3BIGA

Crystal structure of the fructose-1,6-bisphosphatase glpx from e.coli in complex with inorganic phosphate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
324
structure length
321
Chain Sequence
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSTIRRIQSIHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase class II glpX
publication title Structural and Biochemical Characterization of the Type II Fructose-1,6-bisphosphatase GlpX from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 113
structure length 321
sequence length 324
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3bigA01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3bigA02
4GBVA 5ET7A 3KBZA 1Q9DA 1LBZA 5EQ9A 4GWZA 3T0JA 1FPEA 4I40A 4HE1A 2BJIA 5ESYA 1K9ZA 1JP4A 1FJ9A 1IMBA 2GQ1A 1YXIA 1NV2A 4GX6A 1EYIA 1NV1A 3LV0A 1KA1A 3LUZA 1EYJA 4PTKA 3RYDA 3KC1A 1AWBA 1IMDA 5FBPA 5A5LA 2OX3A 5J16A 5ET6A 3KC0A 4IR8A 2FHYA 1FBDA 5IZ3B 3IFAA 1NUZA 4GWSA 2Y5KA 5ET5A 1SPIA 1D9QA 5F24A 1FPLA 1NUYA 1IMFA 5I3SA 2QVUA 1QGXA 4AS5A 1IMEA 1FPBA 4FBPA 2QVRA 1RDZA 1NUXA 2QFLA 2CZKA 5T3JA 1DBZA 4H46A 2FBPA 1LBWA 1G0HA 1FBHA 2WBBA 5ET8A 1FBCA 4G61A 1EYKA 1YYZA 2P3NA 3RPLB 5EQAA 3B8BA 1NV4A 4GWUA 1FPJA 1NUWA 1FBEA 2CZIA 3A29A 2WEFA 1LBVA 1NV7A 2Q74A 1RDYA 2QVVA 3D1RA 1FPGA 3IFCA 4GWYA 2CZHA 5IZ3A 1IMCA 1NV0A 2FIEA 4AS4A 4I3EA 1DCUA 1VDWA 1FBGA 1FJ6A 1YZ0A 1XI6A 3FBPA 2HHMA 4GWWA 5EYGA 2PCRA 5IZ1A 4HE2A 1LEVA 1INPA 1LBXA 4H45A 1G0IA 4GWXA 2FVZA 2DDKA 1FRPA 3BIGA 4I3YA 3QMFA 2F3DA 1FPIA 5DW8A 2VT5A 1CNQA 1RDXA 2Q8MA 1NI9A 4HE0A 4HXVA 2Y5LA 1FSAA 1KA0A 1FBPA 4GX3A 1KZ8A 5EQ7A 1FBFA 2R8TA 4O7IA 2OWZA 1FTAA 2WBDA 1IMAA 5EYHA 3ROJA 1FPFA 2P3VA 4QXDA 4MJOA 2JJKA 4GX4A 4KXPA 5EQ8A 1FPDA 1K9YA 4N81A 3BIHA 2FIXA 4GBWA 1DK4A 2F3BA 1NV3A 1NV6A 3RPLA 1FPKA 1LBYA 1NV5A 5LDZA 1BK4A
chains in the Genus database with same CATH superfamily
3MZ1A 3CFLA 5I57A 1LBZA 4ZE8A 1FPEA 4BDRA 4GXAA 5AA4B 3HO7A 2F6PA 3IJOB 4MLVA 4R9FA 3KC1A 5I2NB 4F29A 1XVYA 3JYRA 3A3UA 3BFTA 4GWSA 3E3KA 2GHBA 3W9WA 3KBRA 3OXNA 1D9QA 5I59A 2F5XA 4KI0E 2RKMA 5I3SA 4LONB 3SEUA 2QL3A 4OA4A 3FGSA 5B7DA 1B0LA 2H99A 5T3JA 3IK6B 2MKZA 3LUYA 3MPLA 1FBCA 3B8BA 5I2NA 3A29A 4XTCQ 4GWYA 1IMCA 4ZZAA 1Y3PA 1FTKA 3R26A 3C33A 1FJ6A 1BLFA 5TPAB 4GVOA 3IOUA 4PC9A 3PV0E 4MAGA 2O7UA 1N3XA 1LEVA 2O68A 1G0IA 3LBSA 4OVQA 1FPIA 1SVXB 2RC9A 3SESA 2V3TA 3E9XA 4G8MA 4YMBA 1MXWA 4F3SA 2V93A 2HZLA 3PGFA 2O1LA 1D9VA 5TPAA 2ZNSA 2WBDA 2R9JA 3S9LC 1M5BA 3FV2A 2JJKA 4NF5B 2XXYA 4N07A 2Z8DA 3VFJA 5J1DA 1OVBA 4R75A 3TMGA 3K1PA 3PPPA 4PBHA 3KBZA 2CZLA 4JSOA 2WX9A 3C35A 1JP4A 3MAMA 4P56A 4PDDA 2DXYA 1YXIA 2I48A 3MPKA 2XXRA 5A5LA 3IO6A 5ET6A 1QVSA 4NF5A 1B5JA 1MQGA 5CI5A 2PVUA 3RPWA 4KCDA 4MH5A 4NAPA 2DYXA 1FPLA 3V8XB 3M3KA 4G4PA 5DVJA 2H4IA 2F7CA 3VE1B 1NL5A 3EF7A 1N76A 3T9XB 1LBWA 2IA4A 4AQ4A 3O28A 1UTHA 3ILTB 4OVTA 3K1NA 4G8HA 3MQ9A 1YCJA 2Y7PA 1OLCA 1USYH 4Q0CA 4H5GA 2WEFA 4YICA 3C32A 1IITA 4UACA 4MNPA 1LBXA 3HPIA 1LAGE 4PE5B 4RY1A 4MCOA 1ZBMA 3SEYA 1MY1A 2GFEA 3Q28A 4ESWA 4HE0A 1H45A 2QS4A 1FSAA 4C0RA 2X7PA 4ELPA 1YAEA 3IAZA 4GX4A 1IXHA 3T9VA 2CEYA 2XX7A 3HN0A 2ZNUA 2VHAA 4OETA 3FV1A 3N5LA 3PD9A 3I6VA 2F6GA 1Q9DA 2RC7A 1FQFA 3HSTA 2BJIA 4F3BA 4I1DA 4PFRA 4E0XA 1ZLQA 4GX6A 4JXIA 1GTKA 3LV0A 3HFUA 4U1OA 1R1NA 5JEIA 3UORA 4LATA 1PDAA 3LSLA 4NWDA 5CMMA 2KLFA 2H25A 4EQ7A 4ND9A 4QHQA 1D4NA 2Z22A 3TUSA 1S9TA 4HTGA 1SW1A 1NUXA 1DBZA 4H46A 2PBWA 5H8NB 4OYVA 3IO4A 1FQEA 3RPLB 4R6HA 2REJA 3OD7A 3K02A 4M4GA 2DP8A 2DWIA 4N6PA 3PPNA 4YMAA 4PAIA 4DZ1A 1HSLA 1NKXA 1WODA 4KCCA 3S9NC 4N15A 2OLBA 5H8NA 2QMXA 1AMFA 3BBRA 4GFRA 3TYHA 4JVCA 4MF3A 3USDA 1N04A 3MZ9A 1UTBB 1AOVA 4X1DA 4UA8A 2XHDA 1SD3A 4POWA 4NHBA 1GV8A 1B3HA 2QS1A 1FPDA 1PBPA 4L17A 4N81A 2V25A 4JWOA 4NG7A 5CM6A 4LVQA 3QYTA 3KJ7A 3OO7A 3S4UA 4IO4A 2XXQA 3MVXA 1OVTA 4PETA 5ICQA 2NOOA 3TELA 4R74A 3TDJA 3TCHA 1UTBA 3T93B 1O7TA 1CB6A 4LZ7A 2YLNA 3O97A 4MEVA 3GXAA 1JVXA 4O3CA 5KDTA 1FBHA 3E13X 4HS7A 4RNSA 2QSXA 1QUIA 1B46A 4PGPA 4XKNA 1XC1A 1ZTYA 1L5TA 2HXRA 4NF0A 4EQBA 4BDNA 5IAIA 1DCUA 1MDP1 1FBGA 2Q2AA 1NNTA 1MPDA 4PCDA 4I8CA 1MM7A 3TPAA 5CMBA 2WYKA 4H45A 3M3FA 4WKMA 2ZZWA 4LZ8A 2ONRA 1B4ZA 2IEEA 4P8BA 2D21A 4JWXA 4ISUA 4N8YA 3TCGA 1QKBA 1A54A 1HSEA 1B7HA 