3BIGA

Crystal structure of the fructose-1,6-bisphosphatase glpx from e.coli in complex with inorganic phosphate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
324
structure length
321
Chain Sequence
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSTIRRIQSIHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Type II Fructose-1,6-bisphosphatase GlpX from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase class II glpX
total genus 113
structure length 321
sequence length 324
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3bigA01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3bigA02
5DW8A 5IZ3B 1YXIA 1FBCA 1EYKA 4HE0A 2Q8MA 1NUWA 5IZ3A 1JP4A 4MJOA 2FIXA 1XI6A 5F24A 4GWUA 1NV2A 1BK4A 1CNQA 2FVZA 4GWWA 1IMCA 3B8BA 1NV1A 4GBWA 5EQ8A 1EYIA 4HE2A 2FBPA 2QVRA 1NV4A 4KXPA 1DBZA 1IMAA 2VT5A 1NV5A 1FRPA 5FBPA 4FBPA 1FBPA 2F3BA 1FBEA 3A29A 1NUXA 1LBYA 4QXDA 1FPEA 1NV0A 1IMDA 1NUZA 4H45A 1KZ8A 2OX3A 4HXVA 2Q74A 5EQ9A 1DCUA 1DK4A 2Y5KA 4IR8A 4PTKA 5IZ1A 5ESYA 3LV0A 1NI9A 1RDYA 1QGXA 1FBFA 1SPIA 1YZ0A 4GX3A 1RDZA 2Y5LA 4I40A 2WBDA 1INPA 2FHYA 1AWBA 1FBDA 3BIHA 5ET8A 4H46A 4AS5A 1NV3A 3LUZA 1FBGA 2CZKA 3RPLA 2CZIA 5A5LA 2QFLA 3FBPA 5EQAA 1FPGA 2BJIA 2P3VA 5ET7A 1FPIA 2JJKA 2QVUA 1IMFA 2DDKA 3KC0A 1LEVA 1YYZA 1K9YA 3BIGA 4GX4A 1FPDA 4GWSA 1FPKA 1EYJA 4GX6A 4O7IA 3KC1A 4GWYA 2R8TA 1G0IA 3ROJA 1NUYA 2PCRA 3RYDA 1D9QA 1LBZA 1IMBA 2OWZA 2FIEA 5J16A 1FPBA 1FJ9A 2GQ1A 4HE1A 5EYHA 2P3NA 2WEFA 3RPLB 5ET5A 2WBBA 1FPLA 4GWXA 4AS4A 4GBVA 5LDZA 1FSAA 5EYGA 1FJ6A 1Q9DA 1IMEA 3KBZA 5EQ7A 1G0HA 1FBHA 1LBVA 1VDWA 1KA1A 4G61A 4I3YA 3T0JA 1KA0A 1FPJA 2CZHA 5ET6A 2HHMA 1FPFA 3IFCA 4N81A 1RDXA 2QVVA 3D1RA 3QMFA 1NV6A 4GWZA 4I3EA 5I3SA 1LBWA 1LBXA 1FTAA 2F3DA 1K9ZA 1NV7A 5T3JA 3IFAA
chains in the Genus database with same CATH superfamily
2FA7A 3CG1A 4F3PA 2CEXA 1NUWA 1Y3PA 1LGBC 1LAFE 3RN8A 4QF9A 4GWUA 3OO6A 4KD5A 4DI3D 4XIGQ 2O6AA 4NEDA 1NNKA 1Z7ME 1UTBB 2NUVA 1NV4A 2O51A 2ONRA 3MZ9A 4YB6A 1IMAA 4XFEA 2VOZA 4NWDA 4NHBA 3H4ZA 5JTYB 3TUSA 1B0LA 4G68C 4HXVA 4PTKA 1B7UA 4EXLA 4MLVA 2CZLA 3TAJA 1OMPA 1FTKA 3KG2A 3EHUA 3OO8A 4FEDA 4GIZA 1JQFA 3U72A 1USYH 2DXYA 2XXQA 3MPLA 2H25A 3RPLA 1POY1 1TFAA 2OPEA 3U92A 1WVJA 4AB6A 3VVFA 2F35A 4TOZA 3E13X 5ICTA 1FPKA 2UVGA 4N07A 2QJEA 4OFJA 1Y3NA 1SYHA 1NFTA 4FATA 1N04A 4HS7A 1G0HA 2XX7A 3MVXA 4IGRA 4G61A 4LZ7A 3OEMA 3HV1A 2WKYA 4DXBA 4H6DA 2VD3A 2RC7A 3PUXE 4OVTA 1MRPA 3C35A 2QMXA 4OVRA 3QMFA 3TDJA 3PUYE 5AA2D 1DTZA 3IFAA 2XXKA 1NNFA 1TT1A 3FXRA 3IO4A 1UTHB 5KCJB 3FUZA 4NF4A 2R6GE 5ITOA 3T1BA 1YAEA 1NV1A 3E79A 4FECA 4JBZA 4P1EA 3T93B 2B4LA 2ZZWA 4KXPA 3CRBA 3BFUA 3VVEA 1FBEA 3LR1A 3N26A 3KJTA 5DVFA 5CMBA 4MNIA 3K1NA 4GD5A 3FVKA 2PBWA 4MCOA 2QFLA 4X8RA 4DCYA 2YLNA 4GL0A 4JWXA 4GWSA 4HW8A 4YKPA 1EYJA 3K1MA 5CRYA 2F97A 4R73A 2DS9A 1MPCA 4U21A 4QFLA 4XKPA 4KYEA 2Y7KA 5EQ7A 2AIXA 3HO7A 1MQDA 3I5OA 2DWAA 5LOMA 4OHNA 3FVOA 1RDXA 4OETA 1Y4CA 4XKQA 5KDTB 4LA9A 2XXVA 3RQTA 1LBWA 4BLAA 3TELA 4Z7EA 2F36A 3S9EA 1K9ZA 3G3JA 4PP0A 1B2HA 3H6WA 3VV5A 5JEIA 1XC1A 2DYXA 1N84A 3FJ7A 1O64A 2QS1A 3HPIA 5AA2A 4X04A 1SQYA 1WODA 4GBWA 2F5XA 1MM6A 4MHFA 3HN0A 2RKMA 3PPRA 2DE2A 2I49A 1NUZA 5CMKA 5B70A 1R9QA 4OESA 4WEPA 3RT8A 1VE4A 4G8NA 4ELQA 1FBFA 3H3GA 1XHYA 2FHYA 3PUVE 2UVIA 2OLBA 1B3LA 4OWDA 2Z8FA 3PUZE 4HTGA 1FPIA 4H5FA 1B7ZA 1FQEA 2ZNUA 3ISPA 3LSXA 4JWOA 1M5BA 2GRVA 2P0SA 4QSCA 5L9SA 1A55A 5HBCA 1IMBA 1FJ9A 3KOSA 4N8YA 4IGTA 4H5GA 2V3QA 2WBBA 3I3VA 4AS4A 1LB9A 1LCTA 3N6UA 3K2DA 1NNTA 5EHSA 3O97A 2Z23A 2QMWA 4MAGA 4P9KA 1QUJA 2R9JA 3UK4A 4ZS9A 2CZHA 1H76A 1QKBA 3LSFB 1MQJA 4ONYA 4DXCA 4PQJA 2YPNA 3I6VA 3MPKA 4DDDA 4IO4A 5DEXB 2Q8MA 2ONSA 5IZ3B 2A5TB 4DIGA 4YMAA 3TEPA 4OERA 4ZZAA 3RY3A 3FZVA 2DE3A 4R6YA 1NV2A 4P0GA 3W9WA 3DLNA 4JXIA 1IMCA 5L9MA 3VFJA 1N7XA 2RC9A 1NMUA 4R6HA 4PAKA 4GQOA 2QVRA 3GYYA 1PB8A 4UA8A 1FRPA 3A29A 1GR2A 5F7VA 1HSEA 5CM6A 4KR5A 5H8FB 4F2OA 3QUJA 2GHAA 1DCUA 3TQWA 1B0HA 1EH3A 1QGXA 1NNPA 4GX3A 3USDA 1UTHA 1I6QA 3TKDA 3KN8A 1LB8A 3CFZA 4MEVA 2BJIA 4L17A 4OVSA 3IX1A 4FORA 1P1NA 4POXA 4OFOA 1FPDA 4O3AA 3K1PA 2KR0A 3KC1A 4U1ZA 1ZBMA 4QFNA 1CE2A 4PETA 1AOVA 4NTLA 2F7BA 3EHTA 4NF8B 4PFBA 1S7YA 3ZKLA 3MP8A 3U8QA 3EN3A 4GL8A 4NE4A 2D21A 3PUWE 4YMBA 4ZEIA 4I9DA 