1XI6A

Extragenic suppressor from pyrococcus furiosus pfu-1862794-001
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
249
structure length
234
Chain Sequence
KLKFWREVAIDIISDFETTIMPFFGNPDGGKLVKLVDKLAEDLILSRITELGVNVVSEEVGVIDNESEYTVIVDPLDGSYNFIAGIPFFALSLAVFKKDKPIYAIIYEPMTERFFEGIPGEGAFLNGKRIKVRKSISFYSRGKGHEIVKHVKRTRTLGAIALELAYLAMGALDGVVDVRKYVRPTDIAAGTIIAKEAGALIKDSAGKDIDISFNATDRLDVIAVNSEELLKTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords extragenic suppressor
publication title Extragenic suppressor from Pyrococcus furiosus Pfu-1862794-001
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 61
structure length 234
sequence length 249
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1xi6A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1xi6A02
3QMFA 4PTKA 3RPLA 2PCRA 4HXVA 1LBYA 5F24A 4GWYA 1IMFA 3KC1A 1FBDA 4GWSA 5ET5A 4GBVA 2P3VA 1G0IA 1FSAA 1CNQA 1NV4A 5I3SA 4GWZA 1NV0A 1VDWA 2F3DA 1FBEA 3KBZA 4QXDA 4MJOA 2CZHA 4I3YA 1K9YA 3BIGA 5ET8A 4H46A 1YXIA 5IZ3A 2WBDA 5EYGA 4FBPA 1XI6A 4I3EA 3D1RA 5DW8A 2OX3A 1RDZA 5EQ9A 1IMCA 1FPIA 2FVZA 4GX4A 1FJ6A 1QGXA 4KXPA 1DCUA 1FPDA 2JJKA 3FBPA 3ROJA 1FRPA 5IZ3B 1FJ9A 5IZ1A 1EYIA 1Q9DA 1DK4A 3BIHA 3IFCA 2QFLA 1FPEA 1RDXA 1AWBA 1RDYA 2FIXA 4HE2A 4GX3A 2Q74A 5A5LA 4HE0A 2FIEA 4G61A 2BJIA 2Y5KA 2P3NA 2FHYA 5FBPA 1LBWA 1IMBA 1FPLA 5LDZA 2CZKA 1FPKA 4HE1A 1FTAA 4IR8A 1JP4A 1NV7A 1BK4A 2OWZA 2QVUA 1NV1A 1DBZA 4GWWA 1FPJA 1LBXA 4O7IA 1NV2A 1FBFA 4I40A 5T3JA 3LV0A 1FBHA 2R8TA 2Y5LA 1FBGA 1G0HA 4GX6A 1YYZA 1FBCA 1IMAA 1K9ZA 4N81A 1NV5A 2WEFA 5EQAA 5ET7A 1KZ8A 4AS4A 1NUZA 3KC0A 3B8BA 4AS5A 1EYJA 5ESYA 1KA1A 1IMEA 5EYHA 3A29A 1NUWA 1NV6A 2FBPA 1IMDA 2VT5A 5ET6A 1EYKA 1FBPA 1NUXA 1FPBA 1FPFA 1NUYA 4GBWA 5EQ7A 3RYDA 1KA0A 2QVRA 4GWXA 3T0JA 1YZ0A 2CZIA 5EQ8A 3LUZA 1INPA 1LBVA 1SPIA 2F3BA 4GWUA 2Q8MA 3RPLB 5J16A 2HHMA 1FPGA 1D9QA 2GQ1A 1LEVA 1LBZA 2QVVA 1NI9A 3IFAA 1NV3A 2DDKA 2WBBA 4H45A
chains in the Genus database with same CATH superfamily
2DE4A 1Y1MA 1AL3A 2PCRA 1JQFA 1IMFA 4AQ4A 3TYHA 5ET5A 4MLQA 2P3VA 5AA4A 5H8HA 1Y3QA 2OBGA 3ODBA 4MJOA 3IOTA 2Y7IA 1YXIA 3THIA 4DCYA 2WYKA 3OENA 1US5A 2ZZXA 4XTCQ 2ABHA 3VXBA 5AE4A 2DYXA 3UP9A 1EZOA 3CFLA 1B9JA 2R71A 1B7HA 3TQWA 3BIHA 1UIUA 1KWHA 3RN8A 4PFUA 4F19A 1DMBA 1Y3NA 3VFJA 3P7IA 1ZIUA 4YAHX 1LBWA 4ZZEA 3OEKA 1FQFA 2V3UA 4OWDA 2VOZA 2DWIA 3IOUA 1PEBA 4GWWA 4H67A 2OCUA 3IB2A 4MNCA 3MAMA 1MQGA 3RQTA 1ZMGA 3K01A 2DE3A 4F31B 1A7LA 4PQJA 4OENA 1FPFA 3GBAA 4GBWA 1NKXA 2QMXA 2D5WA 2KQZA 5I2NB 3T0JA 1XC1A 3MZ9A 4IO6A 4ZEDA 1B1HA 1I6QA 3VV5A 3MSTA 3MW0A 3SEUA 2RCAA 4NF8B 3V8XB 2HEUA 4KCCA 4Q30B 4GWSA 3PUZE 4XKRA 1NV4A 5AA2B 2GH9A 2H9BA 3PPRA 1LFGA 1JW5A 1N3WA 4MEVA 2XXHA 5IZ3A 2GFEA 3VXCA 1YAEA 2WBDA 3EHUA 1IXHA 2V93A 1H44A 1JVXA 2IA4A 1B4HA 5HBCA 5AA2A 4F22A 5JTYB 3L6GA 4RY1A 3CI8A 1FJ6A 2VHAA 1DTGA 1NH8A 3TFLA 3SETA 3JZJA 1B0HA 5DVIA 3E79A 3TAJA 1ZLQA 1R6ZA 2QFLA 2DQVA 1AH5A 1SYHA 3IL1B 2ZYNA 3CSBA 1FQDA 2P3NA 2Y7KA 2NWJA 2DXRA 1IMBA 2ZZVA 1FW0A 2R6GE 1HSLA 3MP6A 4IY5A 2O1MA 1Y4CA 4OXVA 2X7QA 1MDQA 4R2BA 3PUWE 1YYZA 1LBCA 1D9VA 2WEFA 5EQAA 3KZGA 4Q5TA 1VFDA 3C9HA 4F2OA 1ZJLA 3S9EA 3FVKA 4P1LA 2RF1A 4WKMA 2XWIA 3A3UA 3TELA 4ELQA 3B50A 3T1BA 2PX1A 4GWXA 4ZE8A 2ZNSA 1YZ0A 3FASA 4PGPA 5TU0A 3RPLB 2AL4A 1NNTA 3DP6A 2HHMA 2Q9TA 3V89B 1UTHB 2F7AA 1A40A 3MVXA 3EQ1A 2FYIA 3PPNA 2QS4A 1AIVA 3RPLA 1GV8A 2YJPA 1MXVA 1N3XA 3KJTA 3M3KA 2GHAA 1PBPA 3KC1A 1FBDA 4KFQA 1UTHA 5I3SA 3G3IA 4GL0A 2HZLA 5CMBA 1K9YA 5CI5A 4H46A 1EZ9A 1SW4A 4FBPA 4Q8RA 3QUJA 3VLWA 3EHTA 2Y7PA 1ZTYA 3MQ9A 4EF1A 3C32A 1GR2A 4PFIA 3H6VA 2Z8EA 3HFUA 3JYRA 1US4A 1EYIA 1Q9DA 1HSJA 1B32A 2XXTA 4U22A 1MXWA 2VD3A 3CIJA 5B7DA 4O3CA 3OO7A 3D4GA 4G61A 1URGA 2BJIA 3TTMA 1N7XA 4RPOA 3FXRA 2Y5KA 3IO4A 2QJEA 1ZU0A 4YKIA 4BDMA 2O1LA 3GBBA 1EH3A 3TPAA 4BDOA 4ZECA 1OLAA 3MVZA 1P1UA 1O64A 1FPJA 2QRYA 1NV2A 2A5TB 5ELVA 4OFJA 3RTWB 2V84A 2XXYA 5DVFA 1SW1A 4G77A 2A5TA 3T22A 1NUZA 2ZXTA 4R9FA 5I2KB 4DLDA 4P56A 2YPNA 4LZ7A 3C35A 3USDA 4JBZA 5AA1A 3KGCA 5BWJA 1FPBA 4JWYA 4RPNA 5EQ7A 5A5XB 2Q8JA 1NNFA 2XXVA 1INPA 3CG1A 4PBQA 1NI9A 4GRKA 4KCDA 1Y3PA 3QMFA 1VFEA 4DXCA 2THIA 2OK2A 4ELOA 4LATA 3K6WA 3I6VA 2WKYA 3Q25A 3JV9A 5DVJA 1FBEA 4O3AA 3FXBA 4NF5B 2FA7A 4WXJA 4I3EA 4DZ1A 3T9UA 2XX7A 