3LUZA

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
238
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEDYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extragenic suppressor protein suhB
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Hydrolase
total genus 78
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3luzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3luzA02
3RPLB 1FJ6A 5EYHA 2F3BA 1NV1A 4H46A 4MJOA 2FVZA 1G0HA 3ROJA 1FBGA 2FBPA 1IMAA 4I3EA 2QVVA 2Q74A 2OWZA 1IMFA 4GWYA 1LBZA 3A29A 1FRPA 1FPGA 1FPIA 1VDWA 1NV7A 4GX3A 5ET5A 2PCRA 4GWZA 1DCUA 2WEFA 5IZ3A 1FPDA 4PTKA 1G0IA 1NUZA 1KA1A 2Y5KA 1FBHA 3BIHA 2F3DA 2CZKA 4QXDA 1LBYA 1LEVA 1NI9A 1NUXA 1FBFA 5ET8A 1INPA 4GBWA 1YZ0A 3B8BA 2VT5A 4G61A 2DDKA 1EYJA 2OX3A 4HE0A 1EYIA 1FPKA 5EQ9A 5EQ8A 1BK4A 1CNQA 3RPLA 3T0JA 1IMCA 1LBWA 1FPEA 2R8TA 4N81A 5ET6A 4I40A 1FPFA 1YXIA 1NUWA 1AWBA 1LBXA 1D9QA 3LV0A 1KA0A 1DBZA 1NV5A 5A5LA 4FBPA 4GWXA 2CZHA 3LUZA 1NV6A 4GWSA 4IR8A 1NV4A 3IFAA 1NV3A 5ESYA 5IZ1A 1FBDA 1RDZA 5T3JA 2HHMA 5J16A 3KBZA 4GX4A 5IZ3B 2CZIA 2FHYA 1K9YA 1NV2A 2JJKA 5EYGA 1FJ9A 2WBBA 4HE1A 3KC1A 1IMBA 1K9ZA 5FBPA 4HE2A 5ET7A 3RYDA 1SPIA 2P3NA 4AS4A 4AS5A 4I3YA 1EYKA 4GX6A 4KXPA 1DK4A 1KZ8A 1YYZA 1QGXA 5I3SA 5EQAA 2Q8MA 5F24A 3FBPA 1FSAA 2GQ1A 1NV0A 1IMDA 1FBPA 1LBVA 5EQ7A 1IMEA 2P3VA 3BIGA 2BJIA 1RDYA 3IFCA 5DW8A 2FIEA 2QVUA 1FTAA 1FPBA 1JP4A 3KC0A 5LDZA 1XI6A 4GBVA 1FPJA 3QMFA 1FBCA 2FIXA 4O7IA 2Y5LA 1FBEA 2QFLA 1RDXA 4GWUA 4H45A 2WBDA 1NUYA 2QVRA 4GWWA 1FPLA 1Q9DA 3D1RA 4HXVA
chains in the Genus database with same CATH superfamily
3O2AA 5CBRA 4NF6B 4DI3D 4Z0IA 4HCYA 1MY3A 4R9GA 3PPRA 4GWYA 3PPNA 1H43A 2XXXA 4PFUA 2IEEA 3EF7A 4GX3A 4NGUA 2VHAA 4NF4A 3RNNA 1FPDA 2F8DA 1G0IA 3PGFA 4QBAA 4KHZE 1OIBA 4PAIA 4PGPA 5I5PA 2XWVA 1DTGA 2CEYA 3GBBA 1YZ0A 4QFLA 2VT5A 1OQHA 1PBPA 4H6DA 1LBWA 3O6IA 4MMPA 1CE2A 2OCUA 1VE4A 4PE3A 3G3KA 4UACA 5KZTA 3FV1A 2CEXA 3Q27A 1UTBA 3SEXA 1AMFA 3MVZA 3TCHA 2OPEA 2JJKA 3CFXA 4KFQA 2XXYA 4UA8A 2XXRA 5IZZA 3OEMA 4HCWA 1MQHA 5CMCA 4AS5A 3VLUA 4OEVA 3S9NC 2ESNA 1XS5A 4M1VA 1FTKA 1FQFA 2P1SA 3VFJA 3U8QA 5I59A 2FNCA 5AA4B 2OJTA 2NWJA 4N8YA 5DW8A 1BKAA 2FIEA 3HO7A 2OZZA 2DS9A 3MZ1A 3H03A 3OO9A 3E9XA 3HV1A 1LFGA 2DQVA 4QSDA 5H8NA 5JTYB 4FORA 5FTHA 4I62A 2QVRA 5EYFA 1Q9DA 3E79A 4G8NA 1DPPA 4F1UA 4EF2A 4NF8B 