3LUZA

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
238
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEDYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extragenic suppressor protein suhB
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
source organism Bartonella henselae
total genus 78
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3luzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3luzA02
1EYIA 4GWWA 1DK4A 1CNQA 2F3BA 1AWBA 4I3EA 1QGXA 1FBHA 1YYZA 1EYKA 1LBVA 5A5LA 1FBDA 3IFCA 5ET5A 5EYGA 3RPLA 4GX3A 2DDKA 1K9ZA 2CZHA 1NV6A 2CZKA 2PCRA 4HE2A 1NV1A 5F24A 2QVUA 3KC0A 2R8TA 2OX3A 1YXIA 2FVZA 1IMAA 1FPKA 4GBWA 4I3YA 5ET6A 1NV4A 2QVRA 1NV7A 4GWZA 2Q74A 1LBXA 2OWZA 2CZIA 4GX6A 3RPLB 2QFLA 3KBZA 1SPIA 1IMDA 3BIGA 1JP4A 2Y5LA 3IFAA 1IMBA 3KC1A 1DBZA 3LV0A 4HE1A 2FIXA 1NV0A 1FPLA 1RDYA 5I3SA 5EQAA 1VDWA 2WBBA 4GWYA 3T0JA 2P3VA 1KZ8A 4IR8A 4AS5A 2BJIA 1NV3A 3B8BA 4AS4A 5EQ8A 1FPFA 4PTKA 4N81A 4GWUA 1XI6A 2FBPA 2FHYA 5J16A 2F3DA 4FBPA 3LUZA 1INPA 1G0IA 1FRPA 1LBZA 4HXVA 1FBFA 4HE0A 1RDXA 5EQ7A 5LDZA 5ESYA 1FPJA 4I40A 5DW8A 5FBPA 4GBVA 1FPDA 1FPEA 1K9YA 1NUYA 4GX4A 1LBYA 1FPIA 1NV2A 3D1RA 3QMFA 5IZ1A 5EQ9A 1DCUA 2FIEA 4H45A 1IMCA 5ET7A 3FBPA 5IZ3A 4GWXA 3RYDA 1NV5A 1FSAA 2GQ1A 2QVVA 1KA1A 4G61A 1FTAA 1FBEA 1G0HA 1NUXA 3ROJA 1IMEA 5ET8A 2WBDA 5T3JA 3A29A 3BIHA 4O7IA 1KA0A 5IZ3B 1EYJA 2WEFA 1FJ9A 4KXPA 1BK4A 4H46A 1IMFA 1FPGA 2P3NA 1LEVA 1NI9A 4QXDA 1FJ6A 1RDZA 4GWSA 5EYHA 1D9QA 2JJKA 1FBCA 1FBGA 4MJOA 1LBWA 1YZ0A 2Y5KA 2VT5A 1NUZA 1NUWA 1Q9DA 2Q8MA 2HHMA 1FPBA 1FBPA
chains in the Genus database with same CATH superfamily
2PT2A 4H0WA 3ILTB 3OMBA 3ONMA 3RTFB 3IFCA 3T9UA 3TAJA 2CZKA 4PBHA 4F19A 1JW4A 4EDPA 1QKAA 3TCGA 3E79A 2DVZA 5AA1A 3K02A 4KD5A 3QIMA 3P7IA 3OXNA 2PT1A 3U8QA 1KZ8A 5EQ8A 1R9LA 4F1UA 4P3LA 1DTZA 4YB7A 3SEUA 4U4SA 1G0IA 4O8MA 1RKMA 5FTIA 4IO4A 5I56B 5ESYA 2XX7A 4I40A 4X8RA 3LBSA 1NV2A 4HCWA 4IY6A 4YMBA 3QSLA 2QVVA 4ZZAA 3V83A 4MHFA 4RPNA 4EQBA 3H06B 4JVDA 1UTBB 2OWTA 4NF8A 2XWOA 5EHMA 4ND9A 2HEUA 2F34A 4U22A 1Y1ZA 3SKPA 3S2VA 4H46A 1NMUA 4BLAA 2V93A 4N6KA 1SW1A 2PBWA 3IJOB 2R9JA 1UQWA 4IO2A 3K01A 2RF1A 1H45A 2HPGA 3MBPA 1B3FA 3KZGA 1LAGE 3B6QA 4QFPA 3CSGA 4TOZA 4OVPA 3DLNA 2Z22A 4KYDA 2RC9A 3ZSFA 2D21A 3HHFA 1UIVA 1P1QA 3KGCA 4OVTA 2DWJA 2I58A 1MM7A 4TQUQ 3TUSA 2QVUA 2XXVA 1FQCA 1P1OA 1PDAA 2I0CA 1IIWA 2I3WA 1VFEA 5IGAA 2OPEA 4PCDA 1BIYA 4OQOA 2DWIA 1B3EA 1JP4A 3M3KA 1IMBA 5JK4A 3TDJA 1VFDA 2WKYA 3H03A 1Y4CA 5AA2D 5KCJB 1BTJA 4EQ7A 2QPQA 4P11A 2CEXA 1UTHA 4UACA 3LUZA 2I6EA 2O6AA 3PV0E 3TFLA 2OBGA 1LAXA 3PTYA 4OERA 4WKMA 2Q89A 3FATA 4P1LA 5I58A 1QW0A 4QSCA 5IAIA 4PGNA 1IMCA 2OLBA 4THIA 2GQ1A 4I1DA 3TTNA 3FVNA 2F36A 4IO6A 2H98A 2NUVA 2DSFA 4OWDA 4O7IA 2W7YA 1B2HA 1II5A 1MXVA 4DI3D 5H8FB 3RN8A 4PBQA 3G7WA 3IAZA 1LCTA 1B1XA 2H25A 3MJNA 4FE8A 1N76A 4EXKA 4LP2B 3SZPA 2Q8MA 1FBPA 4KHZE 4ZECA 1DK4A 1B3GA 1LSTA 5ET5A 1AIVA 2B4MA 4DCXA 2CZHA 4HCYA 1I6AA 1I6BA 1P1UA 5ET6A 1USYE 3IB1A 4M4GA 4YZZA 1QJMA 1NFTA 4ZEBA 4F31B 1A7LA 3H6VA 4N8YA 3U65A 3C35A 4R2BA 4NWCA 3K6XA 2XXPA 2BJIA 2R6GE 1B05A 2V3UA 1B6HA 4Z7EA 1URSA 1CB6A 1RYXA 2R71A 1FQFA 1B9JA 1WDNA 4F2QA 2XA5A 3G3KA 3NOHA 3BFTA 1LB8A 1B3HA 1SI1A 3T9VA 5EQ9A 2FNCA 3CI8A 2FIEA 4H45A 2KLFA 2KQZA 3RYDA 4BDNA 2HZKA 2BJJX 4RYAA 3MYUA 3C9HA 2DS9A 5I59A 2B3BA 4MLVA 5CMCA 1LAFE 1NNFA 3VVEA 4P8BA 4XFEA 4TLMB 1LEVA 4P0IA 3B6WA 4NF8B 3EHTA 2VPOA 3FZVA 2JJKA 5HPQA 3HSTA 1O63A 4YICA 5TP9A 1N0TA 1NUZA 1MY3A 2OPDA 3RT6B 4PDHA 4N4UA 2XHDA 4I3EA 3S4UA 1GVCA 5CM6A 5A5LA 1FBDA 3FVGA 3ZKKA 4JVIA 4NF4A 3M3LA 3RPLA 3PU5A 1K9ZA 5F24A 3KC0A 2F7AA 3K4UA 5DVFA 3IB2A 3MP6A 1TFAA 2O68A 3KN3A 1A99A 2OWZA 1SI0A 2O51A 5I2KA 4QRZA 1FQBA 3G3HA 5BWJA 3KC1A 1NH7A 4DIGA 1B4HA 2WBBA 1SD3A 2UVJA 1HSLA 4F39A 2F97A 5H8QA 4PE5B 1PB8A 2FBPA 1MXZA 1QUJA 4HXVA 4OETA 1UTHB 2RINA 2V25A 1SDXA 5FBPA 4ECFA 1YAEA 2DWHA 5KZTA 3PMVA 4OXVA 4WXJA 3SDFA 4X1DA 4GXAA 5I58B 2XXYA 3GBBA 1KA0A 4PP0A 2V84A 4PAKA 1D9YA 1BK4A 3MAMA 1NI9A 4BDQA 2NOOA 4EQ9A 3PPRA 1SVXB 3LC8A 1OMPA 2HFBA 2QS3A 1ZTYA 1SYIA 4OVSA 3UK4A 1XHYA 4JVCA 1AWBA 2ZYKA 2DOJA 1QGXA 1FBHA 2NWJA 3T93B 4PFRA 3LSLA 3KOSA 3SEWA 3T1BA 3UA8A 4BDLA 1IMAA 4PFWA 1NV4A 3FVOA 4GWOA 