4LQ2A 1P99A 3OEMA 3C9HA 4NQ8A 3VVFA 4MJOA 4PFYA 1D3KA 4KHZE 1LSTA 4TLLB 2DE4A 1LFHA 4RK2A 1H76A 1I6QA 2DVCA 1LBCA 3S9MC 2I0CA 1YTVA 3FIRA 2DWAA 3IX1A 1B7UA 2VD2A 4PF6A 5CMKA 2ZZXA 4PP0A 1RKMA 2XXKA 3GBAA 3ODBA 3H4ZA 1B3EA 3TZAA 3C34A 3LSWA 2D3IA 4LA9A 4RPOA 1IMEA 3K2DA 1H43A 4PAFA 3K0VA 2P3NA 3PUYE 4H0WA 4PFTA 1JQFA 1OLAA 4GWOA 4ZS9A 4ELQA 5IKBA 4M1VA 3L6GA 2YPNA 3OOAA 1YZ0A 1XI6A 3K6XA 4YB5A 4MNCA 2H9BA 2XXWA 3PPOA 2FVZA 3IB1A 4G68B 4PE3A 4U2RA 2ZYMA 4I62A 4DCYA 1WDNA 4P0GA 1CNQA 1S7YA 2Y84A 2DS9A 3VLUA 2I3WA 2HCAA 3FXQA 3TTNA 1KZ8A 2UVIA 4RYAA 1IXIA 5FTHA 4BDOA 1POY1 3MJNA 5I5PA 5I7IA 1B3LA 4H1XA 1Y1ZA 4G68A 5DVIA 4BDLA 2FIXA 1FPKA 4YKIA 2XXPA 4EXKA 1BK4A 2YJPA 4N17A 5I56A 4XF5A 5ISUA 1Z7ME 5ESYA 1K9ZA 2ESNA 3U8QA 1SW4A 2OJTA 2UVHA 2REGA 2F8DA 1YPNA 1MRPA 1VFDA 2Q89A 4X04A 2OCUA 5TP9B 2H98A 1Y3NA 3HV1A 5L9OA 5K2XA 3V83A 1NUYA 1NFTA 3DLNA 1R9QA 4E0WA 2HPGA 1FPBA 1A8EA 4PQJA 4G2ZA 3C4MA 3GZGA 3V5AA 1DSNA 1N84A 5KZTA 4P11A 1MPCA 1A99A 4JDFA 5KCJB 3PUWE 3O2AA 5AE4A 2A5TB 5TP9A 3IL1B 4LZ5A 1B1HA 2NWJA 5LOMA 1QULA 5H8HB 2DQVA 1T0KA 2GHAA 3QXMA 4YB7A 5AA4A 4GIZA 1PEBA 3Q27A 3WAEA 2I4CA 5ITOA 1ATGA 3DP6A 2ANJA 5I84A 4MBPA 1XOCA 3WAFA 3FXUA 3LSFB 1B40A 2B65A 1LCFA 1JW4A 3RGYA 3O6IA 1MS7A 5H8HA 1Q1KA 4XIGQ 1FTAA 4F39A 4F22A 4OTEA 1J1NA 4KXPA 2VPNA 3P7IA 1Y9UA 1JEUA 3L6HA 2ZZVA 1P1QA 1JW1A 4JBZA 4Q8RA 4NF6B 3OEKA 3LSXA 2VPOA 3CFZA 2W7YA 4QFKA 2FNCA 4NWCA 1DOTA 5EYFA 2XD2A 3OO6A 3RTFB 3OENA 5F24A 2RCAA 2XWIA 3KSJA 4NF6A 1URDA 3H06B 2HAUA 1Y4TA 2CZKA 4ONYA 5JTYB 2I49A 5DVFA 4ELOA 4FE8A 1MY2A 1S50A 1SI1A 3G3KA 4MFIA 3H3GA 1IIWA 5HBCA 3G3IA 5F1QA 1FPGA 1NH7A 5IGAA 2ONKE 3VVDA 3TFLA 3QAXA 4NGUA 2HZKA 5A5XB 2PCRA 2Z23A 4I3YA 5JTYA 3UGWA 4Q30B 5F7VA 1MPBA 3B50A 5DTBA 1MY3A 2X26A 3U72A 2Q9TA 3O6HA 3C31A 3TTLA 5K2YA 3TKDA 1FQDA 2XWKA 3IOWA 4TLMB 5TU0A 3MZBA 2OWZA 3W15C 1B4HA 5A5XA 3FD3A 4NX1A 1B7ZA 3HHFA 1TWYA 2ONSA 2OK2A 4MHFA 4N4UA 4P1LA 4GBVA 3GLBA 3KEIA 3ILUB 1ZKBA 3SKPA 3EPEA 4X48A 4ZDMA 2RC8A 3A3CA 3R7XA 3MP6A 3SZPA 3Q26A 1IMBA 1B3FA 1M5FA 2B4MA 1PB9A 3RYDA 2O7IA 2ZYOA 4OMBA 2I0BA 3BKIB 4KPTA 4LUBA 1BKAA 1XS5A 4NE4A 1WVJA 4YAHX 2QMWA 3PMWA 2QVRA 4ECFA 5I2KB 2QFLA 5ITPA 4O3BA 1BP5A 1US5A 3VXBA 3Q25A 3K6UA 5EQAA 3OO9A 4GWUA 2ALUA 2LAOA 3GBBA 3KFMA 2OPDA 4OVSA 1BTJA 1URGA 1SW5A 5EYGA 2QRYA 3OELA 4IO7A 4P47A 4F1UA 4GWXA 5I2KA 1FTMA 1OIBA 3HCQA 3N6TA 2ZXTA 2NVUB 4O8MA 1ZJLA 4DIGA 1I6BA 4KD5A 4FEBA 2D5WA 1HSJA 1KA0A 1MDQA 4GX3A 3JZJA 2R8TA 1OQGA 3F11A 3T22A 1QKAA 5FTIA 3KOSA 4EQ9A 5IM2A 5IZZA 4F1YA 2Q2CA 3B6TA 1K9YA 2I3VA 2OZZA 4GF8A 2A5SA 4ZZEA 4YKJA 3RPLA 4H65A 1US4A 4IO2A 5EQ9A 1MQIA 2AL4A 4U23A 4GOTA 3K6WA 1FQAA 1Y3QA 3CVGA 1I6AA 3IOTA 2DSFA 2QS2A 3V89B 3LUZA 1GVCA 1IMDA 4PF8A 1DPEA 4MMPA 3RN8A 2R6GE 1SQYA 1NUZA 1LLSA 2Y5KA 1SPIA 1EH3A 1FQCA 2AL5A 2UXAA 4R9GA 3PMXA 2QVUA 4OVJA 4FBPA 4QRZA 5CBSA 4KYDA 4IY5A 3H6UA 3I5OA 3KGCA 4OEUA 4DXBA 3QK6A 1P1NA 1POTA 2Q74A 3U65A 1JETA 1VDWA 2ZMBA 2O69A 3CG3A 1B5IA 4ZECA 2DWHA 3T66A 1PC3A 1MY0A 5EHSA 5BWJA 3KN8A 2VT5A 1FTJA 5H8SA 2O51A 2Q8MA 4BLAA 3FJMA 5BUUA 4Q5TA 2UYFA 3T9UA 4R73A 4YZZA 1II5A 2V3UA 4H67A 4QXDA 4GLIA 5FHMA 1TFDA 4Z0IA 3LR1A 1R6ZA 3BIHA 4POXA 4U1ZA 4IO3A 1B32A 3T0JA 4I40A 4HE1A 1Y1MA 4HCWA 3IOVA 4HW8A 2AYSA 1PB8A 1A7LA 4N6DA 1M5DA 2L5VA 4R72A 4O7MA 4LN5A 1ZU0A 3N94A 1FBDA 1MH3A 3H6WA 1NNPA 3H03A 3S9EA 2XWOA 2XXUA 1VSOA 1MG1A 3GYYA 3PMVA 4MIJA 2UVGA 2QPQA 3RUMA 3VLVA 2FBPA 3G3GA 1LFIA 4RJZA 4QSCA 2QJEA 1NV4A 1NUWA 2P0SA 2XXXA 4GXSB 3MYUA 1UIVA 2O84X 1H44A 5L9MA 4R2FA 3ZSFA 2M8CA 3DP8A 4AB6A 2DDKA 3BIGA 1B5HA 2DE2A 4FJPA 4P9KA 4FECA 1OMPA 5DW8A 4OFLA 1FTOA 4OESA 4UABA 1IQ7A 1LBBA 3CRBA 1N0TA 4IO5A 3TCFA 1SW2A 3PPRA 3O29A 2ZYNA 4X9TA 3MSTA 4KYEA 5H8FB 3TTMA 1LCTA 4N6KA 4XKPA 3THIA 4F3PA 3JV9A 5LDZA 1MY4A 2OBGA 1ELJA 3O6GA 2FYIA 2RINA 5M2VA 2B3FA 3MP1A 4U4XA 3PUZE 2HQ0A 1A8FA 1QW0A 1O64A 3QUJA 4EF1A 4KYSA 5H8FA 2V84A 2O6AA 4ZEIA 4ELRA 5L9SA 4XXUA 1F9BA 2DXRA 1CE2A 2Y7KA 3MC2A 3TEPA 3MBPA 3TTRA 3MVZA 5ET8A 4G61A 1EYKA 3CFXA 4R2BA 2VP1A 2E0SA 2CZIA 1NV7A 3IFCA 4OFJA 4WEDA 3QSLA 1I69A 2OWSA 1NV0A 4XEQA 1JVYA 3FJ7A 4N91A 3DELB 3KG2A 3CR9A 2RCBA 3ONMA 5IZ1A 3OSRA 3EN3A 4DI4B 5CRYA 3E79A 1B58A 2I58A 1MXUA 3SEWA 3T1BA 1M5EA 1XVXA 4HXVA 4JVDA 1P1OA 2WKYA 