4JB7A 3CFZA 1XHYA 1FPIA 2FNCA 1A55A 3IO6A 1IXIA 4GX4A 1H45A 4JWOA 2HPGA 5IZ1A 1D9YA 3BFTA 5ICTA 4N8YA 3N94A 4IB2A 1ZBMA 3PMVA 1JETA 1NNPA 4NG7A 5ITOA 4X04A 3NOHA 2P1SA 2OWTA 2W7YA 5LDZA 2O7IA 4HE1A 4MIJA 2O69A 2UYEA 4L17A 4PFWA 5DTBA 1ZKBA 2UYFA 1LBXA 4EXKA 1B6HA 2UVIA 1FTJA 4GIZA 4F3BA 2QS1A 4YZZA 3LV0A 2R8TA 2DVCA 4LQ2A 4PDHA 4NF0A 3WAEA 1LAXA 4DXBA 3ECRA 2KR0A 1LFHA 2E1SA 1MXXA 3QUFA 1LAFE 3KG2A 3S4UA 1NUXA 4BLAA 1H76A 1VSOA 4N6PA 4O8MA 2VGQA 3FZVA 5F1QA 4N6DA 1AOVA 3T9XB 3ZKLA 4GWYA 4PTKA 3MP8A 3W9WA 5KCJA 5I58B 3IAZA 2WYPA 3H7MA 3BBRA 4H1XA 1OMPA 4MH5A 1QKAA 3BIGA 5I58A 1CB6A 3G3HA 4G8MA 2Q2AA 3TDJA 4YMAA 3O2AA 5JEIA 3GYYA 4PGNA 3OOAA 4NWDA 3ONMA 4XFEA 1B2HA 3VVEA 1MY1A 3DM0A 3FJMA 4JDFA 1D4NA 4IGRA 4N13A 2JJKA 5CM6A 3CVGA 1Z7NE 1B5HA 3IFCA 3G3KA 1FPEA 3TTRA 4PC9A 4OVRA 4U1ZA 5FBPA 2HZKA 5LTCA 4OTEA 4FEBA 4FAJA 1R9LA 2QVUA 4KPTA 4NN3A 2F7CA 4GQOA 1WDNA 3HN0A 3O97A 1YTVA 3FUZA 3W9VA 3EHSA 3MUQA 2Y5LA 4DIGA 1B52A 2H99A 4ZEKA 4BDRA 2ZYOA 2HXWA 3N5LA 1NUYA 1B05A 3RPWA 5EQ8A 3LUZA 4GWUA 1NL5A 3R6UA 4F3SA 4QSDA 2GQ1A 4RYAA 2QVVA 3IFAA 3BFUA 4H45A 3E9XA 4C0RA 2BJJX 4YKPA 1N7WA 4OVPA 3LBSA 3CRBA 3B6QA 3FJ7A 3EF7A 3KBRA 5H8QB 1G0IA 3KN7A 4YB6A 5CMCA 1MY2A 1IQ7A 1N84A 2F8DA 2XX9A 4MMPA 4EQBA 4C1UA 4OETA 1B3EA 5AA4B 3IOVA 1MQHA 2F78A 4OVSA 5H8HB 4DI3D 3TCHA 3K6UA 1DCUA 3FBPA 4I8CA 1DK4A 3VDFA 2ESNA 3K0VA 5HPQA 5CBSA 4N6KA 2P2AA 1RDYA 4HE2A 3ILTB 5CMKA 3MYUA 4GL8A 4YKKA 2ZYMA 3RTFB 4MNPA 1NH7A 3S9MC 4NMYA 3UN6A 2DSFA 1P1NA 1BIYA 4POXA 4IO4A 4RK9A 3QSLA 1FBHA 2XD2A 4LONB 1MQDA 1XVXA 4N8GA 4PFTA 1SDXA 2QS2A 4JVDA 1AMFA 4ND9A 1MDP1 3F11A 3E13X 3V83A 4QF9A 1B3LA 3L6HA 2HCAA 3G3FA 4BDQA 1Y4TA 3S9NC 4DDDA 3SEWA 2PT2A 5DYHA 4XKQA 4P9KA 2DP8A 1MS7A 2DS9A 1A8FA 1OLCA 3G3GA 1LBYA 2ZYKA 2H98A 2XXPA 3A3CA 1FSAA 4N4UA 2O51A 4UACA 4G68B 1MXUA 4H8JA 5FHMA 4EF2A 5EYGA 4QHQA 1XI6A 5DW8A 5EQ9A 1MQIA 4G68A 1SQYA 2QSXA 4N07A 4RXLA 5IZ3B 2RINA 3KOSA 3TODA 2ALUA 4OEUA 3OO8A 4YKJA 5IM2A 4F3PA 1SVXB 3H3GA 3LUYA 3DLNA 5M2VA 1AWBA 3N6TA 2FIXA 5IAIA 2Q74A 4HE0A 4R72A 1YCJA 5H8FB 2DVZA 4NF6B 4R73A 4OFLA 3FGSA 4PCDA 5H8FA 4XXUA 4HW8A 3IR1A 2V25A 4OZ9A 4NF6A 1IIWA 5TPAB 4ISUA 1LB8A 1Y9UA 4MAGA 1SW5A 3U1OA 3MVWA 4ESWA 5TPAA 3FD3A 3LSLA 1JNFA 3KC0A 3UK4A 4OEVA 1NV6A 3OMBA 4F18A 1H43A 1MXYA 4YMBA 4U2RA 4OFOA 2H25A 1QW0A 2Z8DA 5I57B 2F6GA 1RKMA 1KA0A 1USYH 3C36A 3CG3A 1SD3A 2P0SA 2WX9A 2Q8MA 4H8IA 5FHNA 2F36A 4XKNA 2F97A 2LAOA 1LGBC 2B4LA 1ELJA 5I57A 4LA9A 1D9QA 2QPQA 2A5SA 3SZPA 4X8RA 3K02A 2XWVA 3T96B 4HXVA 2OWSA 3H6WA 1PB8A 2Z23A 5I5PA 1L5TA 3M8UA 2XXWA 1NV0A 2ZZWA 4PAKA 4EQ7A 3D1RA 4X1BA 2OX3A 4HCWA 1I6BA 2ONRA 3S2VA 4NF4A 5EYFA 4KYDA 3FV1A 3SDFA 2FVZA 2V3TA 4H5GA 5DT6A 4KXPA 5CBRA 2IEEA 2F7BA 4PE3A 2D21A 1DOTA 3O29A 4R2FA 1B4ZA 3U65A 4KQPA 5JK4A 1SYIA 1A54A 2QS3A 5FTIA 2CZKA 4IR8A 3EN3A 4R6KA 1DBZA 1USYE 4DE8A 4Z0IA 5ISUA 3KN3A 4IO2A 3RT8A 2PYYA 3MPLA 1GTKA 1UTBB 1P1QA 1IZ1A 4QBAA 1TXFA 3HHFA 2VT5A 1FBPA 3EPEA 1WVJA 3IX1A 1UTBA 1ATGA 4X48A 3PD9A 1MRPA 2I48A 1QUIA 1Y20A 3ILUB 3FATA 2XXQA 5CRYA 3VVDA 3U93A 4GWOA 3OO6A 3PPOA 1BKAA 4GWZA 1EZPA 3KBZA 3U92A 1LCFA 5L9SA 2I3VA 4F1YA 4R6YA 1POY1 2NOOA 2F35A 4UA8A 2MKZA 1QULA 4NEDA 4HTGA 1QGXA 3OSRA 2HXRA 1TWYA 3QXMA 4QFOA 3ZSFA 1FJ9A 3B7DA 1B0LA 1B51A 4H5FA 2ZNUA 3K6VA 2FIEA 3MZBA 2RKMA 1FTLA 1UIVA 1Q35A 3G3JA 5DEXA 1B1XA 1PDAA 4TLLB 5L9MA 1FPKA 2OWZA 1NV1A 1FCKA 3T93B 5HM4B 1LAHE 3O9PA 4I40A 4POWA 1URSA 4PDDA 2M8CA 1FBCA 4N81A 5ET7A 4X9TA 4AS4A 4MHFA 5EYHA 1SI0A 1IUDA 5H8SA 1N04A 4YB5A 5ET6A 1EYKA 3OELA 3LC8A 2XXRA 3PTYA 2V3QA 4XF5A 1S50A 3FIRA 2CZIA 2RC9A 5J16A 4LN5A 3M3FA 3PMXA 2I4BA 2WBBA 3K6XA 3PGFA 4M4GA 4NWCA 1LB9A 2HAUA 4AB5A 3MPKA 3M3LA 1FQEA 1CNQA 3Q28A 1LSTA 3ISPA 3O28A 4QXDA 3SEVA 5I56A 2CZHA 3CR9A 3TQLA 4QFLA 4N17A 4LVQA 1CE2A 5KCJB 1QJMA 1M5CA 4E0XA 3RT6B 4ZE9A 1M5EA 1OVTA 4BDLA 4NAPA 3QIMA 1B7UA 2ONSA 1B3HA 2L5VA 3TZAA 1JEUA 4Z7EA 4R6HA 1NMUA 3IB0A 3T9HB 4LQ5A 1JP4A 1XVYA 3KN8A 1II5A 1MXZA 2OJTA 1MH3A 3R7XA 1IEJA 4X1DA 4TLMB 1IMAA 5LOMA 1BP5A 3VVFA 1MQJA 1JEVA 2RCBA 4AS5A 5ESYA 2D3IA 1NUWA 1S9TA 2X26A 2XXUA 4KYEA 1JW1A 2RC8A 4AB6A 2QVRA 4F2QA 2DWJA 3CHGA 1SPIA 1M5BA 3TTKA 2VPNA 1UQWA 1FPGA 5KDTB 2VD2A 4NE4A 1N76A 1NNKA 2B3FA 2UXAA 1NV3A 4EQ9A 4JVIA 3FXQA 1TFDA 4MBPA 1XS5A 