2DSFA 4XF5A 4RPOA 5TU0A 4GIZA 4ELQA 1XT8A 4P56A 3NOHA 2CMOA 3OSQA 1JW1A 1M5BA 1VFDA 3VVFA 2GRVA 2D5WA 1QJMA 3K6UA 2PCRA 4E0WA 3W15C 4C0RA 3LSFB 3CFLA 4NE4A 2F3DA 4P9KA 5CI5A 1MXUA 1IXIA 5H8HA 2DWIA 4GBWA 3FASA 4LP2B 2H99A 3RTWB 3RPWA 4EDPA 1FPEA 4F3GA 3QYTA 4MEVA 3CG1A 4DXCA 4RK9A 3EHTA 3MPLA 4P0IA 4LONB 3RLFE 4ELOA 1LAGE 4F29A 2THIA 3MUQA 3UA8A 1FJ9A 4G68B 4OVSA 1POY1 4PDDA 1B1HA 3T93B 4AS4A 2DP8A 1DK4A 3D4CA 4JSOA 1WVJA 3H6UA 2GQ1A 2ZZWA 2NOOA 2I58A 2XXKA 3QIMA 5DVFA 3IAZA 2QPQA 1IMEA 3BIGA 1RDYA 2XXHA 2QS4A 3N94A 4N07A 4FATA 1Q35A 1O63A 5IAIA 3H6WA 4MFIA 3TFLA 4OQOA 2V84A 2HAVA 2RC9A 1RDXA 1T0KA 1XOCA 2XHDA 2QRYA 4DDDA 3PD9A 1TFDA 1BTJA 2HPGA 3ROJA 4ESXA 3S4UA 5BWJA 2RINA 1LBZA 1LB8A 4F3BA 5M2VA 5JEIA 4P1LA 3AXFA 4O7MA 3SESA 1JVXA 2O84X 5L9MA 1LBYA 3FJGA 3MWBA 4FAJA 2P0SA 4N8GA 4RJZA 4C1TA 3N6TA 2DE4A 5AA2A 1YAEA 2R8TA 4MCOA 5I59B 3KSJA 5H8QA 4YB5A 2ANJA 5A5LA 4JWYA 3BBRA 3S9MC 2ZYNA 3IX1A 3TODA 4OVTA 1PB8A 3TDJA 2PFZA 2CZIA 4OETA 1QVSA 5H8NB 4I8CA 2UVIA 2DE2A 2ONSA 4GXSB 4HE2A 4WEDA 4G8MA 4N6KA 2XD2A 4IGRA 3FVGA 3MBPA 1WODA 3FBPA 4KCCA 1F9BA 4KYDA 1LBVA 3V83A 2HXWA 3S9LC 4O94A 1N04A 1MXZA 3UIFA 2F7AA 3Q25A 4GOTA 2AL5A 3FVOA 5H8HB 4I9DA 3HFUA 2WBDA 4MHFA 4GWWA 1FPLA 3IJOB 4X8RA 3TMGA 1PB7A 3O97A 2DWJA 4ZE9A 3EKIA 2I4BA 2XXVA 4NTLA 5JK4A 3SZPA 4JVIA 1N84A 2F7CA 4ELPA 1DCUA 1AIVA 1KA1A 3CHGA 1NI9A 5J1DA 2Y7PA 4XEQA 2PX1A 1B46A 3TYHA 1LBCA 5TPAA 4PFRA 4OVJA 1P1WA 2PFYA 2NVUB 2RCBA 2XX9A 4DE8A 1HSLA 5ET6A 2HZKA 1XC1A 1NFTA 3N26A 1S7YA 1LBXA 2PT1A 4PF6A 1NV5A 3SEUA 3BFTA 5ESYA 4OVQA 3KBZA 3CG3A 3PPOA 3FXQA 4HE1A 2O1MA 4N4UA 3MP8A 3LSLA 3HN0A 4GWOA 1Y3PA 2ZXTA 1SPIA 4NF6A 1MQJA 4I3YA 4PAKA 4JDFA 1B3HA 5AA2D 1NNFA 4IO5A 1LAFE 1MRPA 5I58A 1XI6A 2ONKE 2FIXA 2Q8JA 3B6TA 4PFYA 1TFAA 2F6PA 3D1RA 5AA2B 1Y20A 3VDFA 3ZKLA 3KJTA 1RYOA 5H8QB 1ZTYA 3MVXA 2CZLA 3E3KA 3OEKA 1IMFA 4EF1A 1B0LA 2R9JA 1NMUA 3TAJA 3U92A 4YB7A 2PYYA 2XX8A 3T1BA 2CZKA 1CB6A 3KSXA 2H98A 2BJJX 3E4RA 3W9WA 4H0WA 4GRKA 2ONRA 1XVYA 1EYIA 1FPKA 3U94A 3RPLA 1A7LA 4KD5A 1UTHB 3O66A 5AA4A 4OANA 1D9QA 1DMBA 1MXYA 3A3CA 4G2ZA 4MNCA 1ANFA 4NAPA 3SEWA 3VXCA 1DPEA 2ALUA 4N17A 5BUUA 1RKMA 4GX4A 5I56B 3V5AA 4NEDA 5JTYA 2B4MA 4MH5A 1VSOA 1I6QA 5H8SA 4LATA 3FATA 2P3NA 2E0SA 3Q28A 5ICQA 1S50A 2R6GE 4ZEIA 1GGGA 4KXPA 1AH5A 4OEUA 1D4NA 1FBPA 4F18A 4EUOA 5ISUA 2ZYOA 3UK4A 