5AA2B 3PPOA 4NTLA 1ZKBA 4OENA 1AH5A 3PUXE 2HAVA 2UYEA 4OEUA 5I57A 5AE4A 1EZ9A 3HHGA 2XXRA 4PFTA 3KBRA 3MZ9A 2ZYOA 3MVYA 1Z7NE 1IXGA 3T96B 2AYSA 1MY4A 2RKMA 3H6TA 2Z8FA 3MSTA 5DT6A 5KCJA 2Z8EA 3ECRA 2A5TA 4P9KA 3EQ1A 3Q26A 1AOVA 2H99A 4LZ7A 1JETA 4PF8A 4PDDA 4PFUA 4EF1A 1NH8A 3IOWA 3EN3A 1PB7A 3OO9A 3UORA 4XF5A 3KJTA 1DCUA 3IOVA 5ISUA 3FD3A 4PFIA 2O1LA 1VR5A 1MQGA 3SEVA 5ET8A 4MX6A 3V8XB 3H6WA 2UVHA 5M2VA 3K6WA 2NVUB 3CFLA 4Q0CA 1SYHA 4LA9A 4H8IA 3S9NC 2PFZA 3OEMA 3JV9A 4KR5A 4LONB 3H7MA 5I59B 1JVYA 3O2AA 1LFGA 3VVDA 1MG1A 2F6GA 3FJ7A 2NXOA 1Y3PA 4R75A 3PUYE 3OOAA 2F3BA 4F3PA 3O6GA 2P1SA 4R73A 5TP9B 2Y7PA 3TTKA 1CE2A 1POY1 1FPKA 2RCAA 4GBWA 2X7QA 2YLNA 2XXXA 4PC9A 1TT1A 1B4ZA 2WYKA 4NF4B 3RPLB 3O97A 1PC3A 5BUUA 1Y20A 3BIGA 4ZEDA 4H8JA 3TPAA 2YPNA 3MPLA 2FIXA 2RCBA 1YTVA 1XT8A 5I2KB 1P1WA 4Q8RA 1DPEA 4ZEIA 4QFLA 1Q1KA 5I2NA 1Y1MA 4GXSB 3O6IA 3OO7A 4ESXA 1INPA 1LBZA 2F6PA 1B5IA 1XS5A 3E9XA 5H8QB 3R6UA 5LDZA 4ZEFA 3A3UA 4ZE8A 1MS7A 1QULA 3I6VA 1GR2A 1B46A 4ZDMA 2GRVA 3D4GA 3MP1A 1S9TA 1DSNA 1WODA 4JWOA 2REGA 3CFZA 3BIHA 4LN5A 4RXLA 3MVXA 2THIA 2E0SA 4MH5A 2WEFA 2Q88A 4N07A 1EZPA 4Q5TA 1WVJA 3C36A 1IMFA 2P3NA 4WEPA 3KN8A 4XKPA 3LSXA 2QS2A 5DVJA 2ZYNA 1FBGA 4DI4B 2VT5A 3E78A 3TZAA 1TFDA 1SBPA 3RLFE 4DDDA 1LB9A 4FJPA 4XXUA 2AL5A 3TEPA 2R8TA 4GD5A 3CIJA 4L17A 4N6DA 4RA1A 1PB9A 3CVGA 2VPNA 3SESA 4PQJA 2VD2A 3KBZA 2RC7A 3K0VA 1B51A 2HXRA 5CBSA 5A5XA 4R2FA 3LV0A 3PD9A 5I5PA 2XXKA 4GLIA 3N26A 4F3BA 4F1VA 1MDQA 2P3VA 1H43A 3QXMA 4MNPA 1NV3A 4AS4A 4KPTA 4UA8A 5I57B 3MWBA 1A54A 4U1ZA 2B4LA 2YJPA 3PPNA 2XWIA 1Y3QA 1FRPA 1B1HA 1SW4A 3DP6A 1B0HA 3SEXA 4PFBA 1RDXA 2Y7KA 1IQ7A 1A8FA 3RPWA 5CMKA 2A5TB 2L5VA 2Q2AA 5IKBA 3EF7A 1KA1A 1JNFA 5CMBA 4BDRA 1G0HA 4FEDA 4RY1A 4DXUA 5T3JA 2XXWA 1US5A 4PFYA 2OK2A 3LUYA 1FTOA 5DEXA 4R6YA 2HQ0A 1AL3A 2ALUA 4IO5A 1HSEA 1HSJA 3L6HA 2PMSA 4R9GA 1FW0A 1MXWA 4NEDA 3UGWA 3JZJA 1B7HA 1B7UA 4FAJA 4QHQA 1IUDA 1IITA 1N84A 1Y9UA 4HS7A 4F1YA 2Z8DA 4FEBA 3U94A 1M5EA 4IO7A 2ZNUA 1USYH 3PPQA 2PYYA 1YXIA 2ZNTA 2H5YA 2QVRA 4GWZA 4RK9A 4DXCA 1SW2A 4GX6A 3S9LC 4QSDA 3O66A 3K1NA 1B7ZA 5AA2A 5CBRA 3TTMA 4NAPA 3E4RA 4N81A 1D3KA 4X9TA 2ZMBA 1IXIA 2P2AA 4X48A 1JEVA 3S9EA 3PMXA 1QVSA 3K6UA 5F1QA 5AA4A 4NN3A 5I2NB 3VLWA 1FPJA 4QFOA 2IEEA 4ZZEA 1FPDA 1LBYA 1BP5A 3QYTA 4PAFA 4MMPA 4P0GA 2ABHA 2V4CA 4E0WA 4OTEA 4YKJA 3C31A 3HFUA 3ISPA 1UIUA 5L9SA 1OQGA 2O84X 1O64A 4MEVA 2UVIA 4FORA 3AXFA 2I4CA 5TPAA 4G68C 2F78A 2WYPA 3IO6A 4H5GA 4GFRA 4QFKA 4R6KA 1LBWA 1YZ0A 1ZIUA 1M5CA 1GGGA 1B5JA 2V3TA 2M8CA 5L8DA 2QL3A 3PUWE 5EYGA 1MH4A 2ZZVA 4OVRA 4POXA 1Y4TA 2VP1A 3G3FA 4I3YA 1SQYA 1FTKA 3EKIA 3W15C 2QFLA 5J1DA 3HCQA 3VE1B 4Q30B 3OO8A 4DLDA 2XXUA 3JYRA 4OYVA 3TELA 1VDWA 3OELA 5IM2A 4M1VA 2XXHA 5CC2A 3B50A 4RNSA 4AS5A 4EF2A 5IZZA 5A5XB 1XVXA 4MBPA 3KN7A 3W9VA 4FBPA 2D5WA 1IXHA 4PAIA 1YCJA 1H76A 3IB0A 1URGA 3TODA 2QSXA 4F3GA 2V3QA 1QUIA 1DMBA 2Y7RA 1MQIA 4JSDA 3A3CA 4LQ5A 3MC2A 3ROJA 2WBDA 2B65A 1MDP1 3KG2A 1NL5A 2G93A 1D9VA 3QAXA 4RK2A 3CG1A 1R9QA 4IGTA 2ANJA 4XIGQ 3KSXA 3IJXB 2OJTA 3T22A 5CI5A 5DEXB 1B3LA 3TQLA 1FBCA 1Q9DA 1NUWA 4U21A 5H8SA 1P99A 1OIBA 4F29A 1CNQA 1ZLQA 4NX1A 3KEIA 4POWA 3TKDA 3IL1B 3VLVA 3FV2A 4DCYA 5H8NA 4R72A 3G3IA 4P47A 5DTBA 3EPEA 1IMDA 4KI0E 1ELJA 4JB7A 2WX9A 1N3XA 3U92A 3E3KA 2XWVA 2GHBA 4OHNA 1NV0A 1FPLA 2OWSA 4OESA 4NHBA 1NNTA 2CEYA 2QS1A 3N6TA 3B8BA 1ZMGA 4DZ1A 3MVWA 4ELQA 2FHYA 4R74A 5J16A 4ZE9A 4ZEKA 4FECA 3L6GA 1L5TA 1VSOA 2DQVA 1OVBA 1EU8A 4AQ4A 5JTYA 4HE0A 5ICTA 4XKNA 4QBAA 3O28A 4IY5A 1FPEA 3QMFA 4F18A 4FIMA 4KCDA 5I84A 1I6QA 3WAEA 1NV5A 1POTA 4RPOA 4P1EA 3VFJA 5AA4B 4XEQA 2Y7IA 2H9BA 3FJGA 4NF5A 4HW8A 1MQHA 2HCAA 1EH3A 3CRBA 1XOCA 1LFHA 4OA4A 1D9QA 5TPAB 1JW5A 1JW1A 1Q35A 1FTJA 3C4MA 2O1MA 4XKRA 4U23A 4RJZA 2DDKA 1NV6A 3D4CA 3K1MA 2QRYA 3RY3A 1NV7A 5F7VA 1LBXA 1MXXA 4GVOA 4N6PA 4MNIA 3B6TA 4HE1A 1F9BA 4F22A 1IXCA 1ZU0A 5I3SA 1JQFA 1JVXA 4GWYA 1QUKA 3IR1A 2DVCA 5LTCA 2DE3A 4MNCA 3ZS6A 2ZNSA 2KR0A 4GQOA 4NF0A 1IZ1A 4IB2A 3M8UA 4PE3A 3VVFA 1NKXA 3FV1A 1B32A 4G8MA 5FTHA 4MF3A 3D1RA 1S7YA 5HM4B 4R6HA 1QKBA 1I69A 3PMWA 3H6UA 3IO4A 2I48A 1FBEA 2Y84A 3SERA 2F8DA 4NG7A 1JEUA 3A29A 4OMBA 3ILUB 4O3BA 4YKKA 2QMXA 1A40A 3VV5A 4OFLA 1GV8A 1M5FA 1RDZA 