA 3L6HA 4MMPA 5KZTA 3SZPA 1QKAA 2PFZA 1MPBA 2CEXA 3OD7A 5I2NB 5EQ8A 3N26A 1NNPA 3K0VA 2HAVA 4R6KA 1LFIA 2WYPA 3B7DA 3ROJA 5AA4B 1NI9A 3B50A 4NF8A 2DWJA 1US5A 4LN5A 1NNKA 1Y3PA 3IO6A 3V89B 4F3SA 4JVCA 3IB1A 1YYZA 4H46A 1BIYA 3RUMA 1AL3A 4U1OA 1AH5A 3U94A 1B3LA 1A54A 3PUXE 4QSDA 5IM2A 5DEXB 5I3SA 5FHMA 2F6GA 2O6AA 2FHYA 2FYIA 2REJA 1YPNA 4IY5A 3E78A 5ET6A 1MY4A 4XKNA 3LSWA 3U1OA 3OEKA 4BLAA 3S4UA 5KDTB 3E9XA 1VSOA 4GD5A 2ALUA 4XEQA 4FE8A 1B1HA 1JEVA 1MXXA 4O7MA 1SW2A 4MFIA 1QUIA 1LAHE 1XHYA 3TUSA 3OO6A 3HHFA 2R71A 3QUFA 1LCFA 4WEDA 2E0SA 3A3CA 3KN8A 4JVDA 1MXYA 4DXBA 1YTVA 1B05A 1ZJLA 2A5SA 3KSJA 4H0WA 4PCDA 5I56A 1FPBA 1NFTA 3C4MA 1B2HA 1I6QA 2ONSA 1FTLA 3OSQA 1POY1 2XWVA 4ELRA 2ZYMA 1DK4A 3TODA 1IMAA 3WAFA 2CZLA 3BBRA 2F34A 3VE1B 2O1LA 3TCFA 1JW1A 3MUQA 2Q89A 1FPGA 4OHNA 5JTYB 1G0IA 2XXTA 3N6UA 2Q8JA 1MDP1 2OX3A 1N3XA 1EZ9A 4LZ7A 3RTFB 2O51A 4MF3A 4BDMA 4YICA 2Y7RA 1A99A 3CVGA 3K6XA 2OWZA 2Y5LA 2FBPA 2ABHA 4OMBA 4QFPA 4EUOA 4TLMB 5F24A 1VE4A 1IMFA 4YMBA 2B4LA 4R6YA 1NV3A 5FHNA 1ELJA 3IOTA 3IR1A 2I3VA 1LGBC 2V93A 3T1BA 4NF6A 4F1UA 1ZLQA 3P7IA 4NEDA 3RY3A 1P1UA 4DLDA 3VLVA 1NV1A 3TTRA 3LSLA 4N4UA 1NUZA 3QIMA 1SI1A 4BDNA 4ZE8A 2I0CA 5ISUA 2PFYA 1K9YA 3EPEA 1N7WA 2M8CA 3PD8A 4EXKA 4OQOA 1FJ9A 3MVWA 2OLBA 2BJJX 3QK6A 4ZEFA 1D9QA 5H8NA 1I6AA 3S9EA 1NUWA 1IITA 1URDA 4U23A 1B6HA 3BFTA 1MY3A 3PPQA 2DE3A 4IY6A 4KQPA 4GX6A 3SKPA 1O63A 2V25A 4IO5A 5L9SA 3HPIA 3H7MA 3K1NA 4GBWA 3TTLA 3HN0A 1M5CA 1AMFA 4FBPA 3Q29A 4QHQA 2R9JA 2XHDA 1ANFA 4X1BA 1H44A 4P0IA 1FSAA 4ISUA 4YKJA 2DOJA 2ZXTA 2OCUA 4UACA 1LBZA 3FVGA 4WEPA 2QVUA 3Q28A 1JETA 1TXFA 1B46A 1URSA 4N8YA 1Q9DA 5TP9B 3VVEA 4TQUQ 3BKIB 1QULA 1TWYA 1XOCA 4C1UA 2AL5A 3GLBA 3T96B 4UA8A 3DLNA 5DW8A 2XA5A 2IEEA 2PT2A 4U4SA 2F3DA 2GRVA 4DDDA 5H8SA 4OFLA 1MRPA 1JVXA 2R8TA 4KYSA 2OJTA 5K2YA 1B9JA 3LR1A 2ZYNA 3LSXA 4KFQA 1M5EA 3ECRA 2ZYOA 4POXA 3PPNA 3THIA 2AL4A 2O7IA 2UVGA 3SEYA 4EQ9A 1RDXA 4P11A 2THIA 4PETA 4XXUA 5I2KA 3H4ZA 3KSXA 3CR9A
chains in the Genus database with same CATH topology
4PAKA 1FPEA 2ZZXA 2P3NA 5J1DA 3QMFA 4GX4A 4GBVA 2VPOA 4DI4B 4M1VA 1CNQA 2XXKA 4F19A 3MYUA 3PTYA 1LEVA 4OVSA 1EYIA 4PE3A 4F1VA 1AWBA 1LBWA 2KR0A 4GWSA 5LTCA 1NUXA 2MKZA 3LV0A 1IMEA 5IGAA 5J16A 4QBAA 4P56A 1QGXA 2JJKA 4MHFA 5ET8A 4OVRA 4MNIA 4GWYA 4N15A 5ET7A 3D1RA 2CZKA 2HXRA 1IMBA 4AS4A 4PF8A 5IZ3A 4NAPA 4NGUA 4P8BA 4NN3A 4HXVA 1SPIA 1FPLA 3FBPA 2WBDA 2Q74A 4NG7A 4PAFA 3GYYA 4MMPA 3SZPA 2PFZA 4NQ8A 2CEXA 5EQ8A 3E79A 5EYHA 2F3BA 1FBFA 4O7IA 1FBEA 2WYPA 2QVRA 1KZ8A 4PGNA 2HPGA 3ROJA 2V4CA 1NI9A 5LDZA 3B50A 1RDZA 2XWKA 4PC9A 4X8RA 1RDYA 1KA0A 1LBVA 1FPFA 4LN5A 5EQ7A 1FTAA 4PTKA 2CZHA 2KQZA 4JVCA 4GWXA 4PF6A 4IR8A 1YYZA 4H46A 4PDHA 3BIHA 3U65A 4G61A 4PBQA 1K9ZA 2XWIA 4GWZA 3KC0A 4PFBA 5IM2A 4PGPA 3W9VA 4AS5A 4UABA 5T3JA 5I3SA 4HE1A 4QXDA 1NV2A 4N17A 5A5LA 2FHYA 2DVZA 3E78A 5ET6A 4I3EA 4P1LA 4OVTA 1NUYA 4P9KA 2BJIA 1EYKA 4XEQA 2DE2A 4I40A 4XF5A 4H45A 4N81A 4O7MA 4PFIA 1FBHA 1IMDA 4MAGA 3IFCA 2QFLA 5ET5A 4HE2A 5ESYA 4PFRA 4JVDA 4MIJA 4PCDA 2L5VA 2B4MA 1YZ0A 4N6DA 2WEFA 1FPBA 4YZZA 1FRPA 2HZKA 4X9TA 3RPLB 4GWWA 4JVIA 2XWVA 1DK4A 1IMAA 1FPGA 1FPDA 1G0IA 3KC1A 4MCOA 2OX3A 3W9WA 1YXIA 2FIEA 1IMCA 4PBHA 2WYKA 3LUZA 2XWOA 4PDDA 3KBZA 2FIXA 4YICA 2OWZA 2Y5LA 2VPNA 1LBXA 2FBPA 5I5PA 1BK4A 1LBYA 4MX6A 4GX3A 5F24A 1IMFA 2WBBA 4GWUA 4MNCA 2QPQA 2B4LA 1NV3A 4P3LA 4OVQA 3T1BA 4F1UA 1DBZA 1NV7A 5IZ3B 2ZZWA 4MJOA 1NV1A 4N4UA 4PAIA 1NUZA 2Q8MA 5CM6A 2ZZVA 4N6KA 2F5XA 1FPKA 1FBCA 4HE0A 2P3VA 3FXBA 2PFYA 2FVZA 5I7IA 1K9YA 1KA1A 2CZIA 4N91A 4O94A 3RPLA 1NV4A 3MSTA 1FJ9A 4MEVA 3T0JA 2CEYA 4X04A 1D9QA 2Q9TA 1NUWA 1XI6A 1VDWA 1NV5A 4I3YA 3IFAA 4HCWA 5JK4A 2DE3A 2HZLA 4GX6A 3B8BA 2HHMA 5IZ1A 4MNPA 4KXPA 4GBWA 1G0HA 4FBPA 5FBPA 4DI3D 4F18A 1FBDA 3BIGA 3HFUA 1DCUA 1FSAA 2DDKA 1FPJA 1LBZA 2QVUA 2WX9A 4OVPA 4O8MA 1FBGA 4N8YA 3ISPA 1Q9DA 4XFEA 1EYJA 4P1EA 1FPIA 3CHGA 1FJ6A 2Y5KA 1INPA 4NX1A 4OANA 5DW8A 2XA5A 5IZZA 2F3DA 1FBPA 5EYGA 3NOHA 2R8TA 2GQ1A 2QVVA 4N8GA 2PCRA 5EQAA 1JP4A 4NF0A 2DE4A 2V3QA 3EKIA 4OA4A 1RDXA 4P47A 3A29A 4HCYA 4PETA 4NHBA 1NV0A 2VT5A 1NV6A 3RYDA 5EQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPE A;  1VDW A;  1NV5 A;  3RPL B;  4GWW A;  4I3Y A;  2P3N A;  3IFA A;  1FBF A;  4O7I A;  4AS5 A;  1FBE A;  2QVR A;  3QMF A;  1DK4 A;  4GX6 A;  1KZ8 A;  1IMA A;  3B8B A;  3ROJ A;  1NI9 A;  5LDZ A;  2HHM A;  1RDZ A;  5IZ1 A;  4GX4 A;  4KXP A;  4GBV A;  1FPG A;  4GBW A;  1RDY A;  1KA0 A;  1FPD A;  1G0I A;  1FPF A;  1LBV A;  3KC1 A;  1CNQ A;  2OX3 A;  5EQ7 A;  1G0H A;  4FBP A;  5FBP A;  1YXI A;  1FTA A;  1LEV A;  2FIE A;  1IMC A;  1FBD A;  4PTK A;  2CZH A;  3BIG A;  4GWX A;  1DCU A;  1EYI A;  4IR8 A;  1YYZ A;  1FSA A;  4H46 A;  1AWB A;  1LBW A;  3BIH A;  3LUZ A;  2DDK A;  4G61 A;  3KBZ A;  2FIX A;  4GWS A;  1K9Z A;  4GWZ A;  1FPJ A;  1LBZ A;  3KC0 A;  2OWZ A;  2QVU A;  2Y5L A;  1LBX A;  2FBP A;  1FBG A;  1BK4 A;  1LBY A;  1NUX A;  1Q9D A;  3LV0 A;  1IME A;  1EYJ A;  1IMF A;  2WBB A;  4GX3 A;  4GWU A;  5F24 A;  5I3S A;  5T3J A;  4HE1 A;  5J16 A;  4QXD A;  1NV3 A;  1NV2 A;  5A5L A;  1FPI A;  2FHY A;  1FJ6 A;  2Y5K A;  1QGX A;  2JJK A;  3RYD A;  1INP A;  5ET6 A;  4I3E A;  5ET8 A;  1DBZ A;  1NUY A;  1NV7 A;  5DW8 A;  4GWY A;  2BJI A;  1EYK A;  5IZ3 B;  5ET7 A;  2F3D A;  1FBP A;  1NV1 A;  4MJO A;  5EYG A;  3D1R A;  4I40 A;  2R8T A;  1NUZ A;  2CZK A;  2GQ1 A;  4H45 A;  2Q8M A;  4N81 A;  1IMB A;  2QVV A;  4AS4 A;  1FBH A;  5IZ3 A;  1IMD A;  1FPK A;  2PCR A;  1FBC A;  3IFC A;  4HE0 A;  4HXV A;  2P3V A;  1SPI A;  2QFL A;  5EQA A;  5ET5 A;  1FPL A;  3FBP A;  2WBD A;  1JP4 A;  2FVZ A;  1K9Y A;  1KA1 A;  2CZI A;  2Q74 A;  1RDX A;  3RPL A;  1NV4 A;  4HE2 A;  5ESY A;  3A29 A;  1FJ9 A;  3T0J A;  1NV0 A;  2VT5 A;  1YZ0 A;  2WEF A;  1FPB A;  1D9Q A;  5EQ8 A;  1NV6 A;  5EYH A;  1NUW A;  1FRP A;  1XI6 A;  2F3B A;  5EQ9 A; 
#chains in the Genus database with same CATH topology