2ONKE 2XHDA 4I1DA 4MF3A 1LLSA 1D3KA 5KDTA 4IO5A 1B3FA 3K00A 3TEPA 2NXOA 4I3YA 4JSOA 3OEMA 2F6PA 2XA5A 3H6TA 3T9VA 1O63A 1PB7A 3IJXB 1Z7ME 5CC2A 3VE1B 3LR1A 4OESA 4H6DA 2I0CA 3QK6A 3TUSA 4F1UA 4XEQA 5H8NB 2I4CA 1YPNA 4N91A 5L8DA 2UVGA 2DWAA 5J1DA 3KJ7A 4TQUQ 2B4MA 4U21A 3QAXA 1BK4A 4E0WA 5H8NA 2DXYA 2GHBA 3N6UA 5IKBA 1GVCA 2H4IA 4RK2A 2OPDA 3MP1A 4ONYA 3FVOA 1O7TA 4LZ5A 1DPPA 5BUUA 2CEYA 4P0IA 1IMEA 2ZNTA 4GVOA 1POTA 3EKIA 3FVNA 3E78A 3OD7A 4RNSA 1Y1ZA 4IY6A 4BDNA 3MC2A 4NTLA 3SESA 4K3FA 2CZLA 1BLFA 1Q1KA 4U23A 4PFRA 1FQAA 1IXGA 3H06B 1JVYA 4P47A 4FIMA 4EDPA 3C33A 4I62A 1VDWA 1XOCA 5ET8A 4GXSB 4OA4A 1LCTA 3K2DA 1QUJA 4KR5A 5K2XA 4R9GA 4NX1A 4DI4B 3K1NA 4QRZA 4I9DA 4KI0E 1TT1A 3O6IA 4ELPA 4OYVA 4NQ8A 1R9QA 4FE8A 3SEYA 4PAIA 1B5JA 1DPEA 1H3DA 3O6HA 5I84A 4QFNA 3I3VA 2AYSA 4GX3A 3IORA 1HSEA 5FHOA 3HCQA 4F1VA 4KD5A 3O6GA 4MX6A 3KSJA 2I58A 1NFTA 3CFXA 1FQBA 1FTAA 1MH4A 3QYTA 1NV7A 4IO3A 3OSQA 2KLFA 2G29A 4KYSA 4JWXA 5T3JA 3FVGA 1FBGA 4FORA 2I3WA 3MWBA 5I2NA 3KSXA 1LBBA 3T66A 4C1TA 3Q27A 3HHGA 1A99A 4DCXA 1QVSA 5F7VA 4YU0A 2XX8A 3K1MA 1R1NA 4FJPA 4NF8A 4ECFA 1P1OA 1B3GA 1FTMA 5KZTA 2G93A 4LZ8A 4F39A 2XD3A 1I6AA 2DDKA 1FTOA 3RGYA 4H0WA 4OANA 5EHSA 2O6AA 3LSFB 3TKDA 2OLBA 4GBVA 4MFIA 3WAFA 2Q88A 1PC3A 4U1OA 5JTYA 4R75A 3DELB 2RC7A 2F3DA 3AXFA 5ITPA 1PBQA 4ZEBA 4RA1A 4U4XA 3GZGA 4PF8A 4YB7A 2Y7WA 2HFBA 2V4CA 4R74A 3H03A 4KHZE 2Q89A 2UVJA 4G4PA 1MY3A 2O84X 5AA2D 1RDXA 3TTLA 4NF4B 4ZEIA 5IZZA 2Q2CA 3MVYA 3SKPA 2FHYA 4QFKA 3O66A 2I49A 2ZMBA 2OPEA 4M1VA 4OQOA 5FTHA 4O7MA 5ICQA 1MY4A 1B5IA 1FBFA 3PD8A 4PP0A 4O94A 4PBHA 3FV2A 2DWHA 3IJOB 4F3GA 1SBPA 2QMWA 1MPDA 3RLFE 1B46A 3MBPA 3GLBA 3B8BA 2VP1A 3RNNA 1MM7A 1IMDA 3K1PA 2NVUB 1M5DA 4TOZA 1IITA 5B70A 2AL5A 4HCYA 3E4RA 2I0BA 1FTKA 4JSDA 4LUBA 3LSXA 1QKBA 4MLVA 2UVHA 4IO7A 2YLNA 1VE4A 4P3LA 1BTJA 1P99A 5EHMA 4PAFA 1GGGA 3C31A 3UGWA 4JXIA 4OVQA 2Y7RA 1IMCA 1PB9A 2O7UA 2OZZA 4NGUA 4QSCA 3ROJA 4RJZA 1M5FA 1S7YA 3Q26A 1LFIA 4P8BA 3S9LC 3HV1A 5L9OA 1RYXA 1N0TA 3KOTA 1B7ZA 4OVTA 4NHBA 2R9JA 1FPLA 4GXAA 3ZKKA 3G7WA 1A8EA 5CMMA 3DP4A 3E3KA 4XKPA 5I2KA 3PV0E 4OHNA 3A09A 5DEXB 4O7IA 4G8HA 1IXCA 2ANJA 3LSWA 4FECA 4ELRA 4THIA 1G0HA 4GX6A 4G2ZA 5A5XA 1B58A 3SEXA 2PFZA 2O68A 1EYJA 3C4MA 4FEDA 4H65A 2FBPA 4OMBA 1OIBA 2PT1A 5TP9B 3RYDA 4EXLA 2DE2A 1LBVA 2F3BA 3H6UA 1MG1A 1SI1A 3PU5A 4QSEA 5TP9A 3VLUA 4YICA 4NF5A 1LAGE 4P1EA 1OQGA 4ZZAA 1DSNA 3FXUA 1MPCA 4ZEFA 3RUMA 4N15A 2HAVA 2F34A 1RDZA 2HQ0A 2QL3A 3PUVE 3PPQA 3MJNA 3UIFA 3B6TA 3BKIB 5I56B 4GF8A 2PMSA 1FRPA 5K2YA 3PUYE 3U8QA 3SERA 4PETA 3UA8A 4LP2B 2DOJA 5A5LA 4EUOA 4QFPA 3TTNA 2XWOA 2Z8FA 3N26A 3GXAA 1DTZA 3U72A 1MM6A 1OVBA 4P11A 3TMGA 1EU8A 1VR5A 4GLIA 2VPOA 3RY3A 1MY0A 4OVJA 1T0KA 3HSTA 2Z22A 3UORA 1F9BA 3ZS6A 1I69A 1JW4A 1K9ZA 4PFYA 3HPIA 4OERA 3D4CA 1KA1A 3A29A 3PUXE 4ZS9A 3IK6B 1ANFA 2B3BA 4GOTA 4PF6A 5IGAA 2CMOA 3K4UA 4IGTA 2PFYA 4MNIA 4JVCA 1XT8A 2XXKA 1LEVA 1LBZA 1URDA 3PPPA 2NUVA 4WEDA 5F24A 3B6WA 3H4ZA 4WEPA 2X7PA 4Q0CA 2XWKA 1QUKA 1J1NA 4ZDMA 3KFMA 3C34A 4PE5B 2H5YA 4MCOA 1FPDA 4P0GA 2PVUA 5I7IA 3KEIA 3U94A 1OQHA 4HS7A 2Y84A 4PFBA 3IOWA 3PMWA 3VLVA 1SW2A 3HO7A 4G68C 4G8NA 2B65A 4GD5A 2PBWA 2I6EA 3R26A 1P1WA 3V5AA 4DXUA 3Q29A 1FQCA 3DP8A 5AA3A 1RYOA 2GRVA 2AIXA 3OXNA 2XXXA 1NV5A 1WODA 1KZ8A 3CSGA 5I59B 1B40A 4U4SA 2F5XA 3TCFA 3I5OA 3MZ1A 4FATA 2E0SA 4XIGQ 3TCGA 5I59A 3IB1A 4GFRA 3FJGA 4ESXA 5H8QA 2XXIA 1TFAA 4O3BA 4UABA 4F29A 2REGA 2CEXA 3OO9A 2REJA 3W15C 1MPBA
chains in the Genus database with same CATH topology
4PTKA 2DE4A 4OANA 2PCRA 3W9WA 1IMFA 5ET5A 4GBVA 2P3VA 2WYPA 4GWZA 3KBZA 2F3DA 4MJOA 3BIGA 1YXIA 2WYKA 2ZZXA 3GYYA 4PGNA 4PF8A 2MKZA 4XFEA 2V4CA 1QGXA 2JJKA 2HXRA 1FJ9A 5CM6A 3BIHA 3IFCA 1FPEA 1RDXA 4F19A 2FIEA 5IZZA 4PC9A 4OVRA 2FHYA 5FBPA 1LBWA 2HZKA 5LTCA 4M1VA 1FPKA 2OWZA 2QVUA 4NN3A 1NV1A 4O7MA 4GWWA 1FBFA 4O94A 4I40A 4PBHA 3W9VA 4MNCA 2Y5LA 4PDDA 1FBCA 4N81A 5ET7A 4X9TA 4AS4A 4MHFA 3B8BA 2DE3A 5EYHA 1IMDA 5ET6A 1EYKA 2DDKA 1FPFA 1NUYA 3PTYA 4GBWA 2KQZA 2V3QA 3T0JA 4XF5A 2CZIA 5EQ8A 3LUZA 5J16A 4GWUA 4LN5A 4HCYA 2GQ1A 3MSTA 2QVVA 3IFAA 2WBBA 4H45A 4OVPA 4GWSA 1G0IA 1CNQA 1NV4A 4MEVA 3ISPA 4QXDA 2CZHA 5IZ3A 4N17A 4P3LA 2WBDA 4MMPA 4PAFA 4OVQA 1IMCA 4OVSA 4DI3D 4NGUA 4NAPA 1FJ6A 1DCUA 3FBPA 3ROJA 1DK4A 