1OVTA 4GWSA 1MY1A 4MLQA 1N7WA 3C33A 1LCFA 1MPDA 2F35A 2ZXTA 1MPCA 2VHAA 4GOTA 1B0LA 1LLSA 2HHMA 2F7BA 3OSQA 4U4XA 4GWWA 2Z23A 4PF6A 4X1BA 1EYKA 1LBVA 5B7DA 4ISUA 4GX3A 1B5HA 4O94A 2PCRA 4E0XA 4X04A 3OD7A 3FGSA 2P0SA 1MM6A 3M3FA 2CZIA 1KWHA 3A09A 3QUFA 5KDTA 3IFAA 4EUOA 2ZYMA 3CHGA 2XXIA 1TXFA 1OQHA 1SW5A 1FCKA 5H8NB 2DE2A 2XD2A 4NF6A 1PEBA 1LAHE 3MPKA 4P56A 4O7MA 1NNKA 3OSRA 1XI6A 1OLAA 1A8EA 4KYSA 3LSWA 5ITOA 4ELOA 3ODBA 4OFJA 2UXAA 2ZZXA 3FXQA 4PETA 3CSBA 5DW8A 4H67A 2DXRA 3BBRA 2XWKA 3G3GA 5JTYB 4FATA 4EXLA 1LGBC 4YKIA 3RTWB 1IMEA 2O69A 1MXYA 3KOTA 3MVZA 5EYFA 1VE4A 5H8HA 5TU0A 2X7PA 1XC1A 4GF8A 4QXDA 1OLCA 3W9WA 5EYHA 1MPBA 4NF5B 2HAUA 4JDFA 3TCFA 5L9MA 4HTGA 2B3FA 4JXIA 4G4PA 3FIRA 4G68A 2Q2CA 1EYIA 1FQAA 3TCHA 2I3VA 4N17A 3FXRA 3GBAA 3Q25A 3VDFA 4LUBA 2XXQA 4NWDA 3R7XA 1S50A 3H3GA 4MCOA 1MXUA 3TMGA 3CFXA 4OVQA 4YAHX 2F5XA 1DBZA 2QJEA 3DP4A 1FTLA 3FXUA 3CG3A 5I7IA 3GZGA 4OANA 3OO6A 4JWYA 3ZKLA 3MP8A 1MRPA 4DE8A 1US4A 2ONRA 4GL8A 5L9OA 1FBFA 2RC8A 4GBVA 1FPIA 3HO7A 5B70A 5ET7A 3THIA 5IZ3A 3DELB 1FSAA 3OEKA 3N6UA 2VGQA 1NUXA 1MH3A 4YU0A 1DOTA 3B7DA 1EZOA 4ONYA 3FJMA 4H6DA 4XTCQ 3MQ9A 4H65A 1A55A 4LVQA 3GYYA 5ELVA 5HBCA 4G77A 3PUVE 1FPGA 3PPPA 3KSJA 1FJ6A 4O3CA 3IK6B 4YB5A 4IO3A 2ZZWA 3PUZE 3DP8A 5FHNA 4LZ5A 4O3AA 4N8GA 2G29A 2ONSA 3PD8A 4MIJA 2I49A 1YYZA 2OZZA 2LAOA 3KJ7A 2Y7WA 1FQDA 5ITPA 4HE2A 3PGFA 4LATA 1FTMA 1ATGA 2GH9A 3KFMA 4TLLB 4GL0A 3MZ1A 2Q74A 2IA4A 4JBZA 4C0RA 4OFOA 4PGPA 3IORA 2Y5LA 2X26A 3F11A 4WEDA 2UVGA 5EQAA 4GRKA 2DP8A 4IR8A 5KDTB 4G8HA 3DM0A 1BLFA 1MQJA 1FPFA 4PTKA 2PX1A 2DYXA 2F3DA 2HXWA 1M5BA 1N7XA 3EHSA 3IOUA 4NF6B 3GLBA 2PVUA 3UN6A 3UP9A 4N15A 2AL4A 3UIFA 3VXCA 3K00A 1PBQA 5DYHA 1P1NA 1H44A 3E13X 1O7TA 4GWXA 4MAGA 3FUZA 4AB5A 3SEYA 2XX9A 4NGUA 1XVYA 3O6HA 5ICQA 4GIZA 3VXBA 3G3JA 4YB6A 3WAFA 4YKPA 4OZ9A 3TTRA 4KFQA 3U72A 4U2RA 3R26A 5K2XA 1DPPA 2I0BA 1MY0A 3U93A 5H8HB 4U1OA 3C32A 2GHAA 4N91A 1TWYA 5K2YA 4ELPA 1Y3NA 3MZBA 3HN0A 5AA3A 4G68B 1RYOA 3Q28A 2ONKE 1ZJLA 1N04A 1B40A 2DXYA 3V89B 1LBBA 1SPIA 3EHUA 3N94A 2VD3A 3HPIA 4G8NA 3FXBA 4H1XA 3I5OA 2PFYA 2GFEA 4OEVA 5CRYA 3T0JA 3Q29A 2QMWA 1B58A 2VOZA 2E1SA 4NE4A 4ESWA 5I56A 4KYEA 4KQPA 4GWUA 2Q9TA 3LR1A 3Q27A 3HV1A 3C34A 4NMYA 3IOTA 2ESNA 5EQ7A 1Z7ME 3K1PA 4F3SA 5FHMA 1K9YA 1NUYA 3USDA 1UTBA 5LOMA 3H4ZA 3VLUA 3FBPA 2I4BA 3T66A 4R9FA 4K3FA 5EHSA 4G61A 3QUJA 4BDOA 1NNPA 4NQ8A 2UYFA 1BKAA 4N13A 2D3IA 3QK6A 5FHOA 3MW0A 5IZ3B 3GXAA 3T9HB 1FJ9A 4Z0IA 1MY2A 4IGRA 3BFUA 4G2ZA 2REJA 4ZS9A 2FYIA 2XXTA 4I8CA 3T9XB 4DXBA 1DTGA 1FPBA 4UABA 1URDA 2A5SA 4OVJA 2F7CA 1MQDA 5JEIA 2O7UA 3MUQA 2MKZA 1J1NA 1YPNA 2O7IA 1R6ZA 2OCUA 4BDMA 1R1NA 3RGYA 1NV1A 3I3VA 2OX3A 3SETA 2FVZA 3U1OA 3FASA 2AIXA 2Q8JA 1LFIA 3RQTA 4LZ8A 4YMAA 1PBPA 3S9MC 4AB6A 1RDYA 3TQWA 1D4NA 4QSEA 3RUMA 4C1TA 3V5AA 2XX8A 4KCCA 1IEJA 3TTLA 4QFNA 4MFIA 2FA7A 3K2DA 4F2OA 3CR9A 3N5LA 1ZBMA 3O9PA 3LSFB 4GX4A 1LBCA 5IZ1A 1B52A 5DVIA 1N3WA 1M5DA 5H8FA 5CMMA 1AMFA 4ELRA 2DWAA 4I62A 1FTAA 1GTKA 2QS4A 1T0KA 4C1UA 4JWXA 1ANFA 4H5FA 2XD3A 4I9DA 3RNNA 4JSOA 3O29A 1EYJA 4QF9A 2CMOA 4KXPA 3IX1A 4LQ2A 1H3DA 2CZLA 2DE4A 2HZLA 4MJOA 3FVKA 3OENA 3RT8A 2Y5KA 1FQEA 3BKIB 3TYHA 2H4IA 3K6VA 4XKQA
chains in the Genus database with same CATH topology
1EYIA 4JVCA 1AWBA 1QGXA 4N17A 1FBHA 3IFCA 5EYGA 2ZZVA 2CZKA 4OVRA 4PBHA 4PFRA 4F19A 3T1BA 1IMAA 4I3YA 1NV4A 4MCOA 3EKIA 3E79A 2DVZA 2QFLA 5J1DA 4OVQA 2F5XA 1DBZA 1VDWA 5IM2A 4M1VA 3B50A 1KZ8A 5I7IA 4OANA 4AS5A 5IZZA 5EQ8A 4F1UA 3W9VA 4P3LA 3MSTA 4FBPA 1G0IA 4PAIA 4P9KA 4O8MA 1FBFA 4PF8A 4PDDA 5ESYA 4I40A 4X8RA 4GBVA 1NV2A 1FPIA 4XF5A 1DCUA 4HCWA 2V3QA 5ET7A 5IZ3A 1FSAA 4PFIA 2QVVA 4MHFA 1NUXA 3ROJA 5ET8A 2WBDA 4MX6A 4JVDA 2XWOA 3GYYA 2PFZA 4H46A 1FPGA 4N6KA 1FJ6A 2ZZWA 1FBCA 1Q9DA 1NUWA 2HPGA 4N8GA 4OVPA 1CNQA 2F3BA 4MIJA 1YYZA 4NX1A 4OVTA 4HE2A 2QVUA 1FPKA 4GBWA 4PC9A 5IGAA 4PCDA 2Q74A 2WYKA 4P47A 3RPLB 1IMDA 3BIGA 4PGPA 1JP4A 2Y5LA 1IMBA 2WX9A 5JK4A 2XWVA 2FIXA 1NV0A 1FPLA 4NHBA 5EQAA 4IR8A 2CEYA 2QPQA 3B8BA 2CEXA 1FPFA 4PTKA 2FHYA 5J16A 2F3DA 3LUZA 1INPA 1LBZA 4N15A 3PTYA 4HE0A 5LDZA 4QBAA 4P1LA 1FPEA 3QMFA 4F18A 4PGNA 1IMCA 4GWXA 1NV5A 4MAGA 2GQ1A 4P1EA 4XEQA 4NGUA 4LN5A 3BIHA 4O7IA 4DI3D 4PBQA 2WEFA 1IMFA 2P3NA 