3LUZA

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
238
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEDYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Hydrolase
molecule keywords Extragenic suppressor protein suhB
total genus 78
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3luzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3luzA02
1EYKA 1SPIA 3B8BA 1IMAA 4PTKA 2JJKA 1KA1A 5DW8A 1YYZA 2GQ1A 3KC1A 5I3SA 5J16A 4HE0A 4FBPA 5EQ9A 1FBDA 1XI6A 1FPBA 1D9QA 1LBZA 3A29A 4KXPA 1FJ6A 4AS5A 1LEVA 5ET8A 2QVRA 1FBCA 1INPA 4H46A 2HHMA 1FBFA 2FIEA 1NUZA 1IMDA 2PCRA 2P3NA 1VDWA 1FPKA 4HE2A 1FJ9A 1FPIA 4GWWA 5LDZA 1JP4A 4MJOA 3D1RA 1YXIA 4GWZA 1IMCA 2Q8MA 1FPFA 1EYJA 5ET5A 1RDZA 4GX3A 1KZ8A 4GWUA 5EYHA 1FSAA 5IZ3A 2WEFA 5EQAA 5IZ1A 1K9YA 2QFLA 2VT5A 1NUYA 1NI9A 1DBZA 4I3YA 1FBEA 3ROJA 4GX6A 5EQ8A 2CZHA 3KC0A 1BK4A 3RPLA 2Y5LA 1FPDA 1LBXA 1CNQA 4GBWA 2Q74A 2CZIA 4GX4A 1NUXA 1FBGA 1FPLA 2QVVA 5EQ7A 5F24A 1NV7A 5IZ3B 5EYGA 1NV0A 1G0HA 1NV3A 2DDKA 1FBHA 2OWZA 3IFCA 4IR8A 3T0JA 3KBZA 3RPLB 1IMFA 1FBPA 4HXVA 1RDYA 5FBPA 1EYIA 4GBVA 5ET7A 1NV5A 2WBDA 1K9ZA 5ESYA 2FBPA 3IFAA 1NUWA 1NV1A 1IMEA 3FBPA 1NV2A 1FTAA 2F3DA 2F3BA 3QMFA 4O7IA 1G0IA 3LUZA 3BIHA 4AS4A 1YZ0A 1RDXA 5ET6A 2FIXA 1DK4A 1FPGA 4GWXA 4N81A 1FPJA 1Q9DA 1IMBA 5A5LA 1KA0A 1FRPA 2WBBA 1FPEA 2FVZA 2QVUA 4I3EA 1LBYA 1LBWA 1NV4A 3BIGA 3RYDA 4GWSA 1LBVA 2P3VA 3LV0A 2OX3A 4GWYA 2Y5KA 2BJIA 1NV6A 4I40A 1AWBA 4G61A 4H45A 1DCUA 2R8TA 1QGXA 5T3JA 2FHYA 4HE1A 2CZKA 4QXDA
chains in the Genus database with same CATH superfamily
2QMXA 3DELB 3DM0A 4NX1A 4X1DA 2AYSA 1XI6A 2OZZA 4KHZE 3OO9A 2HHMA 1SVXB 4POWA 4HE2A 3IK6B 3TQLA 4PFYA 1LB8A 3DP6A 4NWDA 3T96B 4F31B 2VD3A 3EF7A 2DXRA 2FYIA 5JTYA 1LFHA 1F9BA 2QPQA 2V4CA 3RPLA 3B50A 3VXBA 2E0SA 1A8EA 1B58A 1FQAA 2Y7KA 4JWXA 2P1SA 5H8HA 2OJTA 5FHNA 1B05A 4RY1A 5IGAA 1FBPA 5AA1A 2DXYA 2DS9A 5CMKA 4PFIA 3C33A 2G93A 3I6VA 1XHYA 3VVFA 2Z8EA 3O28A 3MVZA 3PD9A 1SYIA 1FPGA 4ZE8A 4XIGQ 4R9FA 2XXQA 5AA4B 4OANA 1Z7NE 1VSOA 3GZGA 1NMUA 2YLNA 1SW2A 5AA2D 2BJIA 5L8DA 2XXHA 2R8TA 3P7IA 1MH3A 4GF8A 5TPAA 1ZLQA 3FZVA 2KR0A 4O7MA 1EZPA 4WXJA 3SESA 3CG3A 1NNTA 1LAXA 3H6WA 3FVGA 1T0KA 1FTOA 1IITA 3EHUA 3GYYA 4R2FA 1MY2A 4PBHA 1B4HA 1IQ7A 3MVXA 3BFTA 4GWZA 4N6DA 2I49A 3FV2A 1FSAA 4JWOA 3H7MA 1H43A 4LA9A 1B3LA 1Q1KA 3BKIB 4P56A 4ELPA 5DEXB 3ILUB 2XXUA 1R9LA 4MNPA 2AL5A 3V89B 5IZ3B 4DDDA 4PE3A 3QUFA 3MZBA 1MG1A 1D9VA 4QFKA 1XT8A 4ZS9A 1FTJA 4R9GA 4LVQA 5I58B 1K9ZA 3MUQA 5AA3A 3JZJA 1B32A 3V83A 3FUZA 1ANFA 1XVXA 3TTNA 4N81A 3SDFA 1LBWA 3IORA 4R75A 4FEDA 3KG2A 3LV0A 2VHAA 2WX9A 3C34A 1EU8A 4PCDA 3W9WA 4IO7A 1YPNA 4OETA 4YB7A 4DLDA 1D3KA 1P1QA 3TTLA 3M3LA 3RT8A 2DWJA 2XD2A 4YKIA 2CZLA 5LOMA 4X48A 3MYUA 4EUOA 5ICTA 1FBFA 4EQBA 1FPKA 5I59A 2WYKA 1LSTA 1RDZA 3L6HA 4H65A 4JSOA 4GWOA 4C0RA 3ROJA 4I3YA 2FNCA 1FTLA 3IR1A 5BUUA 1JEVA 3KSXA 1FPDA 4RNSA 3FASA 1SI0A 4YU0A 4YMBA 3LUYA 3GBAA 3R6UA 3K6VA 1YAEA 4P47A 1NNPA 3SERA 1I6QA 2XA5A 2UYFA 4OWDA 3RN8A 1G0HA 4I1DA 1ZU0A 1MY3A 1JEUA 5HPQA 1WODA 4IR8A 1RKMA 4BLAA 2ZYMA 1DOTA 3FXQA 2YPNA 2Y7PA 3S9MC 3MSTA 3PMWA 3QMFA 4GLIA 3OSRA 3MWBA 4F1YA 1NKXA 2QL3A 3D4CA 3PUVE 4HCWA 3BIGA 4X8RA 2GH9A 2OX3A 1YCJA 4ELOA 1GV8A 4F2OA 4LZ5A 1N04A 1UTBB 2I4BA 1PC3A 3W9VA 3PU5A 5F7VA 2RCBA 4NEDA 5HBCA 2FHYA 2UYEA 2CZKA 4JB7A 2Q2AA 3PMXA 4G8MA 4GXAA 5I58A 5ITPA 1YYZA 1ELJA 3UP9A 3G3GA 5EQ9A 2RC9A 4LUBA 4EDPA 4ESXA 4LQ2A 3SETA 1MQGA 2O1LA 2L5VA 2UXAA 2HZKA 1INPA 2OK2A 2HAVA 3K1MA 3PMVA 4AQ4A 1JP4A 1MXVA 1YXIA 4MBPA 1IMCA 1I69A 1OQGA 4MLQA 4R73A 1XC1A 1OLCA 4N91A 1SQYA 4GWUA 5EYHA 4NF6A 2QFLA 3RUMA 4BDLA 2DE3A 3PPPA 4THIA 3CSGA 4OTEA 1B3HA 3PPOA 3HN0A 4I62A 3CFLA 1MS7A 3RTWB 3Q29A 5I56B 3T9XB 4OQOA 1LFGA 1HSEA 5L9OA 1NV1A 2H99A 1QULA 4LZ8A 3LUZA 5A5XA 3USDA 3UA8A 4H8IA 1RDXA 2HXRA 4UABA 2ZZWA 3LSLA 1IXHA 2O51A 3MC2A 1R1NA 1LBYA 3CG1A 3Q26A 2P3VA 3T9VA 1Y9UA 1GVCA 3LR1A 2F35A 1JETA 4LATA 1QGXA 4LONB 3KN8A 3RQTA 4KYDA 5DW8A 1NL5A 2UVHA 2ZNSA 5FTIA 5AE4A 3KEIA 4BDQA 4JBZA 4MAGA 2OBGA 1B0HA 3E13X 3T9HB 3MW0A 4NF4B 2DWAA 4F18A 3TCGA 2V3TA 5ISUA 4U1ZA 4DXCA 3WAEA 5K2XA 3H3GA 3KSJA 2QJEA 1K9YA 2VT5A 4PAIA 1DBZA 3C9HA 1P99A 2Q2CA 1MY4A 5HM4B 3MVYA 2NOOA 1IXCA 2Q88A 