1XI6A

Extragenic suppressor from pyrococcus furiosus pfu-1862794-001
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
249
structure length
234
Chain Sequence
KLKFWREVAIDIISDFETTIMPFFGNPDGGKLVKLVDKLAEDLILSRITELGVNVVSEEVGVIDNESEYTVIVDPLDGSYNFIAGIPFFALSLAVFKKDKPIYAIIYEPMTERFFEGIPGEGAFLNGKRIKVRKSISFYSRGKGHEIVKHVKRTRTLGAIALELAYLAMGALDGVVDVRKYVRPTDIAAGTIIAKEAGALIKDSAGKDIDISFNATDRLDVIAVNSEELLKTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords extragenic suppressor
publication title Extragenic suppressor from Pyrococcus furiosus Pfu-1862794-001
rcsb
source organism Pyrococcus furiosus
total genus 61
structure length 234
sequence length 249
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1xi6A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1xi6A02
1FBFA 2GQ1A 1IMFA 4GWSA 4GWZA 5EQ7A 5T3JA 3ROJA 1NV4A 4H46A 4HE0A 1FSAA 1FBDA 2BJIA 1VDWA 2HHMA 1NUXA 3D1RA 4GBWA 4HE1A 3FBPA 1DBZA 1FTAA 4QXDA 2Y5KA 1LEVA 4GWYA 4MJOA 1YXIA 5EQ8A 2CZKA 1FPDA 1RDYA 4GWXA 4PTKA 4GWUA 2Y5LA 1YZ0A 5EQ9A 2DDKA 1FPLA 1NV2A 1EYJA 5J16A 1LBZA 4N81A 1EYKA 2QVRA 4HXVA 3LUZA 5IZ3A 4KXPA 3BIHA 1NV6A 1NV0A 2FIEA 2CZHA 4G61A 3BIGA 1SPIA 2JJKA 5A5LA 1FPEA 2PCRA 4GBVA 1K9ZA 1IMCA 1KA1A 4IR8A 1NUYA 4GWWA 5EYGA 1XI6A 2VT5A 1DCUA 1LBVA 3A29A 2CZIA 2QVVA 4H45A 3IFCA 1IMAA 1FBCA 4FBPA 1YYZA 4I3YA 2FVZA 2OX3A 4GX3A 1EYIA 3LV0A 3RYDA 4HE2A 1FBHA 2F3BA 5ESYA 5EQAA 1FPKA 1FPBA 3QMFA 3IFAA 2R8TA 1FJ9A 1NV5A 1FRPA 2OWZA 1IMBA 1FPFA 1FBEA 1RDZA 2P3NA 3KC1A 5LDZA 1FBPA 4GX6A 2FHYA 2Q8MA 4GX4A 5ET5A 4I40A 2WBBA 1RDXA 2QFLA 3RPLB 3B8BA 1NUZA 1G0HA 2F3DA 1FJ6A 2WEFA 3T0JA 1LBYA 3KBZA 1BK4A 1NUWA 1QGXA 2QVUA 1NV7A 5IZ3B 1LBXA 1FPGA 4O7IA 2FBPA 1Q9DA 1NV1A 1IMDA 2P3VA 1K9YA 4AS4A 1IMEA 2FIXA 5IZ1A 4I3EA 1NV3A 2Q74A 5ET8A 5ET6A 5I3SA 1CNQA 1INPA 1FPIA 1G0IA 1LBWA 1FBGA 1DK4A 4AS5A 1KA0A 5DW8A 1KZ8A 5ET7A 5FBPA 1D9QA 1AWBA 1JP4A 3KC0A 1FPJA 5F24A 1NI9A 5EYHA 3RPLA 2WBDA
chains in the Genus database with same CATH superfamily
1YCJA 5H8QA 3H6VA 2QS1A 3GYYA 4XKRA 1SI0A 4DXUA 5BWJA 3QUFA 5I59A 4YKPA 1ZTYA 4OETA 1DSNA 4ESXA 5H8FA 2VD2A 3FUZA 3O9PA 4NF0A 3I6VA 3TFLA 4QRZA 5ITPA 3TQLA 3B6TA 1Y20A 1EZOA 3PTYA 3VLVA 2F5XA 3A3UA 4JWOA 2ZZVA 1IUDA 2CZHA 3SESA 3OOAA 5IZZA 4PAIA 4Q5TA 1B5JA 1B1XA 2JJKA 5AE4A 4POWA 4L17A 1IZ1A 2CZIA 5ICQA 4PE3A 3PUWE 3M3LA 1EYIA 5DYHA 3VV5A 1A54A 1ZBMA 3T1BA 4MX6A 4OTEA 3G3KA 1IXHA 2PFYA 1IMBA 1JVYA 4PP0A 4NF5B 4DXCA 4FE8A 3G7WA 3CRBA 4F31B 1MXUA 4LN5A 4MNPA 1FW0A 4H6DA 5B7DA 3HPIA 2Y7KA 4OVSA 4NF4A 4F18A 4I8CA 3OSRA 4LVQA 5LTCA 5IZ1A 1OVTA 3KBRA 4R72A 3KFMA 2Y7PA 5CM6A 1I6AA 2A5TB 3RLFE 4NF6A 2I58A 2VP1A 1D9QA 4NE4A 3Q28A 4GX3A 1FBFA 4GRKA 4KFQA 2I6EA 3H03A 4XIGQ 3VDFA 2PFZA 1HSLA 3BFUA 2XHDA 4LONB 4GWYA 4MJOA 1JW5A 1YXIA 4OEUA 1M5FA 1FTKA 1YZ0A 4I62A 1MPDA 2QS3A 1B9JA 4PDHA 2DS9A 1Q35A 2F35A 3IR1A 3DLNA 2Y7RA 3OMBA 5DEXB 5I5PA 1RKMA 3CG1A 3KSXA 4MLVA 3PPRA 1IXCA 1B0HA 1NKXA 4P0IA 4GWWA 2Y84A 3U72A 5I56A 1R1NA 4OERA 2DQVA 2V3QA 1FBHA 4K3FA 3SEVA 1UIVA 3G3IA 4KYSA 4P9KA 3IB1A 5H8NB 3MSTA 3O6HA 4EDPA 4RYAA 5I57B 1RDXA 4LQ2A 2XWKA 1ANFA 1NUZA 1QULA 5DTBA 4H8JA 3U8QA 1RYOA 2QS4A 3HN0A 4U22A 2PBWA 1XS5A 3B6WA 3PV0E 1LCFA 4I3EA 1XVXA 2O84X 2ESNA 5A5XB 4LP2B 4YB7A 1SW1A 2XXPA 2DVCA 5AA2B 4P3LA 2I3VA 3CG3A 3OXNA 1JP4A 2AL4A 3TTKA 4PGPA 3K6VA 5FHMA 1N7WA 1MY4A 1Y1MA 5TU0A 2HZKA 3IB2A 3RQTA 3IORA 3FBPA 4QXDA 3VLUA 3S2VA 2B3BA 2GRVA 4IY5A 2LAOA 2Y7WA 1H76A 3JYRA 4JVDA 5J1DA 4EQ7A 4PETA 1SQYA 1O64A 1VE4A 4AB5A 3U94A 4P47A 5F7VA 4PFRA 4EQ9A 3EQ1A 1OQHA 4P1LA 4R2BA 1Y3NA 4FEDA 1N3XA 1LLSA 4BDOA 2A5TA 2XXXA 3UN6A 1T0KA 3IJXB 4I3YA 1AH5A 4ZE9A 4IGRA 2OPEA 3LSXA 1Y9UA 2H5YA 4R9FA 3E13X 1USYE 2I0CA 4MEVA 2UYEA 4O3BA 1BTJA 5AA3A 3PUZE 1XVYA 2WEFA 3AXFA 3HFUA 4ZEIA 1ZLQA 4FAJA 1N0TA 4FECA 1IITA 2XXUA 4ESWA 2WYPA 3KN3A 2F7BA 2XX9A 4U1ZA 3S9NC 3CSGA 5I3SA 3IAZA 1B32A 1DPEA 5DEXA 3KOSA 2DWIA 4N6PA 2ABHA 3C33A 3PPPA 1SDXA 3IO6A 2DSFA 1IXIA 1FPJA 3BKIB 4Z7EA 2XD3A 4OANA 1MXXA 3TMGA 4H46A 1QJMA 1GR2A 3TDJA 2Z8DA 5I7IA 4P8BA 1OLAA 2B3FA 1SVXB 2RF1A 2QS2A 3LC8A 4KHZE 5H8NA 3CI8A 5DVFA 1SW5A 2DDKA 2L5VA 4F39A 1B3GA 4ND9A 3DELB 4UA8A 2H98A 2PMSA 4PAKA 2CEYA 3K2DA 4OFLA 3K1PA 4YKJA 1MM6A 3N6TA 1B3EA 3TYHA 5A5XA 4KD5A 4IR8A 4NHBA 1DCUA 1D4NA 4WEPA 