 2QMW A;  2P3N A;  5J1D A;  3G3G A;  3KGC A;  4NF5 A;  1P1O A;  5ICT A;  1SDX A;  4F1Y A;  3SER A;  3TQW A;  4U1Z A;  4QFK A;  3FV1 A;  4OXV A;  5I59 B;  2QS2 A;  3O29 A;  5AA2 A;  3PTY A;  2VOZ A;  2XXW A;  3PUV E;  1IZ1 A;  3IB0 A;  3LC8 A;  3S2V A;  2VHA A;  2RKM A;  5TPA A;  4R6H A;  1LBW A;  1TFD A;  3ZKK A;  3IJX B;  4GWS A;  2DVC A;  3GXA A;  1MXW A;  3SEX A;  4EDP A;  2RF1 A;  1D9V A;  2ESN A;  1NUX A;  5CMC A;  1O64 A;  2QRY A;  3LV0 A;  1IME A;  2V3T A;  5IGA A;  4NF6 B;  3HCQ A;  3U93 A;  2D3I A;  3EQ1 A;  2D5W A;  1QGX A;  2JJK A;  3U92 A;  3K02 A;  1PC3 A;  3FZV A;  4FIM A;  3C33 A;  3IOU A;  4OVR A;  4N15 A;  4GWY A;  1MPD A;  1B3H A;  3PUW E;  2YLN A;  1FTM A;  2HXR A;  1IMB A;  2O84 X;  3VVF A;  1CB6 A;  1HSL A;  5HM4 B;  4P8B A;  1QVS A;  4HXV A;  2XD2 A;  2GFE A;  3DM0 A;  3FBP A;  1LCT A;  2WBD A;  3IB2 A;  3K1P A;  2Y84 A;  2Q74 A;  4NG7 A;  1SYH A;  2X7Q A;  2OWS A;  4Q30 B;  1OLC A;  2QSX A;  1Y4T A;  2O68 A;  1MXZ A;  2B3B A;  4MLV A;  4O3B A;  1FBF A;  1FBE A;  1MQJ A;  2UVH A;  1KZ8 A;  4PGN A;  5LDZ A;  4KI0 E;  4X8R A;  3N94 A;  1FPF A;  2H5Y A;  2RCA A;  3HST A;  1JW5 A;  3H6T A;  4MLQ A;  2H99 A;  3LBS A;  4PTK A;  3SEW A;  3TCG A;  3H03 A;  1A55 A;  4G8M A;  1USY E;  4IR8 A;  3LUY A;  1B32 A;  2R6G E;  4IGR A;  3U65 A;  4O3A A;  4XTC Q;  2XXY A;  4RK2 A;  4NE4 A;  1K9Z A;  1IXG A;  1OIB A;  4F31 B;  5KCJ A;  2ONR A;  4PGP A;  4UAB A;  2Z23 A;  4QFO A;  4HE1 A;  3OEN A;  3T9U A;  5CMK A;  1NV2 A;  4LUB A;  3DP4 A;  1LLS A;  4I3E A;  4G2Z A;  3C31 A;  4G4P A;  1N3W A;  5ELV A;  2H98 A;  2BJI A;  2I4B A;  4LZ8 A;  1EYK A;  5AA2 D;  3VLU A;  3I5O A;  1DSN A;  2ZYK A;  2I3W A;  5I57 A;  1A8E A;  3TAJ A;  4EF1 A;  1I69 A;  1LAF E;  4ZS9 A;  3KJT A;  2F36 A;  4RA1 A;  2VD2 A;  2QFL A;  5I2K B;  3B6Q A;  2FNC A;  3FXQ A;  4ZE9 A;  4HS7 A;  1EH3 A;  3UGW A;  4LA9 A;  1B0L A;  2L5V A;  4EQB A;  2B4M A;  2P0S A;  3ODB A;  3OO8 A;  1LBC A;  4AB6 A;  4GIZ A;  4ESW A;  1FRP A;  4XKP A;  3MW0 A;  1PB9 A;  3PD9 A;  3GBB A;  1MQH A;  4KHZ E;  1XVY A;  1MQI A;  4YKI A;  4R9F A;  3MPL A;  2F7C A;  5BWJ A;  5L9M A;  1UTH A;  4OFO A;  2DXR A;  3FVK A;  1ATG A;  4JSO A;  3AXF A;  1DOT A;  3KBZ A;  4MBP A;  1RYX A;  1FQF A;  2DWA A;  1OVT A;  4R2B A;  1B4H A;  3O6H A;  3I6V A;  1LBY A;  1MPC A;  4THI A;  5FHO A;  3M8U A;  1B52 A;  4X1D A;  1IXI A;  3H06 B;  1B51 A;  2P1S A;  4OVQ A;  1DBZ A;  2AYS A;  4R75 A;  4LON B;  1PBP A;  1MH4 A;  1A7L A;  1IQ7 A;  4MJO A;  2Q8M A;  3TMG A;  4N6K A;  3O97 A;  4KCC A;  1LB9 A;  1FPK A;  2UYE A;  3G7W A;  4HE0 A;  3FD3 A;  5FTI A;  3FXB A;  5FTH A;  1O7T A;  4N91 A;  4O94 A;  1DTZ A;  3RPL A;  3C9H A;  1UTB A;  3SEU A;  4MEV A;  3SEV A;  3PU5 A;  1MY2 A;  4X04 A;  1XI6 A;  3FJM A;  4HCW A;  5JK4 A;  2HZL A;  3B8B A;  2Y7I A;  5DVJ A;  2HHM A;  4OES A;  4GOT A;  4TOZ A;  3H6V A;  4OER A;  3TDJ A;  4POW A;  2NVU B;  1YCJ A;  2LAO A;  1R9L A;  1G0H A;  5FBP A;  4OET A;  4DI3 D;  4F18 A;  1FBD A;  1GV8 A;  3SDF A;  4YAH X;  3QXM A;  4X48 A;  3UP9 A;  1QUJ A;  2NXO A;  4QFL A;  