4IB2A 1IXHA 3K6XA 3KBRA 3PPQA 1OVBA 5KCJA 5TPAB 3TTRA 1QULA 1NUYA 4I1DA 4KI0E 4ESWA 1A8FA 3EPEA 4RYAA 4TQUQ 1SW5A 4KR5A 3ILTB 1M5DA 1P1OA 1FJ6A 3T9XB 5CM6A 1LBBA 4I3EA 1B3FA 2V25A 2B3FA 4HTGA 1FTLA 1BLFA 4MF3A 2XWOA 4H5FA 3EQ1A 3C31A 5LTCA 1NUZA 4G68A 3C9HA 2DE3A 4BDLA 4N13A 4DZ1A 3FUZA 4U4XA 2REJA 3MPKA 3ODBA 4BDMA 4BDNA 3K6VA 4GVOA 2I0BA 3QXMA 3RT6B 3THIA 3T0JA 1B3EA 2DXRA 4PQJA 2RKMA 1MH4A 5EHMA 5I58B 1MPDA 1AL3A 2P2AA 1KA0A 4TLMB 5H8FB 4XXUA 1PBQA 4OFLA 3G3FA 3LSWA 1ZBMA 5FBPA 1B9JA 4QFOA 2VOZA 3OD7A 2NXOA 3KFMA 3I3VA 3PMWA 1KZ8A 2QSXA 1YYZA 2QJEA 3FJMA 3ISPA 2Y7IA 2HEUA 1USYE 1MPBA 3RTFB 3KOTA 4GFRA 4LN5A 4IY5A 4RPNA 4X1DA 1FPJA 3KOSA 1A99A 4O7IA 3OELA 4NHBA 4ZEDA 1TT1A 1NNPA 4YZZA 1NNKA 2NUVA 3PMVA 3IOUA 3RPLB 4F3SA 1Q1KA 2GHBA 4AQ4A 2I3WA 1JEVA 1Y4TA 2I49A 3H4ZA 4GQOA 1FPIA 1US4A 4OZ9A 1YTVA 4R6HA 1QW0A 4PTKA 3IR1A 4QFNA 2B3BA 3GBAA 3CR9A 3DM0A 1FBFA 5AE4A 3UGWA 1Y1MA 4N6DA 3UN6A 4MAGA 4YICA 4G61A 3C32A 4Q0CA 5IM2A 3GLBA 4GL0A 3SETA 1SVXB 3U65A 4I40A 4LZ8A 5TP9A 4JVCA 1YXIA 3CI8A 3HCQA 4BLAA 1LAHE 4FBPA 4P8BA 1SW4A 1B4ZA 4NWCA 4GWSA 3VLVA 1AOVA 1NV4A 2WYKA 2HHMA 5KCJB 3M3LA 5IZ3B 3U1OA 3PD8A 1OQGA 1B3GA 4XKPA 1N76A 2F5XA 1EZPA 3T66A 3C35A 5ET7A 4KQPA 4OXVA 2XXTA 4FEDA 1FQEA 2G93A 4RK2A 1H44A 4PGNA 4GXAA 3PU5A 1IMDA 5KDTB 3G3JA 2P3VA 2XXUA 2BJIA 1Y3QA 3GZGA 3A3UA 2GHAA 1JP4A 3T96B 4AB5A 4GBVA 4F39A 4H8JA 3TQLA 1II5A 4OESA 3OXNA 4PFBA 5DEXB 3I5OA 2HFBA 5HM4B 4XKNA 4O3CA 4R9FA 4NN3A 1B5JA 3TKDA 3ZKKA 4H46A 5CMBA 4TLLB 1UIVA 4LA9A 4PE5B 3S2VA 4H1XA 2AL4A 4LQ2A 3TTMA 3SDFA 2OK2A 2O68A 5DTBA 4MBPA 5A5XB 4F19A 3VVEA 3TQWA 3FXBA 2FYIA 1H3DA 1OLAA 2DWHA 1TXFA 4MX6A 1N3WA 4DI4B 4H8IA 1B51A 1JVYA 2Z8FA 2V93A 1LB9A 4P11A 4ZECA 1SW1A 5FHNA 4G8HA 1ATGA 1A54A 2LAOA 1B7HA 3IO6A 3U72A 3FVKA 5IGAA 2F35A 5I2KA 3MC2A 3D4GA 4F2QA 5AA1A 1FW0A 4UABA 2Z22A 3PUYE 1MY4A 2B4LA 3PUWE 4WKMA 3QAXA 2MKZA 1B2HA 2F97A 4KYSA 3K00A 3B7DA 1IXGA 3MAMA 4EQ7A 3DELB 2XXQA 4ZE8A 3WAEA 3SKPA 1WDNA 2YPNA 4U2RA 4N91A 3PUXE 1SBPA 2Q89A 2GH9A 4JXIA 2AYSA 4PFIA 5TP9B 1G0HA 1UTHA 4ND9A 2H5YA 3T9UA 1XVXA 1NV7A 4YU0A 2Z8DA 4X9TA 3TZAA 5I56A 3K01A 1L5TA 3ONMA 1MM6A 3O28A 4EQBA 1OLCA 2VP1A 2I48A 5I84A 4MIJA 4P1EA 4G77A 3HHGA 1PDAA 4N81A 4FE8A 5K2XA 1R9LA 3KEIA 1SDXA 4XIGQ 2PVUA 3LUZA 3PPPA 3IFAA 1N7WA 1M5FA 2Y7RA 2KQZA 4OYVA 3KC1A 3V8XB 1FTMA 3PMXA 