1I6AA 1FBHA 2OZZA 1LBVA 4M4GA 4PBHA 4WEDA 1IQ7A 1B52A 1H43A 1QW0A 4Q8RA 4ZEFA 1OLAA 4O3CA 4N81A 1TXFA 3FJMA 1J1NA 4U4XA 1XOCA 2DQVA 3QYTA 4LQ2A 1QULA 3IB2A 4YB5A 4YU0A 5H8QA 4EDPA 1MY2A 3IR1A 5A5XB 2VP1A 1USYE 3CVGA 2FIXA 3PMVA 4F1YA 3NOHA 2VHAA 4PAFA 5L8DA 3LUYA 3Q25A 4P1LA 1SYIA 3HCQA 3C9HA 3FXBA 3RUMA 4HE2A 1DPEA 5TP9A 3K6XA 4H8IA 1JEVA 3BBRA 4R74A 1SI1A 3SKPA 5TU0A 3IAZA 2O7IA 3PV0E 2VPOA 2DWHA 2DVZA 4DXUA 5I57A 1NI9A 1RDYA 2PT2A 5CMCA 1BKAA 4I40A 1N0TA 3GBBA 4I62A 3MJNA 1FBDA 5F1QA 1T0KA 1EU8A 1B4HA 3H03A 4RK2A 1MPBA 2ALUA 1FPGA 1A7LA 1P1QA 2QVUA 2H5YA 4GWOA 3BIGA 3ZS6A 1Y3QA 4JVCA 2XXUA 3O6HA 2R8TA 2QS4A 4KYDA 2PCRA 1XVXA 1MS7A 4ECFA 4MNCA 4MLQA 2WEFA 4C1TA 4Q30B 2UYEA 3IJOB 4R9GA 2QS3A 1O63A 5LTCA 4KPTA 4I8CA 3T0JA 3U94A 3SEVA 2PX1A 2O69A 3B6WA 1MDP1 1JW5A 1EYKA 4HE0A 1NKXA 2OCUA 4FE8A 5DVJA 3FVGA 2X7PA 4ESWA 2ABHA 4F2QA 1B7HA 3T9UA 4FIMA 2Z22A 1CNQA 2G29A 3HSTA 1OVBA 3RTFB 3N6TA 4K3FA 3E78A 1ZKBA 2I6EA 4H8JA 2XHDA 1NV5A 1ZIUA 3OMBA 3PPNA 1EZ9A 2UVHA 3IO6A 2Z8EA 1NV0A 3FXQA 1LBCA 1ZTYA 3OOAA 4POWA 2H9BA 4UABA 4U4SA 1MXZA 1IXCA 4PFRA 1D3KA 1MXVA 4NQ8A 4R2BA 3U93A 1JW4A 3FATA 4C0RA 3K00A 3V89B 2ZNTA 2DDKA 1IIWA 1MY1A 4WXJA 4LN5A 3MUQA 1NUYA 3OD7A 2HEUA 3FVNA 5I57B 2D5WA 1FSAA 1P99A 2B3FA 3OSRA 3N5LA 4RJZA 3MQ9A 3PMXA 3MSTA 5IAIA 5ET6A 1POTA 2BJJX 3UGWA 3MP1A 4PDDA 5FHMA 4OXVA 1NV6A 3A3UA 1GVCA 5I58B 1ELJA 4NN3A 1FCKA 3LSWA 3M8UA 1MXUA 2ZMBA 4OEVA 3B50A 4ELOA 4LUBA 1B3FA 1AL3A 2WX9A 3SETA 3KEIA 3D4GA 3S9MC 3QXMA 4X48A 2ONKE 5IKBA 2CEYA 1XT8A 3C4MA 2O1LA 1PC3A 3TYHA 5IGAA 2GHBA 5CMMA 4F19A 4TLMB 4OA4A 4EQ9A 2HAVA 4PAIA 1HSJA 2V84A 1IMDA 5I59B 1DK4A 4IR8A 5CBSA 1LFHA 1MH4A 3KFMA 3MZ1A 3PGFA 1OLCA 4F3BA 5ICQA 4R75A 3PTYA 5ET8A 5KDTA 4JVDA 3N94A 5EQAA 4EF2A 1LEVA 2PMSA 2HXRA 4GXAA 3T66A 3UP9A 2OPDA 4F31B 2KLFA 2ESNA 4O7MA 4OZ9A 2H99A 4Z0IA 1MQHA 1S9TA 4GXSB 4O94A 3K6WA 4RA1A 5DVIA 4N13A 1N3WA 3DP4A 5J1DA 2W7YA 5I2NA 1QVSA 4BDLA 4PGNA 1RYXA 1KA0A 2Y7IA 5AA4B 5BUUA 3LSLA 3V5AA 2XXRA 1DOTA 1B9JA 1BLFA 2PT1A 5H8FA 3KN3A 1VR5A 3A09A 2I0BA 1EZOA 5T3JA 5DW8A 2O1MA 1ZLQA 2GH9A 4M1VA 3F11A 1LAGE 3JZJA 2X7QA 3FXUA 2V3TA 3Q27A 4LZ8A 4KFQA 1IXIA 1JVXA 3MBPA 3GLBA 1B3EA 2MKZA 4PFIA 3S4UA 2ZYKA 3S9LC 1VSOA 1P1UA 3IK6B 4PBQA 3P7IA 2ANJA 3ILTB 4KHZE 1FQCA 3FV1A 5IZ1A 1MXWA 4N91A 2Q9TA 1O7TA 4PE3A 2V3UA 3V8XB 2WBDA 1B5JA 3TTMA 3SERA 4E0WA 3TZAA 4ISUA 2HZKA 3ODBA 1GV8A 5AA4A 2P3VA 2PVUA 5EYFA 3E9XA 1B58A 3MYUA 1FTLA 4OEUA 4BDRA 3ROJA 4N6PA 2OWZA 3QUFA 1FQBA 5J16A 1FPBA 4HE1A 3S2VA 1FPLA 4E0XA 2P2AA 1XS5A 3MVWA 3PU5A 3DP8A 4F39A 4G68A 1ZJLA 1PB7A 3M3LA 4LZ5A 1YPNA 1D9VA 3CG3A 1TFDA 3GXAA 5I3SA 4Q0CA 1LBXA 4BDQA 3R7XA 1VFDA 4OANA 2F3DA 1UIUA 1FQFA 1SW4A 2FNCA 1Y1ZA 3U65A 3B8BA 1M5CA 1DPPA 1B46A 1CB6A 3JYRA 4KYSA 4YZZA 3EKIA 3L6GA 4ZZEA 1DBZA 3H6VA 3TMGA 2WYPA 1FTOA 3TCGA 3QK6A 5I56A 1LBYA 4RYAA 5EQ9A 3TTLA 4X1BA 4P0IA 4KQPA 4OVJA 3TQLA 4P56A 4N4UA 4OYVA 1XVYA 1H3DA 3DM0A 2WYKA 3KZGA 3VE1B 2ZYOA 3TTRA 3IOUA 2DVCA 3TODA 4LONB 1BTJA 5H8NA 1II5A 4NAPA 1LBZA 2M8CA 4OFLA 3MAMA 3E4RA 1SW5A 2OK2A 3HHGA 4GBVA 4IY6A 4ZEBA 3M3KA 4F1UA 2Q88A 5EHMA 1FJ6A 1Q9DA 3KBZA 2B65A 4UACA 3VVDA 5AA3A 3RNNA 1KA1A 5M2VA 3T96B 1MG1A 4ELPA 1JETA 2Y7PA 1D4NA 1R1NA 3IFCA 1B5HA 1RKMA 2THIA 2ZXTA 4MMPA 1Y4TA 1Y9UA 3CSGA 1PEBA 2F6PA 5ITPA 4N6KA 5KZTA 5H8SA 4MF3A 1MY3A 1N7WA 3K6UA 4G8MA 4C1UA 4YKIA 2QSXA 2FVZA 4R2FA 5DT6A 1URDA 4AQ4A 1EYIA 3E3KA 5K2YA 1A40A 3W9VA 3DP6A 4FBPA 3B6TA 3UORA 2O84X 5TPAB 3O2AA 1Y1MA 2I3VA 5TPAA 2I58A 3RPWA 2Y5LA 4BDMA 2F6GA 3KBRA 3G3KA 4IO7A 4GRKA 5K2XA 3TTKA 4U22A 2AL5A 1Z7NE 4G4PA 1GGGA 1FBGA 4QSEA 2CZKA 2XXIA 3G3IA 2DE4A 3KSJA 5ET7A 4ZE9A 2F78A 4YKJA 3OO7A 2AYSA 3KOTA 3RYDA 1D9QA 3SEYA 3RLFE 2UYFA 1A99A 3GZGA 5I56B 1URSA 4ZEDA 4U1OA 5DYHA 5FHNA 2A5SA 1VDWA 3UA8A 2RCAA 4IO3A 4I3YA 4RXLA 1TWYA 3ILUB 1M5DA 4N17A 4X1DA 3SDFA 3CSBA 4JVIA 3SEUA 2OBGA 5AA2B 1MPDA 2NVUB 1UIVA 1B40A 2NWJA 3FASA 1FTAA 1LAHE 1SD3A 2Q8JA 4XKNA 1DSNA 4IO2A 1I69A 2HPGA 1YXIA 5H8NB 3ONMA 4NF8A 3G3HA 1JP4A 4MJOA 4YKKA 3ZKKA 1BK4A 1DTGA 3MVYA 5EQ8A 1LFGA 4G68B 5H8HB 4GF8A 4NF4B 4OTEA 3T22A 3VLVA 2VT5A 4H1XA 4IY5A 2DP8A 3MZBA 4RK9A 2F7CA 1FQDA 3RT6B 2B3BA 4EXKA 3LV0A 1B3HA 5FTHA 3PPOA 2XWIA 3TFLA 3MVZA 1F9BA 1SW2A 3CIJA 4PFUA 3BIHA 