1JVY A;  1B0H A;  5IAI A;  5EYF A;  3O2A A;  5I58 A;  4XFE A;  1PBQ A;  4P1E A;  3KN3 A;  4QF9 A;  2Y5K A;  3IOV A;  4ND9 A;  1TFA A;  1B58 A;  4NX1 A;  5DT6 A;  3O66 A;  4C1T A;  5EYG A;  1FBP A;  5CBS A;  1M5D A;  3EN3 A;  4H5F A;  3MVX A;  4JXI A;  3V83 A;  2RCB A;  1R9Q A;  2Y7P A;  3OOA A;  3T66 A;  4TLL B;  2V3Q A;  3EKI A;  4RXL A;  4OA4 A;  4GL8 A;  4LQ2 A;  3W15 C;  1FQA A;  1BP5 A;  2QS1 A;  2VT5 A;  4PFY A;  3G3K A;  3IOW A;  1MS7 A;  3RYD A;  4R9G A;  5EQ9 A;  4PAK A;  3CG3 A;  3PMV A;  5H8H A;  3JZJ A;  3UIF A;  3ZKL A;  2G93 A;  4KD5 A;  4O3C A;  1RYO A;  2F78 A;  4GBV A;  4EQ7 A;  1B5J A;  1UTH B;  2VPO A;  2F97 A;  2XXK A;  2A5T A;  3MYU A;  5HPQ A;  2KLF A;  3CIJ A;  2NWJ A;  3RNN A;  1EYI A;  2DYX A;  1H45 A;  3IO4 A;  3KBR A;  4NF8 B;  2KR0 A;  2NOO A;  5EHM A;  5F1Q A;  3K01 A;  3MWB A;  3OXN A;  3DP6 A;  3PPO A;  3R26 A;  3MP6 A;  3EHT A;  2ANJ A;  4QBA A;  1POT A;  1PB7 A;  4P56 A;  4N07 A;  2HXW A;  4Q5T A;  4I62 A;  3MC2 A;  1RKM A;  3T9H B;  1PB8 A;  4MNI A;  2F7B A;  5ET7 A;  3UK4 A;  1B40 A;  3JYR A;  1B5H A;  4PE5 B;  4PF8 A;  4NAP A;  2VD3 A;  2V3U A;  1UTB B;  3FJ7 A;  1XS5 A;  2O69 A;  1QKB A;  1DPE A;  2ZNS A;  1OLA A;  3OMB A;  1JW4 A;  3ZS6 A;  4IO4 A;  3KG2 A;  4OFJ A;  4NQ8 A;  1LAX A;  1P99 A;  3CSG A;  3TKD A;  3G3J A;  2V84 A;  3VVD A;  5H8Q A;  2F3B A;  1EU8 A;  4JSD A;  3I3V A;  1Y9U A;  3MP1 A;  2NUV A;  4O7I A;  5I56 B;  3PMX A;  2HPG A;  1B3G A;  4ONY A;  1Z7M E;  1RDZ A;  2ONK E;  4PC9 A;  1IIW A;  2I58 A;  4JWO A;  1VR5 A;  4BDL A;  1KA0 A;  1IXC A;  1LBV A;  1SW5 A;  2W7Y A;  1P1W A;  1NKX A;  5EQ7 A;  2Z8D A;  4JBZ A;  3T9V A;  2CZH A;  4GWO A;  3IJO B;  1DTG A;  1II5 A;  3HHG A;  4LVQ A;  3BIH A;  5I58 B;  1HSJ A;  3O6I A;  2XWI A;  2GH9 A;  3KC0 A;  1H76 A;  1Y1Z A;  3ZSF A;  1SYI A;  3S9L C;  5T3J A;  2F8D A;  2QMX A;  4XIG Q;  3SET A;  5A5L A;  2DVZ A;  4GF8 A;  5AA3 A;  3O6G A;  4U2R A;  4P1L A;  2X7P A;  3N5L A;  4ZEB A;  3TZA A;  3UA8 A;  4RJZ A;  3IK6 B;  2F7A A;  2DE2 A;  4I40 A;  4XF5 A;  3K6V A;  1FQC A;  4GVO A;  4N81 A;  1BTJ A;  4PFI A;  1FBH A;  1SI0 A;  1DMB A;  1Z7N E;  5DTB A;  2I49 A;  3EHS A;  4LAT A;  4HE2 A;  4PFR A;  3Q26 A;  3MVY A;  3VDF A;  4MIJ A;  5CRY A;  3RTW B;  4F29 A;  3TFL A;  1ZKB A;  1YZ0 A;  3DP8 A;  2WEF A;  4N6D A;  5H8H B;  4F2Q A;  4IGT A;  3CFX A;  4YZZ A;  1D4N A;  1AIV A;  4H8J A;  2RIN A;  2HZK A;  4GWW A;  1US4 A;  3ILT B;  1Y4C A;  2RC7 A;  1JEU A;  3UOR A;  4U22 A;  5L9O A;  3KFM A;  5H8N B;  2XX8 A;  1Q35 A;  3S9N C;  1URG A;  1FPD A;  3KC1 A;  3PV0 E;  3R6U A;  4HTG A;  3MPK A;  4MCO A;  3W9W A;  5LOM A;  2ZNT A;  1YXI A;  2FIE A;  1IMC A;  2DXY A;  1Y3Q A;  4PBH A;  2WYK A;  1FCK A;  5AE4 A;  1IUD A;  3TEP A;  1IXH A;  3Q27 A;  5B70 A;  3LUZ A;  2XWO A;  3OSR A;  2FIX A;  1MM6 A;  3EHU A;  4GRK A;  3H6W A;  2VPN A;  1LBX A;  1Y1M A;  1BK4 A;  5I5P A;  4MX6 A;  4Z0I A;  2I4C A;  4GWU A;  3FVN A;  3V5A A;  4PQJ A;  1LAG E;  4P3L