4NEDA 1ZIUA 2WYPA 1SBPA 4XKRA 2XXTA 3E78A 4DCXA 2ZYKA 3ROJA 4IO6A 3A09A 3EHSA 1BIYA 3FJGA 1MXVA 1NNFA 2PFYA 2AIXA 4OVPA 3FVGA 4MNIA 3TODA 2XXIA 1O63A 5KCJA 1DTZA 4F3GA 4OENA 4U22A 1FCKA 2A5TA 4G8NA 1A40A 4DLDA 4F31B 4BDMA 1A55A 1LB8A 4F18A 4H8IA 1FJ9A 4OANA 4OEVA 1RYOA 4GL8A 4RXLA 4THIA 2XX8A 1VR5A 3RT6B 1AWBA 4F1VA 4PGNA 3KC0A 4IY6A 3SEVA 2CEXA 3TTKA 4QFNA 3U92A 5CBRA 3K4UA 4MLQA 1B05A 1ZMGA 4QSEA 1EZPA 4DE8A 3FVKA 4Z7EA 4AS5A 3UK4A 4U4SA 2XA5A 3RY3A 2F7AA 2PT2A 1G0HA 4O94A 2FA7A 3OSQA 4F2QA 4WEPA 3FVOA 3PD8A 4QF9A 1FBEA 4X1BA 3M3LA 1LBVA 2QVVA 3ECRA 2CZHA 2V3QA 4I3EA 3VXCA 5H8QB 1B2HA 3PUVE 3I3VA 1GGGA 3B6WA 4R6KA 2XXVA 3FBPA 3OO8A 5B70A 3ZS6A 1INPA 3CI8A 3G3JA 3IORA 4XFEA 2OWTA 3KN7A 1FRPA 4FORA 3QMFA 3RQTA 1MH4A 2DOJA 4PBQA 2XXHA 4OVRA 3R6UA 1ANFA 3CHGA 3U1OA 2P1SA 4X8RA 3K1MA 1IXGA 3MWBA 2F78A 5H8QA 5EQ7A 1FTLA 1LAFE 3MP8A 1UTHB 5EYHA 4G77A 3TQLA 2P3VA 4DDDA 5EQ8A 1B51A 3RT8A 3EHUA 4YB6A 2NXOA 4G68C 1QUKA 3CIJA 1R9LA 1NV5A 4PFUA 2DVZA 1IXCA 4YKPA 2P2AA 4IGTA 2F36A 1NNKA 3D4GA 4ZE9A 2VOZA 5DT6A 2GRVA 4P0IA 1P1UA 3FATA 4PTKA 1EYJA 2GH9A 2DWJA 3PU5A 2H5YA 5HPQA 3FASA 2FHYA 3B7DA 1FQBA 4IGRA 3SETA 3KJTA 5ET5A 2XWVA 3CSGA 3IB0A 5EHMA 5ELVA 3B6QA 4QFLA 3MW0A 1OQHA 2RF1A 1RDZA 3C36A 4PDHA 4I9DA 1DTGA 4DXUA 3FZVA 1LAXA 2F34A 1SYHA 3SDFA 1JW5A 1TT1A 1N7XA 3IR1A 4FAJA 2THIA 4FEDA 3IB2A 4EXLA 3ZKLA 1UQWA 4AS4A 3FVNA 2XX9A 4NN3A 1NMUA 5AA2D 4GWWA 2HHMA 3KN3A 4LP2B 1MQJA 2B3BA 4ZEKA 3W9VA 2R71A 1M5CA 3Q29A 4YKKA 1SDXA 4YU0A 2F97A 1FBPA 4DI3D 2Y7WA 3VDFA 1DPPA 1IMAA 4OERA 4ZEFA 1Y20A 3G3HA 1B9JA 3MUQA 1EZOA 4K3FA 4ZEDA 4R6YA 4DXCA 4EF2A 4GBWA 2F3BA 2F35A 1LBYA 2F7BA 3EQ1A 3UA8A 2HAVA 4OQOA 3AXFA 2Y7RA 3O9PA 1NV2A 3DP4A 1KA1A 5FBPA 4JB7A 2V4CA 3T96B 4RA1A 5IZ3B 3IFAA 5LTCA 2Q8JA 1B0HA 4QFPA 1IMFA 1EZ9A 1LAHE 5DYHA 4ZEBA 4EDPA 3O66A 4BDQA 2PYYA 3UIFA 4TQUQ 3OMBA 5HM4B 5IZ3A 1XHYA 5FHOA 2HXWA 2VD3A 4KQPA 1URSA 4NF4B 5ICTA 4HE2A 2KR0A 2BJJX 2ZNTA 3S2VA 4WXJA 3VLWA 1FW0A 5AA1A 2VGQA 2F3DA 5JK4A 3BFUA 2OPEA 1MQHA 2I6EA 2Y5LA 3K01A 4PFWA 5KDTB 4O7IA 3TQWA 3MVYA 4NF4A 1N3WA 3N6UA 1GR2A 3K6VA 4HCYA 4C1UA 4OHNA 4OXVA 1DK4A 4OWDA 3N26A 4TOZA 3QUFA 5AA3A 1AH5A 2UVJA 4GWZA 4ESXA 4H8JA 1AL3A 2GQ1A 5CMCA 3D4CA 3M8UA 4U21A 4P1EA 2QS3A 2B4LA 4RK9A 4LQ5A 2OX3A 3QIMA 3PPQA 4OFOA 4F19A 1B6HA 1MXYA 2G93A 2Q88A 1LFGA 3KZGA 4QBAA 1VFEA 1SYIA 3E4RA 2ABHA 3PUXE 3U93A 4NMYA 4GRKA 4IB2A 3EKIA 1FPJA 2X7QA 3D1RA 1RDYA 1IUDA 4FATA 3K00A 4JWYA 5DEXB 4GL0A 3UP9A 3H6TA 3U94A 1VE4A 1IEJA 2Z8FA 1IZ1A 4NF8B 5FHNA 1QJMA 1JNFA 2PMSA 2NUVA 3FXBA 1Z7NE 4MX6A 3SERA 1PB7A 2G29A 4JSDA 4OZ9A 5DEXA 4PAKA 5I58B 2I4BA 3H6VA 4NF8A 1XT8A 2Y7IA 1MXZA 1NV3A 2PT1A 1TFAA 3EHTA 3PTYA 1USYE 4P3LA 4FIMA 5ET7A 4PFBA 2PFZA 3CG1A 4NTLA 2Z8EA 3G3FA 1MM6A 3G7WA 1EYIA 1P1WA 1NV1A 1MXXA 3RLFE 3FUZA 5I58A 3NOHA 5J16A 4KFQA 3VVEA 4IR8A 3ISPA 3LC8A 4N8GA 2UYEA 4H5FA 3CSBA 3RNNA 4C1TA 4H6DA 2KQZA 3DM0A 1Q35A 2PX1A 4XKQA 1QGXA 1B3GA 5AA2B 1N7WA 1B1XA 1RYXA 3RTWB 2HFBA 2WBBA 1H3DA 1YYZA 4PFIA 3KSXA 1NH8A 1SI0A 3MVWA 4QSDA 1B52A 5I56B 2FIEA 3H7MA 4KR5A 3ZKKA 4EUOA 1AIVA 2E1SA 2DE3A 3TAJA 2HEUA 5AA2A 2CMOA 1DMBA 1QUJA 4GQOA 3SEXA 4RPNA 3HHGA 1LGBC 2XD3A 1PBQA 1RDXA 1LB9A 4AB5A 3T9HB 3KOTA 5I57B 1Y4CA 1NI9A 1UIUA 3UN6A 4QFOA 1KWHA 2O1MA 4JVIA 5L8DA 3IJXB 4F2OA 5CC2A 1FBFA 1D9YA 4GD5A 1FPFA 1TXFA 4O3AA 1MQDA 4N13A 3FXRA 3VV5A 1NV6A 1JEVA 5I59B 1EU8A
chains in the Genus database with same CATH topology
5EQ9A 1LBZA 1FPEA 3LUZA 4PTKA 1EYJA 3KC1A 1IMDA 4PF8A 4PF6A 2ZZXA 4MMPA 2FHYA 2XXKA 1NUZA 4GWSA 2Y5KA 3W9WA 5ET5A 2XWVA 1SPIA 1D9QA 2F5XA 5I3SA 2QVUA 1IMEA 4FBPA 4OA4A 1RDZA 4PAFA 4PDHA 5T3JA 2MKZA 1FBCA 2P3NA 3B8BA 3A29A 2Q74A 3U65A 4GWYA 1IMCA 4AS4A 1VDWA 4M1VA 4NN3A 1FJ6A 1YZ0A 1XI6A 4GWWA 2HHMA 4PC9A 4MAGA 4MNCA 1LEVA 1G0IA 2FVZA 4PE3A 4OVQA 1FPIA 3W9VA 2VT5A 1CNQA 2Q8MA 1FBPA 4DI3D 2HZLA 1KZ8A 2WBDA 1IMAA 4YZZA 4QXDA 2JJKA 5I5PA 5I7IA 3BIHA 2FIXA 4GBWA 5J1DA 2F3BA 1FPKA 1LBYA 4PBHA 1BK4A 3KBZA 3T0JA 4N17A 4I40A 4XF5A 4HE1A 2WX9A 5ESYA 4HCWA 1K9ZA 1JP4A 4P56A 4PDDA 1YXIA 4N6DA 1NV2A 2L5VA 1KA1A 4O7MA 4X04A 5FBPA 4LN5A 5A5LA 2V4CA 5ET6A 1FBDA 5IZ3B 3IFAA 5LTCA 2XWOA 4NAPA 1FPLA 1NUYA 1IMFA 2HPGA 1FPBA 3GYYA 4MIJA 2QPQA 2FBPA 1LBWA 4OVTA 1NV4A 1NUWA 2WEFA 5IZ3A 