4QFKA 4H46A 1MY4A 3B6QA 4X9TA 3Q28A 1B6HA 4PGPA 4NF6B 3O28A 3WAFA 4MFIA 1Y20A 3AXFA 1G0IA 1MH3A 3IOVA 2H4IA 4OQOA 1AIVA 4JDFA 4LQ5A 3CFXA 2V93A 1MXYA 3G3GA 5I2NB 3FD3A 4P8BA 2G93A 2HCAA 4R72A 4GWXA 4QSDA 1IZ1A 4JWYA 1OIBA 2VD2A 1SI0A 2QL3A 4DI4B 3S9NC 5DTBA 5H8HA 2HFBA 4EQ7A 1MQGA 3PPPA 1JVYA 3VXBA 3UN6A 4LP2B 3KGCA 1I6BA 4RY1A 3FV2A 3EF7A 2E0SA 4OMBA 4KCDA 2RF1A 4U2RA 1A8FA 1Q1KA 1B32A 4QBAA 1PBPA 2Q2CA 2PFYA 1QUIA 4O3BA 4IO6A 4HCYA 3OO9A 4OENA 2LAOA 1LBBA 2DOJA 1FBPA 5FTIA 1B3GA 5BWJA 1NUXA 1MY0A 5IZZA 4NX1A 3A3CA 4EUOA 2Y7RA 1NH8A 4HCWA 2DSFA 2I4CA 2D3IA 5I7IA 1INPA 1NH7A 1AWBA 1NV3A 3G3FA 3BFTA 2UVJA 3JV9A 4OVPA 2HQ0A 1IMFA 3UIFA 3KC0A 3R26A 2B4MA 1JEUA 3H6TA 4TQUQ 4DCXA 4FJPA 3CR9A 3VXCA 3V83A 2KQZA 4DLDA 1IXHA 2XXXA 1A54A 1B05A 2I3WA 2GFEA 3PPQA 2XWKA 1A8EA 1GTKA 2ZZXA 3L6HA 4ZE8A 1N76A 1QUKA 2DWJA 1H45A 2FYIA 1FPJA 4YB7A 3IORA 3GBAA 1LLSA 3EHSA 2XXWA 3OELA 5ELVA 3IB1A 3RTWB 3FGSA 2CMOA 4QHQA 3T9VA 2V25A 5TP9B 3OSQA 2VGQA 3QSLA 1ZU0A 3K01A 2H98A 1RYOA 3WAEA 3IB0A 1XI6A 5JK4A 4NF0A 4R6KA 1WDNA 2F8DA 5A5XA 1M5FA 2UXAA 4THIA 3TCHA 3MC2A 1D9YA 1FQAA 2IEEA 1AH5A 1UTBA 1R6ZA 1PBQA 3W15C 4DZ1A 2XA5A 2OX3A 5B7DA 2Q74A 1SBPA 3TTNA 2F7AA 1YZ0A 2HZLA 3HFUA 1H44A 3K4UA 4WKMA 2ZNSA 4H65A 3BKIB 2CZIA 3EQ1A 3TPAA 2QS2A 3FBPA 1SVXB 2XD3A 1YYZA 4FAJA 4GX4A 3QIMA 3O9PA 4PFYA 4PFTA 3VLUA 1LCFA 2I4BA 4PFWA 4G77A 3RPLB 3SEWA 5LDZA 4MBPA 2OJTA 1OQHA 5EYGA 1IMEA 5IM2A 2PFZA 1B51A 1L5TA 4XF5A 4PCDA 2XWOA 4TLLB 3CI8A 4GLIA 2V4CA 3OEKA 4F3SA 4JSDA 4ELRA 2QVVA 4NF5A 4F22A 2YJPA 1UQWA 3MP6A 1IEJA 4PF8A 3KSXA 2REJA 4N8GA 4NF6A 3SEXA 1Q35A 1DMBA 2L5VA 4YAHX 1URGA 2Y7WA 2OWSA 3O6IA 3ECRA 4GFRA 1SDXA 3R6UA 5IZ3A 2A5TA 3KJ7A 2XXPA 2I0CA 5F24A 4XXUA 3LBSA 4GWWA 2ZYNA 2AL4A 3CHGA 1VFEA 3M3FA 3O29A 2FBPA 3MWBA 5ISUA 4FEBA 1N3XA 3PD9A 3K0VA 1FPEA 2RCBA 1NL5A 5L9OA 4XEQA 1FTMA 2REGA 2XXHA 3O6GA 2O68A 4ZDMA 4I1DA 1B1XA 4QFPA 4XKRA 4H0WA 3SESA 1MDQA 3H6UA 5CI5A 1B4ZA 3FIRA 4MNPA 2XXYA 1YTVA 3FJGA 1OQGA 3OENA 5ET5A 4KI0E 4QRZA 4ND9A 4ZEKA 2RC8A 1BIYA 4Q5TA 4GOTA 4O8MA 3C31A 4DE8A 3C34A 3T9HB 1FW0A 4G2ZA 3SZPA 1EZPA 4YICA 4GWZA 1NV7A 1IITA 2Z8DA 3TCFA 4RPNA 4PC9A 4LATA 3Q26A 3Q29A 1IXGA 1FBCA 4OVQA 4N15A 5CC2A 5CBRA 4F3GA 2O7UA 2P1SA 4BDNA 5I59A 3IOWA 2ZZVA 2F3BA 1S50A 1R9LA 4QXDA 2R71A 4EF1A 1YCJA 3K02A 4H45A 1KZ8A 1B1HA 2Y5KA 3O66A 4PF6A 4JB7A 3MW0A 1MXXA 1BP5A 3H7MA 4U23A 2QRYA 4AS5A 4PE5B 3LUZA 2NOOA 1AMFA 4PDHA 5A5LA 1M5EA 1LSTA 2XX8A 2JJKA 5FHOA 4MIJA 4BDOA 3PD8A 3C36A 4GX6A 1PDAA 5HM4B 3THIA 4F18A 5H8QB 5I84A 3DELB 3ZSFA 2X26A 2GQ1A 5EYHA 2P3NA 2I48A 5AA1A 1QKAA 4MH5A 2NXOA 1MQIA 3CFLA 4RPOA 5I2KB 5JTYA 3C33A 2HHMA 1FPFA 3HHFA 3D1RA 4F29A 4GVOA 5I5PA 3T9XB 4H67A 4KCCA 4I3EA 2HXWA 2Q89A 1QJMA 2XX9A 3IJXB 4LVQA 4F1VA 1US5A 3PMWA 5AE4A 1KWHA 4XTCQ 1HSLA 3QAXA 4NF5B 2Q2AA 1P1WA 4IO5A 4P3LA 2DXRA 3RGYA 5DEXA 2HAUA 2Y84A 5FBPA 3EPEA 3H06B 4IB2A 5KCJA 1ANFA 1US4A 3U1OA 2XWVA 4P47A 2RINA 5ESYA 2DWIA 1SPIA 1OVTA 3IL1B 1RDZA 1IUDA 4G8HA 1JNFA 2OWTA 4JSOA 2VPNA 4QFOA 3C32A 3OXNA 5HPQA 1FTJA 5I2KA 1K9YA 4N6DA 3KN7A 4O7IA 4GWYA 4NGUA 4ESXA 1ZMGA 2PYYA 2FIEA 1ATGA 1JW1A 3B7DA 4R9FA 3IOTA 3K6VA 2XD2A 4NMYA 3D4CA 1LFIA 4NG7A 2F34A 1LAXA 4ZECA 4AB5A 5I58A 4EQBA 2QPQA 3G7WA 1PB9A 3LC8A 2E1SA 1MM7A 4NWCA 4RNSA 1B5IA 2ZYMA 4P11A 2IA4A 1P1OA 4MX6A 3VLWA 1SW1A 3VDFA 2XXTA
chains in the Genus database with same CATH topology
5DW8A 5IZ3B 1YXIA 2HPGA 2L5VA 1FBCA 1EYKA 4HE0A 2Q8MA 4F1VA 2CEXA 2WX9A 4M1VA 1NUWA 5IZ3A 4OVQA 4X8RA 1JP4A 3T1BA 4MJOA 2DE3A 2XWVA 2FIXA 1XI6A 5F24A 4GWUA 1NV2A 4N15A 4NF0A 3NOHA 1BK4A 4PAFA 3U65A 3W9WA 4DI3D 1CNQA 4X04A 2FVZA 4GWWA 1IMCA 3B8BA 4P1LA 4P3LA 4QBAA 3CHGA 1NV1A 2CEYA 4GBWA 2F5XA 2PFYA 3E79A 4P1EA 5EQ8A 4PAKA 2MKZA 1EYIA 3FXBA 4HE2A 3EKIA 2FBPA 2QVRA 2B4LA 3GYYA 4YZZA 4HCYA 3E78A 5IGAA 1NV4A 2ZZWA 4KXPA 1DBZA 4PFIA 3W9VA 1IMAA 2VT5A 1NV5A 4F19A 1FRPA 5FBPA 2WYPA 2ZZVA 4FBPA 1FBPA 2F3BA 1FBEA 4XFEA 3A29A 4MHFA 4NHBA 2VPOA 1NUXA 4OA4A 5CM6A 2DE2A 1LBYA 4QXDA 1FPEA 1NV0A 4PAIA 4PBQA 2DVZA 5IZZA 1IMDA 1NUZA 4H45A 2XA5A 1KZ8A 2OX3A 4HXVA 2Q74A 5EQ9A 1DCUA 1DK4A 2Y5KA 4IR8A 4PTKA 5IZ1A 5ESYA 3LV0A 4P47A 4PF6A 4N91A 1NI9A 4UABA 4XEQA 1RDYA 1QGXA 1FBFA 1SPIA 1YZ0A 2Q9TA 4MNIA 4PE3A 4HCWA 4GX3A 2XWIA 