3C32A 3PUVE 1P1UA 1TFAA 2FVZA 3LV0A 3ZS6A 5TP9A 1CB6A 1GGGA 1S7YA 2RINA 4GL8A 1B7HA 4X04A 2XWIA 1UTHB 2FHYA 1D9YA 4GX4A 3TTLA 4JSDA 5H8QB 1IEJA 2OCUA 2FBPA 4PAFA 5I59B 3VVFA 1A40A 3VFJA 5ET8A 2OWTA 4ZZEA 3FVGA 1DK4A 1SYIA 4NQ8A 2P0SA 2DP8A 4OFJA 5ET7A 3T93B 2DWAA 4GD5A 5H8SA 2Q2CA 3H3GA 4OWDA 5ELVA 2HPGA 4KCCA 2HEUA 1DPPA 1NUXA 4MF3A 2XXTA 4PE5B 4QFKA 2YJPA 5DT6A 4MMPA 1H44A 4TLLB 1IQ7A 4IO6A 3K1NA 1P1NA 3IOUA 2DE2A 1XOCA 3L6HA 3KGCA 4KXPA 4H65A 4HCWA 2R9JA 5I84A 3TTRA 3G3JA 4N07A 4E0WA 1B5IA 2H9BA 2G93A 1NUYA 4OVTA 4F19A 3A29A 5L9OA 4XKQA 4PFIA 3O28A 3I5OA 5ESYA 1UTBA 1FPBA 3QK6A 2XWVA 5FTIA 2OPDA 2Z23A 3MQ9A 2XXVA 4NF6B 1MH4A 4EF2A 1LB8A 3PPQA 3R26A 3KBZA 4JVCA 5ISUA 3SKPA 1DMBA 3USDA 1B2HA 1NV1A 1DTGA 5JK4A 1P1QA 3DP6A 1AIVA 3O66A 2UVIA 1TFDA 5CMBA 1LFGA 3HV1A 3HO7A 1B4ZA 1B58A 3KJ7A 3N6UA 5CMCA 3V89B 1JQFA 1KA0A 2I48A 2PT2A 5B70A 1TWYA 3OENA 4OXVA 4R9GA 3FJGA 2DXYA 1J1NA 3MAMA 4AQ4A 5T3JA 2E0SA 4H5FA 1FTOA 2IA4A 4DZ1A 4PCDA 4MFIA 2Y5KA 3EHSA 2UVJA 4ISUA 3HSTA 2F36A 3EHUA 1A8FA 1Y1ZA 2VHAA 3PMXA 3IK6B 2NXOA 4QSCA 2PYYA 3FATA 2QVRA 1JW1A 2Q89A 3E79A 3TCHA 4KYEA 3T9HB 3LSLA 2PX1A 3UA8A 4O3CA 4G2ZA 4KCDA 2QVVA 4F3BA 2OX3A 1II5A 2DOJA 4BDNA 2UYFA 3RYDA 2OZZA 4Q30B 3KOTA 3Q29A 4NF8B 4DI3D 3MC2A 2Z22A 1FTMA 1Y4TA 3CFLA 4YAHX 3FD3A 4OVJA 1M5DA 3UGWA 1EZ9A 3K02A 3ZKKA 1Y4CA 4PFTA 1P1OA 2B65A 5JEIA 1NUWA 2V3TA 3IOWA 2O51A 1XC1A 3HCQA 1IMDA 4NX1A 1LBCA 1HSEA 1N7XA 3V5AA 1CNQA 2Q8JA 5FBPA 3W9VA 3D4CA 4X48A 4NWDA 2O6AA 1AWBA 4IB2A 2QSXA 3EN3A 2DVZA 3CFXA 2ZYNA 3LBSA 5EQ7A 4GWZA 4YB5A 4RY1A 1MXZA 4R2FA 4GBWA 2UXAA 3V8XB 3EKIA 3N94A 3ZKLA 4LZ5A 3R6UA 2H99A 3T22A 4BDMA 1MQDA 1SBPA 3VLWA 4OVQA 4YB6A 1P99A 3SEUA 4OENA 4YMBA 1EYJA 1I6QA 1LBZA 4N81A 1EYKA 3K0VA 3H6UA 4DE8A 1Z7NE 5IAIA 1AOVA 3RNNA 2PCRA 4P1EA 2XXKA 1XI6A 1LBVA 3VE1B 3O97A 4FBPA 1YYZA 1N84A 3NOHA 5CBRA 1B7ZA 4F1VA 5EQAA 3UK4A 4GL0A 3KSJA 3FXUA 3D4GA 3C34A 4WXJA 4XF5A 3FV1A 5DVJA 4G68A 1EH3A 3MVZA 3M3KA 2MKZA 4OVRA 1JEVA 3G3FA 1O63A 1LBYA 1JEUA 4JXIA 1ATGA 4IGTA 1B52A 1QGXA 1JW4A 4DCXA 2I3WA 2X7PA 1M5BA 5EHMA 3F11A 3KG2A 1PB9A 4THIA 3GXAA 1QVSA 4F29A 3N5LA 5CBSA 4LQ5A 4NWCA 2AIXA 3MP6A 1KZ8A 3WAFA 1MG1A 1NNKA 4EF1A 5AA1A 4H0WA 3O6IA 3TTMA 3ODBA 4IO5A 4HE0A 3HHFA 2PT1A 2HHMA 4NF8A 3FXBA 1EU8A 1XT8A 2DE4A 3MW0A 4ELQA 2Q88A 1IIWA 1MDQA 4GIZA 1PC3A 3UORA 1H3DA 3WAEA 1MQGA 2ANJA 4P0GA 3T96B 5TP9B 1MY1A 4MNIA 4PC9A 4O7MA 2HZLA 5IGAA 3H6WA 2OLBA 5H8HA 1QW0A 1PB8A 1MY0A 2RC9A 3BIGA 3T66A 2FYIA 1ZKBA 2FA7A 3G3GA 4QFOA 1BLFA 4R74A 2I0BA 3FJ7A 2AL5A 4NAPA 1QUJA 2ZMBA 4ECFA 4R6YA 3GZGA 4P11A 4RJZA 3QXMA 1KWHA 3SERA 3FIRA 1LBBA 2CEXA 1S50A 1N04A 4JB7A 3PD8A 1LGBC 2XXWA 4TOZA 1MXYA 4PDDA 2PVUA 2ZYMA 4HTGA 4U4XA 3RPWA 2FNCA 2HQ0A 2KR0A 2NUVA 1AL3A 2QVUA 5IZ3B 4ZECA 1FQFA 3TQWA 2FIXA 3MUQA 4GF8A 2Q74A 4OQOA 4XKPA 1Q1KA 4C1TA 1G0IA 4YICA 3I3VA 3KC0A 1OIBA 3K01A 1A7LA 4QBAA 2F34A 2I4CA 2H4IA 1YAEA 1O7TA 4LUBA 1BIYA 1ZU0A 1DBZA 1LEVA 3S9LC 4PF8A 2F6GA 3SDFA 1OMPA 3GBBA 4KPTA 5CMMA 3MVYA 1FPLA 1NV2A 5L9MA 1MQJA 5J16A 1UTBB 5HM4B 4G4PA 4ZS9A 3JV9A 1MS7A 1NV6A 1NV0A 4UABA 4ELOA 4IY6A 2B4MA 4ELPA 3E9XA 4IO3A 1K9ZA 3RUMA 4YZZA 1B7UA 3Q25A 3IL1B 2F7AA 4KQPA 3MVWA 4OEVA 3MPKA 4PF6A 3TZAA 1A8EA 2CZLA 3W9WA 4OYVA 3FVKA 1MY3A 4O3AA 4F2OA 1RDZA 2P3NA 2WKYA 4O94A 3Q27A 4U21A 3O29A 4QFPA 2W7YA 4F3GA 3B8BA 4PBHA 3TTNA 1VFEA 2O1LA 1H45A 1YTVA 1CE2A 1Z7ME 2DYXA 4U23A 4N4UA 3SEWA 5TPAA 5AA4A 4M4GA 1D9VA 2QJEA 1FSAA 1SW2A 2GH9A 1L5TA 1JNFA 4MHFA 1USYH 1US4A 3ISPA 1MXWA 2RKMA 4N91A 3VVDA 4PFBA 3LR1A 4QFLA 4C1UA 2F7CA 3LUZA 5IZ3A 1NMUA 3K6UA 4N17A 4PBQA 4G61A 2XD2A 1KA1A 4R6KA 2R6GE 5DVIA 4U1OA 3THIA 3IFCA 4HW8A 3QUJA 4RPOA 1POY1 3QIMA 2ONRA 4WEDA 2R8TA 3C9HA 4N13A 1Y3PA 1NV5A 4RK2A 5L9SA 3PMWA 1YPNA 3KC1A 2WX9A 2F8DA 5ET5A 3HHGA 3S9EA 3DP4A 3PUYE 4XXUA 2R71A 2HAVA 2X7QA 4MLQA 3A3CA 1FPGA 4O7IA 4UACA 2Z8FA 5ET6A 4RK9A 4ZEFA 1FPIA 2UVGA 3TCGA 1B51A 4FIMA 3CHGA 2QPQA 2HCAA 1XHYA 4ZEKA 1QKBA 1HSJA 3IOVA 2QRYA 3Q26A 4ZEBA 1URGA 3L6GA 4N15A 1B3LA 1US5A 5FHOA 3FZVA 2F6PA 1B1HA 2XXYA 1RDYA 2E1SA 3K1MA 2ZNSA 4Z0IA 3KZGA 4JDFA 1BP5A 2V3UA 1VSOA 4GWOA 4MAGA 4HXVA 2GHBA 4LA9A 4EQBA 2X26A 3MP1A 3BIHA 5AA2D 4H5GA 4FJPA 3LUYA 5A5LA 4G68B 3OO6A 1I69A 1POTA 4YU0A 4R6HA 5BUUA 1IMAA 3BFTA 3QAXA 3K6XA 