4OA4A 1D9QA 3SZPA 1FBGA 4DI4B 2VT5A 3E78A 2Q8MA 1FBPA 4N91A 1DK4A 5ET5A 2B4MA 2DDKA 2CZHA 1NV6A 4HCYA 2R8TA 5ET6A 4N6DA 1NV7A 4YZZA 1LBXA 2VPNA 3KBZA 1SPIA 4MNIA 2HXRA 3LV0A 5I5PA 4HE1A 2XXKA 4N8YA 3U65A 3FXBA 2PFYA 4F1VA 5I3SA 4GWYA 3T0JA 2P3VA 4MNPA 2BJIA 1NV3A 4AS4A 5LTCA 2DE3A 4MNCA 4GWUA 2Q9TA 2KR0A 2B4LA 4NF0A 2XWIA 4PE3A 1FRPA 4PFBA 1RDXA 5EQ7A 2XA5A 3NOHA 1K9YA 1NUYA 3D1RA 5EQ9A 2FIEA 4H45A 2KQZA 3FBPA 2L5VA 3RYDA 1KA1A 4G61A 1FBEA 1G0HA 2HZKA 3MYUA 4NG7A 4NQ8A 5T3JA 3A29A 5IZ3B 1FJ9A 4P8BA 4XFEA 1LEVA 1RDZA 4GWSA 2VPOA 2JJKA 4YICA 1NUZA 2HHMA 1FPBA 4UABA 4PDHA 4GWWA 4N4UA 4I3EA 4PF6A 5CM6A 1EYKA 1LBVA 5A5LA 2MKZA 1FBDA 4JVIA 3RPLA 4GX3A 1K9ZA 4O94A 2PCRA 1NV1A 4X04A 5F24A 3KC0A 2OX3A 1YXIA 2FVZA 2QVRA 4GWZA 2OWZA 2CZIA 4GX6A 3IFAA 3KC1A 3CHGA 1RDYA 2DE2A 2WBBA 4NAPA 4P56A 4O7MA 4N81A 4X9TA 1XI6A 2FBPA 4HXVA 2ZZXA 4NN3A 4PETA 1FPJA 5DW8A 5FBPA 1FPDA 4GX4A 1LBYA 5IZ1A 4PAFA 4MMPA 2XWKA 2V4CA 3HFUA 1FTAA 1IMEA 3ISPA 1KA0A 1EYJA 4MEVA 4KXPA 4PAKA 1BK4A 1NI9A 4QXDA 3W9WA 5EYHA 2WYPA 2HZLA 2DE4A 4OVSA 4MJOA 1LBWA 1YZ0A 2Y5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYI A;  4GWW A;  1DK4 A;  1CNQ A;  2F3B A;  1AWB A;  4I3E A;  1QGX A;  1FBH A;  1YYZ A;  1EYK A;  1LBV A;  5A5L A;  1FBD A;  3IFC A;  5ET5 A;  5EYG A;  3RPL A;  4GX3 A;  2DDK A;  1K9Z A;  2CZH A;  1NV6 A;  2CZK A;  2PCR A;  4HE2 A;  1NV1 A;  5F24 A;  2QVU A;  3KC0 A;  2R8T A;  2OX3 A;  1YXI A;  2FVZ A;  1IMA A;  1FPK A;  4GBW A;  4I3Y A;  5ET6 A;  1NV4 A;  2QVR A;  1NV7 A;  4GWZ A;  2Q74 A;  1LBX A;  2OWZ A;  2CZI A;  4GX6 A;  3RPL B;  2QFL A;  3KBZ A;  1SPI A;  1IMD A;  3BIG A;  1JP4 A;  2Y5L A;  3IFA A;  1IMB A;  3KC1 A;  1DBZ A;  3LV0 A;  4HE1 A;  2FIX A;  1NV0 A;  1FPL A;  1RDY A;  5I3S A;  5EQA A;  1VDW A;  2WBB A;  4GWY A;  3T0J A;  2P3V A;  1KZ8 A;  4IR8 A;  4AS5 A;  2BJI A;  1NV3 A;  3B8B A;  4AS4 A;  5EQ8 A;  1FPF A;  4PTK A;  4N81 A;  4GWU A;  1XI6 A;  2FBP A;  2FHY A;  5J16 A;  2F3D A;  4FBP A;  3LUZ A;  1INP A;  1G0I A;  1FRP A;  1LBZ A;  4HXV A;  1FBF A;  4HE0 A;  1RDX A;  5EQ7 A;  5LDZ A;  5ESY A;  1FPJ A;  4I40 A;  5DW8 A;  5FBP A;  4GBV A;  1FPD A;  1FPE A;  1K9Y A;  1NUY A;  4GX4 A;  1LBY A;  1FPI A;  1NV2 A;  3D1R A;  3QMF A;  5IZ1 A;  5EQ9 A;  1DCU A;  2FIE A;  4H45 A;  1IMC A;  5ET7 A;  3FBP A;  5IZ3 A;  4GWX A;  3RYD A;  1NV5 A;  1FSA A;  2GQ1 A;  2QVV A;  1KA1 A;  4G61 A;  1FTA A;  1FBE A;  1G0H A;  1NUX A;  3ROJ A;  1IME A;  5ET8 A;  2WBD A;  5T3J A;  3A29 A;  3BIH A;  4O7I A;  1KA0 A;  5IZ3 B;  1EYJ A;  2WEF A;  1FJ9 A;  4KXP A;  1BK4 A;  4H46 A;  1IMF A;  1FPG A;  2P3N A;  1LEV A;  1NI9 A;  4QXD A;  1FJ6 A;  1RDZ A;  4GWS A;  5EYH A;  1D9Q A;  2JJK A;  1FBC A;  1FBG A;  4MJO A;  1LBW A;  1YZ0 A;  2Y5K A;  2VT5 A;  1NUZ A;  1NUW A;  1Q9D A;  2Q8M A;  2HHM A;  1FPB A;  1FBP A; 
#chains in the Genus database with same CATH topology
 2PT2 A;  4H0W A;  3ILT B;  3OMB A;  3ONM A;  3RTF B;  3IFC A;  3T9U A;  3TAJ A;  2CZK A;  4PBH A;  4F19 A;  1JW4 A;  4EDP A;  1QKA A;  3TCG A;  3E79 A;  2DVZ A;  5AA1 A;  3K02 A;  4KD5 A;  3QIM A;  3P7I A;  3OXN A;  2PT1 A;  3U8Q A;  1KZ8 A;  5EQ8 A;  1R9L A;  4F1U A;  4P3L A;  1DTZ A;  4YB7 A;  3SEU A;  4U4S A;  1G0I A;  4O8M A;  1RKM A;  5FTI A;  4IO4 A;  5I56 B;  5ESY A;  2XX7 A;  4I40 A;  4X8R A;  3LBS A;  1NV2 A;  4HCW A;  4IY6 A;  4YMB A;  3QSL A;  2QVV A;  4ZZA A;  3V83 A;  4MHF A;  4RPN A;  4EQB A;  3H06 B;  4JVD A;  1UTB B;  2OWT A;  4NF8 A;  2XWO A;  5EHM A;  4ND9 A;  2HEU A;  2F34 A;  4U22 A;  1Y1Z A;  3SKP A;  3S2V A;  4H46 A;  1NMU A;  4BLA A;  2V93 A;  4N6K A;  1SW1 A;  2PBW A;  3IJO B;  2R9J A;  1UQW A;  4IO2 A;  3K01 A;  2RF1 A;  1H45 A;  2HPG A;  3MBP A;  1B3F A;  3KZG A;  1LAG E;  3B6Q A;  4QFP A;  3CSG A;  4TOZ A;  4OVP A;  3DLN A;  2Z22 A;  4KYD A;  2RC9 A;  3ZSF A;  2D21 A;  3HHF A;  1UIV A;  1P1Q A;  3KGC A;  4OVT A;  2DWJ A;  2I58 A;  1MM7 A;  4TQU Q;  3TUS A;  2QVU A;  2XXV A;  1FQC A;  1P1O A;  1PDA A;  2I0C A;  1IIW A;  2I3W A;  1VFE A;  5IGA A;  2OPE A;  4PCD A;  1BIY A;  4OQO A;  2DWI A;  1B3E A;  1JP4 A;  3M3K A;  1IMB A;  5JK4 A;  3TDJ A;  1VFD A;  2WKY A;  3H03 A;  1Y4C A;  5AA2 D;  5KCJ B;  1BTJ A;  4EQ7 A;  2QPQ A;  4P11 A;  2CEX A;  1UTH A;  4UAC A;  3LUZ A;  2I6E A;  2O6A A;  3PV0 E;  3TFL A;  2OBG A;  1LAX A;  3PTY A;  4OER A;  4WKM A;  2Q89 A;  3FAT A;  4P1L A;  5I58 A;  1QW0 A;  4QSC A;  5IAI A;  4PGN A;  1IMC A;  2OLB A;  4THI A;  2GQ1 A;  4I1D A;  3TTN A;  3FVN A;  2F36 A;  4IO6 A;  2H98 A;  2NUV A;  2DSF A;  4OWD A;  4O7I A;  2W7Y A;  1B2H A;  1II5 A;  1MXV A;  4DI3 D;  5H8F B;  3RN8 A;  4PBQ A;  3G7W A;  3IAZ A;  1LCT A;  1B1X A;  2H25 A;  3MJN A;  4FE8 A;  1N76 A;  4EXK A;  4LP2 B;  3SZP A;  2Q8M A;  1FBP A;  4KHZ E;  4ZEC A;  1DK4 A;  1B3G A;  1LST A;  5ET5 A;  1AIV A;  2B4M A;  4DCX A;  2CZH A;  4HCY A;  1I6A A;  1I6B A;  1P1U A;  5ET6 A;  1USY E;  3IB1 A;  4M4G A;  4YZZ A;  1QJM A;  1NFT A;  4ZEB A;  4F31 B;  1A7L A;  3H6V A;  4N8Y A;  3U65 A;  3C35 A;  4R2B A;  4NWC A;  3K6X A;  2XXP A;  2BJI A;  2R6G E;  1B05 A;  2V3U A;  1B6H A;  4Z7E A;  1URS A;  1CB6 A;  1RYX A;  2R71 A;  1FQF A;  1B9J A;  1WDN A;  4F2Q A;  2XA5 A;  3G3K A;  3NOH A;  3BFT A;  1LB8 A;  1B3H A;  1SI1 A;  3T9V A;  5EQ9 A;  2FNC A;  3CI8 A;  2FIE A;  4H45 A;  2KLF A;  2KQZ A;  3RYD A;  4BDN A;  2HZK A;  2BJJ X;  4RYA A;  3MYU A;  3C9H A;  2DS9 A;  5I59 A;  2B3B A;  4MLV A;  5CMC A;  1LAF E;  1NNF A;  3VVE A;  4P8B A;  4XFE A;  4TLM B;  1LEV A;  4P0I A;  3B6W A;  4NF8 B;  3EHT A;  2VPO A;  3FZV A;  2JJK A;  5HPQ A;  3HST A;  1O63 A;  4YIC A;  5TP9 A;  1N0T A;  1NUZ A;  1MY3 A;  2OPD A;  3RT6 B;  4PDH A;  4N4U A;  2XHD A;  4I3E A;  3S4U A;  1GVC A;  5CM6 A;  5A5L A;  1FBD A;  3FVG A;  3ZKK A;  4JVI A;  4NF4 A;  3M3L A;  3RPL A;  3PU5 A;  1K9Z A;  5F24 A;  3KC0 A;  2F7A A;  3K4U A;  5DVF A;  3IB2 A;  3MP6 A;  1TFA A;  2O68 A;  3KN3 A;  1A99 A;  2OWZ A;  1SI0 A;  2O51 A;  5I2K A;  4QRZ A;  1FQB A;  3G3H A;  5BWJ A;  3KC1 A;  1NH7 A;  4DIG A;  1B4H A;  2WBB A;  1SD3 A;  2UVJ A;  1HSL A;  4F39 A;  2F97 A;  5H8Q A;  4PE5 B;  1PB8 A;  2FBP A;  1MXZ A;  1QUJ A;  4HXV A;  4OET A;  1UTH B;  2RIN A;  2V25 A;  1SDX A;  5FBP A;  4ECF A;  1YAE A;  2DWH A;  5KZT A;  3PMV A;  4OXV A;  4WXJ A;  3SDF A;  4X1D A;  4GXA A;  5I58 B;  2XXY A;  3GBB A;  1KA0 A;  4PP0 A;  2V84 A;  4PAK A;  1D9Y A;  1BK4 A;  3MAM A;  1NI9 A;  4BDQ A;  2NOO A;  4EQ9 A;  3PPR A;  1SVX B;  3LC8 A;  1OMP A;  2HFB A;  2QS3 A;  1ZTY A;  1SYI A;  4OVS A;  3UK4 A;  1XHY A;  4JVC A;  1AWB A;  2ZYK A;  2DOJ A;  1QGX A;  1FBH A;  2NWJ A;  3T93 B;  4PFR A;  3LSL A;  3KOS A;  3SEW A;  3T1B A;  3UA8 A;  4BDL A;  1IMA A;  4PFW A;  1NV4 A;  3FVO A;  4GWO A;  5AA2 B;  3PPO A;  4NTL A;  1ZKB A;  4OEN A;  1AH5 A;  3PUX E;  2HAV A;  2UYE A;  4OEU A;  5I57 A;  5AE4 A;  1EZ9 A;  3HHG A;  2XXR A;  4PFT A;  3KBR A;  3MZ9 A;  2ZYO A;  3MVY A;  1Z7N E;  1IXG A;  3T96 B;  2AYS A;  1MY4 A;  2RKM A;  3H6T A;  2Z8F A;  3MST A;  5DT6 A;  5KCJ A;  2Z8E A;  3ECR A;  2A5T A;  4P9K A;  3EQ1 A;  3Q26 A;  1AOV A;  2H99 A;  4LZ7 A;  1JET A;  4PF8 A;  4PDD A;  4PFU A;  4EF1 A;  1NH8 A;  3IOW A;  3EN3 A;  1PB7 A;  3OO9 A;  3UOR A;  4XF5 A;  3KJT A;  1DCU A;  3IOV A;  5ISU A;  3FD3 A;  4PFI A;  2O1L A;  1VR5 A;  1MQG A;  3SEV A;  5ET8 A;  4MX6 A;  3V8X B;  3H6W A;  2UVH A;  5M2V A;  3K6W A;  2NVU B;  3CFL A;  4Q0C A;  1SYH A;  4LA9 A;  4H8I A;  3S9N C;  2PFZ A;  3OEM A;  3JV9 A;  4KR5 A;  4LON B;  3H7M A;  5I59 B;  1JVY A;  3O2A A;  1LFG A;  3VVD A;  1MG1 A;  2F6G A;  3FJ7 A;  2NXO A;  1Y3P A;  4R75 A;  3PUY E;  3OOA A;  2F3B A;  4F3P A;  3O6G A;  2P1S A;  4R73 A;  5TP9 B;  2Y7P A;  3TTK A;  1CE2 A;  1POY 1;  1FPK A;  2RCA A;  4GBW A;  2X7Q A;  2YLN A;  2XXX A;  4PC9 A;  1TT1 A;  1B4Z A;  2WYK A;  4NF4 B;  3RPL B;  3O97 A;  1PC3 A;  5BUU A;  1Y20 A;  3BIG A;  4ZED A;  4H8J A;  3TPA A;  2YPN A;  3MPL A;  2FIX A;  2RCB A;  1YTV A;  1XT8 A;  5I2K B;  1P1W A;  4Q8R A;  1DPE A;  4ZEI A;  4QFL A;  1Q1K A;  5I2N A;  1Y1M A;  4GXS B;  3O6I A;  3OO7 A;  4ESX A;  1INP A;  1LBZ A;  2F6P A;  1B5I A;  1XS5 A;  3E9X A;  5H8Q B;  3R6U A;  5LDZ A;  4ZEF A;  3A3U A;  4ZE8 A;  1MS7 A;  1QUL A;  3I6V A;  1GR2 A;  1B46 A;  4ZDM A;  2GRV A;  3D4G A;  3MP1 A;  1S9T A;  1DSN A;  1WOD A;  4JWO A;  2REG A;  3CFZ A;  3BIH A;  4LN5 A;  4RXL A;  3MVX A;  2THI A;  2E0S A;  