1RDZA 2Y5LA 4I40A 4PFRA 5JK4A 2HZLA 2WBDA 3HFUA 4P56A 5I7IA 4N4UA 1INPA 2FHYA 1AWBA 3PTYA 4NQ8A 1FBDA 3BIHA 5ET8A 4H46A 4AS5A 4NX1A 1NV3A 4X9TA 2VPNA 3LUZA 4MCOA 1FBGA 4JVDA 2HZKA 2CZKA 3RPLA 4PDHA 2CZIA 5A5LA 4MEVA 4OVPA 2QFLA 3FBPA 5EQAA 1FPGA 2BJIA 2P3VA 5ET7A 1FPIA 2DE4A 2WYKA 2JJKA 2QVUA 1IMFA 2DDKA 3KC0A 4MIJA 3ISPA 4OVSA 1LEVA 1YYZA 4PGPA 1K9YA 3BIGA 2B4MA 4GX4A 4LN5A 1FPDA 4GWSA 4JVCA 3MYUA 1FPKA 2HXRA 4N6DA 2KR0A 1EYJA 4GX6A 4O7IA 3KC1A 4GWYA 2R8TA 1G0IA 3ROJA 4NAPA 1NUYA 2PCRA 3RYDA 4PETA 4NGUA 1D9QA 1LBZA 1IMBA 2OWZA 2KQZA 4MNPA 4F18A 4O7MA 2FIEA 5J16A 1FPBA 4PFBA 1FJ9A 2GQ1A 4N8YA 4HE1A 5EYHA 2P3NA 2XWKA 4MNCA 4P8BA 2WEFA 3RPLB 5ET5A 2V3QA 4O94A 2WBBA 1FPLA 4N6KA 2ZZXA 4GWXA 4AS4A 4GBVA 5LDZA 1FSAA 4F1UA 5EYGA 1FJ6A 1Q9DA 1IMEA 3KBZA 5EQ7A 5J1DA 1G0HA 4NG7A 1FBHA 5IM2A 1LBVA 1VDWA 1KA1A 4G61A 2PFZA 4I3YA 4MAGA 4P9KA 4PBHA 4N17A 4PGNA 4O8MA 3MSTA 2XWOA 4PCDA 4XF5A 3T0JA 4DI4B 1KA0A 1FPJA 5LTCA 2CZHA 5ET6A 2HHMA 1FPFA 2QPQA 2V4CA 3IFCA 4JVIA 4N81A 4OVTA 4PDDA 1RDXA 2QVVA 3D1RA 3SZPA 4MMPA 4OVRA 3QMFA 4YICA 1NV6A 5I5PA 4GWZA 4I3EA 5I3SA 1LBWA 4PF8A 1LBXA 1FTAA 4N8GA 4NN3A 4OANA 2F3DA 1K9ZA 1NV7A 4MX6A 4PC9A 5T3JA 3IFAA 2XXKA 3B50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DW8 A;  5IZ3 B;  1YXI A;  1FBC A;  1EYK A;  4HE0 A;  2Q8M A;  1NUW A;  5IZ3 A;  1JP4 A;  4MJO A;  2FIX A;  1XI6 A;  5F24 A;  4GWU A;  1NV2 A;  1BK4 A;  1CNQ A;  2FVZ A;  4GWW A;  1IMC A;  3B8B A;  1NV1 A;  4GBW A;  5EQ8 A;  1EYI A;  4HE2 A;  2FBP A;  2QVR A;  1NV4 A;  4KXP A;  1DBZ A;  1IMA A;  2VT5 A;  1NV5 A;  1FRP A;  5FBP A;  4FBP A;  1FBP A;  2F3B A;  1FBE A;  3A29 A;  1NUX A;  1LBY A;  4QXD A;  1FPE A;  1NV0 A;  1IMD A;  1NUZ A;  4H45 A;  1KZ8 A;  2OX3 A;  4HXV A;  2Q74 A;  5EQ9 A;  1DCU A;  1DK4 A;  2Y5K A;  4IR8 A;  4PTK A;  5IZ1 A;  5ESY A;  3LV0 A;  1NI9 A;  1RDY A;  1QGX A;  1FBF A;  1SPI A;  1YZ0 A;  4GX3 A;  1RDZ A;  2Y5L A;  4I40 A;  2WBD A;  1INP A;  2FHY A;  1AWB A;  1FBD A;  3BIH A;  5ET8 A;  4H46 A;  4AS5 A;  1NV3 A;  3LUZ A;  1FBG A;  2CZK A;  3RPL A;  2CZI A;  5A5L A;  2QFL A;  3FBP A;  5EQA A;  1FPG A;  2BJI A;  2P3V A;  5ET7 A;  1FPI A;  2JJK A;  2QVU A;  1IMF A;  2DDK A;  3KC0 A;  1LEV A;  1YYZ A;  1K9Y A;  3BIG A;  4GX4 A;  1FPD A;  4GWS A;  1FPK A;  1EYJ A;  4GX6 A;  4O7I A;  3KC1 A;  4GWY A;  2R8T A;  1G0I A;  3ROJ A;  1NUY A;  2PCR A;  3RYD A;  1D9Q A;  1LBZ A;  1IMB A;  2OWZ A;  2FIE A;  5J16 A;  1FPB A;  1FJ9 A;  2GQ1 A;  4HE1 A;  5EYH A;  2P3N A;  2WEF A;  3RPL B;  5ET5 A;  2WBB A;  1FPL A;  4GWX A;  4AS4 A;  4GBV A;  5LDZ A;  1FSA A;  5EYG A;  1FJ6 A;  1Q9D A;  1IME A;  3KBZ A;  5EQ7 A;  1G0H A;  1FBH A;  1LBV A;  1VDW A;  1KA1 A;  4G61 A;  4I3Y A;  3T0J A;  1KA0 A;  1FPJ A;  2CZH A;  5ET6 A;  2HHM A;  1FPF A;  3IFC A;  4N81 A;  1RDX A;  2QVV A;  3D1R A;  3QMF A;  1NV6 A;  4GWZ A;  4I3E A;  5I3S A;  1LBW A;  1LBX A;  1FTA A;  2F3D A;  1K9Z A;  1NV7 A;  5T3J A;  3IFA A; 
#chains in the Genus database with same CATH topology
 2FA7 A;  3CG1 A;  4F3P A;  2CEX A;  1NUW A;  1Y3P A;  1LGB C;  1LAF E;  3RN8 A;  4QF9 A;  4GWU A;  3OO6 A;  4KD5 A;  4DI3 D;  4XIG Q;  2O6A A;  4NED A;  1NNK A;  1Z7M E;  1UTB B;  2NUV A;  1NV4 A;  2O51 A;  2ONR A;  3MZ9 A;  4YB6 A;  1IMA A;  4XFE A;  2VOZ A;  4NWD A;  4NHB A;  3H4Z A;  5JTY B;  3TUS A;  1B0L A;  4G68 C;  4HXV A;  4PTK A;  1B7U A;  4EXL A;  4MLV A;  2CZL A;  3TAJ A;  1OMP A;  1FTK A;  3KG2 A;  3EHU A;  3OO8 A;  4FED A;  4GIZ A;  1JQF A;  3U72 A;  1USY H;  2DXY A;  2XXQ A;  3MPL A;  2H25 A;  3RPL A;  1POY 1;  1TFA A;  2OPE A;  3U92 A;  1WVJ A;  4AB6 A;  3VVF A;  2F35 A;  4TOZ A;  3E13 X;  5ICT A;  1FPK A;  2UVG A;  4N07 A;  2QJE A;  4OFJ A;  1Y3N A;  1SYH A;  1NFT A;  4FAT A;  1N04 A;  4HS7 A;  1G0H A;  2XX7 A;  3MVX A;  4IGR A;  4G61 A;  4LZ7 A;  3OEM A;  3HV1 A;  2WKY A;  4DXB A;  4H6D A;  2VD3 A;  2RC7 A;  3PUX E;  4OVT A;  1MRP A;  3C35 A;  2QMX A;  4OVR A;  3QMF A;  3TDJ A;  3PUY E;  5AA2 D;  1DTZ A;  3IFA A;  2XXK A;  1NNF A;  1TT1 A;  3FXR A;  3IO4 A;  1UTH B;  5KCJ B;  3FUZ A;  4NF4 A;  2R6G E;  5ITO A;  3T1B A;  1YAE A;  1NV1 A;  3E79 A;  4FEC A;  4JBZ A;  4P1E A;  3T93 B;  2B4L A;  2ZZW A;  4KXP A;  3CRB A;  