1VR5A 1FPKA 4OMBA 4N6DA 3QMFA 3IFAA 4H67A 2O1MA 4FEBA 1FPFA 3PGFA 5LDZA 3IJOB 3T9XB 2ZZXA 4GX6A 4I40A 2UVHA 1N3WA 4OZ9A 3VXBA 4I1DA 5JTYB 4YKIA 4XFEA 1URSA 1DOTA 4GQOA 4OVPA 1UIUA 1LBXA 1B05A 3C35A 1LAXA 2DE3A 4RA1A 3C36A 2H25A 4GOTA 2P1SA 1NNTA 1INPA 4N8YA 5I2NB 1I6BA 4JWXA 4AS5A 1LAGE 2YLNA 4NGUA 1MPCA 1FQEA 5EYHA 1MQIA 1AMFA 4IO4A 1LFHA 1TT1A 4ONYA 1FBDA 2NVUB 2BJIA 2REGA 3D1RA 3TPAA 4HE1A 1SW4A 5H8HB 5FHNA 5KZTA 3CFZA 4G8MA 5KDTA 2ONKE 4F1UA 4R73A 1FPDA 4PTKA 3RT6B 1GTKA 3ZSFA 2Y5LA 1MRPA 5ITOA 4FATA 3H06B 4KI0E 5KCJA 5EHSA 1VFDA 1FCKA 4QF9A 2FIEA 2NOOA 5IKBA 4ELRA 2ONSA 3E4RA 4QSDA 4JVIA 2DWHA 4Q0CA 3U92A 4HCYA 3ECRA 2VT5A 4M1VA 4DLDA 2REJA 1N76A 2ALUA 4TQUQ 3RY3A 5LOMA 4EUOA 1LAHE 2O69A 3ILUB 4GFRA 1OLCA 3OELA 3UIFA 3MVXA 1H43A 4F2QA 2D21A 3FGSA 1K9YA 1EZPA 1GV8A 2KQZA 2D5WA 4NTLA 2NWJA 1WDNA 1B0LA 3RT8A 3U65A 5DW8A 3U1OA 3RPLA 4DI4B 2GQ1A 1S9TA 3EHTA 4MBPA 3ROJA 2IEEA 3VXCA 3MPLA 4G8HA 4P56A 3EF7A 2BJJX 5EQ8A 3W15C 3FXQA 1R9QA 3MYUA 3E78A 4RPNA 3SZPA 5JTYA 1WVJA 2M8CA 4H1XA 1FQBA 4JSOA 3K4UA 1UQWA 4DDDA 1SPIA 3JZJA 2ZZWA 5I2NA 5EYGA 3RTWB 4FORA 2XXRA 3FXRA 4H45A 1ZMGA 1URDA 1MXVA 4KR5A 3H6TA 3V83A 3LSWA 2F3BA 2RCBA 2I49A 4GXAA 4XEQA 1PB7A 1BKAA 2V4CA 3P7IA 3T9UA 3MBPA 1FBEA 1FBPA 2Q2AA 2OJTA 3M8UA 5K2YA 2A5SA 5TPAB 4DCYA 4OHNA 3K6WA 3DM0A 1MH3A 1P1WA 2F3DA 5AA4B 1FJ6A 4XTCQ 3T0JA 2VGQA 4G68C 1BK4A 1NV7A 2XWOA 5F1QA 3TELA 1Q9DA 3B6QA 2P3VA 3SEXA 1JETA 1JVXA 4C0RA 2Q9TA 3FVNA 1NL5A 4N8GA 3IX1A 4OA4A 4AB6A 3GLBA 1SI1A 2V93A 4G8NA 1B3FA 4NF5A 2VOZA 4NN3A 1NI9A 1MPBA 4YMAA 4IO7A 2WBDA 2KLFA 4I9DA 3M3FA 1IMFA 3TODA 2RC7A 2D3IA 4X9TA 4RNSA 4MNCA 3MZBA 2V25A 2O7UA 3IB0A 5I2KB 5EYFA 3FJMA 3TCFA 5HBCA 3VVEA 3TUSA 3PMVA 4GWXA 4U2RA 1B46A 2XXQA 3S9MC 5HPQA 3E3KA 3CVGA 4JWYA 2VPNA 3TKDA 2HFBA 2HAUA 3MZ1A 1B5HA 1PEBA 5K2XA 3MJNA 4EXKA 1FPEA 2XX8A 4F22A 1IMCA 4IO2A 1B4HA 5I58B 1FTJA 4DXBA 1MDP1 2OBGA 1Y3QA 2AYSA 2O68A 4BDQA 4OESA 1TXFA 1LAFE 4F3PA 3QYTA 3MZ9A 1PBPA 1FJ9A 2THIA 4LZ7A 4PQJA 4RXLA 2ZNUA 4EXLA 4NG7A 3T9VA 4ZZAA 1M5CA 1ZIUA 4NMYA 3H4ZA 2QFLA 4U4SA 1B3HA 1LB9A 1D3KA 3SETA 2XA5A 4MIJA 4XKNA 1MQHA 1NV3A 3IOTA 3TAJA 5CI5A 3N26A 3OO7A 3KJTA 1NFTA 2Z8EA 4R75A 5CMKA 5I57A 1FQCA 1QKAA 2P2AA 3OO9A 4JBZA 4GWSA 2F78A 4Q8RA 1NV4A 4X1DA 3UP9A 5ICTA 1QUKA 1VDWA 1QUIA 2QMXA 3QSLA 3KEIA 4QSEA 2HXRA 1A99A 3IO4A 4X1BA 2GHAA 4QFNA 3CSBA 4MH5A 3RGYA 2WYKA 1B40A 5AA2A 4BDLA 3FASA 4GXSB 4GLIA 4ZEDA 2HXWA 3R7XA 2CMOA 3OSQA 1LFIA 1SYHA 3RN8A 3CR9A 3PUXE 2OWSA 4GBVA 4NEDA 1DTZA 3DP8A 3G3HA 4G77A 2ZYOA 1R6ZA 4HE2A 3B7DA 4PGNA 3GBAA 2XX7A 3U93A 3O2AA 1FRPA 2OWZA 1SD3A 5H8FB 3PU5A 1NH7A 2QMWA 5L8DA 5I2KA 3K00A 2WBBA 3S4UA 4H8IA 4LZ8A 1G0HA 3O6GA 4QHQA 3OEMA 1MY2A 2G29A 2ZYKA 1GVCA 2YPNA 3ONMA 4N6KA 1IMEA 2O7IA 4DIGA 1ELJA 5KDTB 3FV2A 1F9BA 5FTHA 3SEYA 2VD3A 2F97A 3C31A 5CRYA 5IM2A 1OQGA 2DXRA 5I58A 4E0XA 3KN7A 2B4LA 5KCJB 4PFWA 2VPOA 4KYDA 2ZNTA 1FTAA 1NH8A 2OK2A 2XXIA 2Y7IA 4F1YA 4BDRA 3H7MA 3EPEA 1NNPA 1M5EA 4LATA 3PD9A 2CZKA 5CC2A 2ZXTA 3MP8A 4GWUA 5EQ9A 4HS7A 3FVOA 4NF4B 2DWJA 3B50A 1PBQA 1FTLA 4X8RA 4O8MA 2I4BA 3OEKA 4BLAA 4PFYA 3LSFB 3PPOA 4ZDMA 4GVOA 1LSTA 3BBRA 1LCTA 2V84A 2XXHA 3PPNA 3OD7A 3TEPA 1FBCA 1IXGA 4PFUA 4OFOA 1OVBA 5M2VA 4F3SA 3RTFB 1NNFA 3CIJA 4YKKA 2Q8MA 1FQDA 2QL3A 4TLMB 3RPLB 4POXA 1R9LA 1B6HA 3C4MA 1WODA 1RYXA 2RC8A 4AS4A 3KN8A 4ZE8A 1FQAA 4WKMA 4MCOA 1LBWA 3ILTB 1FBGA 1A55A 3OO8A 2GFEA 3MWBA 1UTHA 1PDAA 1ZJLA 2RCAA 5I56B 5F24A 3A09A 1MM7A
chains in the Genus database with same CATH topology
4DI4B 2GQ1A 3ROJA 3GYYA 2HPGA 1NUXA 1DBZA 4P56A 1LEVA 4PF8A 5EQ8A 4MMPA 4NF0A 3MYUA 3E78A 1FPLA 1NV2A 3SZPA 5J16A 2DE2A 3PTYA 4KXPA 2F5XA 1NV6A 1NV0A 2ZZVA 4HCWA 2CZHA 4UABA 5IZZA 2B4MA 4PAIA 1SPIA 2JJKA 2ZZWA 1K9ZA 1NUYA 4OVTA 4YZZA 4F19A 5EYGA 3A29A 2CZIA 4H45A 4PE3A 1EYIA 4PFIA 3T1BA 2F3BA 5ESYA 4PF6A 1FPBA 3W9WA 4XEQA 4MX6A 2PFYA 2V4CA 2XWVA 1IMBA 1FBEA 1RDZA 2P3NA 4O94A 1FBPA 4LN5A 4MNPA 3B8BA 2F3DA 1FJ6A 4PBHA 3T0JA 3KBZA 4JVCA 1BK4A 1NV7A 2XWOA 4OVSA 4F18A 1Q9DA 1NV1A 2P3VA 5JK4A 5LTCA 5IZ1A 2Q9TA 4N8GA 4OA4A 5CM6A 1KA0A 4N4UA 1D9QA 4NN3A 1NI9A 4GX3A 2WBDA 1FBFA 1IMFA 5T3JA 4X9TA 1FSAA 2PFZA 4MNCA 4MHFA 4PCDA 2Y5KA 4GWYA 4MJOA 1YXIA 3ISPA 4N91A 4GWXA 1YZ0A 4PFBA 4PDHA 2QVRA 2VPNA 3LUZA 5IZ3A 4N17A 