3MYUA 4YICA 4HE2A 4MNPA 1LBXA 2KR0A 2DDKA 3BIGA 4MCOA 2DE2A 4P9KA 2F3DA 5JK4A 5DW8A 4HE0A 2Y5LA 1FSAA 4UABA 4O7IA 1FTAA 4X9TA 3MSTA 4GX4A 4KXPA 4HCYA 2CEYA 2VPNA 4N6KA 1DK4A 5LDZA 2ZZVA 1Q9DA 4GWZA 2VPOA 2BJIA 4PFRA 2GQ1A 4GX6A 4P1EA 3LV0A 3HFUA 2B4LA 2OX3A 4F19A 5F24A 2XWIA 4QBAA 1NUXA 2CZKA 1DBZA 4H46A 5ET8A 4G61A 1EYKA 3RPLB 3EKIA 1FPJA 2CZIA 1NV7A 3D1RA 1RDYA 3IFCA 1FPGA 1NV0A 5IGAA 4XEQA 4N91A 4NGUA 4PAIA 2HZKA 2PCRA 5IZ1A 4N15A 4DI4B 4I3YA 3E79A 3T1BA 3FXBA 3B50A 4MX6A 4JVCA 4HXVA 2Q9TA 4JVDA 2WYPA 2XWKA 3E78A 4PAKA 2OWZA 3ROJA 4NHBA 4NX1A 2PFYA 1FPDA 4OVPA 4N81A 4NG7A 4MNIA 1NV3A 4MHFA 5CM6A 3PTYA 4N4UA 4P3LA 4P1LA 4GBVA 5ET7A 4PFBA 2PFZA 4F18A 3SZPA 1FJ9A 1IMBA 4PETA 4OANA 1EYIA 2B4MA 1NV1A 3RYDA 1AWBA 4F1VA 3NOHA 5J16A 4PGNA 3KC0A 4IR8A 3ISPA 4N8GA 2CEXA 2KQZA 4MEVA 1QGXA 4AS5A 2QVRA 2XA5A 2QFLA 1G0HA 1FBHA 2WBBA 4O94A 1YYZA 4PFIA 4PGPA 5EQAA 4GWUA 1FBEA 2HXRA 1LBVA 2QVVA 4NF0A 2CZHA 2V3QA 2FIEA 4I3EA 1DCUA 1FBGA 4PCDA 4OVSA 2DE3A 3FBPA 5EYGA 2WYKA 1INPA 4H45A 4P47A 4XFEA 4F1UA 4GWXA 2ZZWA 1FRPA 3QMFA 4P8BA 1RDXA 4O8MA 4PBQA 1NI9A 4OVRA 4N8YA 3CHGA 4X8RA 1KA0A 4JVIA 4GX3A 5EQ7A 1FBFA 2R8TA 5EYHA 4NQ8A 1FPFA 2P3VA 4MJOA 5IM2A 5IZZA 5EQ8A 1K9YA 1NV6A 3RPLA 2DE4A 1NV5A 2DVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBV A;  5ET7 A;  3KBZ A;  1Q9D A;  1LBZ A;  5EQ9 A;  4GWZ A;  3T0J A;  1FPE A;  4I40 A;  4HE1 A;  2BJI A;  5ESY A;  1K9Z A;  1JP4 A;  1FJ9 A;  1IMB A;  2GQ1 A;  1YXI A;  1NV2 A;  4GX6 A;  1EYI A;  1NV1 A;  3LV0 A;  1KA1 A;  3LUZ A;  1EYJ A;  4PTK A;  3RYD A;  3KC1 A;  1AWB A;  1IMD A;  5FBP A;  5A5L A;  2OX3 A;  5J16 A;  5ET6 A;  3KC0 A;  4IR8 A;  2FHY A;  1FBD A;  5IZ3 B;  3IFA A;  1NUZ A;  4GWS A;  2Y5K A;  5ET5 A;  1SPI A;  1D9Q A;  5F24 A;  1FPL A;  1NUY A;  1IMF A;  5I3S A;  2QVU A;  1QGX A;  4AS5 A;  1IME A;  1FPB A;  4FBP A;  2QVR A;  1RDZ A;  1NUX A;  2QFL A;  2CZK A;  5T3J A;  1DBZ A;  4H46 A;  2FBP A;  1LBW A;  1G0H A;  1FBH A;  2WBB A;  5ET8 A;  1FBC A;  4G61 A;  1EYK A;  1YYZ A;  2P3N A;  3RPL B;  5EQA A;  3B8B A;  1NV4 A;  4GWU A;  1FPJ A;  1NUW A;  1FBE A;  2CZI A;  3A29 A;  2WEF A;  1LBV A;  1NV7 A;  2Q74 A;  1RDY A;  2QVV A;  3D1R A;  1FPG A;  3IFC A;  4GWY A;  2CZH A;  5IZ3 A;  1IMC A;  1NV0 A;  2FIE A;  4AS4 A;  4I3E A;  1DCU A;  1VDW A;  1FBG A;  1FJ6 A;  1YZ0 A;  1XI6 A;  3FBP A;  2HHM A;  4GWW A;  5EYG A;  2PCR A;  5IZ1 A;  4HE2 A;  1LEV A;  1INP A;  1LBX A;  4H45 A;  1G0I A;  4GWX A;  2FVZ A;  2DDK A;  1FRP A;  3BIG A;  4I3Y A;  3QMF A;  2F3D A;  1FPI A;  5DW8 A;  2VT5 A;  1CNQ A;  1RDX A;  2Q8M A;  1NI9 A;  4HE0 A;  4HXV A;  2Y5L A;  1FSA A;  1KA0 A;  1FBP A;  4GX3 A;  1KZ8 A;  5EQ7 A;  1FBF A;  2R8T A;  4O7I A;  2OWZ A;  1FTA A;  2WBD A;  1IMA A;  5EYH A;  3ROJ A;  1FPF A;  2P3V A;  4QXD A;  4MJO A;  2JJK A;  4GX4 A;  4KXP A;  5EQ8 A;  1FPD A;  1K9Y A;  4N81 A;  3BIH A;  2FIX A;  4GBW A;  1DK4 A;  2F3B A;  1NV3 A;  1NV6 A;  3RPL A;  1FPK A;  1LBY A;  1NV5 A;  5LDZ A;  1BK4 A; 
#chains in the Genus database with same CATH topology
 3MZ1 A;  3CFL A;  5I57 A;  1LBZ A;  4ZE8 A;  1FPE A;  4BDR A;  4GXA A;  5AA4 B;  3HO7 A;  2F6P A;  3IJO B;  4MLV A;  4R9F A;  3KC1 A;  5I2N B;  4F29 A;  1XVY A;  3JYR A;  3A3U A;  3BFT A;  4GWS A;  3E3K A;  2GHB A;  3W9W A;  3KBR A;  3OXN A;  1D9Q A;  5I59 A;  2F5X A;  4KI0 E;  2RKM A;  5I3S A;  4LON B;  3SEU A;  2QL3 A;  4OA4 A;  3FGS A;  5B7D A;  1B0L A;  2H99 A;  5T3J A;  3IK6 B;  2MKZ A;  3LUY A;  3MPL A;  1FBC A;  3B8B A;  5I2N A;  3A29 A;  4XTC Q;  4GWY A;  1IMC A;  4ZZA A;  1Y3P A;  1FTK A;  3R26 A;  3C33 A;  1FJ6 A;  1BLF A;  5TPA B;  4GVO A;  3IOU A;  4PC9 A;  3PV0 E;  4MAG A;  2O7U A;  1N3X A;  1LEV A;  2O68 A;  1G0I A;  3LBS A;  4OVQ A;  1FPI A;  1SVX B;  2RC9 A;  3SES A;  2V3T A;  3E9X A;  4G8M A;  4YMB A;  1MXW A;  4F3S A;  2V93 A;  2HZL A;  3PGF A;  2O1L A;  1D9V A;  5TPA A;  2ZNS A;  2WBD A;  2R9J A;  3S9L C;  1M5B A;  3FV2 A;  2JJK A;  4NF5 B;  2XXY A;  4N07 A;  2Z8D A;  3VFJ A;  5J1D A;  1OVB A;  4R75 A;  3TMG A;  3K1P A;  3PPP A;  4PBH A;  3KBZ A;  2CZL A;  4JSO A;  2WX9 A;  3C35 A;  1JP4 A;  3MAM A;  4P56 A;  4PDD A;  2DXY A;  1YXI A;  2I48 A;  3MPK A;  2XXR A;  5A5L A;  3IO6 A;  5ET6 A;  