4MH5 A;  2WEF A;  2Q88 A;  4N07 A;  1EZP A;  4Q5T A;  1WVJ A;  3C36 A;  1IMF A;  2P3N A;  4WEP A;  3KN8 A;  4XKP A;  3LSX A;  2QS2 A;  5DVJ A;  2ZYN A;  1FBG A;  4DI4 B;  2VT5 A;  3E78 A;  3TZA A;  1TFD A;  1SBP A;  3RLF E;  4DDD A;  1LB9 A;  4FJP A;  4XXU A;  2AL5 A;  3TEP A;  2R8T A;  4GD5 A;  3CIJ A;  4L17 A;  4N6D A;  4RA1 A;  1PB9 A;  3CVG A;  2VPN A;  3SES A;  4PQJ A;  2VD2 A;  3KBZ A;  2RC7 A;  3K0V A;  1B51 A;  2HXR A;  5CBS A;  5A5X A;  4R2F A;  3LV0 A;  3PD9 A;  5I5P A;  2XXK A;  4GLI A;  3N26 A;  4F3B A;  4F1V A;  1MDQ A;  2P3V A;  1H43 A;  3QXM A;  4MNP A;  1NV3 A;  4AS4 A;  4KPT A;  4UA8 A;  5I57 B;  3MWB A;  1A54 A;  4U1Z A;  2B4L A;  2YJP A;  3PPN A;  2XWI A;  1Y3Q A;  1FRP A;  1B1H A;  1SW4 A;  3DP6 A;  1B0H A;  3SEX A;  4PFB A;  1RDX A;  2Y7K A;  1IQ7 A;  1A8F A;  3RPW A;  5CMK A;  2A5T B;  2L5V A;  2Q2A A;  5IKB A;  3EF7 A;  1KA1 A;  1JNF A;  5CMB A;  4BDR A;  1G0H A;  4FED A;  4RY1 A;  4DXU A;  5T3J A;  2XXW A;  1US5 A;  4PFY A;  2OK2 A;  3LUY A;  1FTO A;  5DEX A;  4R6Y A;  2HQ0 A;  1AL3 A;  2ALU A;  4IO5 A;  1HSE A;  1HSJ A;  3L6H A;  2PMS A;  4R9G A;  1FW0 A;  1MXW A;  4NED A;  3UGW A;  3JZJ A;  1B7H A;  1B7U A;  4FAJ A;  4QHQ A;  1IUD A;  1IIT A;  1N84 A;  1Y9U A;  4HS7 A;  4F1Y A;  2Z8D A;  4FEB A;  3U94 A;  1M5E A;  4IO7 A;  2ZNU A;  1USY H;  3PPQ A;  2PYY A;  1YXI A;  2ZNT A;  2H5Y A;  2QVR A;  4GWZ A;  4RK9 A;  4DXC A;  1SW2 A;  4GX6 A;  3S9L C;  4QSD A;  3O66 A;  3K1N A;  1B7Z A;  5AA2 A;  5CBR A;  3TTM A;  4NAP A;  3E4R A;  4N81 A;  1D3K A;  4X9T A;  2ZMB A;  1IXI A;  2P2A A;  4X48 A;  1JEV A;  3S9E A;  3PMX A;  1QVS A;  3K6U A;  5F1Q A;  5AA4 A;  4NN3 A;  5I2N B;  3VLW A;  1FPJ A;  4QFO A;  2IEE A;  4ZZE A;  1FPD A;  1LBY A;  1BP5 A;  3QYT A;  4PAF A;  4MMP A;  4P0G A;  2ABH A;  2V4C A;  4E0W A;  4OTE A;  4YKJ A;  3C31 A;  3HFU A;  3ISP A;  1UIU A;  5L9S A;  1OQG A;  2O84 X;  1O64 A;  4MEV A;  2UVI A;  4FOR A;  3AXF A;  2I4C A;  5TPA A;  4G68 C;  2F78 A;  2WYP A;  3IO6 A;  4H5G A;  4GFR A;  4QFK A;  4R6K A;  1LBW A;  1YZ0 A;  1ZIU A;  1M5C A;  1GGG A;  1B5J A;  2V3T A;  2M8C A;  5L8D A;  2QL3 A;  3PUW E;  5EYG A;  1MH4 A;  2ZZV A;  4OVR A;  4POX A;  1Y4T A;  2VP1 A;  3G3F A;  4I3Y A;  1SQY A;  1FTK A;  3EKI A;  3W15 C;  2QFL A;  5J1D A;  3HCQ A;  3VE1 B;  4Q30 B;  3OO8 A;  4DLD A;  2XXU A;  3JYR A;  4OYV A;  3TEL A;  1VDW A;  3OEL A;  5IM2 A;  4M1V A;  2XXH A;  5CC2 A;  3B50 A;  4RNS A;  4AS5 A;  4EF2 A;  5IZZ A;  5A5X B;  1XVX A;  4MBP A;  3KN7 A;  3W9V A;  4FBP A;  2D5W A;  1IXH A;  4PAI A;  1YCJ A;  1H76 A;  3IB0 A;  1URG A;  3TOD A;  2QSX A;  4F3G A;  2V3Q A;  1QUI A;  1DMB A;  2Y7R A;  1MQI A;  4JSD A;  3A3C A;  4LQ5 A;  3MC2 A;  3ROJ A;  2WBD A;  2B65 A;  1MDP 1;  3KG2 A;  1NL5 A;  2G93 A;  1D9V A;  3QAX A;  4RK2 A;  3CG1 A;  1R9Q A;  4IGT A;  2ANJ A;  4XIG Q;  3KSX A;  3IJX B;  2OJT A;  3T22 A;  5CI5 A;  5DEX B;  1B3L A;  3TQL A;  1FBC A;  1Q9D A;  1NUW A;  4U21 A;  5H8S A;  1P99 A;  1OIB A;  4F29 A;  1CNQ A;  1ZLQ A;  4NX1 A;  3KEI A;  4POW A;  3TKD A;  3IL1 B;  3VLV A;  3FV2 A;  4DCY A;  5H8N A;  4R72 A;  3G3I A;  4P47 A;  5DTB A;  3EPE A;  1IMD A;  4KI0 E;  1ELJ A;  4JB7 A;  2WX9 A;  1N3X A;  3U92 A;  3E3K A;  2XWV A;  2GHB A;  4OHN A;  1NV0 A;  1FPL A;  2OWS A;  4OES A;  4NHB A;  1NNT A;  2CEY A;  2QS1 A;  3N6T A;  3B8B A;  1ZMG A;  4DZ1 A;  3MVW A;  4ELQ A;  2FHY A;  4R74 A;  5J16 A;  4ZE9 A;  4ZEK A;  4FEC A;  3L6G A;  1L5T A;  1VSO A;  2DQV A;  1OVB A;  1EU8 A;  4AQ4 A;  5JTY A;  4HE0 A;  5ICT A;  4XKN A;  4QBA A;  3O28 A;  4IY5 A;  1FPE A;  3QMF A;  4F18 A;  4FIM A;  4KCD A;  5I84 A;  1I6Q A;  3WAE A;  1NV5 A;  1POT A;  4RPO A;  4P1E A;  3VFJ A;  5AA4 B;  4XEQ A;  2Y7I A;  2H9B A;  3FJG A;  4NF5 A;  4HW8 A;  1MQH A;  2HCA A;  1EH3 A;  3CRB A;  1XOC A;  1LFH A;  4OA4 A;  1D9Q A;  5TPA B;  1JW5 A;  1JW1 A;  1Q35 A;  1FTJ A;  3C4M A;  2O1M A;  4XKR A;  4U23 A;  4RJZ A;  2DDK A;  1NV6 A;  3D4C A;  3K1M A;  2QRY A;  3RY3 A;  1NV7 A;  5F7V A;  1LBX A;  1MXX A;  4GVO A;  4N6P A;  4MNI A;  3B6T A;  4HE1 A;  1F9B A;  4F22 A;  1IXC A;  1ZU0 A;  5I3S A;  1JQF A;  1JVX A;  4GWY A;  1QUK A;  3IR1 A;  2DVC A;  5LTC A;  