3BFU A;  3VVE A;  1FBE A;  3LR1 A;  3N26 A;  3KJT A;  5DVF A;  5CMB A;  4MNI A;  3K1N A;  4GD5 A;  3FVK A;  2PBW A;  4MCO A;  2QFL A;  4X8R A;  4DCY A;  2YLN A;  4GL0 A;  4JWX A;  4GWS A;  4HW8 A;  4YKP A;  1EYJ A;  3K1M A;  5CRY A;  2F97 A;  4R73 A;  2DS9 A;  1MPC A;  4U21 A;  4QFL A;  4XKP A;  4KYE A;  2Y7K A;  5EQ7 A;  2AIX A;  3HO7 A;  1MQD A;  3I5O A;  2DWA A;  5LOM A;  4OHN A;  3FVO A;  1RDX A;  4OET A;  1Y4C A;  4XKQ A;  5KDT B;  4LA9 A;  2XXV A;  3RQT A;  1LBW A;  4BLA A;  3TEL A;  4Z7E A;  2F36 A;  3S9E A;  1K9Z A;  3G3J A;  4PP0 A;  1B2H A;  3H6W A;  3VV5 A;  5JEI A;  1XC1 A;  2DYX A;  1N84 A;  3FJ7 A;  1O64 A;  2QS1 A;  3HPI A;  5AA2 A;  4X04 A;  1SQY A;  1WOD A;  4GBW A;  2F5X A;  1MM6 A;  4MHF A;  3HN0 A;  2RKM A;  3PPR A;  2DE2 A;  2I49 A;  1NUZ A;  5CMK A;  5B70 A;  1R9Q A;  4OES A;  4WEP A;  3RT8 A;  1VE4 A;  4G8N A;  4ELQ A;  1FBF A;  3H3G A;  1XHY A;  2FHY A;  3PUV E;  2UVI A;  2OLB A;  1B3L A;  4OWD A;  2Z8F A;  3PUZ E;  4HTG A;  1FPI A;  4H5F A;  1B7Z A;  1FQE A;  2ZNU A;  3ISP A;  3LSX A;  4JWO A;  1M5B A;  2GRV A;  2P0S A;  4QSC A;  5L9S A;  1A55 A;  5HBC A;  1IMB A;  1FJ9 A;  3KOS A;  4N8Y A;  4IGT A;  4H5G A;  2V3Q A;  2WBB A;  3I3V A;  4AS4 A;  1LB9 A;  1LCT A;  3N6U A;  3K2D A;  1NNT A;  5EHS A;  3O97 A;  2Z23 A;  2QMW A;  4MAG A;  4P9K A;  1QUJ A;  2R9J A;  3UK4 A;  4ZS9 A;  2CZH A;  1H76 A;  1QKB A;  3LSF B;  1MQJ A;  4ONY A;  4DXC A;  4PQJ A;  2YPN A;  3I6V A;  3MPK A;  4DDD A;  4IO4 A;  5DEX B;  2Q8M A;  2ONS A;  5IZ3 B;  2A5T B;  4DIG A;  4YMA A;  3TEP A;  4OER A;  4ZZA A;  3RY3 A;  3FZV A;  2DE3 A;  4R6Y A;  1NV2 A;  4P0G A;  3W9W A;  3DLN A;  4JXI A;  1IMC A;  5L9M A;  3VFJ A;  1N7X A;  2RC9 A;  1NMU A;  4R6H A;  4PAK A;  4GQO A;  2QVR A;  3GYY A;  1PB8 A;  4UA8 A;  1FRP A;  3A29 A;  1GR2 A;  5F7V A;  1HSE A;  5CM6 A;  4KR5 A;  5H8F B;  4F2O A;  3QUJ A;  2GHA A;  1DCU A;  3TQW A;  1B0H A;  1EH3 A;  1QGX A;  1NNP A;  4GX3 A;  3USD A;  1UTH A;  1I6Q A;  3TKD A;  3KN8 A;  1LB8 A;  3CFZ A;  4MEV A;  2BJI A;  4L17 A;  4OVS A;  3IX1 A;  4FOR A;  1P1N A;  4POX A;  4OFO A;  1FPD A;  4O3A A;  3K1P A;  2KR0 A;  3KC1 A;  4U1Z A;  1ZBM A;  4QFN A;  1CE2 A;  4PET A;  1AOV A;  4NTL A;  2F7B A;  3EHT A;  4NF8 B;  4PFB A;  1S7Y A;  3ZKL A;  3MP8 A;  3U8Q A;  3EN3 A;  4GL8 A;  4NE4 A;  2D21 A;  3PUW E;  4YMB A;  4ZEI A;  4I9D A;  1I6A A;  1FBH A;  2OZZ A;  1LBV A;  4M4G A;  4PBH A;  4WED A;  1IQ7 A;  1B52 A;  1H43 A;  1QW0 A;  4Q8R A;  4ZEF A;  1OLA A;  4O3C A;  4N81 A;  1TXF A;  3FJM A;  1J1N A;  4U4X A;  1XOC A;  2DQV A;  3QYT A;  4LQ2 A;  1QUL A;  3IB2 A;  4YB5 A;  4YU0 A;  5H8Q A;  4EDP A;  1MY2 A;  3IR1 A;  5A5X B;  2VP1 A;  1USY E;  3CVG A;  2FIX A;  3PMV A;  4F1Y A;  3NOH A;  2VHA A;  4PAF A;  5L8D A;  3LUY A;  3Q25 A;  4P1L A;  1SYI A;  3HCQ A;  3C9H A;  3FXB A;  3RUM A;  4HE2 A;  1DPE A;  5TP9 A;  3K6X A;  4H8I A;  1JEV A;  3BBR A;  4R74 A;  1SI1 A;  3SKP A;  5TU0 A;  3IAZ A;  2O7I A;  3PV0 E;  2VPO A;  2DWH A;  2DVZ A;  4DXU A;  5I57 A;  1NI9 A;  1RDY A;  2PT2 A;  5CMC A;  1BKA A;  4I40 A;  1N0T A;  3GBB A;  4I62 A;  3MJN A;  1FBD A;  5F1Q A;  1T0K A;  1EU8 A;  1B4H A;  3H03 A;  4RK2 A;  1MPB A;  2ALU A;  1FPG A;  1A7L A;  1P1Q A;  2QVU A;  2H5Y A;  4GWO A;  3BIG A;  3ZS6 A;  1Y3Q A;  4JVC A;  2XXU A;  3O6H A;  2R8T A;  2QS4 A;  4KYD A;  2PCR A;  1XVX A;  1MS7 A;  4ECF A;  4MNC A;  4MLQ A;  2WEF A;  4C1T A;  4Q30 B;  2UYE A;  3IJO B;  4R9G A;  2QS3 A;  1O63 A;  5LTC A;  4KPT A;  4I8C A;  3T0J A;  3U94 A;  3SEV A;  2PX1 A;  2O69 A;  3B6W A;  1MDP 1;  1JW5 A;  1EYK A;  4HE0 A;  1NKX A;  2OCU A;  4FE8 A;  5DVJ A;  3FVG A;  2X7P A;  4ESW A;  2ABH A;  4F2Q A;  1B7H A;  3T9U A;  4FIM A;  2Z22 A;  1CNQ A;  2G29 A;  3HST A;  1OVB A;  3RTF B;  3N6T A;  4K3F A;  3E78 A;  1ZKB A;  2I6E A;  4H8J A;  2XHD A;  1NV5 A;  1ZIU A;  3OMB A;  3PPN A;  1EZ9 A;  2UVH A;  3IO6 A;  2Z8E A;  1NV0 A;  3FXQ A;  1LBC A;  1ZTY A;  3OOA A;  4POW A;  2H9B A;  4UAB A;  4U4S A;  1MXZ A;  1IXC A;  4PFR A;  1D3K A;  1MXV A;  4NQ8 A;  4R2B A;  3U93 A;  1JW4 A;  3FAT A;  4C0R A;  3K00 A;  3V89 B;  2ZNT A;  2DDK A;  1IIW A;  1MY1 A;  4WXJ A;  4LN5 A;  3MUQ A;  1NUY A;  3OD7 A;  2HEU A;  