1JW5A 4PAFA 2VD3A 1RYXA 2OPDA 1JNFA 5DYHA 2QS3A 2QMWA 3K02A 4MLQA 3G3IA 3MQ9A 5F1QA 2O69A 3IB0A 3KG2A 4JBZA 1J1NA 5I2NB 3O9PA 4GL8A 3TTLA 3ZS6A 3T9VA 4P47A 3IJXB 5ICTA 4XFEA 4ZEFA 5CMMA 5L8DA 3V89B 4H45A 3FV2A 3UORA 1JQFA 2I3VA 3CSBA 2FVZA 1B40A 5IKBA 5H8FA 1SQYA 2A5TB 5I2KB 5ET5A 4WXJA 5FTIA 4OFJA 2O51A 3IK6B 2FA7A 1FBHA 1HSEA 1LCFA 4GD5A 4F22A 4QSEA 3M8UA 3K6WA 5ET8A 3R26A 1FQAA 4OFOA 1QKAA 1SW2A 2OX3A 1FQCA 5EQ8A 1URDA 2ZNTA 3MSTA 2OLBA 5HBCA 1A55A 2UVJA 2HCAA 1NV6A 1ZIUA 4U1ZA 4G4PA 2RC8A 1RDZA 2ZYKA 4MNIA 5CBSA 3B6QA 5EHSA 1SI1A 1MH3A 4RXLA 2Q88A 4IO4A 3C34A 1B0HA 4X04A 3JV9A 3ZSFA 5EQAA 2Q9TA 1S9TA 1SI0A 2RF1A 1FSAA 1YPNA 2D3IA 1IEJA 3OENA 4THIA 1MXXA 4ONYA 4P0GA 3K1PA 2WKYA 3KJ7A 4JVDA 3KC0A 2HQ0A 3TEPA 3QMFA 4ZZEA 4OERA 1JETA 4NWDA 1Y1ZA 4G68C 2Q2CA 1USYH 1ZMGA 3A09A 1MQDA 5ELVA 2KLFA 5DT6A 3O6HA 4MJOA 1FBGA 2ZNSA 3TUSA 4BDRA 1IMAA 1N3XA 2D21A 1N0TA 3CFZA 1VFEA 3IOVA 4NQ8A 4U4SA 4C1UA 3HHFA 5I7IA 4JB7A 5IZ3A 4MNPA 4R2FA 1US5A 1NUXA 3HPIA 3FXRA 1IXCA 1B58A 4BDOA 2DYXA 4OENA 4BDQA 2UVGA 2X7QA 1IMCA 4RY1A 4F31B 5KDTA 3FZVA 1PB9A 3LV0A 3K1NA 4R73A 4KCDA 2CZHA 4PFWA 1FQDA 3GYYA 1NL5A 2E1SA 4H65A 5DEXA 2Y84A 2O1LA 1LCTA 3L6GA 2ZYMA 4KYEA 2F36A 1EYKA 4RA1A 1IITA 3L6HA 5CMKA 1KWHA 4X1BA 1MQGA 2ZMBA 3WAFA 5A5XA 3MYUA 1R9QA 2YLNA 1M5EA 4WEPA 2HXRA 3O6GA 4O3BA 1FBCA 3E78A 4N6PA 1SYIA 3N6UA 4POWA 3B6WA 2V4CA 3FD3A 4IO2A 3JYRA 3RY3A 2Q2AA 2ZZXA 5CC2A 2F3BA 4NG7A 1MY0A 5HPQA 2W7YA 1FRPA 3PUZE 4RNSA 4F2OA 3G7WA 1I6AA 2QS2A 3SERA 1D3KA 2H25A 1MPCA 1FTOA 5B70A 3LUYA 3OOAA 4QXDA 4X48A 1LFIA 4TOZA 1LGBC 4YKKA 2DDKA 1EYJA 1QUJA 2HAUA 1URGA 2H9BA 4FECA 4U23A 1QUKA 1Y4CA 4ZEBA 2R71A 3QSLA 4JSDA 1JEUA 4PP0A 5IZ1A 3R7XA 1IUDA 1Z7ME 3H3GA 3IOWA 3RUMA 1IMBA 4U22A 3TCFA 3KGCA 4PBQA 4PBHA 1ZU0A 2A5SA 3R6UA 3MZ9A 2Y7WA 1B4HA 5I3SA 2Q8MA 2RC7A 4DIGA 2ZNUA 4XTCQ 5EQ7A 4JWOA 3MP1A 5ITOA 3DLNA 5CRYA 1FTAA 1FPBA 3LSXA 1DTZA 1BIYA 4ZS9A 1FCKA 2QFLA 1UIUA 3H6VA 3VXBA 4GWUA 2F7BA 4LUBA 4YKIA 3CVGA 3SEYA 4H5GA 4L17A 3C36A 2O7IA 2KR0A 2Z23A 3VLWA 2FBPA 4P3LA 4F3PA 3N5LA 4E0XA 4O3AA 1OMPA 4OHNA 1A40A 3G3GA 5I57B 5FHMA 1EZ9A 1LLSA 4YAHX 3Q29A 4LQ5A 5AA3A 1FTJA 1H45A 2IA4A 1VR5A 1ZJLA 3MJNA 4DLDA 5B7DA 3OMBA 1P1NA 3B8BA 3IL1B 4R6KA 4OVRA 3KZGA 2XXPA 1FPFA 3BFUA 1AWBA 1EH3A 5I2NA 3U93A 4GWXA 3RT8A 2XD3A 4IO6A 5DVJA 5T3JA 4NF4B 2VPNA 2ABHA 2FHYA 