4N15A 1NV0A 4RA1A 1FQBA 3C32A 3EQ1A 4P0IA 2DDKA 2HFBA 4HCYA 3V5AA 4P1LA 1NV5A 2THIA 2DWHA 2RINA 3TEPA 2XWKA 2NVUB 3G3KA 2F3DA 4O7IA 1SD3A 1QUIA 4ZE9A 4RPOA 1QUKA 2NUVA 5TP9B 1BTJA 2WBBA 1FPEA 2XWOA 1R6ZA 1AIVA 1VFEA 3RY3A 2DOJA 3HPIA 2OPDA 1LAFE 1MXXA 2I48A 1BIYA 2I0CA 4OFLA 3ZKLA 1A55A 3FIRA 5I3SA 4FORA 4YB6A 1H44A 4ZECA 2V3UA 3U1OA 4HS7A 4G8NA 4XKQA 3N6UA 3S9EA 4OENA 2UVIA 4X9TA 1FTKA 1WDNA 1EYJA 4N8GA 4H5FA 2O68A 5IZ3A 2B4LA 2XX9A 3PTYA 4XEQA 2ALUA 1LB9A 4TLLB 2OPEA 3ISPA 2IEEA 1XVYA 5DVJA 2Q74A 1DTGA 1XOCA 4YKJA 4U4XA 2LAOA 3U93A 5ICQA 4GXSB 5EYGA 1FW0A 1NH7A 1QUJA 4N6PA 3O97A 3QXMA 1RDYA 4MEVA 1IEJA 3LBSA 1MQIA 4R2BA 4GD5A 1RYXA 1URGA 5FTHA 1AH5A 4QFNA 5ITOA 2V25A 4ZEIA 2V93A 5CM6A 3JYRA 4N07A 3EN3A 1Q9DA 3G3HA 1UIUA 1KA0A 3B6WA 3O9PA 3FGSA 5TPAB 2VPOA 3O6HA 3IOTA 4GWSA 4JWYA 3BBRA 5CMCA 4M4GA 3TYHA 2D3IA 1OVBA 3IO6A 1GR2A 3F11A 1B7ZA 3B8BA 1B46A 3U65A 4MNCA 4N13A 2X7PA 3UN6A 5KCJA 1D9QA 1OMPA 3KJTA 1B7UA 1FQEA 4MH5A 1IMDA 3SEWA 3OO7A 4NQ8A 4MCOA 2I3VA 3TFLA 3CSBA 3TPAA 2Q8MA 4G77A 1TXFA 2HEUA 1SDXA 1FBEA 3D4GA 3EPEA 2CZHA 4Z7EA 4O3AA 3UGWA 4C1UA 1FQFA 3K6XA 5EYFA 3SZPA 2DQVA 3GBBA 3MP1A 1LCTA 3G3JA 1SYHA 1UTHA 3MZ1A 3QUJA 4WKMA 4RYAA 1SI1A 2E1SA 2OWZA 3TQWA 1S9TA 1WVJA 4DIGA 3T9UA 1M5DA 3HSTA 4DXBA 3CFXA 5K2YA 3IFAA 3TODA 4XTCQ 2R71A 5EHSA 4G2ZA 3S2VA 3KN3A 2DSFA 2DP8A 3DP4A 3PUYE 3MPLA 4OVRA 4NE4A 1Q35A 3PPQA 1B3EA 2VOZA 1Y3PA 2XWIA 4NHBA 1OLAA 2AIXA 3FVNA 4QSCA 3Q25A 4Z0IA 1J1NA 2XXWA 1IXGA 4QRZA 4H5GA 1B1HA 4ECFA 1YTVA 2O6AA 2CMOA 1KA1A 3V8XB 4WEPA 3MPKA 4OVTA 4FBPA 3FJMA 3C31A 1URDA 1FBDA 4PDHA 4U2RA 1LEVA 1B52A 2GRVA 4MF3A 4NWCA 1ZIUA 4H46A 3TCHA 4K3FA 3K00A 1L5TA 4YMAA 1FJ9A 4RJZA 1FPIA 4GWWA 1URSA 3JV9A 4U4SA 4OFOA 3TCFA 1DPPA 1UQWA 2I6EA 3PV0E 3VXCA 3S9NC 1PBQA 3TELA 3GXAA 4KYSA 2R6GE 5H8HB 3K02A 3IJXB 1VE4A 4LN5A 5BWJA 3PD8A 5B7DA 3IX1A 4GX4A 2NWJA 3IJOB 4EXKA 3IB2A 2PYYA 2PMSA 2XD3A 4RXLA 3G7WA 5H8NB 3A3UA 4PF6A 4JVCA 2GHBA 3KBZA 3U94A 3SEUA 3FV1A 4HXVA 4E0WA 4QBAA 4EQ9A 1TT1A 2Z23A 3O66A 4OVPA 2M8CA 2F36A 3TMGA 4OEUA 4RK2A 2OWTA 4HTGA 4AS4A 4G68C 5ET6A 4PGNA 1AOVA 3H6TA 1FRPA 1B6HA 4PDDA 2H9BA 5IKBA 1QW0A 4H0WA 3OMBA 4AB5A 4DXUA 1ZJLA 4MMPA 1MXZA 1MRPA 3OO8A 4G61A 4MLVA 1DCUA 1XS5A 4M1VA 5T3JA 3HFUA 4HE1A 4I8CA 4GL8A 1M5BA 1LFIA 2GQ1A 3PPRA 1Z7ME 3ZSFA 4G68B 4BDNA 2XHDA 2NXOA 4ZDMA 1GGGA 3MJNA 2ANJA 1DPEA 4OMBA 2P0SA 3FJGA 1P1UA 3QSLA 4IO2A 5JEIA 3D1RA 4R72A 1P1WA 4ZZEA 5DT6A 1LCFA 1N0TA 1P1NA 4F1UA 1NI9A 4OA4A 4GX6A 4ZEBA 3TKDA 4GBWA 2CZIA 4ESWA 3MVWA 2DE4A 3LSXA 3H06B 3B6TA 1ZBMA 1Y20A 1MM7A 3OOAA 4OERA 2R9JA 3FVOA 3IFCA 3LC8A 5LTCA 3IOUA 5FBPA 3PUXE 4IGTA 2ZMBA 2WBDA 4GFRA 4LQ5A 2XXYA 1JW1A 1FTAA 2ZYOA 2F3BA 4MHFA 1A99A 3VLVA 1YZ0A 1B9JA 1N7WA 2CEXA 4YKKA 1FPJA 2RC8A 4PBQA 3VVEA 2PX1A 3HHGA 4POXA 1VR5A 5ELVA 3S9LC 4L17A 4O94A 2V3QA 5L9MA 2ZZXA 2PBWA 1SPIA 3TUSA 4PTKA 5KDTA 3MAMA 4P8BA 4XKNA 4AS5A 3QYTA 4RK9A 5H8FB 1N84A 3K1NA 5DVIA 2XX7A 2F7CA 1IZ1A 3OD7A 4N8YA 4JDFA 1JW4A 1FPFA 1B5HA 3O29A 3PUZE 2I0BA 1NUYA 3IOWA 3VE1B 1GTKA 2Y5LA 1LBXA 3OEKA 2O1MA 1FBGA 4XKPA 1OQHA 1LBCA 4NF0A 2OLBA 1NV7A 5KCJB 2RCAA 2B4MA 1NNKA 5IZZA 4F39A 5DEXA 2X7QA 4PAFA 4GVOA 5H8QB 1UTHB 1UIVA 3RPLB 1IMFA 1FQDA 4KYEA 3C36A 2Q9TA 5ET7A 3FATA 3IAZA 3MP6A 2CEYA 4F3PA 4PC9A 4WEDA 3HHFA 1O64A 3FBPA 2HCAA 3O6GA 2QS3A 4E0XA 4XF5A 1D4NA 1HSLA 4GQOA 1PEBA 2ONKE 4BDMA 3TDJA 1PDAA 1NV4A 3A3CA 1QKBA 2F34A 2HXWA 4LP2B 3H6UA 1POTA 1B1XA 4H45A 3Q28A 4NN3A 3ECRA 3K1PA 2XXRA 4ZEFA 2JJKA 4HE0A 2O7UA 3PUWE 3A29A 2ZNTA 3FJ7A 4NF6B 1HSJA 3DP8A 1FBCA 5JTYB 5AA4A 1R9QA 2XWVA 2P3NA 1NNFA 5LDZA 4P3LA 3PPNA 4P1EA 4JXIA 5I2KA 2PFZA 3K4UA 1DMBA 5CMMA 1BLFA 3ODBA 3NOHA 2BJJX 4DI4B 3T22A 1P1OA 5EQ8A 1MDP1 3KC0A 4PFRA 3TAJA 3UORA 1Y3QA 2RF1A 4Q5TA 4F3GA 5TU0A 4P9KA 2B65A 4GIZA 5F24A 3E78A 3VLWA 2F6GA 3SEYA 3ONMA 3T93B 1NV3A 1MXWA 4ELRA 3TZAA 2B3FA 1NFTA 4P11A 4FECA 1H3DA 5FHMA 2OWSA 5CC2A 3K01A 3T1BA 1B5JA 2XXPA 3CHGA 4U21A 4F3SA 4X1BA 3CI8A 5AA2B 3CR9A 3RGYA 3LSWA 5I2NA 3A09A 1MQDA 3T66A 3S4UA 2P2AA 1OVTA 2I3WA 4N6KA 1LBBA 4XFEA 4I40A 3E4RA 5I56A 2XXKA 3VFJA 4PGPA 2D21A 3DLNA 2ZYNA 2ZXTA 4KCCA 2ZYKA 1MQJA 2H98A 5KZTA 3UIFA 1CE2A 5I2KB 4N4UA 5I57B 3MBPA 2Y7WA 4I9DA 4XKRA 2O69A 