2L5VA 3E79A 2QFLA 4N6KA 1RDYA 4HE2A 4P8BA 3MYUA 2P3NA 4OVTA 4NHBA 1IMBA 1FPLA 2ZZVA 4MNPA 1JP4A 4O7IA 1FBHA 4N8GA 1G0HA 4GX6A 1YYZA 1IMAA 2WEFA 5EQAA 2PFZA 4JVDA 4AS5A 1EYJA 5ESYA 1NUWA 2FBPA 4P1LA 2XWIA 3B50A 3T1BA 3RYDA 2QVRA 4GWXA 1YZ0A 4PGPA 2DE2A 3CHGA 3RPLB 1LBVA 1SPIA 2F3BA 2VPNA 2HHMA 2Q9TA 1FPGA 4P9KA 4YICA 1NV3A 4JVIA 3RPLA 4P1EA 1LBYA 3KC1A 1FBDA 1FSAA 4N4UA 5I3SA 2HZLA 4I3YA 1K9YA 4H46A 2XA5A 4N15A 5EYGA 4FBPA 1XI6A 5DW8A 1RDZA 5EQ9A 4PFIA 3HFUA 1FRPA 5IZ3B 1EYIA 1Q9DA 5IM2A 4PETA 1AWBA 2FIXA 2Q74A 5A5LA 4HE0A 4G61A 4XEQA 2BJIA 4F1UA 2DVZA 2XWOA 2Y5KA 4N91A 4PCDA 5J1DA 2B4MA 1BK4A 1FPJA 2VPOA 1NV2A 4MAGA 1K9ZA 1NUZA 3KC0A 2CEYA 1KA1A 1IMEA 3A29A 4P56A 1NV6A 4F18A 1FPBA 3EKIA 3E78A 5EQ7A 1KA0A 4PF6A 5IGAA 2WX9A 2Q8MA 1INPA 2PFYA 4MNIA 4JVCA 2B4LA 2XXKA 1D9QA 4PBQA 1LEVA 1LBZA 1NI9A 2QPQA 3SZPA 4PFRA 3QMFA 4X8RA 2XWVA 4HXVA 5F24A 5I5PA 4P47A 1NV0A 1VDWA 1FBEA 3FXBA 2ZZWA 5ET8A 2XWKA 4OA4A 4PAKA 4I3EA 3D1RA 2OX3A 4NX1A 4HCWA 4DI4B 1FPIA 2FVZA 4GX4A 4NQ8A 4MCOA 4KXPA 1FPDA 5I7IA 2HPGA 5IZ1A 4N8YA 4PAIA 4PFBA 4PE3A 4GX3A 4F1VA 4NG7A 4MX6A 3U65A 5JK4A 4X04A 3NOHA 5LDZA 2CZKA 4HE1A 4MIJA 1FTAA 4IR8A 1NV7A 1DBZA 1LBXA 5T3JA 4YZZA 3LV0A 2R8TA 1FBGA 4PDHA 4NF0A 1NV5A 1KZ8A 2KR0A 4QBAA 2F5XA 2VT5A 1FBPA 1NUXA 4O8MA 4UABA 4N6DA 2CEXA 4GWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QMF A;  4PTK A;  3RPL A;  2PCR A;  4HXV A;  1LBY A;  5F24 A;  4GWY A;  1IMF A;  3KC1 A;  1FBD A;  4GWS A;  5ET5 A;  4GBV A;  2P3V A;  1G0I A;  1FSA A;  1CNQ A;  1NV4 A;  5I3S A;  4GWZ A;  1NV0 A;  1VDW A;  2F3D A;  1FBE A;  3KBZ A;  4QXD A;  4MJO A;  2CZH A;  4I3Y A;  1K9Y A;  3BIG A;  5ET8 A;  4H46 A;  1YXI A;  5IZ3 A;  2WBD A;  5EYG A;  4FBP A;  1XI6 A;  4I3E A;  3D1R A;  5DW8 A;  2OX3 A;  1RDZ A;  5EQ9 A;  1IMC A;  1FPI A;  2FVZ A;  4GX4 A;  1FJ6 A;  1QGX A;  4KXP A;  1DCU A;  1FPD A;  2JJK A;  3FBP A;  3ROJ A;  1FRP A;  5IZ3 B;  1FJ9 A;  5IZ1 A;  1EYI A;  1Q9D A;  1DK4 A;  3BIH A;  3IFC A;  2QFL A;  1FPE A;  1RDX A;  1AWB A;  1RDY A;  2FIX A;  4HE2 A;  4GX3 A;  2Q74 A;  5A5L A;  4HE0 A;  2FIE A;  4G61 A;  2BJI A;  2Y5K A;  2P3N A;  2FHY A;  5FBP A;  1LBW A;  1IMB A;  1FPL A;  5LDZ A;  2CZK A;  1FPK A;  4HE1 A;  1FTA A;  4IR8 A;  1JP4 A;  1NV7 A;  1BK4 A;  2OWZ A;  2QVU A;  1NV1 A;  1DBZ A;  4GWW A;  1FPJ A;  1LBX A;  4O7I A;  1NV2 A;  1FBF A;  4I40 A;  5T3J A;  3LV0 A;  1FBH A;  2R8T A;  2Y5L A;  1FBG A;  1G0H A;  4GX6 A;  1YYZ A;  1FBC A;  1IMA A;  1K9Z A;  4N81 A;  1NV5 A;  2WEF A;  5EQA A;  5ET7 A;  1KZ8 A;  4AS4 A;  1NUZ A;  3KC0 A;  3B8B A;  4AS5 A;  1EYJ A;  5ESY A;  1KA1 A;  1IME A;  5EYH A;  3A29 A;  1NUW A;  1NV6 A;  2FBP A;  1IMD A;  2VT5 A;  5ET6 A;  1EYK A;  1FBP A;  1NUX A;  1FPB A;  1FPF A;  1NUY A;  4GBW A;  5EQ7 A;  3RYD A;  1KA0 A;  2QVR A;  4GWX A;  3T0J A;  1YZ0 A;  2CZI A;  5EQ8 A;  3LUZ A;  1INP A;  1LBV A;  1SPI A;  2F3B A;  4GWU A;  2Q8M A;  3RPL B;  5J16 A;  2HHM A;  1FPG A;  1D9Q A;  2GQ1 A;  1LEV A;  1LBZ A;  2QVV A;  1NI9 A;  3IFA A;  1NV3 A;  2DDK A;  2WBB A;  4H45 A; 
#chains in the Genus database with same CATH topology
 2DE4 A;  1Y1M A;  1AL3 A;  2PCR A;  1JQF A;  1IMF A;  4AQ4 A;  3TYH A;  5ET5 A;  4MLQ A;  2P3V A;  5AA4 A;  5H8H A;  1Y3Q A;  2OBG A;  3ODB A;  4MJO A;  3IOT A;  2Y7I A;  1YXI A;  3THI A;  4DCY A;  2WYK A;  3OEN A;  1US5 A;  2ZZX A;  4XTC Q;  2ABH A;  3VXB A;  5AE4 A;  2DYX A;  3UP9 A;  1EZO A;  3CFL A;  1B9J A;  2R71 A;  1B7H A;  3TQW A;  3BIH A;  1UIU A;  1KWH A;  3RN8 A;  4PFU A;  4F19 A;  1DMB A;  1Y3N A;  3VFJ A;  3P7I A;  1ZIU A;  4YAH X;  1LBW A;  4ZZE A;  3OEK A;  1FQF A;  2V3U A;  4OWD A;  2VOZ A;  2DWI A;  3IOU A;  1PEB A;  4GWW A;  4H67 A;  2OCU A;  3IB2 A;  4MNC A;  3MAM A;  1MQG A;  3RQT A;  1ZMG A;  3K01 A;  2DE3 A;  4F31 B;  1A7L A;  4PQJ A;  4OEN A;  1FPF A;  3GBA A;  4GBW A;  1NKX A;  2QMX A;  2D5W A;  2KQZ A;  5I2N B;  3T0J A;  1XC1 A;  3MZ9 A;  4IO6 A;  4ZED A;  1B1H A;  1I6Q A;  3VV5 A;  3MST A;  3MW0 A;  3SEU A;  2RCA A;  4NF8 B;  3V8X B;  2HEU A;  4KCC A;  4Q30 B;  4GWS A;  3PUZ E;  4XKR A;  1NV4 A;  5AA2 B;  2GH9 A;  2H9B A;  3PPR A;  1LFG A;  1JW5 A;  1N3W A;  4MEV A;  2XXH A;  5IZ3 A;  2GFE A;  3VXC A;  1YAE A;  2WBD A;  3EHU A;  1IXH