3E79A 5I5PA 4PBQA 4G61A 1FPEA 1IMCA 1KA1A 4GWWA 2QVVA 3IFCA 2OX3A 3RYDA 2V3QA 1FBHA 4DI3D 2R8TA 4P9KA 1FJ9A 1NV5A 3KC1A 2WX9A 3MSTA 4NG7A 5ET5A 1RDXA 2QFLA 2XWKA 1NUZA 1NUWA 2XA5A 1FPGA 4O7IA 4MIJA 1IMDA 4NX1A 4I3EA 1NV3A 5ET6A 1CNQA 1FPIA 3CHGA 5FBPA 4P3LA 2QPQA 3W9VA 1AWBA 1JP4A 4PGPA 2DVZA 5EQ7A 4GWSA 4GWZA 2HZKA 1NV4A 1VDWA 4GBWA 3FBPA 4N15A 3EKIA 4QXDA 2HXRA 4JVDA 5J1DA 2WYKA 1RDYA 4PETA 4OVQA 1EYJA 1LBZA 4N81A 1EYKA 4HXVA 4MAGA 4P47A 3BIHA 4PFRA 4P1LA 5A5LA 2PCRA 4GBVA 4P1EA 2XXKA 1XI6A 1LBVA 1IMAA 4FBPA 1YYZA 4I3YA 3NOHA 4F1VA 4HE2A 4PGNA 5EQAA 1FPKA 4N6DA 3QMFA 3IFAA 1FRPA 2OWZA 1FPFA 5LDZA 4XF5A 2ZZXA 4GX6A 4MEVA 4I40A 2WBBA 2MKZA 4OVRA 1G0HA 2WEFA 1LBYA 3HFUA 4XFEA 1QGXA 4OVPA 1LBXA 4N6KA 1IMEA 2DE3A 2WYPA 5I3SA 1INPA 4N8YA 4AS5A 4NGUA 1KZ8A 5IM2A 1FPJA 5EYHA 2B4LA 4OANA 4H46A 4HE0A 2VPOA 1FBDA 2BJIA 2HHMA 3D1RA 4P8BA 5I7IA 4HE1A 1FTAA 3FXBA 2DE4A 4F1UA 2CZKA 1FPDA 4PTKA 4GWUA 2Y5LA 5EQ9A 2DDKA 2L5VA 3B50A 4MNIA 4X8RA 4PC9A 4O8MA 4O7MA 2HZLA 5IGAA 4PAKA 2CEYA 2FIEA 3BIGA 4JVIA 4IR8A 4HCYA 2VT5A 4NHBA 1DCUA 4M1VA 1FBCA 2FVZA 4NAPA 3LV0A 2CEXA 4X04A 2XWIA 2FHYA 2Q8MA 4GX4A 4PDDA 3RPLB 2KR0A 2QVUA 5IZ3B 2FBPA 1K9YA 4AS4A 2KQZA 4PAFA 2FIXA 2Q74A 5ET8A 4MCOA 1G0IA 1LBWA 1FBGA 1DK4A 3U65A 4NQ8A 5DW8A 4YICA 5ET7A 3KC0A 5F24A 3RPLA 4QBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBF A;  2GQ1 A;  1IMF A;  4GWS A;  4GWZ A;  5EQ7 A;  5T3J A;  3ROJ A;  1NV4 A;  4H46 A;  4HE0 A;  1FSA A;  1FBD A;  2BJI A;  1VDW A;  2HHM A;  1NUX A;  3D1R A;  4GBW A;  4HE1 A;  3FBP A;  1DBZ A;  1FTA A;  4QXD A;  2Y5K A;  1LEV A;  4GWY A;  4MJO A;  1YXI A;  5EQ8 A;  2CZK A;  1FPD A;  1RDY A;  4GWX A;  4PTK A;  4GWU A;  2Y5L A;  1YZ0 A;  5EQ9 A;  2DDK A;  1FPL A;  1NV2 A;  1EYJ A;  5J16 A;  1LBZ A;  4N81 A;  1EYK A;  2QVR A;  4HXV A;  3LUZ A;  5IZ3 A;  4KXP A;  3BIH A;  1NV6 A;  1NV0 A;  2FIE A;  2CZH A;  4G61 A;  3BIG A;  1SPI A;  2JJK A;  5A5L A;  1FPE A;  2PCR A;  4GBV A;  1K9Z A;  1IMC A;  1KA1 A;  4IR8 A;  1NUY A;  4GWW A;  5EYG A;  1XI6 A;  2VT5 A;  1DCU A;  1LBV A;  3A29 A;  2CZI A;  2QVV A;  4H45 A;  3IFC A;  1IMA A;  1FBC A;  4FBP A;  1YYZ A;  4I3Y A;  2FVZ A;  2OX3 A;  4GX3 A;  1EYI A;  3LV0 A;  3RYD A;  4HE2 A;  1FBH A;  2F3B A;  5ESY A;  5EQA A;  1FPK A;  1FPB A;  3QMF A;  3IFA A;  2R8T A;  1FJ9 A;  1NV5 A;  1FRP A;  2OWZ A;  1IMB A;  1FPF A;  1FBE A;  1RDZ A;  2P3N A;  3KC1 A;  5LDZ A;  1FBP A;  4GX6 A;  2FHY A;  2Q8M A;  4GX4 A;  5ET5 A;  4I40 A;  2WBB A;  1RDX A;  2QFL A;  3RPL B;  3B8B A;  1NUZ A;  1G0H A;  2F3D A;  1FJ6 A;  2WEF A;  3T0J A;  1LBY A;  3KBZ A;  1BK4 A;  1NUW A;  1QGX A;  2QVU A;  1NV7 A;  5IZ3 B;  1LBX A;  1FPG A;  4O7I A;  2FBP A;  1Q9D A;  1NV1 A;  1IMD A;  2P3V A;  1K9Y A;  4AS4 A;  1IME A;  2FIX A;  5IZ1 A;  4I3E A;  1NV3 A;  2Q74 A;  5ET8 A;  5ET6 A;  5I3S A;  1CNQ A;  1INP A;  1FPI A;  1G0I A;  1LBW A;  1FBG A;  1DK4 A;  4AS5 A;  1KA0 A;  5DW8 A;  1KZ8 A;  5ET7 A;  5FBP A;  1D9Q A;  1AWB A;  1JP4 A;  3KC0 A;  1FPJ A;  5F24 A;  1NI9 A;  5EYH A;  3RPL A;  2WBD A; 
#chains in the Genus database with same CATH topology
 1YCJ A;  5H8Q A;  3H6V A;  2QS1 A;  3GYY A;  4XKR A;  1SI0 A;  4DXU A;  5BWJ A;  3QUF A;  5I59 A;  4YKP A;  1ZTY A;  4OET A;  1DSN A;  4ESX A;  5H8F A;  2VD2 A;  3FUZ A;  3O9P A;  4NF0 A;  3I6V A;  3TFL A;  4QRZ A;  5ITP A;  3TQL A;  3B6T A;  1Y20 A;  1EZO A;  3PTY A;  3VLV A;  2F5X A;  3A3U A;  4JWO A;  2ZZV A;  1IUD A;  2CZH A;  3SES A;  3OOA A;  5IZZ A;  4PAI A;  4Q5T A;  1B5J A;  1B1X A;  2JJK A;  5AE4 A;  4POW A;  4L17 A;  1IZ1 A;  2CZI A;  5ICQ A;  4PE3 A;  3PUW E;  3M3L A;  1EYI A;  5DYH A;  3VV5 A;  1A54 A;  1ZBM A;  3T1B A;  4MX6 A;  4OTE A;  3G3K A;  1IXH A;  2PFY A;  1IMB A;  1JVY A;  4PP0 A;  4NF5 B;  4DXC A;  4FE8 A;  3G7W A;  3CRB A;  4F31 B;  1MXU A;  4LN5 A;  4MNP A;  1FW0 A;  4H6D A;  5B7D A;  3HPI A;  2Y7K A;  4OVS A;  4NF4 A;  4F18 A;  4I8C A;  3OSR A;  4LVQ A;  5LTC A;  5IZ1 A;  1OVT A;  3KBR A;  4R72 A;  3KFM A;  2Y7P A;  5CM6 A;  1I6A A;  2A5T B;  3RLF E;  4NF6 A;  2I58 A;  2VP1 A;  1D9Q A;  4NE4 A;  3Q28 A;  4GX3 A;  1FBF A;  4GRK A;  4KFQ A;  2I6E A;  3H03 A;  4XIG Q;  3VDF A;  2PFZ A;  1HSL A;  3BFU A;  2XHD A;  4LON B;  4GWY A;  4MJO