4Q0CA 2DE2A 4NTLA 4ZEKA 2HAUA 4BDOA 4PETA 3RLFE 1EZ9A 1LGBC 3AXFA 2XXTA 5ET5A 3VV5A 1TFDA 3U92A 2UVGA 4KI0E 2VPNA 1BK4A 2REJA 3VDFA 3OO6A 4OXVA 3ILTB 2GFEA 1B0LA 4U1OA 4AB6A 1US5A 4ND9A 4IO5A 2MKZA 4N17A 2PT2A 3CRBA 3KZGA 2H5YA 1FBHA 4EF2A 2F78A 4OHNA 2DVCA 2REGA 4DCXA 4OVJA 4EXLA 4JVDA 4RPNA 4H6DA 1NUWA 1TFAA 1IMEA 2IA4A 4R6YA 2QSXA 5DTBA 1US4A 3N94A 2A5SA 1IXIA 1QVSA 3O6IA 5CBRA 1O7TA 3QAXA 1ZMGA 5H8QA 4IO4A 1MPBA 5DYHA 4DCYA 5A5LA 1QKAA 2PFYA 3FXRA 3IO4A 1MY0A 4JSDA 3RNNA 4OESA 2D5WA 2XX8A 4YZZA 1IIWA 2XXIA 3KFMA 1B2HA 3OSQA 1VFDA 1PB7A 5B70A 4KR5A 2VP1A 3KC1A 2ABHA 4FATA 3E3KA 3OEMA 4QSDA 1FJ6A 4IY6A 1FTMA 2B3BA 4YICA 1A8FA 3HO7A 1S7YA 3N5LA 2ZNUA 4F22A 3H03A 4OZ9A 2RC7A 1EH3A 5I7IA 2QS2A 3K6UA 1TWYA 4IGRA 4G8HA 2HQ0A 4F2QA 3TTMA 2H4IA 2GHAA 1CB6A 4XXUA 3RT6B 5IM2A 4HW8A 1JQFA 1JW5A 2QS4A 2X26A 1USYE 1LLSA 2A5TA 3R26A 4PFBA 4LZ7A 4F1VA 1I6AA 1POY1 1Y4TA 3OXNA 2QRYA 2PVUA 4G4PA 1H76A 3G3IA 1QJMA 4MIJA 5F1QA 3T0JA 3FXUA 3B7DA 1EYIA 1MDQA 5FHOA 4H8JA 1FCKA 1UTBA 2ZZVA 5CBSA 2FBPA 4EF1A 4ISUA 1BP5A 1MY1A 1NV2A 3WAFA 3EKIA 3CIJA 1M5FA 2V84A 1DTZA 2ONSA 4QFOA 3I3VA 1DSNA 2I58A 1KWHA 3MP8A 4GL0A 1USYH 1ZKBA 1LBVA 3VLUA 2PT1A 2Y7IA 3KN7A 4NF5A 1MXUA 1JVYA 4IY5A 4PQJA 1A54A 4ZEDA 4P0GA 3B6QA 4KQPA 1IMAA 5J16A 3H6VA 1B5IA 5ET8A 3CVGA 5CMBA 2KQZA 3QIMA 3M8UA 2Z8DA 2XXXA 1MQHA 4X04A 1N7XA 1SW1A 4MJOA 3C4MA 3N6TA 2G29A 4PP0A 4R6KA 3VVDA 2F6PA 1JVXA 5DVFA 1KZ8A 4G68A 4NGUA 4YB5A 3IOVA 3C35A 4ZZAA 3UK4A 5KDTB 4DI3D 1Y3NA 3N26A 2O7IA 3U8QA 4R6HA 1CNQA 5CRYA 2W7YA 3THIA 1M5CA 2F97A 5J1DA 5IAIA 4BDRA 2F5XA 1MXYA 4NF4A 3W15C 4TLMB 1N3XA 1ZTYA 5ESYA 3CFZA 3ZS6A 1MPCA 5I57A 1B3FA 3BIHA 1IUDA 2FIXA 1A7LA 4YAHX 2F7AA 2UVJA 1IMBA 4FEBA 1I6BA 3G3FA 3RYDA 1A40A 3BFUA 3KBRA 1B40A 2O84X 1B4ZA 1AWBA 3LSFB 3KGCA 2VD2A 4ONYA 4QXDA 5A5XB 1EYKA 2A5TB 3SEXA 3IL1B 3IB1A 5H8SA 4QSEA 3FXBA 3KOSA 4NF8B 2Q8JA 3EHSA 3SKPA 2FA7A 5I2NB 5L9SA 2VGQA 1NUZA 2PCRA 4PFTA 4TQUQ 4FIMA 3R7XA 4EQ7A 4NMYA 3M3KA 4DZ1A 1MH4A 5EQAA 4F19A 4FJPA 2RKMA 3I5OA 1Y4CA 3M3FA 3QK6A 5M2VA 4QFPA 1NUXA 4MNIA 2I4CA 4U23A 4H1XA 2QVVA 5EQ7A 1RYOA 4IO6A 4F3BA 2QMWA 4IO3A 4PF8A 4MX6A 4KD5A 1LAHE 1B51A 2Q89A 4PAKA 2ESNA 4GBVA 2QS1A 5I5PA 3Q27A 4MFIA 1O63A 3RTFB 3GLBA 4O8MA 4UA8A 4FAJA 3PGFA 1N76A 4H67A 1JNFA 4F29A 4FE8A 4KPTA 2Y7RA 1DK4A 4IB2A 4GWXA 1EZOA 5H8FA 3HCQA 2FVZA 5I59B 2DYXA 1SW4A 2F8DA 4GOTA 4TOZA 1FQCA 1NH8A 1ATGA 4PFUA 3MQ9A 2Y5KA 1MPDA 1LAGE 3KJ7A 1PB9A 4U22A 2DVZA 2ONRA 1D9YA 2KLFA 4UACA 4Q30B 1II5A 5CI5A 3OENA 2AL4A 3OELA 3MZ9A 3ZKKA 1FPBA 4YKPA 1LBZA 3E9XA 4QHQA 4KXPA 4JVIA 1Y1ZA 2QVRA 1B7HA 1SW5A 2FIEA 3K2DA 4OVQA 1VDWA 4C1TA 4Q8RA 3K0VA 2HZLA 3H4ZA 5JK4A 1PBPA 4ELQA 4GX3A 1MM6A 3K6WA 1M5EA 2OCUA 1B3GA 4NF8A 5H8NA 2WEFA 5IZ1A 4PFWA 2F7BA 2XXVA 3SEVA 2Y84A 4OFJA 4OVSA 4KFQA 1Y1MA 1S50A 1FPLA 3EHTA 4GRKA 4NF5B 4OYVA 2WYPA 2H25A 3L6GA 4R74A 3TTRA 3FVKA 3RPWA 4DE8A 5TP9A 4KCDA 5I84A 1OIBA 3HV1A 3FD3A 2HPGA 1N3WA 5AA2A 3TTKA 2YJPA 4QFLA 4QF9A 2WKYA 1G0IA 1BKAA 3O2AA 2DWIA 3E79A 4O3CA 3KOTA 3U72A 2QVUA 4I3EA 3IB0A 4OEVA 1AL3A 4GWYA 1SBPA 4PE5B 2Z8FA 1H45A 1NV6A 1AMFA 4NG7A 4O3BA 5EHMA 4NAPA 2Z22A 1PB8A
chains in the Genus database with same CATH topology
1EYKA 1SPIA 3B8BA 1IMAA 4PTKA 3U65A 4MNCA 2JJKA 1KA1A 5DW8A 2KR0A 4O7MA 1YYZA 2GQ1A 3KC1A 5I3SA 5J16A 4HE0A 4FBPA 3FXBA 4NX1A 5EQ9A 4OVTA 4P8BA 4N4UA 1FBDA 1XI6A 1FPBA 1D9QA 1LBZA 3A29A 4PDHA 4KXPA 1FJ6A 4AS5A 1LEVA 2L5VA 5ET8A 3MYUA 4JVIA 4MAGA 2QVRA 1FBCA 2HZKA 4YICA 1INPA 4H46A 2HHMA 3GYYA 2KQZA 1FBFA 2FIEA 2DE2A 1NUZA 1IMDA 2PCRA 2XWVA 2P3NA 1VDWA 4OVQA 1FPKA 4PBHA 4NQ8A 4PETA 4X9TA 4F1UA 4HE2A 1FJ9A 4N8YA 4MCOA 1FPIA 4GWWA 2HZLA 5LDZA 4X04A 4F18A 1JP4A 4MJOA 3D1RA 1YXIA 2WYKA 4P3LA 5I7IA 4GWZA 1IMCA 4N6DA 5JK4A 2Q8MA 1FPFA 1EYJA 5ET5A 1RDZA 4P1EA 4GX3A 1KZ8A 4N91A 4N8GA 4NGUA 2PFZA 4GWUA 5EYHA 1FSAA 5IZ3A 2WEFA 5EQAA 5IZ1A 2B4LA 1K9YA 2QFLA 2VT5A 3NOHA 1NUYA 1NI9A 1DBZA 4I3YA 1FBEA 3ROJA 4OA4A 4F19A 2QPQA 3PTYA 4DI4B 4XEQA 4GX6A 5EQ8A 2CZHA 5IM2A 2V4CA 2VPNA 3KC0A 1BK4A 4PFRA 3ISPA 3RPLA 4LN5A 3SZPA 2Y5LA 1FPDA 4P56A 1LBXA 1CNQA 2DE3A 4GBWA 2Q74A 4PFBA 2CZIA 3B50A 4GX4A 1NUXA 1FBGA 2DE4A 4MNIA 4OVSA 4P9KA 4F1VA 4P47A 1FPLA 2QVVA 5EQ7A 5F24A 4NF0A 