A;  2V93 A;  1H44 A;  1JVX A;  2IA4 A;  1B4H A;  5HBC A;  5AA2 A;  4F22 A;  5JTY B;  3L6G A;  4RY1 A;  3CI8 A;  1FJ6 A;  2VHA A;  1DTG A;  1NH8 A;  3TFL A;  3SET A;  3JZJ A;  1B0H A;  5DVI A;  3E79 A;  3TAJ A;  1ZLQ A;  1R6Z A;  2QFL A;  2DQV A;  1AH5 A;  1SYH A;  3IL1 B;  2ZYN A;  3CSB A;  1FQD A;  2P3N A;  2Y7K A;  2NWJ A;  2DXR A;  1IMB A;  2ZZV A;  1FW0 A;  2R6G E;  1HSL A;  3MP6 A;  4IY5 A;  2O1M A;  1Y4C A;  4OXV A;  2X7Q A;  1MDQ A;  4R2B A;  3PUW E;  1YYZ A;  1LBC A;  1D9V A;  2WEF A;  5EQA A;  3KZG A;  4Q5T A;  1VFD A;  3C9H A;  4F2O A;  1ZJL A;  3S9E A;  3FVK A;  4P1L A;  2RF1 A;  4WKM A;  2XWI A;  3A3U A;  3TEL A;  4ELQ A;  3B50 A;  3T1B A;  2PX1 A;  4GWX A;  4ZE8 A;  2ZNS A;  1YZ0 A;  3FAS A;  4PGP A;  5TU0 A;  3RPL B;  2AL4 A;  1NNT A;  3DP6 A;  2HHM A;  2Q9T A;  3V89 B;  1UTH B;  2F7A A;  1A40 A;  3MVX A;  3EQ1 A;  2FYI A;  3PPN A;  2QS4 A;  1AIV A;  3RPL A;  1GV8 A;  2YJP A;  1MXV A;  1N3X A;  3KJT A;  3M3K A;  2GHA A;  1PBP A;  3KC1 A;  1FBD A;  4KFQ A;  1UTH A;  5I3S A;  3G3I A;  4GL0 A;  2HZL A;  5CMB A;  1K9Y A;  5CI5 A;  4H46 A;  1EZ9 A;  1SW4 A;  4FBP A;  4Q8R A;  3QUJ A;  3VLW A;  3EHT A;  2Y7P A;  1ZTY A;  3MQ9 A;  4EF1 A;  3C32 A;  1GR2 A;  4PFI A;  3H6V A;  2Z8E A;  3HFU A;  3JYR A;  1US4 A;  1EYI A;  1Q9D A;  1HSJ A;  1B32 A;  2XXT A;  4U22 A;  1MXW A;  2VD3 A;  3CIJ A;  5B7D A;  4O3C A;  3OO7 A;  3D4G A;  4G61 A;  1URG A;  2BJI A;  3TTM A;  1N7X A;  4RPO A;  3FXR A;  2Y5K A;  3IO4 A;  2QJE A;  1ZU0 A;  4YKI A;  4BDM A;  2O1L A;  3GBB A;  1EH3 A;  3TPA A;  4BDO A;  4ZEC A;  1OLA A;  3MVZ A;  1P1U A;  1O64 A;  1FPJ A;  2QRY A;  1NV2 A;  2A5T B;  5ELV A;  4OFJ A;  3RTW B;  2V84 A;  2XXY A;  5DVF A;  1SW1 A;  4G77 A;  2A5T A;  3T22 A;  1NUZ A;  2ZXT A;  4R9F A;  5I2K B;  4DLD A;  4P56 A;  2YPN A;  4LZ7 A;  3C35 A;  3USD A;  4JBZ A;  5AA1 A;  3KGC A;  5BWJ A;  1FPB A;  4JWY A;  4RPN A;  5EQ7 A;  5A5X B;  2Q8J A;  1NNF A;  2XXV A;  1INP A;  3CG1 A;  4PBQ A;  1NI9 A;  4GRK A;  4KCD A;  1Y3P A;  3QMF A;  1VFE A;  4DXC A;  2THI A;  2OK2 A;  4ELO A;  4LAT A;  3K6W A;  3I6V A;  2WKY A;  3Q25 A;  3JV9 A;  5DVJ A;  1FBE A;  4O3A A;  3FXB A;  4NF5 B;  2FA7 A;  4WXJ A;  4I3E A;  4DZ1 A;  3T9U A;  2XX7 A;  4JB7 A;  3CFZ A;  1XHY A;  1FPI A;  2FNC A;  1A55 A;  3IO6 A;  1IXI A;  4GX4 A;  1H45 A;  4JWO A;  2HPG A;  5IZ1 A;  1D9Y A;  3BFT A;  5ICT A;  4N8Y A;  3N94 A;  4IB2 A;  1ZBM A;  3PMV A;  1JET A;  1NNP A;  4NG7 A;  5ITO A;  4X04 A;  3NOH A;  2P1S A;  2OWT A;  2W7Y A;  5LDZ A;  2O7I A;  4HE1 A;  4MIJ A;  2O69 A;  2UYE A;  4L17 A;  4PFW A;  5DTB A;  1ZKB A;  2UYF A;  1LBX A;  4EXK A;  1B6H A;  2UVI A;  1FTJ A;  4GIZ A;  4F3B A;  2QS1 A;  4YZZ A;  3LV0 A;  2R8T A;  2DVC A;  4LQ2 A;  4PDH A;  4NF0 A;  3WAE A;  1LAX A;  4DXB A;  3ECR A;  2KR0 A;  1LFH A;  2E1S A;  1MXX A;  3QUF A;  1LAF E;  3KG2 A;  3S4U A;  1NUX A;  4BLA A;  1H76 A;  1VSO A;  4N6P A;  4O8M A;  2VGQ A;  3FZV A;  5F1Q A;  4N6D A;  1AOV A;  3T9X B;  3ZKL A;  4GWY A;  4PTK A;  3MP8 A;  3W9W A;  5KCJ A;  5I58 B;  3IAZ A;  2WYP A;  3H7M A;  3BBR A;  4H1X A;  1OMP A;  4MH5 A;  1QKA A;  3BIG A;  5I58 A;  1CB6 A;  3G3H A;  4G8M A;  2Q2A A;  3TDJ A;  4YMA A;  3O2A A;  5JEI A;  3GYY A;  4PGN A;  3OOA A;  4NWD A;  3ONM A;  4XFE A;  1B2H A;  3VVE A;  1MY1 A;  3DM0 A;  3FJM A;  4JDF A;  1D4N A;  4IGR A;  4N13 A;  2JJK A;  5CM6 A;  3CVG A;  1Z7N E;  1B5H A;  3IFC A;  3G3K A;  1FPE A;  3TTR A;  4PC9 A;  4OVR A;  4U1Z A;  5FBP A;  2HZK A;  5LTC A;  4OTE A;  4FEB A;  4FAJ A;  1R9L A;  2QVU A;  4KPT A;  4NN3 A;  2F7C A;  4GQO A;  1WDN A;  3HN0 A;  3O97 A;  1YTV A;  3FUZ A;  3W9V A;  3EHS A;  3MUQ A;  2Y5L A;  4DIG A;  1B52 A;  2H99 A;  4ZEK A;  4BDR A;  2ZYO A;  2HXW A;  3N5L A;  1NUY A;  1B05 A;  3RPW A;  5EQ8 A;  3LUZ A;  4GWU A;  1NL5 A;  3R6U A;  4F3S A;  4QSD A;  2GQ1 A;  4RYA A;  2QVV A;  3IFA A;  3BFU A;  4H45 A;  3E9X A;  4C0R A;  2BJJ X;  4YKP A;  1N7W A;  4OVP A;  3LBS A;  3CRB A;  3B6Q A;  3FJ7 A;  3EF7 A;  3KBR A;  5H8Q B;  1G0I A;  3KN7 A;  4YB6 A;  5CMC A;  1MY2 A;  1IQ7 A;  1N84 A;  2F8D A;  2XX9 A;  4MMP A;  4EQB A;  4C1U A;  4OET A;  1B3E A;  5AA4 B;  3IOV A;  1MQH A;  2F78 A;  4OVS A;  5H8H B;  4DI3 D;  3TCH A;  3K6U