1QVS A;  4NF5 A;  1B5J A;  1MQG A;  5CI5 A;  2PVU A;  3RPW A;  4KCD A;  4MH5 A;  4NAP A;  2DYX A;  1FPL A;  3V8X B;  3M3K A;  4G4P A;  5DVJ A;  2H4I A;  2F7C A;  3VE1 B;  1NL5 A;  3EF7 A;  1N76 A;  3T9X B;  1LBW A;  2IA4 A;  4AQ4 A;  3O28 A;  1UTH A;  3ILT B;  4OVT A;  3K1N A;  4G8H A;  3MQ9 A;  1YCJ A;  2Y7P A;  1OLC A;  1USY H;  4Q0C A;  4H5G A;  2WEF A;  4YIC A;  3C32 A;  1IIT A;  4UAC A;  4MNP A;  1LBX A;  3HPI A;  1LAG E;  4PE5 B;  4RY1 A;  4MCO A;  1ZBM A;  3SEY A;  1MY1 A;  2GFE A;  3Q28 A;  4ESW A;  4HE0 A;  1H45 A;  2QS4 A;  1FSA A;  4C0R A;  2X7P A;  4ELP A;  1YAE A;  3IAZ A;  4GX4 A;  1IXH A;  3T9V A;  2CEY A;  2XX7 A;  3HN0 A;  2ZNU A;  2VHA A;  4OET A;  3FV1 A;  3N5L A;  3PD9 A;  3I6V A;  2F6G A;  1Q9D A;  2RC7 A;  1FQF A;  3HST A;  2BJI A;  4F3B A;  4I1D A;  4PFR A;  4E0X A;  1ZLQ A;  4GX6 A;  4JXI A;  1GTK A;  3LV0 A;  3HFU A;  4U1O A;  1R1N A;  5JEI A;  3UOR A;  4LAT A;  1PDA A;  3LSL A;  4NWD A;  5CMM A;  2KLF A;  2H25 A;  4EQ7 A;  4ND9 A;  4QHQ A;  1D4N A;  2Z22 A;  3TUS A;  1S9T A;  4HTG A;  1SW1 A;  1NUX A;  1DBZ A;  4H46 A;  2PBW A;  5H8N B;  4OYV A;  3IO4 A;  1FQE A;  3RPL B;  4R6H A;  2REJ A;  3OD7 A;  3K02 A;  4M4G A;  2DP8 A;  2DWI A;  4N6P A;  3PPN A;  4YMA A;  4PAI A;  4DZ1 A;  1HSL A;  1NKX A;  1WOD A;  4KCC A;  3S9N C;  4N15 A;  2OLB A;  5H8N A;  2QMX A;  1AMF A;  3BBR A;  4GFR A;  3TYH A;  4JVC A;  4MF3 A;  3USD A;  1N04 A;  3MZ9 A;  1UTB B;  1AOV A;  4X1D A;  4UA8 A;  2XHD A;  1SD3 A;  4POW A;  4NHB A;  1GV8 A;  1B3H A;  2QS1 A;  1FPD A;  1PBP A;  4L17 A;  4N81 A;  2V25 A;  4JWO A;  4NG7 A;  5CM6 A;  4LVQ A;  3QYT A;  3KJ7 A;  3OO7 A;  3S4U A;  4IO4 A;  2XXQ A;  3MVX A;  1OVT A;  4PET A;  5ICQ A;  2NOO A;  3TEL A;  4R74 A;  3TDJ A;  3TCH A;  1UTB A;  3T93 B;  1O7T A;  1CB6 A;  4LZ7 A;  2YLN A;  3O97 A;  4MEV A;  3GXA A;  1JVX A;  4O3C A;  5KDT A;  1FBH A;  3E13 X;  4HS7 A;  4RNS A;  2QSX A;  1QUI A;  1B46 A;  4PGP A;  4XKN A;  1XC1 A;  1ZTY A;  1L5T A;  2HXR A;  4NF0 A;  4EQB A;  4BDN A;  5IAI A;  1DCU A;  1MDP 1;  1FBG A;  2Q2A A;  1NNT A;  1MPD A;  4PCD A;  4I8C A;  1MM7 A;  3TPA A;  5CMB A;  2WYK A;  4H45 A;  3M3F A;  4WKM A;  2ZZW A;  4LZ8 A;  2ONR A;  1B4Z A;  2IEE A;  4P8B A;  2D21 A;  4JWX A;  4ISU A;  4N8Y A;  3TCG A;  1QKB A;  1A54 A;  1HSE A;  1B7H A;  4LQ2 A;  1P99 A;  3OEM A;  3C9H A;  4NQ8 A;  3VVF A;  4MJO A;  4PFY A;  1D3K A;  4KHZ E;  1LST A;  4TLL B;  2DE4 A;  1LFH A;  4RK2 A;  1H76 A;  1I6Q A;  2DVC A;  1LBC A;  3S9M C;  2I0C A;  1YTV A;  3FIR A;  2DWA A;  3IX1 A;  1B7U A;  2VD2 A;  4PF6 A;  5CMK A;  2ZZX A;  4PP0 A;  1RKM A;  2XXK A;  3GBA A;  3ODB A;  3H4Z A;  1B3E A;  3TZA A;  3C34 A;  3LSW A;  2D3I A;  4LA9 A;  4RPO A;  1IME A;  3K2D A;  1H43 A;  4PAF A;  3K0V A;  2P3N A;  3PUY E;  4H0W A;  4PFT A;  1JQF A;  1OLA A;  4GWO A;  4ZS9 A;  4ELQ A;  5IKB A;  4M1V A;  3L6G A;  2YPN A;  3OOA A;  1YZ0 A;  1XI6 A;  3K6X A;  4YB5 A;  4MNC A;  2H9B A;  2XXW A;  3PPO A;  2FVZ A;  3IB1 A;  4G68 B;  4PE3 A;  4U2R A;  2ZYM A;  4I62 A;  4DCY A;  1WDN A;  4P0G A;  1CNQ A;  1S7Y A;  2Y84 A;  2DS9 A;  3VLU A;  2I3W A;  2HCA A;  3FXQ A;  3TTN A;  1KZ8 A;  2UVI A;  4RYA A;  1IXI A;  5FTH A;  4BDO A;  1POY 1;  3MJN A;  5I5P A;  5I7I A;  1B3L A;  4H1X A;  1Y1Z A;  4G68 A;  5DVI A;  4BDL A;  2FIX A;  1FPK A;  4YKI A;  2XXP A;  4EXK A;  1BK4 A;  2YJP A;  4N17 A;  5I56 A;  4XF5 A;  5ISU A;  1Z7M E;  5ESY A;  1K9Z A;  2ESN A;  3U8Q A;  1SW4 A;  2OJT A;  2UVH A;  2REG A;  2F8D A;  1YPN A;  1MRP A;  1VFD A;  2Q89 A;  4X04 A;  2OCU A;  5TP9 B;  2H98 A;  1Y3N A;  3HV1 A;  5L9O A;  5K2X A;  3V83 A;  1NUY A;  1NFT A;  3DLN A;  1R9Q A;  4E0W A;  2HPG A;  1FPB A;  1A8E A;  4PQJ A;  4G2Z A;  3C4M A;  3GZG A;  3V5A A;  1DSN A;  1N84 A;  5KZT A;  4P11 A;  1MPC A;  1A99 A;  4JDF A;  5KCJ B;  3PUW E;  3O2A A;  5AE4 A;  2A5T B;  5TP9 A;  3IL1 B;  4LZ5 A;  1B1H A;  2NWJ A;  5LOM A;  1QUL A;  5H8H B;  2DQV A;  1T0K A;  2GHA A;  3QXM A;  4YB7 A;  5AA4 A;  4GIZ A;  1PEB A;  3Q27 A;  3WAE A;  2I4C A;  5ITO A;  1ATG A;  3DP6 A;  2ANJ A;  5I84 A;  4MBP A;  1XOC A;  3WAF A;  3FXU A;  3LSF B;  1B40 A;  2B65 A;  1LCF A;  1JW4 A;  3RGY A;  3O6I A;  1MS7 A;  5H8H A;  1Q1K A;  4XIG