3FVN A;  5I57 B;  2D5W A;  1FSA A;  1P99 A;  2B3F A;  3OSR A;  3N5L A;  4RJZ A;  3MQ9 A;  3PMX A;  3MST A;  5IAI A;  5ET6 A;  1POT A;  2BJJ X;  3UGW A;  3MP1 A;  4PDD A;  5FHM A;  4OXV A;  1NV6 A;  3A3U A;  1GVC A;  5I58 B;  1ELJ A;  4NN3 A;  1FCK A;  3LSW A;  3M8U A;  1MXU A;  2ZMB A;  4OEV A;  3B50 A;  4ELO A;  4LUB A;  1B3F A;  1AL3 A;  2WX9 A;  3SET A;  3KEI A;  3D4G A;  3S9M C;  3QXM A;  4X48 A;  2ONK E;  5IKB A;  2CEY A;  1XT8 A;  3C4M A;  2O1L A;  1PC3 A;  3TYH A;  5IGA A;  2GHB A;  5CMM A;  4F19 A;  4TLM B;  4OA4 A;  4EQ9 A;  2HAV A;  4PAI A;  1HSJ A;  2V84 A;  1IMD A;  5I59 B;  1DK4 A;  4IR8 A;  5CBS A;  1LFH A;  1MH4 A;  3KFM A;  3MZ1 A;  3PGF A;  1OLC A;  4F3B A;  5ICQ A;  4R75 A;  3PTY A;  5ET8 A;  5KDT A;  4JVD A;  3N94 A;  5EQA A;  4EF2 A;  1LEV A;  2PMS A;  2HXR A;  4GXA A;  3T66 A;  3UP9 A;  2OPD A;  4F31 B;  2KLF A;  2ESN A;  4O7M A;  4OZ9 A;  2H99 A;  4Z0I A;  1MQH A;  1S9T A;  4GXS B;  4O94 A;  3K6W A;  4RA1 A;  5DVI A;  4N13 A;  1N3W A;  3DP4 A;  5J1D A;  2W7Y A;  5I2N A;  1QVS A;  4BDL A;  4PGN A;  1RYX A;  1KA0 A;  2Y7I A;  5AA4 B;  5BUU A;  3LSL A;  3V5A A;  2XXR A;  1DOT A;  1B9J A;  1BLF A;  2PT1 A;  5H8F A;  3KN3 A;  1VR5 A;  3A09 A;  2I0B A;  1EZO A;  5T3J A;  5DW8 A;  2O1M A;  1ZLQ A;  2GH9 A;  4M1V A;  3F11 A;  1LAG E;  3JZJ A;  2X7Q A;  3FXU A;  2V3T A;  3Q27 A;  4LZ8 A;  4KFQ A;  1IXI A;  1JVX A;  3MBP A;  3GLB A;  1B3E A;  2MKZ A;  4PFI A;  3S4U A;  2ZYK A;  3S9L C;  1VSO A;  1P1U A;  3IK6 B;  4PBQ A;  3P7I A;  2ANJ A;  3ILT B;  4KHZ E;  1FQC A;  3FV1 A;  5IZ1 A;  1MXW A;  4N91 A;  2Q9T A;  1O7T A;  4PE3 A;  2V3U A;  3V8X B;  2WBD A;  1B5J A;  3TTM A;  3SER A;  4E0W A;  3TZA A;  4ISU A;  2HZK A;  3ODB A;  1GV8 A;  5AA4 A;  2P3V A;  2PVU A;  5EYF A;  3E9X A;  1B58 A;  3MYU A;  1FTL A;  4OEU A;  4BDR A;  3ROJ A;  4N6P A;  2OWZ A;  3QUF A;  1FQB A;  5J16 A;  1FPB A;  4HE1 A;  3S2V A;  1FPL A;  4E0X A;  2P2A A;  1XS5 A;  3MVW A;  3PU5 A;  3DP8 A;  4F39 A;  4G68 A;  1ZJL A;  1PB7 A;  3M3L A;  4LZ5 A;  1YPN A;  1D9V A;  3CG3 A;  1TFD A;  3GXA A;  5I3S A;  4Q0C A;  1LBX A;  4BDQ A;  3R7X A;  1VFD A;  4OAN A;  2F3D A;  1UIU A;  1FQF A;  1SW4 A;  2FNC A;  1Y1Z A;  3U65 A;  3B8B A;  1M5C A;  1DPP A;  1B46 A;  1CB6 A;  3JYR A;  4KYS A;  4YZZ A;  3EKI A;  3L6G A;  4ZZE A;  1DBZ A;  3H6V A;  3TMG A;  2WYP A;  1FTO A;  3TCG A;  3QK6 A;  5I56 A;  1LBY A;  4RYA A;  5EQ9 A;  3TTL A;  4X1B A;  4P0I A;  4KQP A;  4OVJ A;  3TQL A;  4P56 A;  4N4U A;  4OYV A;  1XVY A;  1H3D A;  3DM0 A;  2WYK A;  3KZG A;  3VE1 B;  2ZYO A;  3TTR A;  3IOU A;  2DVC A;  3TOD A;  4LON B;  1BTJ A;  5H8N A;  1II5 A;  4NAP A;  1LBZ A;  2M8C A;  4OFL A;  3MAM A;  3E4R A;  1SW5 A;  2OK2 A;  3HHG A;  4GBV A;  4IY6 A;  4ZEB A;  3M3K A;  4F1U A;  2Q88 A;  5EHM A;  1FJ6 A;  1Q9D A;  3KBZ A;  2B65 A;  4UAC A;  3VVD A;  5AA3 A;  3RNN A;  1KA1 A;  5M2V A;  3T96 B;  1MG1 A;  4ELP A;  1JET A;  2Y7P A;  1D4N A;  1R1N A;  3IFC A;  1B5H A;  1RKM A;  2THI A;  2ZXT A;  4MMP A;  1Y4T A;  1Y9U A;  3CSG A;  1PEB A;  2F6P A;  5ITP A;  4N6K A;  5KZT A;  5H8S A;  4MF3 A;  1MY3 A;  1N7W A;  3K6U A;  4G8M A;  4C1U A;  4YKI A;  2QSX A;  2FVZ A;  4R2F A;  5DT6 A;  1URD A;  4AQ4 A;  1EYI A;  3E3K A;  5K2Y A;  1A40 A;  3W9V A;  3DP6 A;  4FBP A;  3B6T A;  3UOR A;  2O84 X;  5TPA B;  3O2A A;  1Y1M A;  2I3V A;  5TPA A;  2I58 A;  3RPW A;  2Y5L A;  4BDM A;  2F6G A;  3KBR A;  3G3K A;  4IO7 A;  4GRK A;  5K2X A;  3TTK A;  4U22 A;  2AL5 A;  1Z7N E;  4G4P A;  1GGG A;  1FBG A;  4QSE A;  2CZK A;  2XXI A;  3G3I A;  2DE4 A;  3KSJ A;  5ET7 A;  4ZE9 A;  2F78 A;  4YKJ A;  3OO7 A;  2AYS A;  3KOT A;  3RYD A;  1D9Q A;  3SEY A;  3RLF E;  2UYF A;  1A99 A;  3GZG A;  5I56 B;  1URS A;  4ZED A;  4U1O A;  5DYH A;  5FHN A;  2A5S A;  1VDW A;  3UA8 A;  2RCA A;  4IO3 A;  4I3Y A;  4RXL A;  1TWY A;  3ILU B;  1M5D A;  4N17 A;  4X1D A;  3SDF A;  3CSB A;  4JVI A;  3SEU A;  2OBG A;  5AA2 B;  1MPD A;  2NVU B;  1UIV A;  1B40 A;  2NWJ A;  3FAS A;  1FTA A;  1LAH E;  1SD3 A;  2Q8J A;  4XKN A;  1DSN A;  4IO2 A;  1I69 A;  2HPG A;  1YXI A;  5H8N B;  3ONM A;  4NF8 A;  3G3H A;  1JP4 A;  4MJO A;  4YKK A;  3ZKK A;  1BK4 A;  1DTG A;  3MVY A;  5EQ8 A;  1LFG A;  4G68 B;  