3E78A 2MKZA 1NV7A 4DI3D 2B4MA 4MNPA 5J1DA 5IZZA 2XA5A 4N17A 5IZ3B 4N15A 5EYGA 1NV0A 1G0HA 4MX6A 4PF8A 1NV3A 2WYPA 4PF6A 2DDKA 4JVCA 1FBHA 2OWZA 2F5XA 3IFCA 4IR8A 4HCYA 4MIJA 4PAFA 3T0JA 4PE3A 3KBZA 5LTCA 5IGAA 3RPLB 1IMFA 1FBPA 4HXVA 1RDYA 5FBPA 4PAKA 4MEVA 1EYIA 4GBVA 5ET7A 2Q9TA 4P1LA 4QBAA 5I5PA 4PFIA 1NV5A 2WBDA 2CEYA 1K9ZA 2ZZVA 5ESYA 2FBPA 4JVDA 4O8MA 4PC9A 2HPGA 2XWKA 4OVPA 3IFAA 1NUWA 1NV1A 1IMEA 3T1BA 3FBPA 1NV2A 1FTAA 3MSTA 2F3DA 2F3BA 3QMFA 4O7IA 3EKIA 1G0IA 3LUZA 4PAIA 3BIHA 4MHFA 4AS4A 4XF5A 1YZ0A 1RDXA 5ET6A 2HXRA 4UABA 3CHGA 5CM6A 2FIXA 4PGNA 2ZZWA 1DK4A 1FPGA 2CEXA 3E79A 4HCWA 4GWXA 4N81A 1FPJA 1Q9DA 1IMBA 5A5LA 1KA0A 4OVRA 1FRPA 2WBBA 2PFYA 1FPEA 2FVZA 2QVUA 2VPOA 2XWOA 4I3EA 1LBYA 1LBWA 1NV4A 4OANA 4PDDA 3BIGA 3RYDA 4X8RA 4PBQA 4GWSA 1LBVA 2P3VA 3LV0A 2OX3A 2XWIA 4NHBA 4GWYA 4MMPA 4N6KA 2Y5KA 4YZZA 2BJIA 2WX9A 4XFEA 1NV6A 4I40A 3W9VA 4PCDA 3W9WA 1AWBA 4G61A 4H45A 2XXKA 1DCUA 2R8TA 1QGXA 2DVZA 4NG7A 4NN3A 4O94A 4M1VA 4NAPA 5T3JA 3HFUA 2FHYA 4HE1A 2V3QA 4PGPA 2ZZXA 2CZKA 4QXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYK A;  1SPI A;  3B8B A;  1IMA A;  4PTK A;  2JJK A;  1KA1 A;  5DW8 A;  1YYZ A;  2GQ1 A;  3KC1 A;  5I3S A;  5J16 A;  4HE0 A;  4FBP A;  5EQ9 A;  1FBD A;  1XI6 A;  1FPB A;  1D9Q A;  1LBZ A;  3A29 A;  4KXP A;  1FJ6 A;  4AS5 A;  1LEV A;  5ET8 A;  2QVR A;  1FBC A;  1INP A;  4H46 A;  2HHM A;  1FBF A;  2FIE A;  1NUZ A;  1IMD A;  2PCR A;  2P3N A;  1VDW A;  1FPK A;  4HE2 A;  1FJ9 A;  1FPI A;  4GWW A;  5LDZ A;  1JP4 A;  4MJO A;  3D1R A;  1YXI A;  4GWZ A;  1IMC A;  2Q8M A;  1FPF A;  1EYJ A;  5ET5 A;  1RDZ A;  4GX3 A;  1KZ8 A;  4GWU A;  5EYH A;  1FSA A;  5IZ3 A;  2WEF A;  5EQA A;  5IZ1 A;  1K9Y A;  2QFL A;  2VT5 A;  1NUY A;  1NI9 A;  1DBZ A;  4I3Y A;  1FBE A;  3ROJ A;  4GX6 A;  5EQ8 A;  2CZH A;  3KC0 A;  1BK4 A;  3RPL A;  2Y5L A;  1FPD A;  1LBX A;  1CNQ A;  4GBW A;  2Q74 A;  2CZI A;  4GX4 A;  1NUX A;  1FBG A;  1FPL A;  2QVV A;  5EQ7 A;  5F24 A;  1NV7 A;  5IZ3 B;  5EYG A;  1NV0 A;  1G0H A;  1NV3 A;  2DDK A;  1FBH A;  2OWZ A;  3IFC A;  4IR8 A;  3T0J A;  3KBZ A;  3RPL B;  1IMF A;  1FBP A;  4HXV A;  1RDY A;  5FBP A;  1EYI A;  4GBV A;  5ET7 A;  1NV5 A;  2WBD A;  1K9Z A;  5ESY A;  2FBP A;  3IFA A;  1NUW A;  1NV1 A;  1IME A;  3FBP A;  1NV2 A;  1FTA A;  2F3D A;  2F3B A;  3QMF A;  4O7I A;  1G0I A;  3LUZ A;  3BIH A;  4AS4 A;  1YZ0 A;  1RDX A;  5ET6 A;  2FIX A;  1DK4 A;  1FPG A;  4GWX A;  4N81 A;  1FPJ A;  1Q9D A;  1IMB A;  5A5L A;  1KA0 A;  1FRP A;  2WBB A;  1FPE A;  2FVZ A;  2QVU A;  4I3E A;  1LBY A;  1LBW A;  1NV4 A;  3BIG A;  3RYD A;  4GWS A;  1LBV A;  2P3V A;  3LV0 A;  2OX3 A;  4GWY A;  2Y5K A;  2BJI A;  1NV6 A;  4I40 A;  1AWB A;  4G61 A;  4H45 A;  1DCU A;  2R8T A;  1QGX A;  5T3J A;  2FHY A;  4HE1 A;  2CZK A;  4QXD A; 
#chains in the Genus database with same CATH topology
 2QMX A;  3DEL B;  3DM0 A;  4NX1 A;  4X1D A;  2AYS A;  1XI6 A;  2OZZ A;  4KHZ E;  3OO9 A;  2HHM A;  1SVX B;  4POW A;  4HE2 A;  3IK6 B;  3TQL A;  4PFY A;  1LB8 A;  3DP6 A;  4NWD A;  3T96 B;  4F31 B;  2VD3 A;  3EF7 A;  2DXR A;  2FYI A;  5JTY A;  1LFH A;  1F9B A;  2QPQ A;  2V4C A;  3RPL A;  3B50 A;  3VXB A;  2E0S A;  1A8E A;  1B58 A;  1FQA A;  2Y7K A;  4JWX A;  2P1S A;  5H8H A;  2OJT A;  5FHN A;  1B05 A;  4RY1 A;  5IGA A;  1FBP A;  5AA1 A;  2DXY A;  2DS9 A;  5CMK A;  4PFI A;  3C33 A;  2G93 A;  3I6V A;  1XHY A;  3VVF A;  2Z8E A;  3O28 A;  3MVZ A;  3PD9 A;  1SYI A;  1FPG A;  4ZE8 A;  4XIG Q;  4R9F A;  2XXQ A;  5AA4 B;  4OAN A;  1Z7N E;  1VSO A;  3GZG A;  1NMU A;  2YLN A;  1SW2 A;  5AA2 D;  2BJI A;  5L8D A;  2XXH A;  2R8T A;  3P7I A;  1MH3 A;  4GF8 A;  5TPA A;  1ZLQ A;  3FZV A;  2KR0 A;  4O7M A;  1EZP A;  4WXJ A;  3SES A;  3CG3 A;  1NNT A;  1LAX A;  3H6W A;  3FVG A;  1T0K A;  1FTO A;  1IIT A;  3EHU A;  3GYY A;  4R2F A;  1MY2 A;  4PBH A;  1B4H A;  1IQ7 A;  3MVX A;  3BFT A;  4GWZ A;  4N6D A;  2I49 A;  3FV2 A;  1FSA A;  4JWO A;  3H7M A;  1H43 A;  4LA9 A;  1B3L A;  1Q1K A;  3BKI B;  4P56 A;  4ELP A;  5DEX B;  3ILU B;  2XXU A;  1R9L A;  4MNP A;  2AL5 A;  3V89 B;  5IZ3 B;  4DDD A;  4PE3 A;  3QUF A;  3MZB A;  1MG1 A;  1D9V A;  4QFK A;  1XT8 A;  4ZS9 A;  1FTJ A;  4R9G A;  