A;  3GZG A;  3FVO A;  3C32 A;  3RGY A;  4EXL A;  4F2O A;  4E0W A;  3ONM A;  4PAI A;  4WKM A;  5CM6 A;  2ZZV A;  2HQ0 A;  4XKQ A;  1SBP A;  3TQL A;  1N0T A;  1N76 A;  5I7I A;  2CZI A;  2HAU A;  3MST A;  1SQY A;  4FJP A;  5H8Q B;  1LFG A;  1ZMG A;  3T0J A;  3M3L A;  2CEY A;  4QSC A;  3RQT A;  4NF4 A;  1JQF A;  1NV5 A;  1SVX B;  3Q25 A;  3PMW A;  4GL0 A;  2I0B A;  4ZZE A;  1Q1K A;  1B4Z A;  4GFR A;  5IZ1 A;  2OBG A;  3CRB A;  4MNP A;  1A40 A;  4R2F A;  4ELO A;  4NTL A;  3RN8 A;  4PFU A;  2F35 A;  2F6P A;  2D21 A;  5ICQ A;  2WKY A;  1N84 A;  4ZEK A;  3C35 A;  4ELP A;  1B3F A;  1BKA A;  4ESX A;  4NF5 B;  2FA7 A;  4DXC A;  1MY0 A;  1NNF A;  4OTE A;  2DDK A;  1KWH A;  4N6P A;  4DZ1 A;  5AA2 B;  1FPJ A;  4WXJ A;  2VGQ A;  4OVP A;  3FAS A;  1FBG A;  1FW0 A;  1EYJ A;  5TPA B;  2GHB A;  2QS3 A;  4OWD A;  3USD A;  4H5G A;  4BDO A;  1FPI A;  3CHG A;  1FJ6 A;  1JNF A;  1ZIU A;  2UVJ A;  1QW0 A;  2REG A;  3B6W A;  3ILU B;  3NOH A;  3G3F A;  1NNT A;  2QVV A;  3SES A;  5H8F A;  4RK9 A;  4HW8 A;  4N8G A;  4KCD A;  4QSE A;  1MXU A;  4YB7 A;  2X26 A;  5EQA A;  3M3K A;  3IX1 A;  1JP4 A;  1MH3 A;  4P47 A;  3A29 A;  4C0R A;  1NV6 A;  4JWY A;  3K1M A;  4JWX A;  3IOR A;  3U8Q A;  4DCY A;  2ZZX A;  2GHA A;  4RPO A;  3FAT A;  4ZEC A;  2XXV A;  3QUJ A;  3T93 B;  3PUY E;  2DS9 A;  4P0G A;  4GX4 A;  2OZZ A;  1FTO A;  4G8N A;  4DI4 B;  4M1V A;  4I1D A;  1CNQ A;  2I6E A;  2OWT A;  3WAE A;  1NH7 A;  1CE2 A;  4N13 A;  4NWD A;  4NWC A;  4RNS A;  4OVS A;  3VV5 A;  5TP9 A;  5L8D A;  4QFN A;  2DQV A;  2G29 A;  1GTK A;  1ZU0 A;  5IKB A;  4L17 A;  4JDF A;  3UN6 A;  1GR2 A;  4AB5 A;  2MKZ A;  5TU0 A;  2PMS A;  2OK2 A;  3FJG A;  5J16 A;  1OQG A;  3V8X B;  2XXI A;  3T22 A;  1QUK A;  5ET8 A;  5KCJ B;  4K3F A;  5ITO A;  1B5I A;  2H25 A;  4R72 A;  3MP8 A;  4ZZA A;  2AIX A;  1XT8 A;  4PFW A;  3D1R A;  4BDQ A;  4LP2 B;  2CZK A;  2Q88 A;  5IZ3 A;  3KN7 A;  1YAE A;  3RPW A;  4NGU A;  3U72 A;  2Y7K A;  1I6B A;  1SPI A;  1FPL A;  4G68 C;  1GVC A;  5I57 B;  4YKK A;  4F3B A;  2E1S A;  3GYY A;  4PP0 A;  4ZEI A;  1VFE A;  4NF4 B;  4ECF A;  1WDN A;  3KEI A;  5B7D A;  4OEU A;  2Q2A A;  3E79 A;  5EYH A;  2PYY A;  1NMU A;  1P1N A;  2HEU A;  5I59 A;  1WOD A;  3QYT A;  2QVR A;  3TTM A;  2V4C A;  2XWK A;  5EHS A;  1RDY A;  1EZO A;  2YPN A;  4FAJ A;  1ZTY A;  1FTA A;  1PDA A;  2H4I A;  5BUU A;  2KQZ A;  4GWX A;  1OMP A;  4IO6 A;  4PF6 A;  3A09 A;  4PDH A;  4YKP A;  1H3D A;  4G61 A;  4PBQ A;  3VXB A;  4GWZ A;  2XXH A;  3IAZ A;  1FTJ A;  4PFB A;  3W9V A;  1MQD A;  4AS5 A;  1XVX A;  3TTN A;  4I8C A;  3E3K A;  4QXD A;  3E13 X;  4N17 A;  1R1N A;  1UIV A;  5F7V A;  3KOT A;  2YJP A;  5DVF A;  3O9P A;  2DWH A;  4OVT A;  3T9X B;  2UXA A;  4PFT A;  1QJM A;  1NUY A;  5H8F B;  1XC1 A;  4M4G A;  4P9K A;  1PEB A;  4ZED A;  3N6T A;  3MAM A;  1UQW A;  4H45 A;  3QAX A;  4KYD A;  5JEI A;  1IMD A;  2H9B A;  4U21 A;  4MAG A;  3IFC A;  4OVJ A;  2PX1 A;  5ET5 A;  3L6G A;  1S50 A;  3OEL A;  1ZBM A;  3OO9 A;  