A;  1DCU A;  3FBP A;  4I8C A;  1DK4 A;  3VDF A;  2ESN A;  3K0V A;  5HPQ A;  5CBS A;  4N6K A;  2P2A A;  1RDY A;  4HE2 A;  3ILT B;  5CMK A;  3MYU A;  4GL8 A;  4YKK A;  2ZYM A;  3RTF B;  4MNP A;  1NH7 A;  3S9M C;  4NMY A;  3UN6 A;  2DSF A;  1P1N A;  1BIY A;  4POX A;  4IO4 A;  4RK9 A;  3QSL A;  1FBH A;  2XD2 A;  4LON B;  1MQD A;  1XVX A;  4N8G A;  4PFT A;  1SDX A;  2QS2 A;  4JVD A;  1AMF A;  4ND9 A;  1MDP 1;  3F11 A;  3E13 X;  3V83 A;  4QF9 A;  1B3L A;  3L6H A;  2HCA A;  3G3F A;  4BDQ A;  1Y4T A;  3S9N C;  4DDD A;  3SEW A;  2PT2 A;  5DYH A;  4XKQ A;  4P9K A;  2DP8 A;  1MS7 A;  2DS9 A;  1A8F A;  1OLC A;  3G3G A;  1LBY A;  2ZYK A;  2H98 A;  2XXP A;  3A3C A;  1FSA A;  4N4U A;  2O51 A;  4UAC A;  4G68 B;  1MXU A;  4H8J A;  5FHM A;  4EF2 A;  5EYG A;  4QHQ A;  1XI6 A;  5DW8 A;  5EQ9 A;  1MQI A;  4G68 A;  1SQY A;  2QSX A;  4N07 A;  4RXL A;  5IZ3 B;  2RIN A;  3KOS A;  3TOD A;  2ALU A;  4OEU A;  3OO8 A;  4YKJ A;  5IM2 A;  4F3P A;  1SVX B;  3H3G A;  3LUY A;  3DLN A;  5M2V A;  1AWB A;  3N6T A;  2FIX A;  5IAI A;  2Q74 A;  4HE0 A;  4R72 A;  1YCJ A;  5H8F B;  2DVZ A;  4NF6 B;  4R73 A;  4OFL A;  3FGS A;  4PCD A;  5H8F A;  4XXU A;  4HW8 A;  3IR1 A;  2V25 A;  4OZ9 A;  4NF6 A;  1IIW A;  5TPA B;  4ISU A;  1LB8 A;  1Y9U A;  4MAG A;  1SW5 A;  3U1O A;  3MVW A;  4ESW A;  5TPA A;  3FD3 A;  3LSL A;  1JNF A;  3KC0 A;  3UK4 A;  4OEV A;  1NV6 A;  3OMB A;  4F18 A;  1H43 A;  1MXY A;  4YMB A;  4U2R A;  4OFO A;  2H25 A;  1QW0 A;  2Z8D A;  5I57 B;  2F6G A;  1RKM A;  1KA0 A;  1USY H;  3C36 A;  3CG3 A;  1SD3 A;  2P0S A;  2WX9 A;  2Q8M A;  4H8I A;  5FHN A;  2F36 A;  4XKN A;  2F97 A;  2LAO A;  1LGB C;  2B4L A;  1ELJ A;  5I57 A;  4LA9 A;  1D9Q A;  2QPQ A;  2A5S A;  3SZP A;  4X8R A;  3K02 A;  2XWV A;  3T96 B;  4HXV A;  2OWS A;  3H6W A;  1PB8 A;  2Z23 A;  5I5P A;  1L5T A;  3M8U A;  2XXW A;  1NV0 A;  2ZZW A;  4PAK A;  4EQ7 A;  3D1R A;  4X1B A;  2OX3 A;  4HCW A;  1I6B A;  2ONR A;  3S2V A;  4NF4 A;  5EYF A;  4KYD A;  3FV1 A;  3SDF A;  2FVZ A;  2V3T A;  4H5G A;  5DT6 A;  4KXP A;  5CBR A;  2IEE A;  2F7B A;  4PE3 A;  2D21 A;  1DOT A;  3O29 A;  4R2F A;  1B4Z A;  3U65 A;  4KQP A;  5JK4 A;  1SYI A;  1A54 A;  2QS3 A;  5FTI A;  2CZK A;  4IR8 A;  3EN3 A;  4R6K A;  1DBZ A;  1USY E;  4DE8 A;  4Z0I A;  5ISU A;  3KN3 A;  4IO2 A;  3RT8 A;  2PYY A;  3MPL A;  1GTK A;  1UTB B;  1P1Q A;  1IZ1 A;  4QBA A;  1TXF A;  3HHF A;  2VT5 A;  1FBP A;  3EPE A;  1WVJ A;  3IX1 A;  1UTB A;  1ATG A;  4X48 A;  3PD9 A;  1MRP A;  2I48 A;  1QUI A;  1Y20 A;  3ILU B;  3FAT A;  2XXQ A;  5CRY A;  3VVD A;  3U93 A;  4GWO A;  3OO6 A;  3PPO A;  1BKA A;  4GWZ A;  1EZP A;  3KBZ A;  3U92 A;  1LCF A;  5L9S A;  2I3V A;  4F1Y A;  4R6Y A;  1POY 1;  2NOO A;  2F35 A;  4UA8 A;  2MKZ A;  1QUL A;  4NED A;  4HTG A;  1QGX A;  3OSR A;  2HXR A;  1TWY A;  3QXM A;  4QFO A;  3ZSF A;  1FJ9 A;  3B7D A;  1B0L A;  1B51 A;  4H5F A;  2ZNU A;  3K6V A;  2FIE A;  3MZB A;  2RKM A;  1FTL A;  1UIV A;  1Q35 A;  3G3J A;  5DEX A;  1B1X A;  1PDA A;  4TLL B;  5L9M A;  1FPK A;  2OWZ A;  1NV1 A;  1FCK A;  3T93 B;  5HM4 B;  1LAH E;  3O9P A;  4I40 A;  4POW A;  1URS A;  4PDD A;  2M8C A;  1FBC A;  4N81 A;  5ET7 A;  4X9T A;  4AS4 A;  4MHF A;  5EYH A;  1SI0 A;  1IUD A;  5H8S A;  1N04 A;  4YB5 A;  5ET6 A;  1EYK A;  3OEL A;  3LC8 A;  2XXR A;  3PTY A;  2V3Q A;  4XF5 A;  1S50 A;  3FIR A;  2CZI A;  2RC9 A;  5J16 A;  4LN5 A;  3M3F A;  3PMX A;  2I4B A;  2WBB A;  3K6X A;  3PGF A;  4M4G A;  4NWC A;  1LB9 A;  2HAU A;  4AB5 A;  3MPK A;  3M3L A;  1FQE A;  1CNQ A;  3Q28 A;  1LST A;  3ISP A;  3O28 A;  4QXD A;  3SEV A;  5I56 A;  2CZH A;  3CR9 A;  3TQL A;  4QFL A;  4N17 A;  4LVQ A;  1CE2 A;  5KCJ B;  1QJM A;  1M5C A;  4E0X A;  3RT6 B;  4ZE9 A;  1M5E A;  1OVT A;  4BDL A;  4NAP A;  3QIM A;  1B7U A;  2ONS A;  1B3H A;  2L5V A;  3TZA A;  1JEU A;  4Z7E A;  4R6H A;  1NMU A;  3IB0 A;  3T9H B;  4LQ5 A;  1JP4 A;  1XVY A;  3KN8 A;  1II5 A;  1MXZ A;  2OJT A;  1MH3 A;  3R7X A;  1IEJ A;  4X1D A;  4TLM B;  1IMA A;  5LOM A;  1BP5 A;  3VVF A;  1MQJ A;  1JEV A;  2RCB A;  4AS5 A;  5ESY A;  2D3I A;  1NUW A;  1S9T A;  2X26 A;  2XXU A;  4KYE A;  1JW1 A;  2RC8 A;  4AB6 A;  2QVR A;  4F2Q A;  2DWJ A;  3CHG A;  1SPI A;  1M5B A;  3TTK A;  2VPN A;  1UQW A;  1FPG A;  5KDT