A;  1JW5 A;  1YXI A;  4OEU A;  1M5F A;  1FTK A;  1YZ0 A;  4I62 A;  1MPD A;  2QS3 A;  1B9J A;  4PDH A;  2DS9 A;  1Q35 A;  2F35 A;  3IR1 A;  3DLN A;  2Y7R A;  3OMB A;  5DEX B;  5I5P A;  1RKM A;  3CG1 A;  3KSX A;  4MLV A;  3PPR A;  1IXC A;  1B0H A;  1NKX A;  4P0I A;  4GWW A;  2Y84 A;  3U72 A;  5I56 A;  1R1N A;  4OER A;  2DQV A;  2V3Q A;  1FBH A;  4K3F A;  3SEV A;  1UIV A;  3G3I A;  4KYS A;  4P9K A;  3IB1 A;  5H8N B;  3MST A;  3O6H A;  4EDP A;  4RYA A;  5I57 B;  1RDX A;  4LQ2 A;  2XWK A;  1ANF A;  1NUZ A;  1QUL A;  5DTB A;  4H8J A;  3U8Q A;  1RYO A;  2QS4 A;  3HN0 A;  4U22 A;  2PBW A;  1XS5 A;  3B6W A;  3PV0 E;  1LCF A;  4I3E A;  1XVX A;  2O84 X;  2ESN A;  5A5X B;  4LP2 B;  4YB7 A;  1SW1 A;  2XXP A;  2DVC A;  5AA2 B;  4P3L A;  2I3V A;  3CG3 A;  3OXN A;  1JP4 A;  2AL4 A;  3TTK A;  4PGP A;  3K6V A;  5FHM A;  1N7W A;  1MY4 A;  1Y1M A;  5TU0 A;  2HZK A;  3IB2 A;  3RQT A;  3IOR A;  3FBP A;  4QXD A;  3VLU A;  3S2V A;  2B3B A;  2GRV A;  4IY5 A;  2LAO A;  2Y7W A;  1H76 A;  3JYR A;  4JVD A;  5J1D A;  4EQ7 A;  4PET A;  1SQY A;  1O64 A;  1VE4 A;  4AB5 A;  3U94 A;  4P47 A;  5F7V A;  4PFR A;  4EQ9 A;  3EQ1 A;  1OQH A;  4P1L A;  4R2B A;  1Y3N A;  4FED A;  1N3X A;  1LLS A;  4BDO A;  2A5T A;  2XXX A;  3UN6 A;  1T0K A;  3IJX B;  4I3Y A;  1AH5 A;  4ZE9 A;  4IGR A;  2OPE A;  3LSX A;  1Y9U A;  2H5Y A;  4R9F A;  3E13 X;  1USY E;  2I0C A;  4MEV A;  2UYE A;  4O3B A;  1BTJ A;  5AA3 A;  3PUZ E;  1XVY A;  2WEF A;  3AXF A;  3HFU A;  4ZEI A;  1ZLQ A;  4FAJ A;  1N0T A;  4FEC A;  1IIT A;  2XXU A;  4ESW A;  2WYP A;  3KN3 A;  2F7B A;  2XX9 A;  4U1Z A;  3S9N C;  3CSG A;  5I3S A;  3IAZ A;  1B32 A;  1DPE A;  5DEX A;  3KOS A;  2DWI A;  4N6P A;  2ABH A;  3C33 A;  3PPP A;  1SDX A;  3IO6 A;  2DSF A;  1IXI A;  1FPJ A;  3BKI B;  4Z7E A;  2XD3 A;  4OAN A;  1MXX A;  3TMG A;  4H46 A;  1QJM A;  1GR2 A;  3TDJ A;  2Z8D A;  5I7I A;  4P8B A;  1OLA A;  2B3F A;  1SVX B;  2RF1 A;  2QS2 A;  3LC8 A;  4KHZ E;  5H8N A;  3CI8 A;  5DVF A;  1SW5 A;  2DDK A;  2L5V A;  4F39 A;  1B3G A;  4ND9 A;  3DEL B;  4UA8 A;  2H98 A;  2PMS A;  4PAK A;  2CEY A;  3K2D A;  4OFL A;  3K1P A;  4YKJ A;  1MM6 A;  3N6T A;  1B3E A;  3TYH A;  5A5X A;  4KD5 A;  4IR8 A;  4NHB A;  1DCU A;  1D4N A;  4WEP A;  3C32 A;  3PUV E;  1P1U A;  1TFA A;  2FVZ A;  3LV0 A;  3ZS6 A;  5TP9 A;  1CB6 A;  1GGG A;  1S7Y A;  2RIN A;  4GL8 A;  1B7H A;  4X04 A;  2XWI A;  1UTH B;  2FHY A;  1D9Y A;  4GX4 A;  3TTL A;  4JSD A;  5H8Q B;  1IEJ A;  2OCU A;  2FBP A;  4PAF A;  5I59 B;  3VVF A;  1A40 A;  3VFJ A;  5ET8 A;  2OWT A;  4ZZE A;  3FVG A;  1DK4 A;  1SYI A;  4NQ8 A;  2P0S A;  2DP8 A;  4OFJ A;  5ET7 A;  3T93 B;  2DWA A;  4GD5 A;  5H8S A;  2Q2C A;  3H3G A;  4OWD A;  5ELV A;  2HPG A;  4KCC A;  2HEU A;  1DPP A;  1NUX A;  4MF3 A;  2XXT A;  4PE5 B;  4QFK A;  2YJP A;  5DT6 A;  4MMP A;  1H44 A;  4TLL B;  1IQ7 A;  4IO6 A;  3K1N A;  1P1N A;  3IOU A;  2DE2 A;  1XOC A;  3L6H A;  3KGC A;  4KXP A;  4H65 A;  4HCW A;  2R9J A;  5I84 A;  3TTR A;  3G3J A;  4N07 A;  4E0W A;  1B5I A;  2H9B A;  2G93 A;  1NUY A;  4OVT A;  4F19 A;  3A29 A;  5L9O A;  4XKQ A;  4PFI A;  3O28 A;  3I5O A;  5ESY A;  1UTB A;  1FPB A;  3QK6 A;  2XWV A;  5FTI A;  2OPD A;  2Z23 A;  3MQ9 A;  2XXV A;  4NF6 B;  1MH4 A;  4EF2 A;  1LB8 A;  3PPQ A;  3R26 A;  3KBZ A;  4JVC A;  5ISU A;  3SKP A;  1DMB A;  3USD A;  1B2H A;  1NV1 A;  1DTG A;  5JK4 A;  1P1Q A;  3DP6 A;  1AIV A;  3O66 A;  2UVI A;  1TFD A;  5CMB A;  1LFG A;  3HV1 A;  3HO7 A;  1B4Z A;  1B58 A;  3KJ7 A;  3N6U A;  5CMC A;  3V89 B;  1JQF A;  1KA0 A;  2I48 A;  2PT2 A;  5B70 A;  1TWY A;  3OEN A;  4OXV A;  4R9G A;  3FJG A;  2DXY A;  1J1N A;  3MAM A;  4AQ4 A;  5T3J A;  2E0S A;  4H5F A;  1FTO A;  2IA4 A;  4DZ1 A;  4PCD A;  4MFI A;  2Y5K A;  3EHS A;  2UVJ A;  4ISU A;  3HST A;  2F36 A;  3EHU A;  1A8F A;  1Y1Z A;  2VHA A;  3PMX A;  3IK6 B;  2NXO A;  4QSC A;  2PYY A;  3FAT A;  2QVR A;  1JW1 A;  2Q89 A;  3E79 A;  3TCH A;  4KYE A;  3T9H B;  3LSL A;  2PX1 A;  3UA8 A;  4O3C A;  4G2Z A;  4KCD A;  2QVV A;  4F3B A;  2OX3 A;  1II5 A;  2DOJ A;  4BDN A;  2UYF A;  3RYD A;  2OZZ A;  4Q30 B;  3KOT A;  3Q29 A;  4NF8 B;  4DI3 D;  3MC2 A;  2Z22 A;  1FTM A;  1Y4T A;  3CFL A;  4YAH X;  3FD3 A;  4OVJ A;  1M5D A;  3UGW A;  1EZ9 A;  3K02 