3C36 A;  3VFJ A;  1MG1 A;  1NL5 A;  4F39 A;  5ESY A;  5CBR A;  1B7H A;  3C34 A;  1B7U A;  4BDR A;  4G68 A;  4QRZ A;  1AOV A;  3RT6 B;  3KZG A;  4MH5 A;  1P1Q A;  4X9T A;  3RPL B;  4JVI A;  2ZMB A;  1BLF A;  2QL3 A;  3FV2 A;  4R73 A;  4DIG A;  4KR5 A;  3EF7 A;  5AA1 A;  1Y3N A;  4U4X A;  4Q8R A;  4KPT A;  1UIU A;  4H67 A;  4OYV A;  3RLF E;  1IEJ A;  3TYH A;  1FQB A;  3TTK A;  4Z7E A;  4IO7 A;  1H43 A;  4JB7 A;  3H6U A;  4PDD A;  5I84 A;  1EZP A;  2OPD A;  2HCA A;  1WVJ A;  2XXQ A;  3H3G A;  4GX3 A;  2O7U A;  2WBB A;  4MNC A;  2QPQ A;  1VFD A;  4YMA A;  2QS4 A;  4AQ4 A;  1B1X A;  2DWI A;  1A8F A;  4GXS B;  1NV7 A;  3CFL A;  3K6W A;  1M5F A;  5IZ3 B;  2ZZW A;  4GQO A;  4I9D A;  4FEC A;  4H8I A;  2XXU A;  3FGS A;  1J1N A;  3K6U A;  4FAT A;  2XX7 A;  2XXR A;  3KOS A;  3TCH A;  2F5X A;  1FBC A;  3PPP A;  5K2X A;  2P3V A;  2IA4 A;  5A5X A;  1LBB A;  3MZB A;  2FVZ A;  1KA1 A;  5DYH A;  3M3F A;  1NV4 A;  3CSB A;  3CFZ A;  2Z8E A;  5M2V A;  2RC8 A;  1S7Y A;  1OQH A;  1R6Z A;  4OEV A;  2Q9T A;  4IO2 A;  3BFU A;  5CC2 A;  5ITP A;  1S9T A;  4DCX A;  1VDW A;  4I3Y A;  3IFA A;  5I2N A;  2P2A A;  4F3P A;  4KYE A;  4KXP A;  2XXX A;  3HV1 A;  5AA4 A;  3LSF B;  2UVI A;  2B65 A;  3D4C A;  4DXU A;  1DPP A;  4R74 A;  1GGG A;  4EF2 A;  3BIG A;  3HFU A;  1DCU A;  4H1X A;  2QJE A;  3FXU A;  3VXC A;  4XKR A;  4RYA A;  3CG1 A;  1SD3 A;  1SW4 A;  2VP1 A;  1LST A;  5CMB A;  2A5T B;  3FUZ A;  2WX9 A;  3HO7 A;  4O8M A;  3B6T A;  3ISP A;  4GLI A;  1SW1 A;  2XX9 A;  3FIR A;  2I48 A;  3PUZ E;  5DVI A;  2B3F A;  5DEX A;  1INP A;  1N04 A;  1MXV A;  4OAN A;  3E4R A;  4LZ5 A;  1USY H;  5IZZ A;  4ELQ A;  1D9Y A;  4FED A;  3QSL A;  4RPN A;  2GQ1 A;  2DP8 A;  2XD3 A;  4OZ9 A;  3O28 A;  5KDT A;  2Q2C A;  1MY1 A;  5CI5 A;  2PCR A;  2CMO A;  1HSE A;  1L5T A;  4G77 A;  1MM7 A;  3G3I A;  3K00 A;  4NF0 A;  2DE4 A;  4G68 B;  4RY1 A;  4GXA A;  1FQD A;  3IL1 B;  4HCY A;  4NHB A;  3K2D A;  4G8H A;  1NV0 A;  4IB2 A;  3DEL B;  4H6D A;  3JV9 A;  3OO7 A;  1FPE A;  1D3K A;  4Q0C A;  3TEL A;  2O1M A;  1N7X A;  3OEM A;  3QMF A;  4H65 A;  4E0X A;  4YU0 A;  1Y20 A;  2HFB A;  4NMY A;  3D4G A;  2Y7W A;  4F19 A;  1M5B A;  1FQE A;  1LEV A;  3MQ9 A;  2PVU A;  3TPA A;  5JTY A;  1F9B A;  1MQG A;  3PGF A;  3F11 A;  1LFH A;  3CI8 A;  4PE3 A;  4F1V A;  1AWB A;  1MDQ A;  2ZNU A;  4FOR A;  3R7X A;  3PPR A;  3GBA A;  3G3H A;  4FEB A;  5LTC A;  2UYF A;  4DE8 A;  1NH8 A;  5HBC A;  3KJ7 A;  4YB5 A;  4IO3 A;  4F22 A;  4MHF A;  2PT1 A;  3K4U A;  1LB8 A;  2DSF A;  3MJN A;  2OPE A;  2Z8F A;  4LQ5 A;  3MVZ A;  4OEN A;  3VLW A;  3S9M C;  1B7Z A;  1OVB A;  1T0K A;  4YB6 A;  5A5X B;  4AS4 A;  3MBP A;  1FTK A;  5CMM A;  3MZ1 A;  2XXP A;  4NN3 A;  1B3E A;  3FXR A;  1TT1 A;  2RC9 A;  3MZ9 A;  4F3G A;  3RT8 A;  4ZDM A;  3A3U A;  2Z22 A;  2PBW A;  4PAF A;  3L6H A;  4MMP A;  5KZT A;  3SZP A;  1QKA A;  2PFZ A;  1MPB A;  2CEX A;  3OD7 A;  5I2N B;  5EQ8 A;  3N26 A;  1NNP A;  3K0V A;  2HAV A;  4R6K A;  1LFI A;  2WYP