1NV2A 2I0CA 5F7VA 3VVDA 4YKJA 3M3FA 2DVZA 2ZZVA 4OA4A 1B7ZA 3RYDA 2L5VA 3EN3A 4GF8A 1QKBA 2UYFA 3EHSA 1QGXA 1MQIA 3FIRA 3TTKA 2F6GA 1R6ZA 4ZZAA 2A5TA 3QUFA 4OTEA 1P1QA 2UXAA 3G3HA 2QMXA 4QF9A 1ELJA 3O29A 1XHYA 3IORA 1IIWA 1UTBB 2V3TA 1MXVA 4ELRA 1MDP1 3T9HB 1FQBA 4MLVA 3F11A 3ILUB 1GR2A 4HXVA 1NV1A 4LZ5A 4ZDMA 2V3UA 2HZLA 2O7UA 3OO7A 3A29A 1FPGA 1NH8A 3EHUA 3B50A 1NKXA 2V3QA 1VDWA 4ISUA 4DCXA 4GWZA 2WEFA 2H4IA 4AB6A 1B52A 1EU8A 2X26A 3CRBA 1PC3A 1IQ7A 2AIXA 1N7XA 1LEVA 3RQTA 1MDQA 3T22A 1INPA 3KN8A 4IGTA 2VD2A 1MY1A 1I6BA 3IO4A 3DP4A 1DBZA 3H06B 2DWAA 3SEVA 4IR8A 3ECRA 1B05A 4PETA 1NV3A 1QUIA 3M3KA 4POXA 3FJ7A 1R1NA 2WBBA 3OO6A 3W9VA 4PF8A 2WX9A 3FXUA 1M5CA 3Q26A 3FGSA 3USDA 2M8CA 3MVYA 5F24A 1SD3A 2DOJA 1ZKBA 1Z7NE 2VGQA 4YKPA 4Q30B 1POTA 4NX1A 4R72A 3S9EA 4NF5A 4YMBA 1H76A 3IFCA 4KPTA 2QVUA 1B1XA 5L9OA 2QS1A 2B65A 2Y5LA 4NMYA 4XKRA 1GVCA 1NH7A 3C4MA 4K3FA 4DXBA 3DP8A 1P1UA 4FJPA 3TTNA 2XX7A 1MM7A 2PT2A 2XXWA 3JZJA 3MVWA 3P7IA 3VV5A 2OBGA 2Y5KA 3BIHA 2RCAA 5K2YA 2G29A 1I69A 3QUJA 4U1OA 2Y7KA 1SYHA 4EXKA 3IB1A 4H67A 1LSTA 3DP6A 4HE0A 1BK4A 1CNQA 4PDHA 2DVCA 1Y3NA 3K1MA 1NUWA 2XWKA 5L9SA 2UYEA 1B5HA 4JWXA 4OVPA 4QRZA 4PCDA 4FIMA 4GLIA 4PFTA 3TCGA 1MY2A 4YMAA 3RGYA 4ZEKA 5J16A 4ECFA 1O64A 1OVTA 3KN7A 5EYGA 1GTKA 4LZ7A 2DXYA 3H7MA 4R75A 1B6HA 2I6EA 3MP6A 4QSCA 4M4GA 2VPOA 4QHQA 2WYPA 2XXIA 1UQWA 1NV0A 4HS7A 3MZBA 3PTYA 5LDZA 5ITPA 1MG1A 2REGA 3OSRA 1O7TA 3UP9A 1FBEA 1DSNA 4IO3A 1B5IA 2OWTA 1LFHA 2F78A 1ZLQA 4OMBA 4EQ9A 1GV8A 1B7UA 4N15A 2YJPA 2UVHA 4R74A 5EYHA 4IY6A 3C33A 1TWYA 1NNTA 1B3LA 1D9VA 4DXUA 3LBSA 4PC9A 2QVVA 4YB6A 2Q74A 2OWZA 3PV0E 1P99A 3TPAA 1EZOA 4R6YA 4U21A 1URSA 2O6AA 4EXLA 3K2DA 3K4UA 4QFKA 3HSTA 1PEBA 1IZ1A 5FHOA 2GFEA 2X7PA 3PUVE 2PMSA 2QL3A 4NF0A 3CIJA 4O8MA 1HSJA 1A8EA 2PBWA 5EQ9A 4R2BA 4LVQA 2F34A 1LAXA 4NF8A 4NF5B 5LOMA 3QK6A 3K0VA 1FBDA 2XA5A 4Z7EA 1MS7A 3KN3A 2I4CA 3CSGA 1K9YA 4F1VA 3E13X 3TELA 1K9ZA 3LR1A 3OO8A 4IO7A 1BP5A 4F1YA 1JW4A 3LC8A 3H6TA 4GX6A 3BKIB 3GXAA 4Q5TA 4OWDA 1B32A 4HW8A 5I57A 4DCYA 2OWSA 4QFPA 3MW0A 1D9YA 3FVNA 2XWIA 5DVIA 1YCJA 3IOTA 3VE1B 3I6VA 4Q8RA 2Z8EA 3IB2A 4FEBA 3RN8A 1MXWA 1Y9UA 4XKQA 1DOTA
chains in the Genus database with same CATH topology