2DE3 A;  4MNC A;  3ZS6 A;  2ZNS A;  2KR0 A;  4GQO A;  4NF0 A;  1IZ1 A;  4IB2 A;  3M8U A;  4PE3 A;  3VVF A;  1NKX A;  3FV1 A;  1B32 A;  4G8M A;  5FTH A;  4MF3 A;  3D1R A;  1S7Y A;  5HM4 B;  4R6H A;  1QKB A;  1I69 A;  3PMW A;  3H6U A;  3IO4 A;  2I48 A;  1FBE A;  2Y84 A;  3SER A;  2F8D A;  4NG7 A;  1JEU A;  3A29 A;  4OMB A;  3ILU B;  4O3B A;  4YKK A;  2QMX A;  1A40 A;  3VV5 A;  4OFL A;  1GV8 A;  1M5F A;  1RDZ A;  1OVT A;  4GWS A;  1MY1 A;  4MLQ A;  1N7W A;  3C33 A;  1LCF A;  1MPD A;  2F35 A;  2ZXT A;  1MPC A;  2VHA A;  4GOT A;  1B0L A;  1LLS A;  2HHM A;  2F7B A;  3OSQ A;  4U4X A;  4GWW A;  2Z23 A;  4PF6 A;  4X1B A;  1EYK A;  1LBV A;  5B7D A;  4ISU A;  4GX3 A;  1B5H A;  4O94 A;  2PCR A;  4E0X A;  4X04 A;  3OD7 A;  3FGS A;  2P0S A;  1MM6 A;  3M3F A;  2CZI A;  1KWH A;  3A09 A;  3QUF A;  5KDT A;  3IFA A;  4EUO A;  2ZYM A;  3CHG A;  2XXI A;  1TXF A;  1OQH A;  1SW5 A;  1FCK A;  5H8N B;  2DE2 A;  2XD2 A;  4NF6 A;  1PEB A;  1LAH E;  3MPK A;  4P56 A;  4O7M A;  1NNK A;  3OSR A;  1XI6 A;  1OLA A;  1A8E A;  4KYS A;  3LSW A;  5ITO A;  4ELO A;  3ODB A;  4OFJ A;  2UXA A;  2ZZX A;  3FXQ A;  4PET A;  3CSB A;  5DW8 A;  4H67 A;  2DXR A;  3BBR A;  2XWK A;  3G3G A;  5JTY B;  4FAT A;  4EXL A;  1LGB C;  4YKI A;  3RTW B;  1IME A;  2O69 A;  1MXY A;  3KOT A;  3MVZ A;  5EYF A;  1VE4 A;  5H8H A;  5TU0 A;  2X7P A;  1XC1 A;  4GF8 A;  4QXD A;  1OLC A;  3W9W A;  5EYH A;  1MPB A;  4NF5 B;  2HAU A;  4JDF A;  3TCF A;  5L9M A;  4HTG A;  2B3F A;  4JXI A;  4G4P A;  3FIR A;  4G68 A;  2Q2C A;  1EYI A;  1FQA A;  3TCH A;  2I3V A;  4N17 A;  3FXR A;  3GBA A;  3Q25 A;  3VDF A;  4LUB A;  2XXQ A;  4NWD A;  3R7X A;  1S50 A;  3H3G A;  4MCO A;  1MXU A;  3TMG A;  3CFX A;  4OVQ A;  4YAH X;  2F5X A;  1DBZ A;  2QJE A;  3DP4 A;  1FTL A;  3FXU A;  3CG3 A;  5I7I A;  3GZG A;  4OAN A;  3OO6 A;  4JWY A;  3ZKL A;  3MP8 A;  1MRP A;  4DE8 A;  1US4 A;  2ONR A;  4GL8 A;  5L9O A;  1FBF A;  2RC8 A;  4GBV A;  1FPI A;  3HO7 A;  5B70 A;  5ET7 A;  3THI A;  5IZ3 A;  3DEL B;  1FSA A;  3OEK A;  3N6U A;  2VGQ A;  1NUX A;  1MH3 A;  4YU0 A;  1DOT A;  3B7D A;  1EZO A;  4ONY A;  3FJM A;  4H6D A;  4XTC Q;  3MQ9 A;  4H65 A;  1A55 A;  4LVQ A;  3GYY A;  5ELV A;  5HBC A;  4G77 A;  3PUV E;  1FPG A;  3PPP A;  3KSJ A;  1FJ6 A;  4O3C A;  3IK6 B;  4YB5 A;  4IO3 A;  2ZZW A;  3PUZ E;  3DP8 A;  5FHN A;  4LZ5 A;  4O3A A;  4N8G A;  2G29 A;  2ONS A;  3PD8 A;  4MIJ A;  2I49 A;  1YYZ A;  2OZZ A;  2LAO A;  3KJ7 A;  2Y7W A;  1FQD A;  5ITP A;  4HE2 A;  3PGF A;  4LAT A;  1FTM A;  1ATG A;  2GH9 A;  3KFM A;  4TLL B;  4GL0 A;  3MZ1 A;  2Q74 A;  2IA4 A;  4JBZ A;  4C0R A;  4OFO A;  4PGP A;  3IOR A;  2Y5L A;  2X26 A;  3F11 A;  4WED A;  2UVG A;  5EQA A;  4GRK A;  2DP8 A;  4IR8 A;  5KDT B;  4G8H A;  3DM0 A;  1BLF A;  1MQJ A;  1FPF A;  4PTK A;  2PX1 A;  2DYX A;  2F3D A;  2HXW A;  1M5B A;  1N7X A;  3EHS A;  3IOU A;  4NF6 B;  3GLB A;  2PVU A;  3UN6 A;  3UP9 A;  4N15 A;  2AL4 A;  3UIF A;  3VXC A;  3K00 A;  1PBQ A;  5DYH A;  1P1N A;  1H44 A;  3E13 X;  1O7T A;  4GWX A;  4MAG A;  3FUZ A;  4AB5 A;  3SEY A;  2XX9 A;  4NGU A;  1XVY A;  3O6H A;  5ICQ A;  4GIZ A;  3VXB A;  3G3J A;  4YB6 A;  3WAF A;  4YKP A;  4OZ9 A;  3TTR A;  4KFQ A;  3U72 A;  4U2R A;  3R26 A;  5K2X A;  1DPP A;  2I0B A;  1MY0 A;  3U93 A;  5H8H B;  4U1O A;  3C32 A;  2GHA A;  4N91 A;  1TWY A;  5K2Y A;  4ELP A;  1Y3N A;  3MZB A;  3HN0 A;  5AA3 A;  4G68 B;  1RYO A;  3Q28 A;  2ONK E;  1ZJL A;  1N04 A;  1B40 A;  2DXY A;  3V89 B;  1LBB A;  1SPI A;  3EHU A;  3N94 A;  2VD3 A;  3HPI A;  4G8N A;  3FXB A;  4H1X A;  3I5O A;  2PFY A;  2GFE A;  4OEV A;  5CRY A;  3T0J A;  3Q29 A;  2QMW A;  1B58 A;  2VOZ A;  2E1S A;  4NE4 A;  4ESW A;  5I56 A;  4KYE A;  4KQP A;  4GWU A;  2Q9T A;  3LR1 A;  3Q27 A;  3HV1 A;  3C34 A;  4NMY A;  3IOT A;  2ESN A;  5EQ7 A;  1Z7M E;  3K1P A;  4F3S A;  5FHM A;  1K9Y A;  1NUY A;  3USD A;  1UTB A;  5LOM A;  3H4Z A;  3VLU A;  3FBP A;  2I4B A;  3T66 A;  4R9F A;  4K3F A;  5EHS A;  4G61 A;  3QUJ A;  4BDO A;  1NNP A;  4NQ8 A;  2UYF A;  1BKA A;  4N13 A;  2D3I A;  3QK6 A;  5FHO A;  3MW0 A;  5IZ3 B;  3GXA A;  3T9H B;  1FJ9 A;  4Z0I A;  1MY2 A;  4IGR A;  3BFU A;  4G2Z A;  2REJ A;  4ZS9 A;  2FYI A;  2XXT A;  4I8C