A;  3ZKK A;  1Y4C A;  4PFT A;  1P1O A;  2B65 A;  5JEI A;  1NUW A;  2V3T A;  3IOW A;  2O51 A;  1XC1 A;  3HCQ A;  1IMD A;  4NX1 A;  1LBC A;  1HSE A;  1N7X A;  3V5A A;  1CNQ A;  2Q8J A;  5FBP A;  3W9V A;  3D4C A;  4X48 A;  4NWD A;  2O6A A;  1AWB A;  4IB2 A;  2QSX A;  3EN3 A;  2DVZ A;  3CFX A;  2ZYN A;  3LBS A;  5EQ7 A;  4GWZ A;  4YB5 A;  4RY1 A;  1MXZ A;  4R2F A;  4GBW A;  2UXA A;  3V8X B;  3EKI A;  3N94 A;  3ZKL A;  4LZ5 A;  3R6U A;  2H99 A;  3T22 A;  4BDM A;  1MQD A;  1SBP A;  3VLW A;  4OVQ A;  4YB6 A;  1P99 A;  3SEU A;  4OEN A;  4YMB A;  1EYJ A;  1I6Q A;  1LBZ A;  4N81 A;  1EYK A;  3K0V A;  3H6U A;  4DE8 A;  1Z7N E;  5IAI A;  1AOV A;  3RNN A;  2PCR A;  4P1E A;  2XXK A;  1XI6 A;  1LBV A;  3VE1 B;  3O97 A;  4FBP A;  1YYZ A;  1N84 A;  3NOH A;  5CBR A;  1B7Z A;  4F1V A;  5EQA A;  3UK4 A;  4GL0 A;  3KSJ A;  3FXU A;  3D4G A;  3C34 A;  4WXJ A;  4XF5 A;  3FV1 A;  5DVJ A;  4G68 A;  1EH3 A;  3MVZ A;  3M3K A;  2MKZ A;  4OVR A;  1JEV A;  3G3F A;  1O63 A;  1LBY A;  1JEU A;  4JXI A;  1ATG A;  4IGT A;  1B52 A;  1QGX A;  1JW4 A;  4DCX A;  2I3W A;  2X7P A;  1M5B A;  5EHM A;  3F11 A;  3KG2 A;  1PB9 A;  4THI A;  3GXA A;  1QVS A;  4F29 A;  3N5L A;  5CBS A;  4LQ5 A;  4NWC A;  2AIX A;  3MP6 A;  1KZ8 A;  3WAF A;  1MG1 A;  1NNK A;  4EF1 A;  5AA1 A;  4H0W A;  3O6I A;  3TTM A;  3ODB A;  4IO5 A;  4HE0 A;  3HHF A;  2PT1 A;  2HHM A;  4NF8 A;  3FXB A;  1EU8 A;  1XT8 A;  2DE4 A;  3MW0 A;  4ELQ A;  2Q88 A;  1IIW A;  1MDQ A;  4GIZ A;  1PC3 A;  3UOR A;  1H3D A;  3WAE A;  1MQG A;  2ANJ A;  4P0G A;  3T96 B;  5TP9 B;  1MY1 A;  4MNI A;  4PC9 A;  4O7M A;  2HZL A;  5IGA A;  3H6W A;  2OLB A;  5H8H A;  1QW0 A;  1PB8 A;  1MY0 A;  2RC9 A;  3BIG A;  3T66 A;  2FYI A;  1ZKB A;  2FA7 A;  3G3G A;  4QFO A;  1BLF A;  4R74 A;  2I0B A;  3FJ7 A;  2AL5 A;  4NAP A;  1QUJ A;  2ZMB A;  4ECF A;  4R6Y A;  3GZG A;  4P11 A;  4RJZ A;  3QXM A;  1KWH A;  3SER A;  3FIR A;  1LBB A;  2CEX A;  1S50 A;  1N04 A;  4JB7 A;  3PD8 A;  1LGB C;  2XXW A;  4TOZ A;  1MXY A;  4PDD A;  2PVU A;  2ZYM A;  4HTG A;  4U4X A;  3RPW A;  2FNC A;  2HQ0 A;  2KR0 A;  2NUV A;  1AL3 A;  2QVU A;  5IZ3 B;  4ZEC A;  1FQF A;  3TQW A;  2FIX A;  3MUQ A;  4GF8 A;  2Q74 A;  4OQO A;  4XKP A;  1Q1K A;  4C1T A;  1G0I A;  4YIC A;  3I3V A;  3KC0 A;  1OIB A;  3K01 A;  1A7L A;  4QBA A;  2F34 A;  2I4C A;  2H4I A;  1YAE A;  1O7T A;  4LUB A;  1BIY A;  1ZU0 A;  1DBZ A;  1LEV A;  3S9L C;  4PF8 A;  2F6G A;  3SDF A;  1OMP A;  3GBB A;  4KPT A;  5CMM A;  3MVY A;  1FPL A;  1NV2 A;  5L9M A;  1MQJ A;  5J16 A;  1UTB B;  5HM4 B;  4G4P A;  4ZS9 A;  3JV9 A;  1MS7 A;  1NV6 A;  1NV0 A;  4UAB A;  4ELO A;  4IY6 A;  2B4M A;  4ELP A;  3E9X A;  4IO3 A;  1K9Z A;  3RUM A;  4YZZ A;  1B7U A;  3Q25 A;  3IL1 B;  2F7A A;  4KQP A;  3MVW A;  4OEV A;  3MPK A;  4PF6 A;  3TZA A;  1A8E A;  2CZL A;  3W9W A;  4OYV A;  3FVK A;  1MY3 A;  4O3A A;  4F2O A;  1RDZ A;  2P3N A;  2WKY A;  4O94 A;  3Q27 A;  4U21 A;  3O29 A;  4QFP A;  2W7Y A;  4F3G A;  3B8B A;  4PBH A;  3TTN A;  1VFE A;  2O1L A;  1H45 A;  1YTV A;  1CE2 A;  1Z7M E;  2DYX A;  4U23 A;  4N4U A;  3SEW A;  5TPA A;  5AA4 A;  4M4G A;  1D9V A;  2QJE A;  1FSA A;  1SW2 A;  2GH9 A;  1L5T A;  1JNF A;  4MHF A;  1USY H;  1US4 A;  3ISP A;  1MXW A;  2RKM A;  4N91 A;  3VVD A;  4PFB A;  3LR1 A;  4QFL A;  4C1U A;  2F7C A;  3LUZ A;  5IZ3 A;  1NMU A;  3K6U A;  4N17 A;  4PBQ A;  4G61 A;  2XD2 A;  1KA1 A;  4R6K A;  2R6G E;  5DVI A;  4U1O A;  3THI A;  3IFC A;  4HW8 A;  3QUJ A;  4RPO A;  1POY 1;  3QIM A;  2ONR A;  4WED A;  2R8T A;  3C9H A;  4N13 A;  1Y3P A;  1NV5 A;  4RK2 A;  5L9S A;  3PMW A;  1YPN A;  3KC1 A;  2WX9 A;  2F8D A;  5ET5 A;  3HHG A;  3S9E A;  3DP4 A;  3PUY E;  4XXU A;  2R71 A;  2HAV A;  2X7Q A;  4MLQ A;  3A3C A;  1FPG A;  4O7I A;  4UAC A;  2Z8F A;  5ET6 A;  4RK9 A;  4ZEF A;  1FPI A;  2UVG A;  3TCG A;  1B51 A;  4FIM A;  3CHG A;  2QPQ A;  2HCA A;  1XHY A;  4ZEK A;  1QKB A;  1HSJ A;  3IOV A;  2QRY A;  3Q26 A;  4ZEB A;  1URG A;  3L6G A;  4N15 A;  1B3L A;  1US5 A;  5FHO A;  3FZV A;  2F6P A;  1B1H A;  2XXY A;  1RDY A;  2E1S A;  3K1M A;  2ZNS A;  4Z0I A;  3KZG A;  4JDF A;  1BP5 A;  2V3U A;  1VSO A;  4GWO A;  4MAG A;  4HXV A;  2GHB A;  4LA9 A;  4EQB A;  2X26 A;  3MP1 A;  3BIH A;  5AA2 D;  4H5G A;  4FJP