2KR0A 4PFIA 1G0HA 4DI3D 2FBPA 4HCYA 4P3LA 1IMFA 4GWYA 4GX3A 1NV7A 4NGUA 4X9TA 1FPDA 1G0IA 3T1BA 4QBAA 4PAIA 4PGPA 5I5PA 2CZKA 2XWVA 2CEYA 4MIJA 3W9WA 1YZ0A 4P1EA 3B8BA 2VT5A 1EYIA 1FPKA 3RPLA 1LBWA 4OVRA 4N81A 4MMPA 1FPFA 4OANA 1AWBA 1D9QA 4MNCA 4PE3A 4NAPA 4GWXA 3LUZA 3IFAA 4N17A 5T3JA 2CEXA 2VPNA 4GX4A 2FHYA 1NV2A 2JJKA 2KQZA 2DVZA 2ZZVA 3KC1A 2B4MA 5IZZA 4PAFA 4OA4A 4HCWA 3RYDA 2L5VA 2P3NA 4AS5A 4KXPA 1QGXA 4M1VA 1FBPA 4F18A 4N8YA 5DW8A 2FIEA 4P47A 4XFEA 4H45A 1NUYA 2QVRA 1Q9DA 3E79A 4HXVA 1FJ6A 4F1UA 1NV1A 2FVZA 5CM6A 4XF5A 2HZLA 4I3EA 4P56A 3NOHA 3A29A 1FPGA 2XWOA 3B50A 2V3QA 1VDWA 5ET5A 2PCRA 4GWZA 2WEFA 5LTCA 1NUZA 2DE3A 1FBHA 2F3DA 1LEVA 4P9KA 5ET8A 1INPA 4GBWA 2OX3A 5EQ8A 3T0JA 1FPEA 3MSTA 4MEVA 1KA0A 1DBZA 1NV6A 4IR8A 4PETA 1NV3A 1RDZA 4MNIA 1FJ9A 2WBBA 4OVSA 3W9VA 4PF8A 4PDDA 5FBPA 2WX9A 4AS4A 4X04A 1DK4A 1KZ8A 1YYZA 5EQAA 2Q9TA 3ISPA 5F24A 1FSAA 2GQ1A 2ZZWA 2XXKA 4NX1A 2QPQA 1IMEA 3BIGA 1RDYA 4LN5A 3IFCA 2QVUA 4JVDA 3KC0A 1FPJA 3QMFA 4O7IA 4NHBA 2Y5LA 4YZZA 1RDXA 3RPLB 4MJOA 2HPGA 3ROJA 1FBGA 1IMAA 1LBZA 1FPIA 4NQ8A 5I7IA 5IZ3A 4P1LA 4PTKA 2Y5KA 3BIHA 4MNPA 4O7MA 1LBYA 1NUXA 1FBFA 4N8GA 4N6DA 4MAGA 4YICA 4G61A 5IM2A 4HE0A 2DE4A 1BK4A 1CNQA 1IMCA 2R8TA 4MCOA 4PDHA 3U65A 4I40A 4JVCA 1YXIA 1NUWA 3LV0A 2XWKA 5A5LA 4FBPA 4P8BA 4OVPA 2CZHA 4GWSA 4PCDA 4OVTA 1NV4A 2WYKA 3GYYA 2HHMA 5J16A 2PFZA 5IZ3B 2CZIA 5EYGA 2DE2A 2F5XA 4HE2A 5ET7A 4N6KA 2VPOA 1EYKA 2WYPA 3FBPA 1NV0A 4PGNA 1IMDA 1LBVA 3MYUA 2P3VA 2BJIA 4O94A 3PTYA 1JP4A 5LDZA 2HXRA 4GBVA 1FBCA 1FBEA 3E78A 4PFBA 3HFUA 2WBDA 2V4CA 4MHFA 4GWWA 1FPLA 4NN3A 4N15A 2ZZXA 4X8RA 5EYHA 2F3BA 4H46A 3EKIA 4NG7A 2QVVA 4PC9A 2Q74A 2OWZA 5JK4A 3SZPA 1FRPA 4JVIA 4F19A 1DCUA 3FXBA 1KA1A 3CHGA 4QXDA 1NI9A 5J1DA 4XEQA 4NF0A 4MX6A 4O8MA 4DI4B 4PFRA 2PFYA 2DDKA 1EYJA 5EQ9A 5ET6A 2HZKA 1LBXA 4PF6A 1NV5A 5IGAA 5ESYA 5IZ1A 1FBDA 4OVQA 2XA5A 3KBZA 1K9YA 4HE1A 4N4UA 4UABA 4F1VA 1IMBA 1K9ZA 4PBQA 2B4LA 4PBHA 1SPIA 4I3YA 2MKZA 4GX6A 5I3SA 4PAKA 2Q8MA 5EQ7A 1FTAA 1FPBA 2XWIA 1XI6A 2FIXA 2QFLA 4GWUA 4N91A 3D1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPL B;  1FJ6 A;  5EYH A;  2F3B A;  1NV1 A;  4H46 A;  4MJO A;  2FVZ A;  1G0H A;  3ROJ A;  1FBG A;  2FBP A;  1IMA A;  4I3E A;  2QVV A;  2Q74 A;  2OWZ A;  1IMF A;  4GWY A;  1LBZ A;  3A29 A;  1FRP A;  1FPG A;  1FPI A;  1VDW A;  1NV7 A;  4GX3 A;  5ET5 A;  2PCR A;  4GWZ A;  1DCU A;  2WEF A;  5IZ3 A;  1FPD A;  4PTK A;  1G0I A;  1NUZ A;  1KA1 A;  2Y5K