A;  3B7D A;  3ROJ A;  5AA4 B;  1NI9 A;  3B50 A;  4NF8 A;  2DWJ A;  1US5 A;  4LN5 A;  1NNK A;  1Y3P A;  3IO6 A;  3V89 B;  4F3S A;  4JVC A;  3IB1 A;  1YYZ A;  4H46 A;  1BIY A;  3RUM A;  1AL3 A;  4U1O A;  1AH5 A;  3U94 A;  1B3L A;  1A54 A;  3PUX E;  4QSD A;  5IM2 A;  5DEX B;  5I3S A;  5FHM A;  2F6G A;  2O6A A;  2FHY A;  2FYI A;  2REJ A;  1YPN A;  4IY5 A;  3E78 A;  5ET6 A;  1MY4 A;  4XKN A;  3LSW A;  3U1O A;  3OEK A;  4BLA A;  3S4U A;  5KDT B;  3E9X A;  1VSO A;  4GD5 A;  2ALU A;  4XEQ A;  4FE8 A;  1B1H A;  1JEV A;  1MXX A;  4O7M A;  1SW2 A;  4MFI A;  1QUI A;  1LAH E;  1XHY A;  3TUS A;  3OO6 A;  3HHF A;  2R71 A;  3QUF A;  1LCF A;  4WED A;  2E0S A;  3A3C A;  3KN8 A;  4JVD A;  1MXY A;  4DXB A;  1YTV A;  1B05 A;  1ZJL A;  2A5S A;  3KSJ A;  4H0W A;  4PCD A;  5I56 A;  1FPB A;  1NFT A;  3C4M A;  1B2H A;  1I6Q A;  2ONS A;  1FTL A;  3OSQ A;  1POY 1;  2XWV A;  4ELR A;  2ZYM A;  1DK4 A;  3TOD A;  1IMA A;  3WAF A;  2CZL A;  3BBR A;  2F34 A;  3VE1 B;  2O1L A;  3TCF A;  1JW1 A;  3MUQ A;  2Q89 A;  1FPG A;  4OHN A;  5JTY B;  1G0I A;  2XXT A;  3N6U A;  2Q8J A;  1MDP 1;  2OX3 A;  1N3X A;  1EZ9 A;  4LZ7 A;  3RTF B;  2O51 A;  4MF3 A;  4BDM A;  4YIC A;  2Y7R A;  1A99 A;  3CVG A;  3K6X A;  2OWZ A;  2Y5L A;  2FBP A;  2ABH A;  4OMB A;  4QFP A;  4EUO A;  4TLM B;  5F24 A;  1VE4 A;  1IMF A;  4YMB A;  2B4L A;  4R6Y A;  1NV3 A;  5FHN A;  1ELJ A;  3IOT A;  3IR1 A;  2I3V A;  1LGB C;  2V93 A;  3T1B A;  4NF6 A;  4F1U A;  1ZLQ A;  3P7I A;  4NED A;  3RY3 A;  1P1U A;  4DLD A;  3VLV A;  1NV1 A;  3TTR A;  3LSL A;  4N4U A;  1NUZ A;  3QIM A;  1SI1 A;  4BDN A;  4ZE8 A;  2I0C A;  5ISU A;  2PFY A;  1K9Y A;  3EPE A;  1N7W A;  2M8C A;  3PD8 A;  4EXK A;  4OQO A;  1FJ9 A;  3MVW A;  2OLB A;  2BJJ X;  3QK6 A;  4ZEF A;  1D9Q A;  5H8N A;  1I6A A;  3S9E A;  1NUW A;  1IIT A;  1URD A;  4U23 A;  1B6H A;  3BFT A;  1MY3 A;  3PPQ A;  2DE3 A;  4IY6 A;  4KQP A;  4GX6 A;  3SKP A;  1O63 A;  2V25 A;  4IO5 A;  5L9S A;  3HPI A;  3H7M A;  3K1N A;  4GBW A;  3TTL A;  3HN0 A;  1M5C A;  1AMF A;  4FBP A;  3Q29 A;  4QHQ A;  2R9J A;  2XHD A;  1ANF A;  4X1B A;  1H44 A;  4P0I A;  1FSA A;  4ISU A;  4YKJ A;  2DOJ A;  2ZXT A;  2OCU A;  4UAC A;  1LBZ A;  3FVG A;  4WEP A;  2QVU A;  3Q28 A;  1JET A;  1TXF A;  1B46 A;  1URS A;  4N8Y A;  1Q9D A;  5TP9 B;  3VVE A;  4TQU Q;  3BKI B;  1QUL A;  1TWY A;  1XOC A;  4C1U A;  2AL5 A;  3GLB A;  3T96 B;  4UA8 A;  3DLN A;  5DW8 A;  2XA5 A;  2IEE A;  2PT2 A;  4U4S A;  2F3D A;  2GRV A;  4DDD A;  5H8S A;  4OFL A;  1MRP A;  1JVX A;  2R8T A;  4KYS A;  2OJT A;  5K2Y A;  1B9J A;  3LR1 A;  2ZYN A;  3LSX A;  4KFQ A;  1M5E A;  3ECR A;  2ZYO A;  4POX A;  3PPN A;  3THI A;  2AL4 A;  2O7I A;  2UVG A;  3SEY A;  4EQ9 A;  1RDX A;  4P11 A;  2THI A;  4PET A;  4XXU A;  5I2K A;  3H4Z A;  3KSX A;  3CR9 A; 
#chains in the Genus database with same CATH homology