4LVQ A;  5I58 B;  1K9Z A;  3MUQ A;  5AA3 A;  3JZJ A;  1B32 A;  3V83 A;  3FUZ A;  1ANF A;  1XVX A;  3TTN A;  4N81 A;  3SDF A;  1LBW A;  3IOR A;  4R75 A;  4FED A;  3KG2 A;  3LV0 A;  2VHA A;  2WX9 A;  3C34 A;  1EU8 A;  4PCD A;  3W9W A;  4IO7 A;  1YPN A;  4OET A;  4YB7 A;  4DLD A;  1D3K A;  1P1Q A;  3TTL A;  3M3L A;  3RT8 A;  2DWJ A;  2XD2 A;  4YKI A;  2CZL A;  5LOM A;  4X48 A;  3MYU A;  4EUO A;  5ICT A;  1FBF A;  4EQB A;  1FPK A;  5I59 A;  2WYK A;  1LST A;  1RDZ A;  3L6H A;  4H65 A;  4JSO A;  4GWO A;  4C0R A;  3ROJ A;  4I3Y A;  2FNC A;  1FTL A;  3IR1 A;  5BUU A;  1JEV A;  3KSX A;  1FPD A;  4RNS A;  3FAS A;  1SI0 A;  4YU0 A;  4YMB A;  3LUY A;  3GBA A;  3R6U A;  3K6V A;  1YAE A;  4P47 A;  1NNP A;  3SER A;  1I6Q A;  2XA5 A;  2UYF A;  4OWD A;  3RN8 A;  1G0H A;  4I1D A;  1ZU0 A;  1MY3 A;  1JEU A;  5HPQ A;  1WOD A;  4IR8 A;  1RKM A;  4BLA A;  2ZYM A;  1DOT A;  3FXQ A;  2YPN A;  2Y7P A;  3S9M C;  3MST A;  3PMW A;  3QMF A;  4GLI A;  3OSR A;  3MWB A;  4F1Y A;  1NKX A;  2QL3 A;  3D4C A;  3PUV E;  4HCW A;  3BIG A;  4X8R A;  2GH9 A;  2OX3 A;  1YCJ A;  4ELO A;  1GV8 A;  4F2O A;  4LZ5 A;  1N04 A;  1UTB B;  2I4B A;  1PC3 A;  3W9V A;  3PU5 A;  5F7V A;  2RCB A;  4NED A;  5HBC A;  2FHY A;  2UYE A;  2CZK A;  4JB7 A;  2Q2A A;  3PMX A;  4G8M A;  4GXA A;  5I58 A;  5ITP A;  1YYZ A;  1ELJ A;  3UP9 A;  3G3G A;  5EQ9 A;  2RC9 A;  4LUB A;  4EDP A;  4ESX A;  4LQ2 A;  3SET A;  1MQG A;  2O1L A;  2L5V A;  2UXA A;  2HZK A;  1INP A;  2OK2 A;  2HAV A;  3K1M A;  3PMV A;  4AQ4 A;  1JP4 A;  1MXV A;  1YXI A;  4MBP A;  1IMC A;  1I69 A;  1OQG A;  4MLQ A;  4R73 A;  1XC1 A;  1OLC A;  4N91 A;  1SQY A;  4GWU A;  5EYH A;  4NF6 A;  2QFL A;  3RUM A;  4BDL A;  2DE3 A;  3PPP A;  4THI A;  3CSG A;  4OTE A;  1B3H A;  3PPO A;  3HN0 A;  4I62 A;  3CFL A;  1MS7 A;  3RTW B;  3Q29 A;  5I56 B;  3T9X B;  4OQO A;  1LFG A;  1HSE A;  5L9O A;  1NV1 A;  2H99 A;  1QUL A;  4LZ8 A;  3LUZ A;  5A5X A;  3USD A;  3UA8 A;  4H8I A;  1RDX A;  2HXR A;  4UAB A;  2ZZW A;  3LSL A;  1IXH A;  2O51 A;  3MC2 A;  1R1N A;  1LBY A;  3CG1 A;  3Q26 A;  2P3V A;  3T9V A;  1Y9U A;  1GVC A;  3LR1 A;  2F35 A;  1JET A;  4LAT A;  1QGX A;  4LON B;  3KN8 A;  3RQT A;  4KYD A;  5DW8 A;  1NL5 A;  2UVH A;  2ZNS A;  5FTI A;  5AE4 A;  3KEI A;  4BDQ A;  4JBZ A;  4MAG A;  2OBG A;  1B0H A;  3E13 X;  3T9H B;  3MW0 A;  4NF4 B;  2DWA A;  4F18 A;  3TCG A;  2V3T A;  5ISU A;  4U1Z A;  4DXC A;  3WAE A;  5K2X A;  3H3G A;  3KSJ A;  2QJE A;  1K9Y A;  2VT5 A;  4PAI A;  1DBZ A;  3C9H A;  1P99 A;  2Q2C A;  1MY4 A;  5HM4 B;  3MVY A;  2NOO A;  1IXC A;  2Q88 A;  4N15 A;  1NV0 A;  4RA1 A;  1FQB A;  3C32 A;  3EQ1 A;  4P0I A;  2DDK A;  2HFB A;  4HCY A;  3V5A A;  4P1L A;  1NV5 A;  2THI A;  2DWH A;  2RIN A;  3TEP A;  2XWK A;  2NVU B;  3G3K A;  2F3D A;  4O7I A;  1SD3 A;  1QUI A;  4ZE9 A;  4RPO A;  1QUK A;  2NUV A;  5TP9 B;  1BTJ A;  2WBB A;  1FPE A;  2XWO A;  1R6Z A;  1AIV A;  1VFE A;  3RY3 A;  2DOJ A;  3HPI A;  2OPD A;  1LAF E;  1MXX A;  2I48 A;  1BIY A;  2I0C A;  4OFL A;  3ZKL A;  1A55 A;  3FIR A;  5I3S A;  4FOR A;  4YB6 A;  1H44 A;  4ZEC A;  2V3U A;  3U1O A;  4HS7 A;  4G8N A;  4XKQ A;  3N6U A;  3S9E A;  4OEN A;  2UVI A;  4X9T A;  1FTK A;  1WDN A;  1EYJ A;  4N8G A;  4H5F A;  2O68 A;  5IZ3 A;  2B4L A;  2XX9 A;  3PTY A;  4XEQ A;  2ALU A;  1LB9 A;  4TLL B;  2OPE A;  3ISP A;  2IEE A;  1XVY A;  5DVJ A;  2Q74 A;  1DTG A;  1XOC A;  4YKJ A;  4U4X A;  2LAO A;  3U93 A;  5ICQ A;  4GXS B;  5EYG A;  1FW0 A;  1NH7 A;  1QUJ A;  4N6P A;  3O97 A;  3QXM A;  1RDY A;  4MEV A;  1IEJ A;  3LBS A;  1MQI A;  4R2B A;  4GD5 A;  1RYX A;  1URG A;  5FTH A;  1AH5 A;  4QFN A;  5ITO A;  2V25 A;  4ZEI A;  2V93 A;  5CM6 A;  3JYR A;  4N07 A;  3EN3 A;  1Q9D A;  3G3H A;  1UIU A;  1KA0 A;  3B6W A;  3O9P A;  3FGS A;  5TPA B;  2VPO A;  3O6H A;  3IOT A;  4GWS A;  4JWY A;  3BBR A;  5CMC A;  4M4G A;  3TYH A;  2D3I A;  1OVB A;  3IO6 A;  1GR2 A;  3F11 A;  1B7Z A;  3B8B A;  1B46 A;  3U65 A;  4MNC A;  4N13 A;  2X7P A;  3UN6 A;  5KCJ A;  1D9Q A;  1OMP A;  3KJT A;  1B7U A;  1FQE A;  4MH5 A;  1IMD A;  3SEW A;  3OO7 A;  4NQ8 A;  4MCO A;  2I3V A;  3TFL A;  3CSB A;  3TPA A;  2Q8M A;  4G77 A;  1TXF A;  2HEU A;  1SDX A;  1FBE