A;  3T9X B;  4DXB A;  1DTG A;  1FPB A;  4UAB A;  1URD A;  2A5S A;  4OVJ A;  2F7C A;  1MQD A;  5JEI A;  2O7U A;  3MUQ A;  2MKZ A;  1J1N A;  1YPN A;  2O7I A;  1R6Z A;  2OCU A;  4BDM A;  1R1N A;  3RGY A;  1NV1 A;  3I3V A;  2OX3 A;  3SET A;  2FVZ A;  3U1O A;  3FAS A;  2AIX A;  2Q8J A;  1LFI A;  3RQT A;  4LZ8 A;  4YMA A;  1PBP A;  3S9M C;  4AB6 A;  1RDY A;  3TQW A;  1D4N A;  4QSE A;  3RUM A;  4C1T A;  3V5A A;  2XX8 A;  4KCC A;  1IEJ A;  3TTL A;  4QFN A;  4MFI A;  2FA7 A;  3K2D A;  4F2O A;  3CR9 A;  3N5L A;  1ZBM A;  3O9P A;  3LSF B;  4GX4 A;  1LBC A;  5IZ1 A;  1B52 A;  5DVI A;  1N3W A;  1M5D A;  5H8F A;  5CMM A;  1AMF A;  4ELR A;  2DWA A;  4I62 A;  1FTA A;  1GTK A;  2QS4 A;  1T0K A;  4C1U A;  4JWX A;  1ANF A;  4H5F A;  2XD3 A;  4I9D A;  3RNN A;  4JSO A;  3O29 A;  1EYJ A;  4QF9 A;  2CMO A;  4KXP A;  3IX1 A;  4LQ2 A;  1H3D A;  2CZL A;  2DE4 A;  2HZL A;  4MJO A;  3FVK A;  3OEN A;  3RT8 A;  2Y5K A;  1FQE A;  3BKI B;  3TYH A;  2H4I A;  3K6V A;  4XKQ A; 
#chains in the Genus database with same CATH homology
 1EYI A;  4JVC A;  1AWB A;  1QGX A;  4N17 A;  1FBH A;  3IFC A;  5EYG A;  2ZZV A;  2CZK A;  4OVR A;  4PBH A;  4PFR A;  4F19 A;  3T1B A;  1IMA A;  4I3Y A;  1NV4 A;  4MCO A;  3EKI A;  3E79 A;  2DVZ A;  2QFL A;  5J1D A;  4OVQ A;  2F5X A;  1DBZ A;  1VDW A;  5IM2 A;  4M1V A;  3B50 A;  1KZ8 A;  5I7I A;  4OAN A;  4AS5 A;  5IZZ A;  5EQ8 A;  4F1U A;  3W9V A;  4P3L A;  3MST A;  4FBP A;  1G0I A;  4PAI A;  4P9K A;  4O8M A;  1FBF A;  4PF8 A;  4PDD A;  5ESY A;  4I40 A;  4X8R A;  4GBV A;  1NV2 A;  1FPI A;  4XF5 A;  1DCU A;  4HCW A;  2V3Q A;  5ET7 A;  5IZ3 A;  1FSA A;  4PFI A;  2QVV A;  4MHF A;  1NUX A;  3ROJ A;  5ET8 A;  2WBD A;  4MX6 A;  4JVD A;  2XWO A;  3GYY A;  2PFZ A;  4H46 A;  1FPG A;  4N6K A;  1FJ6 A;  2ZZW A;  1FBC A;  1Q9D A;  1NUW A;  2HPG A;  4N8G A;  4OVP A;  1CNQ A;  2F3B A;  4MIJ A;  1YYZ A;  4NX1 A;  4OVT A;  4HE2 A;  2QVU A;  1FPK A;  4GBW A;  4PC9 A;  5IGA A;  4PCD A;  2Q74 A;  2WYK A;  4P47 A;  3RPL B;  1IMD A;  3BIG A;  4PGP A;  1JP4 A;  2Y5L A;  1IMB A;  2WX9 A;  5JK4 A;  2XWV A;  2FIX A;  1NV0 A;  1FPL A;  4NHB A;  5EQA A;  4IR8 A;  2CEY A;  2QPQ A;  3B8B A;  2CEX A;  1FPF A;  4PTK A;  2FHY A;  5J16 A;  2F3D A;  3LUZ A;  1INP A;  1LBZ A;  4N15 A;  3PTY A;  4HE0 A;  5LDZ A;  4QBA A;  4P1L A;  1FPE A;  3QMF A;  4F18 A;  4PGN A;  1IMC A;  4GWX A;  1NV5 A;  4MAG A;  2GQ1 A;  4P1E A;  4XEQ A;  4NGU A;  4LN5 A;  3BIH A;  4O7I A;  4DI3 D;  4PBQ A;  2WEF A;  1IMF A;  2P3N A;  4OA4 A;  1D9Q A;  3SZP A;  1FBG A;  4DI4 B;  2VT5 A;  3E78 A;  2Q8M A;  1FBP A;  4N91 A;  1DK4 A;  5ET5 A;  2B4M A;  2DDK A;  2CZH A;  1NV6 A;  4HCY A;  2R8T A;  5ET6 A;  4N6D A;  1NV7 A;  4YZZ A;  1LBX A;  2VPN A;  3KBZ A;  1SPI A;  4MNI A;  2HXR A;  3LV0 A;  5I5P A;  4HE1 A;  2XXK A;  4N8Y A;  3U65 A;  3FXB A;  2PFY A;  4F1V A;  5I3S A;  4GWY A;  3T0J A;  2P3V A;  4MNP A;  2BJI A;  1NV3 A;  4AS4 A;  5LTC A;  2DE3 A;  4MNC A;  4GWU A;  2Q9T A;  2KR0 A;  2B4L A;  4NF0 A;  2XWI A;  4PE3 A;  1FRP A;  4PFB A;  1RDX A;  5EQ7 A;  2XA5 A;  3NOH A;  1K9Y A;  1NUY A;  3D1R A;  5EQ9 A;  2FIE A;  4H45 A;  2KQZ A;  3FBP A;  2L5V A;  3RYD A;  1KA1 A;  4G61 A;  1FBE A;  1G0H A;  2HZK A;  3MYU A;  4NG7 A;  4NQ8 A;  5T3J A;  3A29 A;  5IZ3 B;  1FJ9 A;  4P8B A;  4XFE A;  1LEV A;  1RDZ A;  4GWS A;  2VPO A;  2JJK A;  4YIC A;  1NUZ A;  2HHM A;  1FPB A;  4UAB A;  4PDH A;  4GWW A;  4N4U A;  4I3E A;  4PF6 A;  5CM6 A;  1EYK A;  1LBV A;  5A5L A;  2MKZ A;  1FBD A;  4JVI A;  3RPL A;  4GX3 A;  1K9Z A;  4O94 A;  2PCR A;  1NV1 A;  4X04 A;  5F24 A;  3KC0 A;  2OX3 A;  1YXI A;  2FVZ A;  2QVR A;  4GWZ A;  2OWZ A;  2CZI A;  4GX6 A;  3IFA A;  3KC1 A;  3CHG A;  1RDY A;  2DE2 A;  2WBB A;  4NAP A;  4P56 A;  4O7M A;  4N81 A;  4X9T A;  1XI6 A;  2FBP A;  4HXV A;  2ZZX A;  4NN3 A;  4PET A;  1FPJ A;  5DW8 A;  5FBP A;  1FPD A;  4GX4 A;  1LBY A;  5IZ1 A;  4PAF A;  4MMP A;  2XWK A;  2V4C A;  3HFU A;  1FTA A;  1IME A;  3ISP A;  1KA0 A;  1EYJ A;  4MEV A;  4KXP A;  4PAK A;  1BK4 A;  1NI9 A;  4QXD A;  3W9W A;  5EYH A;  2WYP A;  2HZL A;  2DE4 A;  4OVS A;  4MJO A;  1LBW A;  1YZ0 A;  2Y5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...