 4PAK A;  1FPE A;  2ZZX A;  2P3N A;  5J1D A;  3QMF A;  4GX4 A;  4GBV A;  2VPO A;  4DI4 B;  4M1V A;  1CNQ A;  2XXK A;  4F19 A;  3MYU A;  3PTY A;  1LEV A;  4OVS A;  1EYI A;  4PE3 A;  4F1V A;  1AWB A;  1LBW A;  2KR0 A;  4GWS A;  5LTC A;  1NUX A;  2MKZ A;  3LV0 A;  1IME A;  5IGA A;  5J16 A;  4QBA A;  4P56 A;  1QGX A;  2JJK A;  4MHF A;  5ET8 A;  4OVR A;  4MNI A;  4GWY A;  4N15 A;  5ET7 A;  3D1R A;  2CZK A;  2HXR A;  1IMB A;  4AS4 A;  4PF8 A;  5IZ3 A;  4NAP A;  4NGU A;  4P8B A;  4NN3 A;  4HXV A;  1SPI A;  1FPL A;  3FBP A;  2WBD A;  2Q74 A;  4NG7 A;  4PAF A;  3GYY A;  4MMP A;  3SZP A;  2PFZ A;  4NQ8 A;  2CEX A;  5EQ8 A;  3E79 A;  5EYH A;  2F3B A;  1FBF A;  4O7I A;  1FBE A;  2WYP A;  2QVR A;  1KZ8 A;  4PGN A;  2HPG A;  3ROJ A;  2V4C A;  1NI9 A;  5LDZ A;  3B50 A;  1RDZ A;  2XWK A;  4PC9 A;  4X8R A;  1RDY A;  1KA0 A;  1LBV A;  1FPF A;  4LN5 A;  5EQ7 A;  1FTA A;  4PTK A;  2CZH A;  2KQZ A;  4JVC A;  4GWX A;  4PF6 A;  4IR8 A;  1YYZ A;  4H46 A;  4PDH A;  3BIH A;  3U65 A;  4G61 A;  4PBQ A;  1K9Z A;  2XWI A;  4GWZ A;  3KC0 A;  4PFB A;  5IM2 A;  4PGP A;  3W9V A;  4AS5 A;  4UAB A;  5T3J A;  5I3S A;  4HE1 A;  4QXD A;  1NV2 A;  4N17 A;  5A5L A;  2FHY A;  2DVZ A;  3E78 A;  5ET6 A;  4I3E A;  4P1L A;  4OVT A;  1NUY A;  4P9K A;  2BJI A;  1EYK A;  4XEQ A;  2DE2 A;  4I40 A;  4XF5 A;  4H45 A;  4N81 A;  4O7M A;  4PFI A;  1FBH A;  1IMD A;  4MAG A;  3IFC A;  2QFL A;  5ET5 A;  4HE2 A;  5ESY A;  4PFR A;  4JVD A;  4MIJ A;  4PCD A;  2L5V A;  2B4M A;  1YZ0 A;  4N6D A;  2WEF A;  1FPB A;  4YZZ A;  1FRP A;  2HZK A;  4X9T A;  3RPL B;  4GWW A;  4JVI A;  2XWV A;  1DK4 A;  1IMA A;  1FPG A;  1FPD A;  1G0I A;  3KC1 A;  4MCO A;  2OX3 A;  3W9W A;  1YXI A;  2FIE A;  1IMC A;  4PBH A;  2WYK A;  3LUZ A;  2XWO A;  4PDD A;  3KBZ A;  2FIX A;  4YIC A;  2OWZ A;  2Y5L A;  2VPN A;  1LBX A;  2FBP A;  5I5P A;  1BK4 A;  1LBY A;  4MX6 A;  4GX3 A;  5F24 A;  1IMF A;  2WBB A;  4GWU A;  4MNC A;  2QPQ A;  2B4L A;  1NV3 A;  4P3L A;  4OVQ A;  3T1B A;  4F1U A;  1DBZ A;  1NV7 A;  5IZ3 B;  2ZZW A;  4MJO A;  1NV1 A;  4N4U A;  4PAI A;  1NUZ A;  2Q8M A;  5CM6 A;  2ZZV A;  4N6K A;  2F5X A;  1FPK A;  1FBC A;  4HE0 A;  2P3V A;  3FXB A;  2PFY A;  2FVZ A;  5I7I A;  1K9Y A;  1KA1 A;  2CZI A;  4N91 A;  4O94 A;  3RPL A;  1NV4 A;  3MST A;  1FJ9 A;  4MEV A;  3T0J A;  2CEY A;  4X04 A;  1D9Q A;  2Q9T A;  1NUW A;  1XI6 A;  1VDW A;  1NV5 A;  4I3Y A;  3IFA A;  4HCW A;  5JK4 A;  2DE3 A;  2HZL A;  4GX6 A;  3B8B A;  2HHM A;  5IZ1 A;  4MNP A;  4KXP A;  4GBW A;  1G0H A;  4FBP A;  5FBP A;  4DI3 D;  4F18 A;  1FBD A;  3BIG A;  3HFU A;  1DCU A;  1FSA A;  2DDK A;  1FPJ A;  1LBZ A;  2QVU A;  2WX9 A;  4OVP A;  4O8M A;  1FBG A;  4N8Y A;  3ISP A;  1Q9D A;  4XFE A;  1EYJ A;  4P1E A;  1FPI A;  3CHG A;  1FJ6 A;  2Y5K A;  1INP A;  4NX1 A;  4OAN A;  5DW8 A;  2XA5 A;  5IZZ A;  2F3D A;  1FBP A;  5EYG A;  3NOH A;  2R8T A;  2GQ1 A;  2QVV A;  4N8G A;  2PCR A;  5EQA A;  1JP4 A;  4NF0 A;  2DE4 A;  2V3Q A;  3EKI A;  4OA4 A;  1RDX A;  4P47 A;  3A29 A;  4HCY A;  4PET A;  4NHB A;  1NV0 A;  2VT5 A;  1NV6 A;  3RYD A;  5EQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...