A;  3D4G A;  3EPE A;  2CZH A;  4Z7E A;  4O3A A;  3UGW A;  4C1U A;  1FQF A;  3K6X A;  5EYF A;  3SZP A;  2DQV A;  3GBB A;  3MP1 A;  1LCT A;  3G3J A;  1SYH A;  1UTH A;  3MZ1 A;  3QUJ A;  4WKM A;  4RYA A;  1SI1 A;  2E1S A;  2OWZ A;  3TQW A;  1S9T A;  1WVJ A;  4DIG A;  3T9U A;  1M5D A;  3HST A;  4DXB A;  3CFX A;  5K2Y A;  3IFA A;  3TOD A;  4XTC Q;  2R71 A;  5EHS A;  4G2Z A;  3S2V A;  3KN3 A;  2DSF A;  2DP8 A;  3DP4 A;  3PUY E;  3MPL A;  4OVR A;  4NE4 A;  1Q35 A;  3PPQ A;  1B3E A;  2VOZ A;  1Y3P A;  2XWI A;  4NHB A;  1OLA A;  2AIX A;  3FVN A;  4QSC A;  3Q25 A;  4Z0I A;  1J1N A;  2XXW A;  1IXG A;  4QRZ A;  4H5G A;  1B1H A;  4ECF A;  1YTV A;  2O6A A;  2CMO A;  1KA1 A;  3V8X B;  4WEP A;  3MPK A;  4OVT A;  4FBP A;  3FJM A;  3C31 A;  1URD A;  1FBD A;  4PDH A;  4U2R A;  1LEV A;  1B52 A;  2GRV A;  4MF3 A;  4NWC A;  1ZIU A;  4H46 A;  3TCH A;  4K3F A;  3K00 A;  1L5T A;  4YMA A;  1FJ9 A;  4RJZ A;  1FPI A;  4GWW A;  1URS A;  3JV9 A;  4U4S A;  4OFO A;  3TCF A;  1DPP A;  1UQW A;  2I6E A;  3PV0 E;  3VXC A;  3S9N C;  1PBQ A;  3TEL A;  3GXA A;  4KYS A;  2R6G E;  5H8H B;  3K02 A;  3IJX B;  1VE4 A;  4LN5 A;  5BWJ A;  3PD8 A;  5B7D A;  3IX1 A;  4GX4 A;  2NWJ A;  3IJO B;  4EXK A;  3IB2 A;  2PYY A;  2PMS A;  2XD3 A;  4RXL A;  3G7W A;  5H8N B;  3A3U A;  4PF6 A;  4JVC A;  2GHB A;  3KBZ A;  3U94 A;  3SEU A;  3FV1 A;  4HXV A;  4E0W A;  4QBA A;  4EQ9 A;  1TT1 A;  2Z23 A;  3O66 A;  4OVP A;  2M8C A;  2F36 A;  3TMG A;  4OEU A;  4RK2 A;  2OWT A;  4HTG A;  4AS4 A;  4G68 C;  5ET6 A;  4PGN A;  1AOV A;  3H6T A;  1FRP A;  1B6H A;  4PDD A;  2H9B A;  5IKB A;  1QW0 A;  4H0W A;  3OMB A;  4AB5 A;  4DXU A;  1ZJL A;  4MMP A;  1MXZ A;  1MRP A;  3OO8 A;  4G61 A;  4MLV A;  1DCU A;  1XS5 A;  4M1V A;  5T3J A;  3HFU A;  4HE1 A;  4I8C A;  4GL8 A;  1M5B A;  1LFI A;  2GQ1 A;  3PPR A;  1Z7M E;  3ZSF A;  4G68 B;  4BDN A;  2XHD A;  2NXO A;  4ZDM A;  1GGG A;  3MJN A;  2ANJ A;  1DPE A;  4OMB A;  2P0S A;  3FJG A;  1P1U A;  3QSL A;  4IO2 A;  5JEI A;  3D1R A;  4R72 A;  1P1W A;  4ZZE A;  5DT6 A;  1LCF A;  1N0T A;  1P1N A;  4F1U A;  1NI9 A;  4OA4 A;  4GX6 A;  4ZEB A;  3TKD A;  4GBW A;  2CZI A;  4ESW A;  3MVW A;  2DE4 A;  3LSX A;  3H06 B;  3B6T A;  1ZBM A;  1Y20 A;  1MM7 A;  3OOA A;  4OER A;  2R9J A;  3FVO A;  3IFC A;  3LC8 A;  5LTC A;  3IOU A;  5FBP A;  3PUX E;  4IGT A;  2ZMB A;  2WBD A;  4GFR A;  4LQ5 A;  2XXY A;  1JW1 A;  1FTA A;  2ZYO A;  2F3B A;  4MHF A;  1A99 A;  3VLV A;  1YZ0 A;  1B9J A;  1N7W A;  2CEX A;  4YKK A;  1FPJ A;  2RC8 A;  4PBQ A;  3VVE A;  2PX1 A;  3HHG A;  4POX A;  1VR5 A;  5ELV A;  3S9L C;  4L17 A;  4O94 A;  2V3Q A;  5L9M A;  2ZZX A;  2PBW A;  1SPI A;  3TUS A;  4PTK A;  5KDT A;  3MAM A;  4P8B A;  4XKN A;  4AS5 A;  3QYT A;  4RK9 A;  5H8F B;  1N84 A;  3K1N A;  5DVI A;  2XX7 A;  2F7C A;  1IZ1 A;  3OD7 A;  4N8Y A;  4JDF A;  1JW4 A;  1FPF A;  1B5H A;  3O29 A;  3PUZ E;  2I0B A;  1NUY A;  3IOW A;  3VE1 B;  1GTK A;  2Y5L A;  1LBX A;  3OEK A;  2O1M A;  1FBG A;  4XKP A;  1OQH A;  1LBC A;  4NF0 A;  2OLB A;  1NV7 A;  5KCJ B;  2RCA A;  2B4M A;  1NNK A;  5IZZ A;  4F39 A;  5DEX A;  2X7Q A;  4PAF A;  4GVO A;  5H8Q B;  1UTH B;  1UIV A;  3RPL B;  1IMF A;  1FQD A;  4KYE A;  3C36 A;  2Q9T A;  5ET7 A;  3FAT A;  3IAZ A;  3MP6 A;  2CEY A;  4F3P A;  4PC9 A;  4WED A;  3HHF A;  1O64 A;  3FBP A;  2HCA A;  3O6G A;  2QS3 A;  4E0X A;  4XF5 A;  1D4N A;  1HSL A;  4GQO A;  1PEB A;  2ONK E;  4BDM A;  3TDJ A;  1PDA A;  1NV4 A;  3A3C A;  1QKB A;  2F34 A;  2HXW A;  4LP2 B;  3H6U A;  1POT A;  1B1X A;  4H45 A;  3Q28 A;  4NN3 A;  3ECR A;  3K1P A;  2XXR A;  4ZEF A;  2JJK A;  4HE0 A;  2O7U A;  3PUW E;  3A29 A;  2ZNT A;  3FJ7 A;  4NF6 B;  1HSJ A;  3DP8 A;  1FBC A;  5JTY B;  5AA4 A;  1R9Q A;  2XWV A;  2P3N A;  1NNF A;  5LDZ A;  4P3L A;  3PPN A;  4P1E A;  4JXI A;  5I2K A;  2PFZ A;  3K4U A;  1DMB A;  5CMM A;  1BLF A;  3ODB A;  3NOH A;  2BJJ X;  4DI4 B;  3T22 A;  1P1O A;  5EQ8 A;  1MDP 1;  3KC0 A;  4PFR A;  3TAJ A;  3UOR A;  1Y3Q A;  2RF1 A;  4Q5T A;  4F3G A;  5TU0 A;  4P9K A;  2B65 A;  4GIZ A;  5F24 A;  3E78 A;  3VLW A;  2F6G A;  3SEY A;  3ONM A;  3T93 B;  1NV3 A;  1MXW A;  4ELR A;  3TZA A;  2B3F A;  1NFT A;  4P11 A;  4FEC A;  1H3D A;  