B;  2VD2 A;  4NE4 A;  1N76 A;  1NNK A;  2B3F A;  2UXA A;  1NV3 A;  4EQ9 A;  4JVI A;  3FXQ A;  1TFD A;  4MBP A;  1XS5 A;  2ONK E;  2XHD A;  4I1D A;  4MF3 A;  1LLS A;  1D3K A;  5KDT A;  4IO5 A;  1B3F A;  3K00 A;  3TEP A;  2NXO A;  4I3Y A;  4JSO A;  3OEM A;  2F6P A;  2XA5 A;  3H6T A;  3T9V A;  1O63 A;  1PB7 A;  3IJX B;  1Z7M E;  5CC2 A;  3VE1 B;  3LR1 A;  4OES A;  4H6D A;  2I0C A;  3QK6 A;  3TUS A;  4F1U A;  4XEQ A;  5H8N B;  2I4C A;  1YPN A;  4N91 A;  5L8D A;  2UVG A;  2DWA A;  5J1D A;  3KJ7 A;  4TQU Q;  2B4M A;  4U21 A;  3QAX A;  1BK4 A;  4E0W A;  5H8N A;  2DXY A;  2GHB A;  3N6U A;  5IKB A;  1GVC A;  2H4I A;  4RK2 A;  2OPD A;  3MP1 A;  4ONY A;  3FVO A;  1O7T A;  4LZ5 A;  1DPP A;  5BUU A;  2CEY A;  4P0I A;  1IME A;  2ZNT A;  4GVO A;  1POT A;  3EKI A;  3FVN A;  3E78 A;  3OD7 A;  4RNS A;  1Y1Z A;  4IY6 A;  4BDN A;  3MC2 A;  4NTL A;  3SES A;  4K3F A;  2CZL A;  1BLF A;  1Q1K A;  4U23 A;  4PFR A;  1FQA A;  1IXG A;  3H06 B;  1JVY A;  4P47 A;  4FIM A;  4EDP A;  3C33 A;  4I62 A;  1VDW A;  1XOC A;  5ET8 A;  4GXS B;  4OA4 A;  1LCT A;  3K2D A;  1QUJ A;  4KR5 A;  5K2X A;  4R9G A;  4NX1 A;  4DI4 B;  3K1N A;  4QRZ A;  4I9D A;  4KI0 E;  1TT1 A;  3O6I A;  4ELP A;  4OYV A;  4NQ8 A;  1R9Q A;  4FE8 A;  3SEY A;  4PAI A;  1B5J A;  1DPE A;  1H3D A;  3O6H A;  5I84 A;  4QFN A;  3I3V A;  2AYS A;  4GX3 A;  3IOR A;  1HSE A;  5FHO A;  3HCQ A;  4F1V A;  4KD5 A;  3O6G A;  4MX6 A;  3KSJ A;  2I58 A;  1NFT A;  3CFX A;  1FQB A;  1FTA A;  1MH4 A;  3QYT A;  1NV7 A;  4IO3 A;  3OSQ A;  2KLF A;  2G29 A;  4KYS A;  4JWX A;  5T3J A;  3FVG A;  1FBG A;  4FOR A;  2I3W A;  3MWB A;  5I2N A;  3KSX A;  1LBB A;  3T66 A;  4C1T A;  3Q27 A;  3HHG A;  1A99 A;  4DCX A;  1QVS A;  5F7V A;  4YU0 A;  2XX8 A;  3K1M A;  1R1N A;  4FJP A;  4NF8 A;  4ECF A;  1P1O A;  1B3G A;  1FTM A;  5KZT A;  2G93 A;  4LZ8 A;  4F39 A;  2XD3 A;  1I6A A;  2DDK A;  1FTO A;  3RGY A;  4H0W A;  4OAN A;  5EHS A;  2O6A A;  3LSF B;  3TKD A;  2OLB A;  4GBV A;  4MFI A;  3WAF A;  2Q88 A;  1PC3 A;  4U1O A;  5JTY A;  4R75 A;  3DEL B;  2RC7 A;  2F3D A;  3AXF A;  5ITP A;  1PBQ A;  4ZEB A;  4RA1 A;  4U4X A;  3GZG A;  4PF8 A;  4YB7 A;  2Y7W A;  2HFB A;  2V4C A;  4R74 A;  3H03 A;  4KHZ E;  2Q89 A;  2UVJ A;  4G4P A;  1MY3 A;  2O84 X;  5AA2 D;  1RDX A;  3TTL A;  4NF4 B;  4ZEI A;  5IZZ A;  2Q2C A;  3MVY A;  3SKP A;  2FHY A;  4QFK A;  3O66 A;  2I49 A;  2ZMB A;  2OPE A;  4M1V A;  4OQO A;  5FTH A;  4O7M A;  5ICQ A;  1MY4 A;  1B5I A;  1FBF A;  3PD8 A;  4PP0 A;  4O94 A;  4PBH A;  3FV2 A;  2DWH A;  3IJO B;  4F3G A;  1SBP A;  2QMW A;  1MPD A;  3RLF E;  1B46 A;  3MBP A;  3GLB A;  3B8B A;  2VP1 A;  3RNN A;  1MM7 A;  1IMD A;  3K1P A;  2NVU B;  1M5D A;  4TOZ A;  1IIT A;  5B70 A;  2AL5 A;  4HCY A;  3E4R A;  2I0B A;  1FTK A;  4JSD A;  4LUB A;  3LSX A;  1QKB A;  4MLV A;  2UVH A;  4IO7 A;  2YLN A;  1VE4 A;  4P3L A;  1BTJ A;  1P99 A;  5EHM A;  4PAF A;  1GGG A;  3C31 A;  3UGW A;  4JXI A;  4OVQ A;  2Y7R A;  1IMC A;  1PB9 A;  2O7U A;  2OZZ A;  4NGU A;  4QSC A;  3ROJ A;  4RJZ A;  1M5F A;  1S7Y A;  3Q26 A;  1LFI A;  4P8B A;  3S9L C;  3HV1 A;  5L9O A;  1RYX A;  1N0T A;  3KOT A;  1B7Z A;  4OVT A;  4NHB A;  2R9J A;  1FPL A;  4GXA A;  3ZKK A;  3G7W A;  1A8E A;  5CMM A;  3DP4 A;  3E3K A;  4XKP A;  5I2K A;  3PV0 E;  4OHN A;  3A09 A;  5DEX B;  4O7I A;  4G8H A;  1IXC A;  2ANJ A;  3LSW A;  4FEC A;  4ELR A;  4THI A;  1G0H A;  4GX6 A;  4G2Z A;  5A5X A;  1B58 A;  3SEX A;  2PFZ A;  2O68 A;  1EYJ A;  3C4M A;  4FED A;  4H65 A;  2FBP A;  4OMB A;  1OIB A;  2PT1 A;  5TP9 B;  3RYD A;  4EXL A;  2DE2 A;  1LBV A;  2F3B A;  3H6U A;  1MG1 A;  1SI1 A;  3PU5 A;  4QSE A;  5TP9 A;  3VLU A;  4YIC A;  4NF5 A;  1LAG E;  4P1E A;  1OQG A;  4ZZA A;  1DSN A;  3FXU A;  1MPC A;  4ZEF A;  3RUM A;  4N15 A;  2HAV A;  2F34 A;  1RDZ A;  2HQ0 A;  2QL3 A;  3PUV E;  3PPQ A;  3MJN A;  3UIF A;  3B6T A;  3BKI B;  5I56 B;  4GF8 A;  2PMS A;  1FRP A;  5K2Y A;  3PUY E;  3U8Q A;  3SER A;  4PET A;  3UA8 A;  4LP2 B;  2DOJ A;  5A5L A;  4EUO A;  4QFP A;  3TTN A;  2XWO A;  2Z8F A;  3N26 A;  3GXA A;  1DTZ A;  3U72 A;  1MM6 A;  1OVB A;  4P11 A;  3TMG A;  1EU8 A;  1VR5 A;  4GLI A;  2VPO A;  3RY3 A;  1MY0 A;  4OVJ A;  1T0K A;  3HST A;  2Z22 A;  3UOR A;  1F9B A;  3ZS6 A;  1I69 