Q;  1FTA A;  4F39 A;  4F22 A;  4OTE A;  1J1N A;  4KXP A;  2VPN A;  3P7I A;  1Y9U A;  1JEU A;  3L6H A;  2ZZV A;  1P1Q A;  1JW1 A;  4JBZ A;  4Q8R A;  4NF6 B;  3OEK A;  3LSX A;  2VPO A;  3CFZ A;  2W7Y A;  4QFK A;  2FNC A;  4NWC A;  1DOT A;  5EYF A;  2XD2 A;  3OO6 A;  3RTF B;  3OEN A;  5F24 A;  2RCA A;  2XWI A;  3KSJ A;  4NF6 A;  1URD A;  3H06 B;  2HAU A;  1Y4T A;  2CZK A;  4ONY A;  5JTY B;  2I49 A;  5DVF A;  4ELO A;  4FE8 A;  1MY2 A;  1S50 A;  1SI1 A;  3G3K A;  4MFI A;  3H3G A;  1IIW A;  5HBC A;  3G3I A;  5F1Q A;  1FPG A;  1NH7 A;  5IGA A;  2ONK E;  3VVD A;  3TFL A;  3QAX A;  4NGU A;  2HZK A;  5A5X B;  2PCR A;  2Z23 A;  4I3Y A;  5JTY A;  3UGW A;  4Q30 B;  5F7V A;  1MPB A;  3B50 A;  5DTB A;  1MY3 A;  2X26 A;  3U72 A;  2Q9T A;  3O6H A;  3C31 A;  3TTL A;  5K2Y A;  3TKD A;  1FQD A;  2XWK A;  3IOW A;  4TLM B;  5TU0 A;  3MZB A;  2OWZ A;  3W15 C;  1B4H A;  5A5X A;  3FD3 A;  4NX1 A;  1B7Z A;  3HHF A;  1TWY A;  2ONS A;  2OK2 A;  4MHF A;  4N4U A;  4P1L A;  4GBV A;  3GLB A;  3KEI A;  3ILU B;  1ZKB A;  3SKP A;  3EPE A;  4X48 A;  4ZDM A;  2RC8 A;  3A3C A;  3R7X A;  3MP6 A;  3SZP A;  3Q26 A;  1IMB A;  1B3F A;  1M5F A;  2B4M A;  1PB9 A;  3RYD A;  2O7I A;  2ZYO A;  4OMB A;  2I0B A;  3BKI B;  4KPT A;  4LUB A;  1BKA A;  1XS5 A;  4NE4 A;  1WVJ A;  4YAH X;  2QMW A;  3PMW A;  2QVR A;  4ECF A;  5I2K B;  2QFL A;  5ITP A;  4O3B A;  1BP5 A;  1US5 A;  3VXB A;  3Q25 A;  3K6U A;  5EQA A;  3OO9 A;  4GWU A;  2ALU A;  2LAO A;  3GBB A;  3KFM A;  2OPD A;  4OVS A;  1BTJ A;  1URG A;  1SW5 A;  5EYG A;  2QRY A;  3OEL A;  4IO7 A;  4P47 A;  4F1U A;  4GWX A;  5I2K A;  1FTM A;  1OIB A;  3HCQ A;  3N6T A;  2ZXT A;  2NVU B;  4O8M A;  1ZJL A;  4DIG A;  1I6B A;  4KD5 A;  4FEB A;  2D5W A;  1HSJ A;  1KA0 A;  1MDQ A;  4GX3 A;  3JZJ A;  2R8T A;  1OQG A;  3F11 A;  3T22 A;  1QKA A;  5FTI A;  3KOS A;  4EQ9 A;  5IM2 A;  5IZZ A;  4F1Y A;  2Q2C A;  3B6T A;  1K9Y A;  2I3V A;  2OZZ A;  4GF8 A;  2A5S A;  4ZZE A;  4YKJ A;  3RPL A;  4H65 A;  1US4 A;  4IO2 A;  5EQ9 A;  1MQI A;  2AL4 A;  4U23 A;  4GOT A;  3K6W A;  1FQA A;  1Y3Q A;  3CVG A;  1I6A A;  3IOT A;  2DSF A;  2QS2 A;  3V89 B;  3LUZ A;  1GVC A;  1IMD A;  4PF8 A;  1DPE A;  4MMP A;  3RN8 A;  2R6G E;  1SQY A;  1NUZ A;  1LLS A;  2Y5K A;  1SPI A;  1EH3 A;  1FQC A;  2AL5 A;  2UXA A;  4R9G A;  3PMX A;  2QVU A;  4OVJ A;  4FBP A;  4QRZ A;  5CBS A;  4KYD A;  4IY5 A;  3H6U A;  3I5O A;  3KGC A;  4OEU A;  4DXB A;  3QK6 A;  1P1N A;  1POT A;  2Q74 A;  3U65 A;  1JET A;  1VDW A;  2ZMB A;  2O69 A;  3CG3 A;  1B5I A;  4ZEC A;  2DWH A;  3T66 A;  1PC3 A;  1MY0 A;  5EHS A;  5BWJ A;  3KN8 A;  2VT5 A;  1FTJ A;  5H8S A;  2O51 A;  2Q8M A;  4BLA A;  3FJM A;  5BUU A;  4Q5T A;  2UYF A;  3T9U A;  4R73 A;  4YZZ A;  1II5 A;  2V3U A;  4H67 A;  4QXD A;  4GLI A;  5FHM A;  1TFD A;  4Z0I A;  3LR1 A;  1R6Z A;  3BIH A;  4POX A;  4U1Z A;  4IO3 A;  1B32 A;  3T0J A;  4I40 A;  4HE1 A;  1Y1M A;  4HCW A;  3IOV A;  4HW8 A;  2AYS A;  1PB8 A;  1A7L A;  4N6D A;  1M5D A;  2L5V A;  4R72 A;  4O7M A;  4LN5 A;  1ZU0 A;  3N94 A;  1FBD A;  1MH3 A;  3H6W A;  1NNP A;  3H03 A;  3S9E A;  2XWO A;  2XXU A;  1VSO A;  1MG1 A;  3GYY A;  3PMV A;  4MIJ A;  2UVG A;  2QPQ A;  3RUM A;  3VLV A;  2FBP A;  3G3G A;  1LFI A;  4RJZ A;  4QSC A;  2QJE A;  1NV4 A;  1NUW A;  2P0S A;  2XXX A;  4GXS B;  3MYU A;  1UIV A;  2O84 X;  1H44 A;  5L9M A;  4R2F A;  3ZSF A;  2M8C A;  3DP8 A;  4AB6 A;  2DDK A;  3BIG A;  1B5H A;  2DE2 A;  4FJP A;  4P9K A;  4FEC A;  1OMP A;  5DW8 A;  4OFL A;  1FTO A;  4OES A;  4UAB A;  1IQ7 A;  1LBB A;  3CRB A;  1N0T A;  4IO5 A;  3TCF A;  1SW2 A;  3PPR A;  3O29 A;  2ZYN A;  4X9T A;  3MST A;  4KYE A;  5H8F B;  3TTM A;  1LCT A;  4N6K A;  4XKP A;  3THI A;  4F3P A;  3JV9 A;  5LDZ A;  1MY4 A;  2OBG A;  1ELJ A;  3O6G A;  2FYI A;  2RIN A;  5M2V A;  2B3F A;  3MP1 A;  4U4X A;  3PUZ E;  2HQ0 A;  1A8F A;  1QW0 A;  1O64 A;  3QUJ A;  4EF1 A;  4KYS A;  5H8F A;  2V84 A;  2O6A A;  4ZEI A;  4ELR A;  5L9S A;  4XXU A;  1F9B A;  2DXR A;  1CE2 A;  2Y7K A;  3MC2 A;  3TEP A;  3MBP A;  3TTR A;  3MVZ A;  5ET8 A;  4G61 A;  1EYK A;  3CFX A;  4R2B A;  2VP1 A;  2E0S A;  2CZI A;  1NV7 A;  3IFC A;  4OFJ A;  4WED A;  3QSL A;  1I69 A;  2OWS A;  1NV0 A;  4XEQ A;  1JVY A;  3FJ7 A;  4N91 