A;  3LUY A;  5A5L A;  4G68 B;  3OO6 A;  1I69 A;  1POT A;  4YU0 A;  4R6H A;  5BUU A;  1IMA A;  3BFT A;  3QAX A;  3K6X A;  1VR5 A;  1FPK A;  4OMB A;  4N6D A;  3QMF A;  3IFA A;  4H67 A;  2O1M A;  4FEB A;  1FPF A;  3PGF A;  5LDZ A;  3IJO B;  3T9X B;  2ZZX A;  4GX6 A;  4I40 A;  2UVH A;  1N3W A;  4OZ9 A;  3VXB A;  4I1D A;  5JTY B;  4YKI A;  4XFE A;  1URS A;  1DOT A;  4GQO A;  4OVP A;  1UIU A;  1LBX A;  1B05 A;  3C35 A;  1LAX A;  2DE3 A;  4RA1 A;  3C36 A;  2H25 A;  4GOT A;  2P1S A;  1NNT A;  1INP A;  4N8Y A;  5I2N B;  1I6B A;  4JWX A;  4AS5 A;  1LAG E;  2YLN A;  4NGU A;  1MPC A;  1FQE A;  5EYH A;  1MQI A;  1AMF A;  4IO4 A;  1LFH A;  1TT1 A;  4ONY A;  1FBD A;  2NVU B;  2BJI A;  2REG A;  3D1R A;  3TPA A;  4HE1 A;  1SW4 A;  5H8H B;  5FHN A;  5KZT A;  3CFZ A;  4G8M A;  5KDT A;  2ONK E;  4F1U A;  4R73 A;  1FPD A;  4PTK A;  3RT6 B;  1GTK A;  3ZSF A;  2Y5L A;  1MRP A;  5ITO A;  4FAT A;  3H06 B;  4KI0 E;  5KCJ A;  5EHS A;  1VFD A;  1FCK A;  4QF9 A;  2FIE A;  2NOO A;  5IKB A;  4ELR A;  2ONS A;  3E4R A;  4QSD A;  4JVI A;  2DWH A;  4Q0C A;  3U92 A;  4HCY A;  3ECR A;  2VT5 A;  4M1V A;  4DLD A;  2REJ A;  1N76 A;  2ALU A;  4TQU Q;  3RY3 A;  5LOM A;  4EUO A;  1LAH E;  2O69 A;  3ILU B;  4GFR A;  1OLC A;  3OEL A;  3UIF A;  3MVX A;  1H43 A;  4F2Q A;  2D21 A;  3FGS A;  1K9Y A;  1EZP A;  1GV8 A;  2KQZ A;  2D5W A;  4NTL A;  2NWJ A;  1WDN A;  1B0L A;  3RT8 A;  3U65 A;  5DW8 A;  3U1O A;  3RPL A;  4DI4 B;  2GQ1 A;  1S9T A;  3EHT A;  4MBP A;  3ROJ A;  2IEE A;  3VXC A;  3MPL A;  4G8H A;  4P56 A;  3EF7 A;  2BJJ X;  5EQ8 A;  3W15 C;  3FXQ A;  1R9Q A;  3MYU A;  3E78 A;  4RPN A;  3SZP A;  5JTY A;  1WVJ A;  2M8C A;  4H1X A;  1FQB A;  4JSO A;  3K4U A;  1UQW A;  4DDD A;  1SPI A;  3JZJ A;  2ZZW A;  5I2N A;  5EYG A;  3RTW B;  4FOR A;  2XXR A;  3FXR A;  4H45 A;  1ZMG A;  1URD A;  1MXV A;  4KR5 A;  3H6T A;  3V83 A;  3LSW A;  2F3B A;  2RCB A;  2I49 A;  4GXA A;  4XEQ A;  1PB7 A;  1BKA A;  2V4C A;  3P7I A;  3T9U A;  3MBP A;  1FBE A;  1FBP A;  2Q2A A;  2OJT A;  3M8U A;  5K2Y A;  2A5S A;  5TPA B;  4DCY A;  4OHN A;  3K6W A;  3DM0 A;  1MH3 A;  1P1W A;  2F3D A;  5AA4 B;  1FJ6 A;  4XTC Q;  3T0J A;  2VGQ A;  4G68 C;  1BK4 A;  1NV7 A;  2XWO A;  5F1Q A;  3TEL A;  1Q9D A;  3B6Q A;  2P3V A;  3SEX A;  1JET A;  1JVX A;  4C0R A;  2Q9T A;  3FVN A;  1NL5 A;  4N8G A;  3IX1 A;  4OA4 A;  4AB6 A;  3GLB A;  1SI1 A;  2V93 A;  4G8N A;  1B3F A;  4NF5 A;  2VOZ A;  4NN3 A;  1NI9 A;  1MPB A;  4YMA A;  4IO7 A;  2WBD A;  2KLF A;  4I9D A;  3M3F A;  1IMF A;  3TOD A;  2RC7 A;  2D3I A;  4X9T A;  4RNS A;  4MNC A;  3MZB A;  2V25 A;  2O7U A;  3IB0 A;  5I2K B;  5EYF A;  3FJM A;  3TCF A;  5HBC A;  3VVE A;  3TUS A;  3PMV A;  4GWX A;  4U2R A;  1B46 A;  2XXQ A;  3S9M C;  5HPQ A;  3E3K A;  3CVG A;  4JWY A;  2VPN A;  3TKD A;  2HFB A;  2HAU A;  3MZ1 A;  1B5H A;  1PEB A;  5K2X A;  3MJN A;  4EXK A;  1FPE A;  2XX8 A;  4F22 A;  1IMC A;  4IO2 A;  1B4H A;  5I58 B;  1FTJ A;  4DXB A;  1MDP 1;  2OBG A;  1Y3Q A;  2AYS A;  2O68 A;  4BDQ A;  4OES A;  1TXF A;  1LAF E;  4F3P A;  3QYT A;  3MZ9 A;  1PBP A;  1FJ9 A;  2THI A;  4LZ7 A;  4PQJ A;  4RXL A;  2ZNU A;  4EXL A;  4NG7 A;  3T9V A;  4ZZA A;  1M5C A;  1ZIU A;  4NMY A;  3H4Z A;  2QFL A;  4U4S A;  1B3H A;  1LB9 A;  1D3K A;  3SET A;  2XA5 A;  4MIJ A;  4XKN A;  1MQH A;  1NV3 A;  3IOT A;  3TAJ A;  5CI5 A;  3N26 A;  3OO7 A;  3KJT A;  1NFT A;  2Z8E A;  4R75 A;  5CMK A;  5I57 A;  1FQC A;  1QKA A;  2P2A A;  3OO9 A;  4JBZ A;  4GWS A;  2F78 A;  4Q8R A;  1NV4 A;  4X1D A;  3UP9 A;  5ICT A;  1QUK A;  1VDW A;  1QUI A;  2QMX A;  3QSL A;  3KEI A;  4QSE A;  2HXR A;  1A99 A;  3IO4 A;  4X1B A;  2GHA A;  4QFN A;  3CSB A;  4MH5 A;  3RGY A;  2WYK A;  1B40 A;  5AA2 A;  4BDL A;  3FAS A;  4GXS B;  4GLI A;  4ZED A;  2HXW A;  3R7X A;  2CMO A;  3OSQ A;  1LFI A;  1SYH A;  3RN8 A;  3CR9 A;  3PUX E;  2OWS A;  4GBV A;  4NED A;  1DTZ A;  3DP8 A;  3G3H A;  4G77 A;  2ZYO A;  1R6Z A;  4HE2 A;  3B7D A;  4PGN A;  3GBA A;  2XX7 A;  3U93 A;  3O2A A;  1FRP A;  2OWZ A;  1SD3 A;  5H8F B;  3PU5 A;  1NH7 A;  2QMW A;  5L8D A;  5I2K A;  3K00 A;  2WBB A;  3S4U A;  4H8I A;  4LZ8 A;  1G0H A;  3O6G A;  4QHQ A;  3OEM A;  1MY2 A;  2G29 A;  2ZYK A;  1GVC A;  2YPN A;  3ONM A;  4N6K A;  1IME A;  2O7I