A;  1FBH A;  3BIH A;  2F3D A;  2CZK A;  4QXD A;  1LBY A;  1LEV A;  1NI9 A;  1NUX A;  1FBF A;  5ET8 A;  1INP A;  4GBW A;  1YZ0 A;  3B8B A;  2VT5 A;  4G61 A;  2DDK A;  1EYJ A;  2OX3 A;  4HE0 A;  1EYI A;  1FPK A;  5EQ9 A;  5EQ8 A;  1BK4 A;  1CNQ A;  3RPL A;  3T0J A;  1IMC A;  1LBW A;  1FPE A;  2R8T A;  4N81 A;  5ET6 A;  4I40 A;  1FPF A;  1YXI A;  1NUW A;  1AWB A;  1LBX A;  1D9Q A;  3LV0 A;  1KA0 A;  1DBZ A;  1NV5 A;  5A5L A;  4FBP A;  4GWX A;  2CZH A;  3LUZ A;  1NV6 A;  4GWS A;  4IR8 A;  1NV4 A;  3IFA A;  1NV3 A;  5ESY A;  5IZ1 A;  1FBD A;  1RDZ A;  5T3J A;  2HHM A;  5J16 A;  3KBZ A;  4GX4 A;  5IZ3 B;  2CZI A;  2FHY A;  1K9Y A;  1NV2 A;  2JJK A;  5EYG A;  1FJ9 A;  2WBB A;  4HE1 A;  3KC1 A;  1IMB A;  1K9Z A;  5FBP A;  4HE2 A;  5ET7 A;  3RYD A;  1SPI A;  2P3N A;  4AS4 A;  4AS5 A;  4I3Y A;  1EYK A;  4GX6 A;  4KXP A;  1DK4 A;  1KZ8 A;  1YYZ A;  1QGX A;  5I3S A;  5EQA A;  2Q8M A;  5F24 A;  3FBP A;  1FSA A;  2GQ1 A;  1NV0 A;  1IMD A;  1FBP A;  1LBV A;  5EQ7 A;  1IME A;  2P3V A;  3BIG A;  2BJI A;  1RDY A;  3IFC A;  5DW8 A;  2FIE A;  2QVU A;  1FTA A;  1FPB A;  1JP4 A;  3KC0 A;  5LDZ A;  1XI6 A;  4GBV A;  1FPJ A;  3QMF A;  1FBC A;  2FIX A;  4O7I A;  2Y5L A;  1FBE A;  2QFL A;  1RDX A;  4GWU A;  4H45 A;  2WBD A;  1NUY A;  2QVR A;  4GWW A;  1FPL A;  1Q9D A;  3D1R A;  4HXV A; 
#chains in the Genus database with same CATH topology
 3O2A A;  5CBR A;  4NF6 B;  4DI3 D;  4Z0I A;  4HCY A;  1MY3 A;  4R9G A;  3PPR A;  4GWY A;  3PPN A;  1H43 A;  2XXX A;  4PFU A;  2IEE A;  3EF7 A;  4GX3 A;  4NGU A;  2VHA A;  4NF4 A;  3RNN A;  1FPD A;  2F8D A;  1G0I A;  3PGF A;  4QBA A;  4KHZ E;  1OIB A;  4PAI A;  4PGP A;  5I5P A;  2XWV A;  1DTG A;  2CEY A;  3GBB A;  1YZ0 A;  4QFL A;  2VT5 A;  1OQH A;  1PBP A;  4H6D A;  1LBW A;  3O6I A;  4MMP A;  1CE2 A;  2OCU A;  1VE4 A;  4PE3 A;  3G3K A;  4UAC A;  5KZT A;  3FV1 A;  2CEX A;  3Q27 A;  1UTB A;  3SEX A;  1AMF A;  3MVZ A;  3TCH A;  2OPE A;  2JJK A;  3CFX A;  4KFQ A;  2XXY A;  4UA8 A;  2XXR A;  5IZZ A;  3OEM A;  4HCW A;  1MQH A;  5CMC A;  4AS5 A;  3VLU A;  4OEV A;  3S9N C;  2ESN A;  1XS5 A;  4M1V A;  1FTK A;  1FQF A;  2P1S A;  3VFJ A;  3U8Q A;  5I59 A;  2FNC A;  5AA4 B;  2OJT A;  2NWJ A;  4N8Y A;  5DW8 A;  1BKA A;  2FIE A;  3HO7 A;  2OZZ A;  2DS9 A;  3MZ1 A;  3H03 A;  3OO9 A;  3E9X A;  3HV1 A;  1LFG A;  