A;  3DEL B;  3KG2 A;  3CR9 A;  2RCB A;  3ONM A;  5IZ1 A;  3OSR A;  3EN3 A;  4DI4 B;  5CRY A;  3E79 A;  1B58 A;  2I58 A;  1MXU A;  3SEW A;  3T1B A;  1M5E A;  1XVX A;  4HXV A;  4JVD A;  1P1O A;  2WKY A;  4NED A;  1ZIU A;  2WYP A;  1SBP A;  4XKR A;  2XXT A;  3E78 A;  4DCX A;  2ZYK A;  3ROJ A;  4IO6 A;  3A09 A;  3EHS A;  1BIY A;  3FJG A;  1MXV A;  1NNF A;  2PFY A;  2AIX A;  4OVP A;  3FVG A;  4MNI A;  3TOD A;  2XXI A;  1O63 A;  5KCJ A;  1DTZ A;  4F3G A;  4OEN A;  4U22 A;  1FCK A;  2A5T A;  4G8N A;  1A40 A;  4DLD A;  4F31 B;  4BDM A;  1A55 A;  1LB8 A;  4F18 A;  4H8I A;  1FJ9 A;  4OAN A;  4OEV A;  1RYO A;  4GL8 A;  4RXL A;  4THI A;  2XX8 A;  1VR5 A;  3RT6 B;  1AWB A;  4F1V A;  4PGN A;  3KC0 A;  4IY6 A;  3SEV A;  2CEX A;  3TTK A;  4QFN A;  3U92 A;  5CBR A;  3K4U A;  4MLQ A;  1B05 A;  1ZMG A;  4QSE A;  1EZP A;  4DE8 A;  3FVK A;  4Z7E A;  4AS5 A;  3UK4 A;  4U4S A;  2XA5 A;  3RY3 A;  2F7A A;  2PT2 A;  1G0H A;  4O94 A;  2FA7 A;  3OSQ A;  4F2Q A;  4WEP A;  3FVO A;  3PD8 A;  4QF9 A;  1FBE A;  4X1B A;  3M3L A;  1LBV A;  2QVV A;  3ECR A;  2CZH A;  2V3Q A;  4I3E A;  3VXC A;  5H8Q B;  1B2H A;  3PUV E;  3I3V A;  1GGG A;  3B6W A;  4R6K A;  2XXV A;  3FBP A;  3OO8 A;  5B70 A;  3ZS6 A;  1INP A;  3CI8 A;  3G3J A;  3IOR A;  4XFE A;  2OWT A;  3KN7 A;  1FRP A;  4FOR A;  3QMF A;  3RQT A;  1MH4 A;  2DOJ A;  4PBQ A;  2XXH A;  4OVR A;  3R6U A;  1ANF A;  3CHG A;  3U1O A;  2P1S A;  4X8R A;  3K1M A;  1IXG A;  3MWB A;  2F78 A;  5H8Q A;  5EQ7 A;  1FTL A;  1LAF E;  3MP8 A;  1UTH B;  5EYH A;  4G77 A;  3TQL A;  2P3V A;  4DDD A;  5EQ8 A;  1B51 A;  3RT8 A;  3EHU A;  4YB6 A;  2NXO A;  4G68 C;  1QUK A;  3CIJ A;  1R9L A;  1NV5 A;  4PFU A;  2DVZ A;  1IXC A;  4YKP A;  2P2A A;  4IGT A;  2F36 A;  1NNK A;  3D4G A;  4ZE9 A;  2VOZ A;  5DT6 A;  2GRV A;  4P0I A;  1P1U A;  3FAT A;  4PTK A;  1EYJ A;  2GH9 A;  2DWJ A;  3PU5 A;  2H5Y A;  5HPQ A;  3FAS A;  2FHY A;  3B7D A;  1FQB A;  4IGR A;  3SET A;  3KJT A;  5ET5 A;  2XWV A;  3CSG A;  3IB0 A;  5EHM A;  5ELV A;  3B6Q A;  4QFL A;  3MW0 A;  1OQH A;  2RF1 A;  1RDZ A;  3C36 A;  4PDH A;  4I9D A;  1DTG A;  4DXU A;  3FZV A;  1LAX A;  2F34 A;  1SYH A;  3SDF A;  1JW5 A;  1TT1 A;  1N7X A;  3IR1 A;  4FAJ A;  2THI A;  4FED A;  3IB2 A;  4EXL A;  3ZKL A;  1UQW A;  4AS4 A;  3FVN A;  2XX9 A;  4NN3 A;  1NMU A;  5AA2 D;  4GWW A;  2HHM A;  3KN3 A;  4LP2 B;  1MQJ A;  2B3B A;  4ZEK A;  3W9V A;  2R71 A;  1M5C A;  3Q29 A;  4YKK A;  1SDX A;  4YU0 A;  2F97 A;  1FBP A;  4DI3 D;  2Y7W A;  3VDF A;  1DPP A;  1IMA A;  4OER A;  4ZEF A;  1Y20 A;  3G3H A;  1B9J A;  3MUQ A;  1EZO A;  4K3F A;  4ZED A;  4R6Y A;  4DXC A;  4EF2 A;  4GBW A;  2F3B A;  2F35 A;  1LBY A;  2F7B A;  3EQ1 A;  3UA8 A;  2HAV A;  4OQO A;  3AXF A;  2Y7R A;  3O9P A;  1NV2 A;  3DP4 A;  1KA1 A;  5FBP A;  4JB7 A;  2V4C A;  3T96 B;  4RA1 A;  5IZ3 B;  3IFA A;  5LTC A;  2Q8J A;  1B0H A;  4QFP A;  1IMF A;  1EZ9 A;  1LAH E;  5DYH A;  4ZEB A;  4EDP A;  3O66 A;  4BDQ A;  2PYY A;  3UIF A;  4TQU Q;  3OMB A;  5HM4 B;  5IZ3 A;  1XHY A;  5FHO A;  2HXW A;  2VD3 A;  4KQP A;  1URS A;  4NF4 B;  5ICT A;  4HE2 A;  2KR0 A;  2BJJ X;  2ZNT A;  3S2V A;  4WXJ A;  3VLW A;  1FW0 A;  5AA1 A;  2VGQ A;  2F3D A;  5JK4 A;  3BFU A;  2OPE A;  1MQH A;  2I6E A;  2Y5L A;  3K01 A;  4PFW A;  5KDT B;  4O7I A;  3TQW A;  3MVY A;  4NF4 A;  1N3W A;  3N6U A;  1GR2 A;  3K6V A;  4HCY A;  4C1U A;  4OHN A;  4OXV A;  1DK4 A;  4OWD A;  3N26 A;  4TOZ A;  3QUF A;  5AA3 A;  1AH5 A;  2UVJ A;  4GWZ A;  4ESX A;  4H8J A;  1AL3 A;  2GQ1 A;  5CMC A;  3D4C A;  3M8U A;  4U21 A;  4P1E A;  2QS3 A;  2B4L A;  4RK9 A;  4LQ5 A;  2OX3 A;  3QIM A;  3PPQ A;  4OFO A;  4F19 A;  1B6H A;  1MXY A;  2G93 A;  2Q88 A;  1LFG A;  3KZG A;  4QBA A;  1VFE A;  1SYI A;  3E4R A;  2ABH A;  3PUX E;  3U93 A;  4NMY A;  4GRK A;  4IB2 A;  3EKI A;  1FPJ A;  2X7Q A;  3D1R A;  1RDY A;  1IUD A;  4FAT A;  3K00 A;  4JWY A;  5DEX B;  4GL0 A;  3UP9 A;  3H6T A;  3U94 A;  1VE4 A;  1IEJ A;  2Z8F A;  1IZ1 A;  4NF8 B;  5FHN A;  1QJM A;  1JNF A;  2PMS A;  2NUV A;  3FXB A;  1Z7N E;  4MX6 A;  3SER A;  1PB7 A;  2G29 A;  4JSD A;  4OZ9 A;  5DEX A;  4PAK A;  5I58 B;  2I4B A;  3H6V A;  4NF8 A;  1XT8 A;  2Y7I A;  1MXZ A;  1NV3 A;  2PT1 A;  1TFA A;  3EHT A;  3PTY A;  