A;  4DIG A;  1ELJ A;  5KDT B;  3FV2 A;  1F9B A;  5FTH A;  3SEY A;  2VD3 A;  2F97 A;  3C31 A;  5CRY A;  5IM2 A;  1OQG A;  2DXR A;  5I58 A;  4E0X A;  3KN7 A;  2B4L A;  5KCJ B;  4PFW A;  2VPO A;  4KYD A;  2ZNT A;  1FTA A;  1NH8 A;  2OK2 A;  2XXI A;  2Y7I A;  4F1Y A;  4BDR A;  3H7M A;  3EPE A;  1NNP A;  1M5E A;  4LAT A;  3PD9 A;  2CZK A;  5CC2 A;  2ZXT A;  3MP8 A;  4GWU A;  5EQ9 A;  4HS7 A;  3FVO A;  4NF4 B;  2DWJ A;  3B50 A;  1PBQ A;  1FTL A;  4X8R A;  4O8M A;  2I4B A;  3OEK A;  4BLA A;  4PFY A;  3LSF B;  3PPO A;  4ZDM A;  4GVO A;  1LST A;  3BBR A;  1LCT A;  2V84 A;  2XXH A;  3PPN A;  3OD7 A;  3TEP A;  1FBC A;  1IXG A;  4PFU A;  4OFO A;  1OVB A;  5M2V A;  4F3S A;  3RTF B;  1NNF A;  3CIJ A;  4YKK A;  2Q8M A;  1FQD A;  2QL3 A;  4TLM B;  3RPL B;  4POX A;  1R9L A;  1B6H A;  3C4M A;  1WOD A;  1RYX A;  2RC8 A;  4AS4 A;  3KN8 A;  4ZE8 A;  1FQA A;  4WKM A;  4MCO A;  1LBW A;  3ILT B;  1FBG A;  1A55 A;  3OO8 A;  2GFE A;  3MWB A;  1UTH A;  1PDA A;  1ZJL A;  2RCA A;  5I56 B;  5F24 A;  3A09 A;  1MM7 A; 
#chains in the Genus database with same CATH homology
 4DI4 B;  2GQ1 A;  3ROJ A;  3GYY A;  2HPG A;  1NUX A;  1DBZ A;  4P56 A;  1LEV A;  4PF8 A;  5EQ8 A;  4MMP A;  4NF0 A;  3MYU A;  3E78 A;  1FPL A;  1NV2 A;  3SZP A;  5J16 A;  2DE2 A;  3PTY A;  4KXP A;  2F5X A;  1NV6 A;  1NV0 A;  2ZZV A;  4HCW A;  2CZH A;  4UAB A;  5IZZ A;  2B4M A;  4PAI A;  1SPI A;  2JJK A;  2ZZW A;  1K9Z A;  1NUY A;  4OVT A;  4YZZ A;  4F19 A;  5EYG A;  3A29 A;  2CZI A;  4H45 A;  4PE3 A;  1EYI A;  4PFI A;  3T1B A;  2F3B A;  5ESY A;  4PF6 A;  1FPB A;  3W9W A;  4XEQ A;  4MX6 A;  2PFY A;  2V4C A;  2XWV A;  1IMB A;  1FBE A;  1RDZ A;  2P3N A;  4O94 A;  1FBP A;  4LN5 A;  4MNP A;  3B8B A;  2F3D A;  1FJ6 A;  4PBH A;  3T0J A;  3KBZ A;  4JVC A;  1BK4 A;  1NV7 A;  2XWO A;  4OVS A;  4F18 A;  1Q9D A;  1NV1 A;  2P3V A;  5JK4 A;  5LTC A;  5IZ1 A;  2Q9T A;  4N8G A;  4OA4 A;  5CM6 A;  1KA0 A;  4N4U A;  1D9Q A;  4NN3 A;  1NI9 A;  4GX3 A;  2WBD A;  1FBF A;  1IMF A;  5T3J A;  4X9T A;  1FSA A;  2PFZ A;  4MNC A;  4MHF A;  4PCD A;  2Y5K A;  4GWY A;  4MJO A;  1YXI A;  3ISP A;  4N91 A;  4GWX A;  1YZ0 A;  4PFB A;  4PDH A;  2QVR A;  2VPN A;  3LUZ A;  5IZ3 A;  4N17 A;  3E79 A;  5I5P A;  4PBQ A;  4G61 A;  1FPE A;  1IMC A;  1KA1 A;  4GWW A;  2QVV A;  3IFC A;  2OX3 A;  3RYD A;  2V3Q A;  1FBH A;  4DI3 D;  2R8T A;  4P9K A;  1FJ9 A;  1NV5 A;  3KC1 A;  2WX9 A;  3MST A;  4NG7 A;  5ET5 A;  1RDX A;  2QFL A;  2XWK A;  1NUZ A;  1NUW A;  2XA5 A;  1FPG A;  4O7I A;  4MIJ A;  1IMD A;  4NX1 A;  4I3E A;  1NV3 A;  5ET6 A;  1CNQ A;  1FPI A;  3CHG A;  5FBP A;  4P3L A;  2QPQ A;  3W9V A;  1AWB A;  1JP4 A;  4PGP A;  2DVZ A;  5EQ7 A;  4GWS A;  4GWZ A;  2HZK A;  1NV4 A;  1VDW A;  4GBW A;  3FBP A;  4N15 A;  3EKI A;  4QXD A;  2HXR A;  4JVD A;  5J1D A;  2WYK A;  1RDY A;  4PET A;  4OVQ A;  1EYJ A;  1LBZ A;  4N81 A;  1EYK A;  4HXV A;  4MAG A;  4P47 A;  3BIH A;  4PFR A;  4P1L A;  5A5L A;  2PCR A;  4GBV A;  4P1E A;  2XXK A;  1XI6 A;  1LBV A;  1IMA A;  4FBP A;  1YYZ A;  4I3Y A;  3NOH A;  4F1V A;  4HE2 A;  4PGN A;  5EQA A;  1FPK A;  4N6D A;  3QMF A;  3IFA A;  1FRP A;  2OWZ A;  1FPF A;  5LDZ A;  4XF5 A;  2ZZX A;  4GX6 A;  4MEV A;  4I40 A;  2WBB A;  2MKZ A;  4OVR A;  1G0H A;  2WEF A;  1LBY A;  3HFU A;  4XFE A;  1QGX A;  4OVP A;  1LBX A;  4N6K A;  1IME A;  2DE3 A;  2WYP A;  5I3S A;  1INP A;  4N8Y A;  4AS5 A;  4NGU A;  1KZ8 A;  5IM2 A;  1FPJ A;  5EYH A;  2B4L A;  4OAN A;  4H46 A;  4HE0 A;  2VPO A;  1FBD A;  2BJI A;  2HHM A;  3D1R A;  4P8B A;  5I7I A;  4HE1 A;  1FTA A;  3FXB A;  2DE4 A;  4F1U A;  2CZK A;  1FPD A;  4PTK A;  4GWU A;  2Y5L A;  5EQ9 A;  2DDK A;  2L5V A;  3B50 A;  4MNI A;  4X8R A;  4PC9 A;  4O8M A;  4O7M A;  2HZL A;  5IGA A;  4PAK A;  2CEY A;  2FIE A;  3BIG A;  4JVI A;  4IR8 A;  4HCY A;  2VT5 A;  4NHB A;  1DCU A;  4M1V A;  1FBC A;  2FVZ A;  4NAP A;  3LV0 A;  2CEX A;  4X04 A;  2XWI A;  2FHY A;  2Q8M A;  4GX4 A;  4PDD A;  3RPL B;  2KR0 A;  2QVU A;  5IZ3 B;  2FBP A;  1K9Y A;  4AS4 A;  2KQZ A;  4PAF A;  2FIX A;  2Q74 A;  5ET8 A;  4MCO A;  1G0I A;  1LBW A;  1FBG A;  1DK4 A;  3U65 A;  4NQ8 A;  5DW8 A;  4YIC A;  5ET7 A;  3KC0 A;  5F24 A;  3RPL A;  4QBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...