A;  1JW4 A;  1K9Z A;  4PFY A;  3HPI A;  4OER A;  3D4C A;  1KA1 A;  3A29 A;  3PUX E;  4ZS9 A;  3IK6 B;  1ANF A;  2B3B A;  4GOT A;  4PF6 A;  5IGA A;  2CMO A;  3K4U A;  4IGT A;  2PFY A;  4MNI A;  4JVC A;  1XT8 A;  2XXK A;  1LEV A;  1LBZ A;  1URD A;  3PPP A;  2NUV A;  4WED A;  5F24 A;  3B6W A;  3H4Z A;  4WEP A;  2X7P A;  4Q0C A;  2XWK A;  1QUK A;  1J1N A;  4ZDM A;  3KFM A;  3C34 A;  4PE5 B;  2H5Y A;  4MCO A;  1FPD A;  4P0G A;  2PVU A;  5I7I A;  3KEI A;  3U94 A;  1OQH A;  4HS7 A;  2Y84 A;  4PFB A;  3IOW A;  3PMW A;  3VLV A;  1SW2 A;  3HO7 A;  4G68 C;  4G8N A;  2B65 A;  4GD5 A;  2PBW A;  2I6E A;  3R26 A;  1P1W A;  3V5A A;  4DXU A;  3Q29 A;  1FQC A;  3DP8 A;  5AA3 A;  1RYO A;  2GRV A;  2AIX A;  3OXN A;  2XXX A;  1NV5 A;  1WOD A;  1KZ8 A;  3CSG A;  5I59 B;  1B40 A;  4U4S A;  2F5X A;  3TCF A;  3I5O A;  3MZ1 A;  4FAT A;  2E0S A;  4XIG Q;  3TCG A;  5I59 A;  3IB1 A;  4GFR A;  3FJG A;  4ESX A;  5H8Q A;  2XXI A;  1TFA A;  4O3B A;  4UAB A;  4F29 A;  2REG A;  2CEX A;  3OO9 A;  2REJ A;  3W15 C;  1MPB A; 
#chains in the Genus database with same CATH homology
 4PTK A;  2DE4 A;  4OAN A;  2PCR A;  3W9W A;  1IMF A;  5ET5 A;  4GBV A;  2P3V A;  2WYP A;  4GWZ A;  3KBZ A;  2F3D A;  4MJO A;  3BIG A;  1YXI A;  2WYK A;  2ZZX A;  3GYY A;  4PGN A;  4PF8 A;  2MKZ A;  4XFE A;  2V4C A;  1QGX A;  2JJK A;  2HXR A;  1FJ9 A;  5CM6 A;  3BIH A;  3IFC A;  1FPE A;  1RDX A;  4F19 A;  2FIE A;  5IZZ A;  4PC9 A;  4OVR A;  2FHY A;  5FBP A;  1LBW A;  2HZK A;  5LTC A;  4M1V A;  1FPK A;  2OWZ A;  2QVU A;  4NN3 A;  1NV1 A;  4O7M A;  4GWW A;  1FBF A;  4O94 A;  4I40 A;  4PBH A;  3W9V A;  4MNC A;  2Y5L A;  4PDD A;  1FBC A;  4N81 A;  5ET7 A;  4X9T A;  4AS4 A;  4MHF A;  3B8B A;  2DE3 A;  5EYH A;  1IMD A;  5ET6 A;  1EYK A;  2DDK A;  1FPF A;  1NUY A;  3PTY A;  4GBW A;  2KQZ A;  2V3Q A;  3T0J A;  4XF5 A;  2CZI A;  5EQ8 A;  3LUZ A;  5J16 A;  4GWU A;  4LN5 A;  4HCY A;  2GQ1 A;  3MST A;  2QVV A;  3IFA A;  2WBB A;  4H45 A;  4OVP A;  4GWS A;  1G0I A;  1CNQ A;  1NV4 A;  4MEV A;  3ISP A;  4QXD A;  2CZH A;  5IZ3 A;  4N17 A;  4P3L A;  2WBD A;  4MMP A;  4PAF A;  4OVQ A;  1IMC A;  4OVS A;  4DI3 D;  4NGU A;  4NAP A;  1FJ6 A;  1DCU A;  3FBP A;  3ROJ A;  1DK4 A;  2L5V A;  3E79 A;  2QFL A;  4N6K A;  1RDY A;  4HE2 A;  4P8B A;  3MYU A;  2P3N A;  4OVT A;  4NHB A;  1IMB A;  1FPL A;  2ZZV A;  4MNP A;  1JP4 A;  4O7I A;  1FBH A;  4N8G A;  1G0H A;  4GX6 A;  1YYZ A;  1IMA A;  2WEF A;  5EQA A;  2PFZ A;  4JVD A;  4AS5 A;  1EYJ A;  5ESY A;  1NUW A;  2FBP A;  4P1L A;  2XWI A;  3B50 A;  3T1B A;  3RYD A;  2QVR A;  4GWX A;  1YZ0 A;  4PGP A;  2DE2 A;  3CHG A;  3RPL B;  1LBV A;  1SPI A;  2F3B A;  2VPN A;  2HHM A;  2Q9T A;  1FPG A;  4P9K A;  4YIC A;  1NV3 A;  4JVI A;  3RPL A;  4P1E A;  1LBY A;  3KC1 A;  1FBD A;  1FSA A;  4N4U A;  5I3S A;  2HZL A;  4I3Y A;  1K9Y A;  4H46 A;  2XA5 A;  4N15 A;  5EYG A;  4FBP A;  1XI6 A;  5DW8 A;  1RDZ A;  5EQ9 A;  4PFI A;  3HFU A;  1FRP A;  5IZ3 B;  1EYI A;  1Q9D A;  5IM2 A;  4PET A;  1AWB A;  2FIX A;  2Q74 A;  5A5L A;  4HE0 A;  4G61 A;  4XEQ A;  2BJI A;  4F1U A;  2DVZ A;  2XWO A;  2Y5K A;  4N91 A;  4PCD A;  5J1D A;  2B4M A;  1BK4 A;  1FPJ A;  2VPO A;  1NV2 A;  4MAG A;  1K9Z A;  1NUZ A;  3KC0 A;  2CEY A;  1KA1 A;  1IME A;  3A29 A;  4P56 A;  1NV6 A;  4F18 A;  1FPB A;  3EKI A;  3E78 A;  5EQ7 A;  1KA0 A;  4PF6 A;  5IGA A;  2WX9 A;  2Q8M A;  1INP A;  2PFY A;  4MNI A;  4JVC A;  2B4L A;  2XXK A;  1D9Q A;  4PBQ A;  1LEV A;  1LBZ A;  1NI9 A;  2QPQ A;  3SZP A;  4PFR A;  3QMF A;  4X8R A;  2XWV A;  4HXV A;  5F24 A;  5I5P A;  4P47 A;  1NV0 A;  1VDW A;  1FBE A;  3FXB A;  2ZZW A;  5ET8 A;  2XWK A;  4OA4 A;  4PAK A;  4I3E A;  3D1R A;  2OX3 A;  4NX1 A;  4HCW A;  4DI4 B;  1FPI A;  2FVZ A;  4GX4 A;  4NQ8 A;  4MCO A;  4KXP A;  1FPD A;  5I7I A;  2HPG A;  5IZ1 A;  4N8Y A;  4PAI A;  4PFB A;  4PE3 A;  4GX3 A;  4F1V A;  4NG7 A;  4MX6 A;  3U65 A;  5JK4 A;  4X04 A;  3NOH A;  5LDZ A;  2CZK A;  4HE1 A;  4MIJ A;  1FTA A;  4IR8 A;  1NV7 A;  1DBZ A;  1LBX A;  5T3J A;  4YZZ A;  3LV0 A;  2R8T A;  1FBG A;  4PDH A;  4NF0 A;  1NV5 A;  1KZ8 A;  2KR0 A;  4QBA A;  2F5X A;  2VT5 A;  1FBP A;  1NUX A;  4O8M A;  4UAB A;  4N6D A;  2CEX A;  4GWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...