1USY E;  4P3L A;  4FIM A;  5ET7 A;  4PFB A;  2PFZ A;  3CG1 A;  4NTL A;  2Z8E A;  3G3F A;  1MM6 A;  3G7W A;  1EYI A;  1P1W A;  1NV1 A;  1MXX A;  3RLF E;  3FUZ A;  5I58 A;  3NOH A;  5J16 A;  4KFQ A;  3VVE A;  4IR8 A;  3ISP A;  3LC8 A;  4N8G A;  2UYE A;  4H5F A;  3CSB A;  3RNN A;  4C1T A;  4H6D A;  2KQZ A;  3DM0 A;  1Q35 A;  2PX1 A;  4XKQ A;  1QGX A;  1B3G A;  5AA2 B;  1N7W A;  1B1X A;  1RYX A;  3RTW B;  2HFB A;  2WBB A;  1H3D A;  1YYZ A;  4PFI A;  3KSX A;  1NH8 A;  1SI0 A;  3MVW A;  4QSD A;  1B52 A;  5I56 B;  2FIE A;  3H7M A;  4KR5 A;  3ZKK A;  4EUO A;  1AIV A;  2E1S A;  2DE3 A;  3TAJ A;  2HEU A;  5AA2 A;  2CMO A;  1DMB A;  1QUJ A;  4GQO A;  3SEX A;  4RPN A;  3HHG A;  1LGB C;  2XD3 A;  1PBQ A;  1RDX A;  1LB9 A;  4AB5 A;  3T9H B;  3KOT A;  5I57 B;  1Y4C A;  1NI9 A;  1UIU A;  3UN6 A;  4QFO A;  1KWH A;  2O1M A;  4JVI A;  5L8D A;  3IJX B;  4F2O A;  5CC2 A;  1FBF A;  1D9Y A;  4GD5 A;  1FPF A;  1TXF A;  4O3A A;  1MQD A;  4N13 A;  3FXR A;  3VV5 A;  1NV6 A;  1JEV A;  5I59 B;  1EU8 A; 
#chains in the Genus database with same CATH homology
 5EQ9 A;  1LBZ A;  1FPE A;  3LUZ A;  4PTK A;  1EYJ A;  3KC1 A;  1IMD A;  4PF8 A;  4PF6 A;  2ZZX A;  4MMP A;  2FHY A;  2XXK A;  1NUZ A;  4GWS A;  2Y5K A;  3W9W A;  5ET5 A;  2XWV A;  1SPI A;  1D9Q A;  2F5X A;  5I3S A;  2QVU A;  1IME A;  4FBP A;  4OA4 A;  1RDZ A;  4PAF A;  4PDH A;  5T3J A;  2MKZ A;  1FBC A;  2P3N A;  3B8B A;  3A29 A;  2Q74 A;  3U65 A;  4GWY A;  1IMC A;  4AS4 A;  1VDW A;  4M1V A;  4NN3 A;  1FJ6 A;  1YZ0 A;  1XI6 A;  4GWW A;  2HHM A;  4PC9 A;  4MAG A;  4MNC A;  1LEV A;  1G0I A;  2FVZ A;  4PE3 A;  4OVQ A;  1FPI A;  3W9V A;  2VT5 A;  1CNQ A;  2Q8M A;  1FBP A;  4DI3 D;  2HZL A;  1KZ8 A;  2WBD A;  1IMA A;  4YZZ A;  4QXD A;  2JJK A;  5I5P A;  5I7I A;  3BIH A;  2FIX A;  4GBW A;  5J1D A;  2F3B A;  1FPK A;  1LBY A;  4PBH A;  1BK4 A;  3KBZ A;  3T0J A;  4N17 A;  4I40 A;  4XF5 A;  4HE1 A;  2WX9 A;  5ESY A;  4HCW A;  1K9Z A;  1JP4 A;  4P56 A;  4PDD A;  1YXI A;  4N6D A;  1NV2 A;  2L5V A;  1KA1 A;  4O7M A;  4X04 A;  5FBP A;  4LN5 A;  5A5L A;  2V4C A;  5ET6 A;  1FBD A;  5IZ3 B;  3IFA A;  5LTC A;  2XWO A;  4NAP A;  1FPL A;  1NUY A;  1IMF A;  2HPG A;  1FPB A;  3GYY A;  4MIJ A;  2QPQ A;  2FBP A;  1LBW A;  4OVT A;  1NV4 A;  1NUW A;  2WEF A;  5IZ3 A;  3MYU A;  4YIC A;  4HE2 A;  4MNP A;  1LBX A;  2KR0 A;  2DDK A;  3BIG A;  4MCO A;  2DE2 A;  4P9K A;  2F3D A;  5JK4 A;  5DW8 A;  4HE0 A;  2Y5L A;  1FSA A;  4UAB A;  4O7I A;  1FTA A;  4X9T A;  3MST A;  4GX4 A;  4KXP A;  4HCY A;  2CEY A;  2VPN A;  4N6K A;  1DK4 A;  5LDZ A;  2ZZV A;  1Q9D A;  4GWZ A;  2VPO A;  2BJI A;  4PFR A;  2GQ1 A;  4GX6 A;  4P1E A;  3LV0 A;  3HFU A;  2B4L A;  2OX3 A;  4F19 A;  5F24 A;  2XWI A;  4QBA A;  1NUX A;  2CZK A;  1DBZ A;  4H46 A;  5ET8 A;  4G61 A;  1EYK A;  3RPL B;  3EKI A;  1FPJ A;  2CZI A;  1NV7 A;  3D1R A;  1RDY A;  3IFC A;  1FPG A;  1NV0 A;  5IGA A;  4XEQ A;  4N91 A;  4NGU A;  4PAI A;  2HZK A;  2PCR A;  5IZ1 A;  4N15 A;  4DI4 B;  4I3Y A;  3E79 A;  3T1B A;  3FXB A;  3B50 A;  4MX6 A;  4JVC A;  4HXV A;  2Q9T A;  4JVD A;  2WYP A;  2XWK A;  3E78 A;  4PAK A;  2OWZ A;  3ROJ A;  4NHB A;  4NX1 A;  2PFY A;  1FPD A;  4OVP A;  4N81 A;  4NG7 A;  4MNI A;  1NV3 A;  4MHF A;  5CM6 A;  3PTY A;  4N4U A;  4P3L A;  4P1L A;  4GBV A;  5ET7 A;  4PFB A;  2PFZ A;  4F18 A;  3SZP A;  1FJ9 A;  1IMB A;  4PET A;  4OAN A;  1EYI A;  2B4M A;  1NV1 A;  3RYD A;  1AWB A;  4F1V A;  3NOH A;  5J16 A;  4PGN A;  3KC0 A;  4IR8 A;  3ISP A;  4N8G A;  2CEX A;  2KQZ A;  4MEV A;  1QGX A;  4AS5 A;  2QVR A;  2XA5 A;  2QFL A;  1G0H A;  1FBH A;  2WBB A;  4O94 A;  1YYZ A;  4PFI A;  4PGP A;  5EQA A;  4GWU A;  1FBE A;  2HXR A;  1LBV A;  2QVV A;  4NF0 A;  2CZH A;  2V3Q A;  2FIE A;  4I3E A;  1DCU A;  1FBG A;  4PCD A;  4OVS A;  2DE3 A;  3FBP A;  5EYG A;  2WYK A;  1INP A;  4H45 A;  4P47 A;  4XFE A;  4F1U A;  4GWX A;  2ZZW A;  1FRP A;  3QMF A;  4P8B A;  1RDX A;  4O8M A;  4PBQ A;  1NI9 A;  4OVR A;  4N8Y A;  3CHG A;  4X8R A;  1KA0 A;  4JVI A;  4GX3 A;  5EQ7 A;  1FBF A;  2R8T A;  5EYH A;  4NQ8 A;  1FPF A;  2P3V A;  4MJO A;  5IM2 A;  5IZZ A;  5EQ8 A;  1K9Y A;  1NV6 A;  3RPL A;  2DE4 A;  1NV5 A;  2DVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...