5H8H B;  4GF8 A;  4NF4 B;  4OTE A;  3T22 A;  3VLV A;  2VT5 A;  4H1X A;  4IY5 A;  2DP8 A;  3MZB A;  4RK9 A;  2F7C A;  1FQD A;  3RT6 B;  2B3B A;  4EXK A;  3LV0 A;  1B3H A;  5FTH A;  3PPO A;  2XWI A;  3TFL A;  3MVZ A;  1F9B A;  1SW2 A;  3CIJ A;  4PFU A;  3BIH A;  4QFK A;  4H46 A;  1MY4 A;  3B6Q A;  4X9T A;  3Q28 A;  1B6H A;  4PGP A;  4NF6 B;  3O28 A;  3WAF A;  4MFI A;  1Y20 A;  3AXF A;  1G0I A;  1MH3 A;  3IOV A;  2H4I A;  4OQO A;  1AIV A;  4JDF A;  4LQ5 A;  3CFX A;  2V93 A;  1MXY A;  3G3G A;  5I2N B;  3FD3 A;  4P8B A;  2G93 A;  2HCA A;  4R72 A;  4GWX A;  4QSD A;  1IZ1 A;  4JWY A;  1OIB A;  2VD2 A;  1SI0 A;  2QL3 A;  4DI4 B;  3S9N C;  5DTB A;  5H8H A;  2HFB A;  4EQ7 A;  1MQG A;  3PPP A;  1JVY A;  3VXB A;  3UN6 A;  4LP2 B;  3KGC A;  1I6B A;  4RY1 A;  3FV2 A;  3EF7 A;  2E0S A;  4OMB A;  4KCD A;  2RF1 A;  4U2R A;  1A8F A;  1Q1K A;  1B32 A;  4QBA A;  1PBP A;  2Q2C A;  2PFY A;  1QUI A;  4O3B A;  4IO6 A;  4HCY A;  3OO9 A;  4OEN A;  2LAO A;  1LBB A;  2DOJ A;  1FBP A;  5FTI A;  1B3G A;  5BWJ A;  1NUX A;  1MY0 A;  5IZZ A;  4NX1 A;  3A3C A;  4EUO A;  2Y7R A;  1NH8 A;  4HCW A;  2DSF A;  2I4C A;  2D3I A;  5I7I A;  1INP A;  1NH7 A;  1AWB A;  1NV3 A;  3G3F A;  3BFT A;  2UVJ A;  3JV9 A;  4OVP A;  2HQ0 A;  1IMF A;  3UIF A;  3KC0 A;  3R26 A;  2B4M A;  1JEU A;  3H6T A;  4TQU Q;  4DCX A;  4FJP A;  3CR9 A;  3VXC A;  3V83 A;  2KQZ A;  4DLD A;  1IXH A;  2XXX A;  1A54 A;  1B05 A;  2I3W A;  2GFE A;  3PPQ A;  2XWK A;  1A8E A;  1GTK A;  2ZZX A;  3L6H A;  4ZE8 A;  1N76 A;  1QUK A;  2DWJ A;  1H45 A;  2FYI A;  1FPJ A;  4YB7 A;  3IOR A;  3GBA A;  1LLS A;  3EHS A;  2XXW A;  3OEL A;  5ELV A;  3IB1 A;  3RTW B;  3FGS A;  2CMO A;  4QHQ A;  3T9V A;  2V25 A;  5TP9 B;  3OSQ A;  2VGQ A;  3QSL A;  1ZU0 A;  3K01 A;  2H98 A;  1RYO A;  3WAE A;  3IB0 A;  1XI6 A;  5JK4 A;  4NF0 A;  4R6K A;  1WDN A;  2F8D A;  5A5X A;  1M5F A;  2UXA A;  4THI A;  3TCH A;  3MC2 A;  1D9Y A;  1FQA A;  2IEE A;  1AH5 A;  1UTB A;  1R6Z A;  1PBQ A;  3W15 C;  4DZ1 A;  2XA5 A;  2OX3 A;  5B7D A;  2Q74 A;  1SBP A;  3TTN A;  2F7A A;  1YZ0 A;  2HZL A;  3HFU A;  1H44 A;  3K4U A;  4WKM A;  2ZNS A;  4H65 A;  3BKI B;  2CZI A;  3EQ1 A;  3TPA A;  2QS2 A;  3FBP A;  1SVX B;  2XD3 A;  1YYZ A;  4FAJ A;  4GX4 A;  3QIM A;  3O9P A;  4PFY A;  4PFT A;  3VLU A;  1LCF A;  2I4B A;  4PFW A;  4G77 A;  3RPL B;  3SEW A;  5LDZ A;  4MBP A;  2OJT A;  1OQH A;  5EYG A;  1IME A;  5IM2 A;  2PFZ A;  1B51 A;  1L5T A;  4XF5 A;  4PCD A;  2XWO A;  4TLL B;  3CI8 A;  4GLI A;  2V4C A;  3OEK A;  4F3S A;  4JSD A;  4ELR A;  2QVV A;  4NF5 A;  4F22 A;  2YJP A;  1UQW A;  3MP6 A;  1IEJ A;  4PF8 A;  3KSX A;  2REJ A;  4N8G A;  4NF6 A;  3SEX A;  1Q35 A;  1DMB A;  2L5V A;  4YAH X;  1URG A;  2Y7W A;  2OWS A;  3O6I A;  3ECR A;  4GFR A;  1SDX A;  3R6U A;  5IZ3 A;  2A5T A;  3KJ7 A;  2XXP A;  2I0C A;  5F24 A;  4XXU A;  3LBS A;  4GWW A;  2ZYN A;  2AL4 A;  3CHG A;  1VFE A;  3M3F A;  3O29 A;  2FBP A;  3MWB A;  5ISU A;  4FEB A;  1N3X A;  3PD9 A;  3K0V A;  1FPE A;  2RCB A;  1NL5 A;  5L9O A;  4XEQ A;  1FTM A;  2REG A;  2XXH A;  3O6G A;  2O68 A;  4ZDM A;  4I1D A;  1B1X A;  4QFP A;  4XKR A;  4H0W A;  3SES A;  1MDQ A;  3H6U A;  5CI5 A;  1B4Z A;  3FIR A;  4MNP A;  2XXY A;  1YTV A;  3FJG A;  1OQG A;  3OEN A;  5ET5 A;  4KI0 E;  4QRZ A;  4ND9 A;  4ZEK A;  2RC8 A;  1BIY A;  4Q5T A;  4GOT A;  4O8M A;  3C31 A;  4DE8 A;  3C34 A;  3T9H B;  1FW0 A;  4G2Z A;  3SZP A;  1EZP A;  4YIC A;  4GWZ A;  1NV7 A;  1IIT A;  2Z8D A;  3TCF A;  4RPN A;  4PC9 A;  4LAT A;  3Q26 A;  3Q29 A;  1IXG A;  1FBC A;  4OVQ A;  4N15 A;  5CC2 A;  5CBR A;  4F3G A;  2O7U A;  2P1S A;  4BDN A;  5I59 A;  3IOW A;  2ZZV A;  2F3B A;  1S50 A;  1R9L A;  4QXD A;  2R71 A;  4EF1 A;  1YCJ A;  3K02 A;  4H45 A;  1KZ8 A;  1B1H A;  2Y5K A;  3O66 A;  4PF6 A;  4JB7 A;  3MW0 A;  1MXX A;  1BP5 A;  3H7M A;  4U23 A;  2QRY A;  4AS5 A;  4PE5 B;  3LUZ A;  2NOO A;  1AMF A;  4PDH A;  5A5L A;  1M5E A;  1LST A;  2XX8 A;  2JJK A;  5FHO A;  4MIJ A;  4BDO A;  3PD8 A;  3C36 A;  4GX6 A;  1PDA A;  5HM4 B;  3THI A;  4F18 A;  5H8Q B;  5I84 A;  3DEL B;  3ZSF A;  2X26 A;  2GQ1 A;  5EYH A;  2P3N A;  2I48 A;  5AA1 A;  1QKA A;  4MH5 A;  2NXO A;  1MQI A;  3CFL A;  4RPO A;  5I2K B;  5JTY A;  3C33 A;  