5FHM A;  2OWS A;  5CC2 A;  3K01 A;  3T1B A;  1B5J A;  2XXP A;  3CHG A;  4U21 A;  4F3S A;  4X1B A;  3CI8 A;  5AA2 B;  3CR9 A;  3RGY A;  3LSW A;  5I2N A;  3A09 A;  1MQD A;  3T66 A;  3S4U A;  2P2A A;  1OVT A;  2I3W A;  4N6K A;  1LBB A;  4XFE A;  4I40 A;  3E4R A;  5I56 A;  2XXK A;  3VFJ A;  4PGP A;  2D21 A;  3DLN A;  2ZYN A;  2ZXT A;  4KCC A;  2ZYK A;  1MQJ A;  2H98 A;  5KZT A;  3UIF A;  1CE2 A;  5I2K B;  4N4U A;  5I57 B;  3MBP A;  2Y7W A;  4I9D A;  4XKR A;  2O69 A;  4Q0C A;  2DE2 A;  4NTL A;  4ZEK A;  2HAU A;  4BDO A;  4PET A;  3RLF E;  1EZ9 A;  1LGB C;  3AXF A;  2XXT A;  5ET5 A;  3VV5 A;  1TFD A;  3U92 A;  2UVG A;  4KI0 E;  2VPN A;  1BK4 A;  2REJ A;  3VDF A;  3OO6 A;  4OXV A;  3ILT B;  2GFE A;  1B0L A;  4U1O A;  4AB6 A;  1US5 A;  4ND9 A;  4IO5 A;  2MKZ A;  4N17 A;  2PT2 A;  3CRB A;  3KZG A;  2H5Y A;  1FBH A;  4EF2 A;  2F78 A;  4OHN A;  2DVC A;  2REG A;  4DCX A;  4OVJ A;  4EXL A;  4JVD A;  4RPN A;  4H6D A;  1NUW A;  1TFA A;  1IME A;  2IA4 A;  4R6Y A;  2QSX A;  5DTB A;  1US4 A;  3N94 A;  2A5S A;  1IXI A;  1QVS A;  3O6I A;  5CBR A;  1O7T A;  3QAX A;  1ZMG A;  5H8Q A;  4IO4 A;  1MPB A;  5DYH A;  4DCY A;  5A5L A;  1QKA A;  2PFY A;  3FXR A;  3IO4 A;  1MY0 A;  4JSD A;  3RNN A;  4OES A;  2D5W A;  2XX8 A;  4YZZ A;  1IIW A;  2XXI A;  3KFM A;  1B2H A;  3OSQ A;  1VFD A;  1PB7 A;  5B70 A;  4KR5 A;  2VP1 A;  3KC1 A;  2ABH A;  4FAT A;  3E3K A;  3OEM A;  4QSD A;  1FJ6 A;  4IY6 A;  1FTM A;  2B3B A;  4YIC A;  1A8F A;  3HO7 A;  1S7Y A;  3N5L A;  2ZNU A;  4F22 A;  3H03 A;  4OZ9 A;  2RC7 A;  1EH3 A;  5I7I A;  2QS2 A;  3K6U A;  1TWY A;  4IGR A;  4G8H A;  2HQ0 A;  4F2Q A;  3TTM A;  2H4I A;  2GHA A;  1CB6 A;  4XXU A;  3RT6 B;  5IM2 A;  4HW8 A;  1JQF A;  1JW5 A;  2QS4 A;  2X26 A;  1USY E;  1LLS A;  2A5T A;  3R26 A;  4PFB A;  4LZ7 A;  4F1V A;  1I6A A;  1POY 1;  1Y4T A;  3OXN A;  2QRY A;  2PVU A;  4G4P A;  1H76 A;  3G3I A;  1QJM A;  4MIJ A;  5F1Q A;  3T0J A;  3FXU A;  3B7D A;  1EYI A;  1MDQ A;  5FHO A;  4H8J A;  1FCK A;  1UTB A;  2ZZV A;  5CBS A;  2FBP A;  4EF1 A;  4ISU A;  1BP5 A;  1MY1 A;  1NV2 A;  3WAF A;  3EKI A;  3CIJ A;  1M5F A;  2V84 A;  1DTZ A;  2ONS A;  4QFO A;  3I3V A;  1DSN A;  2I58 A;  1KWH A;  3MP8 A;  4GL0 A;  1USY H;  1ZKB A;  1LBV A;  3VLU A;  2PT1 A;  2Y7I A;  3KN7 A;  4NF5 A;  1MXU A;  1JVY A;  4IY5 A;  4PQJ A;  1A54 A;  4ZED A;  4P0G A;  3B6Q A;  4KQP A;  1IMA A;  5J16 A;  3H6V A;  1B5I A;  5ET8 A;  3CVG A;  5CMB A;  2KQZ A;  3QIM A;  3M8U A;  2Z8D A;  2XXX A;  1MQH A;  4X04 A;  1N7X A;  1SW1 A;  4MJO A;  3C4M A;  3N6T A;  2G29 A;  4PP0 A;  4R6K A;  3VVD A;  2F6P A;  1JVX A;  5DVF A;  1KZ8 A;  4G68 A;  4NGU A;  4YB5 A;  3IOV A;  3C35 A;  4ZZA A;  3UK4 A;  5KDT B;  4DI3 D;  1Y3N A;  3N26 A;  2O7I A;  3U8Q A;  4R6H A;  1CNQ A;  5CRY A;  2W7Y A;  3THI A;  1M5C A;  2F97 A;  5J1D A;  5IAI A;  4BDR A;  2F5X A;  1MXY A;  4NF4 A;  3W15 C;  4TLM B;  1N3X A;  1ZTY A;  5ESY A;  3CFZ A;  3ZS6 A;  1MPC A;  5I57 A;  1B3F A;  3BIH A;  1IUD A;  2FIX A;  1A7L A;  4YAH X;  2F7A A;  2UVJ A;  1IMB A;  4FEB A;  1I6B A;  3G3F A;  3RYD A;  1A40 A;  3BFU A;  3KBR A;  1B40 A;  2O84 X;  1B4Z A;  1AWB A;  3LSF B;  3KGC A;  2VD2 A;  4ONY A;  4QXD A;  5A5X B;  1EYK A;  2A5T B;  3SEX A;  3IL1 B;  3IB1 A;  5H8S A;  4QSE A;  3FXB A;  3KOS A;  4NF8 B;  2Q8J A;  3EHS A;  3SKP A;  2FA7 A;  5I2N B;  5L9S A;  2VGQ A;  1NUZ A;  2PCR A;  4PFT A;  4TQU Q;  4FIM A;  3R7X A;  4EQ7 A;  4NMY A;  3M3K A;  4DZ1 A;  1MH4 A;  5EQA A;  4F19 A;  4FJP A;  2RKM A;  3I5O A;  1Y4C A;  3M3F A;  3QK6 A;  5M2V A;  4QFP A;  1NUX A;  4MNI A;  2I4C A;  4U23 A;  4H1X A;  2QVV A;  5EQ7 A;  1RYO A;  4IO6 A;  4F3B A;  2QMW A;  4IO3 A;  4PF8 A;  4MX6 A;  4KD5 A;  1LAH E;  1B51 A;  2Q89 A;  4PAK A;  2ESN A;  4GBV A;  2QS1 A;  5I5P A;  3Q27 A;  4MFI A;  1O63 A;  3RTF B;  3GLB A;  4O8M A;  4UA8 A;  4FAJ A;  3PGF A;  1N76 A;  4H67 A;  1JNF A;  4F29 A;  4FE8 A;  4KPT A;  2Y7R A;  1DK4 A;  4IB2 A;  4GWX A;  1EZO A;  5H8F A;  3HCQ A;  2FVZ A;  5I59 B;  2DYX A;  1SW4 A;  2F8D A;  4GOT A;  4TOZ A;  1FQC A;  1NH8 A;  1ATG A;  4PFU A;  3MQ9 A;  2Y5K A;  1MPD A;  1LAG E;  3KJ7 A;  1PB9 A;  4U22 A;  2DVZ A;  2ONR A;  1D9Y A;  