2HHM A;  1FPF A;  3HHF A;  3D1R A;  4F29 A;  4GVO A;  5I5P A;  3T9X B;  4H67 A;  4KCC A;  4I3E A;  2HXW A;  2Q89 A;  1QJM A;  2XX9 A;  3IJX B;  4LVQ A;  4F1V A;  1US5 A;  3PMW A;  5AE4 A;  1KWH A;  4XTC Q;  1HSL A;  3QAX A;  4NF5 B;  2Q2A A;  1P1W A;  4IO5 A;  4P3L A;  2DXR A;  3RGY A;  5DEX A;  2HAU A;  2Y84 A;  5FBP A;  3EPE A;  3H06 B;  4IB2 A;  5KCJ A;  1ANF A;  1US4 A;  3U1O A;  2XWV A;  4P47 A;  2RIN A;  5ESY A;  2DWI A;  1SPI A;  1OVT A;  3IL1 B;  1RDZ A;  1IUD A;  4G8H A;  1JNF A;  2OWT A;  4JSO A;  2VPN A;  4QFO A;  3C32 A;  3OXN A;  5HPQ A;  1FTJ A;  5I2K A;  1K9Y A;  4N6D A;  3KN7 A;  4O7I A;  4GWY A;  4NGU A;  4ESX A;  1ZMG A;  2PYY A;  2FIE A;  1ATG A;  1JW1 A;  3B7D A;  4R9F A;  3IOT A;  3K6V A;  2XD2 A;  4NMY A;  3D4C A;  1LFI A;  4NG7 A;  2F34 A;  1LAX A;  4ZEC A;  4AB5 A;  5I58 A;  4EQB A;  2QPQ A;  3G7W A;  1PB9 A;  3LC8 A;  2E1S A;  1MM7 A;  4NWC A;  4RNS A;  1B5I A;  2ZYM A;  4P11 A;  2IA4 A;  1P1O A;  4MX6 A;  3VLW A;  1SW1 A;  3VDF A;  2XXT A; 
#chains in the Genus database with same CATH homology
 5DW8 A;  5IZ3 B;  1YXI A;  2HPG A;  2L5V A;  1FBC A;  1EYK A;  4HE0 A;  2Q8M A;  4F1V A;  2CEX A;  2WX9 A;  4M1V A;  1NUW A;  5IZ3 A;  4OVQ A;  4X8R A;  1JP4 A;  3T1B A;  4MJO A;  2DE3 A;  2XWV A;  2FIX A;  1XI6 A;  5F24 A;  4GWU A;  1NV2 A;  4N15 A;  4NF0 A;  3NOH A;  1BK4 A;  4PAF A;  3U65 A;  3W9W A;  4DI3 D;  1CNQ A;  4X04 A;  2FVZ A;  4GWW A;  1IMC A;  3B8B A;  4P1L A;  4P3L A;  4QBA A;  3CHG A;  1NV1 A;  2CEY A;  4GBW A;  2F5X A;  2PFY A;  3E79 A;  4P1E A;  5EQ8 A;  4PAK A;  2MKZ A;  1EYI A;  3FXB A;  4HE2 A;  3EKI A;  2FBP A;  2QVR A;  2B4L A;  3GYY A;  4YZZ A;  4HCY A;  3E78 A;  5IGA A;  1NV4 A;  2ZZW A;  4KXP A;  1DBZ A;  4PFI A;  3W9V A;  1IMA A;  2VT5 A;  1NV5 A;  4F19 A;  1FRP A;  5FBP A;  2WYP A;  2ZZV A;  4FBP A;  1FBP A;  2F3B A;  1FBE A;  4XFE A;  3A29 A;  4MHF A;  4NHB A;  2VPO A;  1NUX A;  4OA4 A;  5CM6 A;  2DE2 A;  1LBY A;  4QXD A;  1FPE A;  1NV0 A;  4PAI A;  4PBQ A;  2DVZ A;  5IZZ A;  1IMD A;  1NUZ A;  4H45 A;  2XA5 A;  1KZ8 A;  2OX3 A;  4HXV A;  2Q74 A;  5EQ9 A;  1DCU A;  1DK4 A;  2Y5K A;  4IR8 A;  4PTK A;  5IZ1 A;  5ESY A;  3LV0 A;  4P47 A;  4PF6 A;  4N91 A;  1NI9 A;  4UAB A;  4XEQ A;  1RDY A;  1QGX A;  1FBF A;  1SPI A;  1YZ0 A;  2Q9T A;  4MNI A;  4PE3 A;  4HCW A;  4GX3 A;  2XWI A;  1RDZ A;  2Y5L A;  4I40 A;  4PFR A;  5JK4 A;  2HZL A;  2WBD A;  3HFU A;  4P56 A;  5I7I A;  4N4U A;  1INP A;  2FHY A;  1AWB A;  3PTY A;  4NQ8 A;  1FBD A;  3BIH A;  5ET8 A;  4H46 A;  4AS5 A;  4NX1 A;  1NV3 A;  4X9T A;  2VPN A;  3LUZ A;  4MCO A;  1FBG A;  4JVD A;  2HZK A;  2CZK A;  3RPL A;  4PDH A;  2CZI A;  5A5L A;  4MEV A;  4OVP A;  2QFL A;  3FBP A;  5EQA A;  1FPG A;  2BJI A;  2P3V A;  5ET7 A;  1FPI A;  2DE4 A;  2WYK A;  2JJK A;  2QVU A;  1IMF A;  2DDK A;  3KC0 A;  4MIJ A;  3ISP A;  4OVS A;  1LEV A;  1YYZ A;  4PGP A;  1K9Y A;  3BIG A;  2B4M A;  4GX4 A;  4LN5 A;  1FPD A;  4GWS A;  4JVC A;  3MYU A;  1FPK A;  2HXR A;  4N6D A;  2KR0 A;  1EYJ A;  4GX6 A;  4O7I A;  3KC1 A;  4GWY A;  2R8T A;  1G0I A;  3ROJ A;  4NAP A;  1NUY A;  2PCR A;  3RYD A;  4PET A;  4NGU A;  1D9Q A;  1LBZ A;  1IMB A;  2OWZ A;  2KQZ A;  4MNP A;  4F18 A;  4O7M A;  2FIE A;  5J16 A;  1FPB A;  4PFB A;  1FJ9 A;  2GQ1 A;  4N8Y A;  4HE1 A;  5EYH A;  2P3N A;  2XWK A;  4MNC A;  4P8B A;  2WEF A;  3RPL B;  5ET5 A;  2V3Q A;  4O94 A;  2WBB A;  1FPL A;  4N6K A;  2ZZX A;  4GWX A;  4AS4 A;  4GBV A;  5LDZ A;  1FSA A;  4F1U A;  5EYG A;  1FJ6 A;  1Q9D A;  1IME A;  3KBZ A;  5EQ7 A;  5J1D A;  1G0H A;  4NG7 A;  1FBH A;  5IM2 A;  1LBV A;  1VDW A;  1KA1 A;  4G61 A;  2PFZ A;  4I3Y A;  4MAG A;  4P9K A;  4PBH A;  4N17 A;  4PGN A;  4O8M A;  3MST A;  2XWO A;  4PCD A;  4XF5 A;  3T0J A;  4DI4 B;  1KA0 A;  1FPJ A;  5LTC A;  2CZH A;  5ET6 A;  2HHM A;  1FPF A;  2QPQ A;  2V4C A;  3IFC A;  4JVI A;  4N81 A;  4OVT A;  4PDD A;  1RDX A;  2QVV A;  3D1R A;  3SZP A;  4MMP A;  4OVR A;  3QMF A;  4YIC A;  1NV6 A;  5I5P A;  4GWZ A;  4I3E A;  5I3S A;  1LBW A;  4PF8 A;  1LBX A;  1FTA A;  4N8G A;  4NN3 A;  4OAN A;  2F3D A;  1K9Z A;  1NV7 A;  4MX6 A;  4PC9 A;  5T3J A;  3IFA A;  2XXK A;  3B50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...