2KLF A;  4UAC A;  4Q30 B;  1II5 A;  5CI5 A;  3OEN A;  2AL4 A;  3OEL A;  3MZ9 A;  3ZKK A;  1FPB A;  4YKP A;  1LBZ A;  3E9X A;  4QHQ A;  4KXP A;  4JVI A;  1Y1Z A;  2QVR A;  1B7H A;  1SW5 A;  2FIE A;  3K2D A;  4OVQ A;  1VDW A;  4C1T A;  4Q8R A;  3K0V A;  2HZL A;  3H4Z A;  5JK4 A;  1PBP A;  4ELQ A;  4GX3 A;  1MM6 A;  3K6W A;  1M5E A;  2OCU A;  1B3G A;  4NF8 A;  5H8N A;  2WEF A;  5IZ1 A;  4PFW A;  2F7B A;  2XXV A;  3SEV A;  2Y84 A;  4OFJ A;  4OVS A;  4KFQ A;  1Y1M A;  1S50 A;  1FPL A;  3EHT A;  4GRK A;  4NF5 B;  4OYV A;  2WYP A;  2H25 A;  3L6G A;  4R74 A;  3TTR A;  3FVK A;  3RPW A;  4DE8 A;  5TP9 A;  4KCD A;  5I84 A;  1OIB A;  3HV1 A;  3FD3 A;  2HPG A;  1N3W A;  5AA2 A;  3TTK A;  2YJP A;  4QFL A;  4QF9 A;  2WKY A;  1G0I A;  1BKA A;  3O2A A;  2DWI A;  3E79 A;  4O3C A;  3KOT A;  3U72 A;  2QVU A;  4I3E A;  3IB0 A;  4OEV A;  1AL3 A;  4GWY A;  1SBP A;  4PE5 B;  2Z8F A;  1H45 A;  1NV6 A;  1AMF A;  4NG7 A;  4O3B A;  5EHM A;  4NAP A;  2Z22 A;  1PB8 A; 
#chains in the Genus database with same CATH homology
 1EYK A;  1SPI A;  3B8B A;  1IMA A;  4PTK A;  3U65 A;  4MNC A;  2JJK A;  1KA1 A;  5DW8 A;  2KR0 A;  4O7M A;  1YYZ A;  2GQ1 A;  3KC1 A;  5I3S A;  5J16 A;  4HE0 A;  4FBP A;  3FXB A;  4NX1 A;  5EQ9 A;  4OVT A;  4P8B A;  4N4U A;  1FBD A;  1XI6 A;  1FPB A;  1D9Q A;  1LBZ A;  3A29 A;  4PDH A;  4KXP A;  1FJ6 A;  4AS5 A;  1LEV A;  2L5V A;  5ET8 A;  3MYU A;  4JVI A;  4MAG A;  2QVR A;  1FBC A;  2HZK A;  4YIC A;  1INP A;  4H46 A;  2HHM A;  3GYY A;  2KQZ A;  1FBF A;  2FIE A;  2DE2 A;  1NUZ A;  1IMD A;  2PCR A;  2XWV A;  2P3N A;  1VDW A;  4OVQ A;  1FPK A;  4PBH A;  4NQ8 A;  4PET A;  4X9T A;  4F1U A;  4HE2 A;  1FJ9 A;  4N8Y A;  4MCO A;  1FPI A;  4GWW A;  2HZL A;  5LDZ A;  4X04 A;  4F18 A;  1JP4 A;  4MJO A;  3D1R A;  1YXI A;  2WYK A;  4P3L A;  5I7I A;  4GWZ A;  1IMC A;  4N6D A;  5JK4 A;  2Q8M A;  1FPF A;  1EYJ A;  5ET5 A;  1RDZ A;  4P1E A;  4GX3 A;  1KZ8 A;  4N91 A;  4N8G A;  4NGU A;  2PFZ A;  4GWU A;  5EYH A;  1FSA A;  5IZ3 A;  2WEF A;  5EQA A;  5IZ1 A;  2B4L A;  1K9Y A;  2QFL A;  2VT5 A;  3NOH A;  1NUY A;  1NI9 A;  1DBZ A;  4I3Y A;  1FBE A;  3ROJ A;  4OA4 A;  4F19 A;  2QPQ A;  3PTY A;  4DI4 B;  4XEQ A;  4GX6 A;  5EQ8 A;  2CZH A;  5IM2 A;  2V4C A;  2VPN A;  3KC0 A;  1BK4 A;  4PFR A;  3ISP A;  3RPL A;  4LN5 A;  3SZP A;  2Y5L A;  1FPD A;  4P56 A;  1LBX A;  1CNQ A;  2DE3 A;  4GBW A;  2Q74 A;  4PFB A;  2CZI A;  3B50 A;  4GX4 A;  1NUX A;  1FBG A;  2DE4 A;  4MNI A;  4OVS A;  4P9K A;  4F1V A;  4P47 A;  1FPL A;  2QVV A;  5EQ7 A;  5F24 A;  4NF0 A;  3E78 A;  2MKZ A;  1NV7 A;  4DI3 D;  2B4M A;  4MNP A;  5J1D A;  5IZZ A;  2XA5 A;  4N17 A;  5IZ3 B;  4N15 A;  5EYG A;  1NV0 A;  1G0H A;  4MX6 A;  4PF8 A;  1NV3 A;  2WYP A;  4PF6 A;  2DDK A;  4JVC A;  1FBH A;  2OWZ A;  2F5X A;  3IFC A;  4IR8 A;  4HCY A;  4MIJ A;  4PAF A;  3T0J A;  4PE3 A;  3KBZ A;  5LTC A;  5IGA A;  3RPL B;  1IMF A;  1FBP A;  4HXV A;  1RDY A;  5FBP A;  4PAK A;  4MEV A;  1EYI A;  4GBV A;  5ET7 A;  2Q9T A;  4P1L A;  4QBA A;  5I5P A;  4PFI A;  1NV5 A;  2WBD A;  2CEY A;  1K9Z A;  2ZZV A;  5ESY A;  2FBP A;  4JVD A;  4O8M A;  4PC9 A;  2HPG A;  2XWK A;  4OVP A;  3IFA A;  1NUW A;  1NV1 A;  1IME A;  3T1B A;  3FBP A;  1NV2 A;  1FTA A;  3MST A;  2F3D A;  2F3B A;  3QMF A;  4O7I A;  3EKI A;  1G0I A;  3LUZ A;  4PAI A;  3BIH A;  4MHF A;  4AS4 A;  4XF5 A;  1YZ0 A;  1RDX A;  5ET6 A;  2HXR A;  4UAB A;  3CHG A;  5CM6 A;  2FIX A;  4PGN A;  2ZZW A;  1DK4 A;  1FPG A;  2CEX A;  3E79 A;  4HCW A;  4GWX A;  4N81 A;  1FPJ A;  1Q9D A;  1IMB A;  5A5L A;  1KA0 A;  4OVR A;  1FRP A;  2WBB A;  2PFY A;  1FPE A;  2FVZ A;  2QVU A;  2VPO A;  2XWO A;  4I3E A;  1LBY A;  1LBW A;  1NV4 A;  4OAN A;  4PDD A;  3BIG A;  3RYD A;  4X8R A;  4PBQ A;  4GWS A;  1LBV A;  2P3V A;  3LV0 A;  2OX3 A;  2XWI A;  4NHB A;  4GWY A;  4MMP A;  4N6K A;  2Y5K A;  4YZZ A;  2BJI A;  2WX9 A;  4XFE A;  1NV6 A;  4I40 A;  3W9V A;  4PCD A;  3W9W A;  1AWB A;  4G61 A;  4H45 A;  2XXK A;  1DCU A;  2R8T A;  1QGX A;  2DVZ A;  4NG7 A;  4NN3 A;  4O94 A;  4M1V A;  4NAP A;  5T3J A;  3HFU A;  2FHY A;  4HE1 A;  2V3Q A;  4PGP A;  2ZZX A;  2CZK A;  4QXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...