2DQV A;  4QSD A;  5H8N A;  5JTY B;  4FOR A;  5FTH A;  4I62 A;  2QVR A;  5EYF A;  1Q9D A;  3E79 A;  4G8N A;  1DPP A;  4F1U A;  4EF2 A;  4NF8 B;  2DSF A;  4XF5 A;  4RPO A;  5TU0 A;  4GIZ A;  4ELQ A;  1XT8 A;  4P56 A;  3NOH A;  2CMO A;  3OSQ A;  1JW1 A;  1M5B A;  1VFD A;  3VVF A;  2GRV A;  2D5W A;  1QJM A;  3K6U A;  2PCR A;  4E0W A;  3W15 C;  4C0R A;  3LSF B;  3CFL A;  4NE4 A;  2F3D A;  4P9K A;  5CI5 A;  1MXU A;  1IXI A;  5H8H A;  2DWI A;  4GBW A;  3FAS A;  4LP2 B;  2H99 A;  3RTW B;  3RPW A;  4EDP A;  1FPE A;  4F3G A;  3QYT A;  4MEV A;  3CG1 A;  4DXC A;  4RK9 A;  3EHT A;  3MPL A;  4P0I A;  4LON B;  3RLF E;  4ELO A;  1LAG E;  4F29 A;  2THI A;  3MUQ A;  3UA8 A;  1FJ9 A;  4G68 B;  4OVS A;  1POY 1;  4PDD A;  1B1H A;  3T93 B;  4AS4 A;  2DP8 A;  1DK4 A;  3D4C A;  4JSO A;  1WVJ A;  3H6U A;  2GQ1 A;  2ZZW A;  2NOO A;  2I58 A;  2XXK A;  3QIM A;  5DVF A;  3IAZ A;  2QPQ A;  1IME A;  3BIG A;  1RDY A;  2XXH A;  2QS4 A;  3N94 A;  4N07 A;  4FAT A;  1Q35 A;  1O63 A;  5IAI A;  3H6W A;  4MFI A;  3TFL A;  4OQO A;  2V84 A;  2HAV A;  2RC9 A;  1RDX A;  1T0K A;  1XOC A;  2XHD A;  2QRY A;  4DDD A;  3PD9 A;  1TFD A;  1BTJ A;  2HPG A;  3ROJ A;  4ESX A;  3S4U A;  5BWJ A;  2RIN A;  1LBZ A;  1LB8 A;  4F3B A;  5M2V A;  5JEI A;  4P1L A;  3AXF A;  4O7M A;  3SES A;  1JVX A;  2O84 X;  5L9M A;  1LBY A;  3FJG A;  3MWB A;  4FAJ A;  2P0S A;  4N8G A;  4RJZ A;  4C1T A;  3N6T A;  2DE4 A;  5AA2 A;  1YAE A;  2R8T A;  4MCO A;  5I59 B;  3KSJ A;  5H8Q A;  4YB5 A;  2ANJ A;  5A5L A;  4JWY A;  3BBR A;  3S9M C;  2ZYN A;  3IX1 A;  3TOD A;  4OVT A;  1PB8 A;  3TDJ A;  2PFZ A;  2CZI A;  4OET A;  1QVS A;  5H8N B;  4I8C A;  2UVI A;  2DE2 A;  2ONS A;  4GXS B;  4HE2 A;  4WED A;  4G8M A;  4N6K A;  2XD2 A;  4IGR A;  3FVG A;  3MBP A;  1WOD A;  3FBP A;  4KCC A;  1F9B A;  4KYD A;  1LBV A;  3V83 A;  2HXW A;  3S9L C;  4O94 A;  1N04 A;  1MXZ A;  3UIF A;  2F7A A;  3Q25 A;  4GOT A;  2AL5 A;  3FVO A;  5H8H B;  4I9D A;  3HFU A;  2WBD A;  4MHF A;  4GWW A;  1FPL A;  3IJO B;  4X8R A;  3TMG A;  1PB7 A;  3O97 A;  2DWJ A;  4ZE9 A;  3EKI A;  2I4B A;  2XXV A;  4NTL A;  5JK4 A;  3SZP A;  4JVI A;  1N84 A;  2F7C A;  4ELP A;  1DCU A;  1AIV A;  1KA1 A;  3CHG A;  1NI9 A;  5J1D A;  2Y7P A;  4XEQ A;  2PX1 A;  1B46 A;  3TYH A;  1LBC A;  5TPA A;  4PFR A;  4OVJ A;  1P1W A;  2PFY A;  2NVU B;  2RCB A;  2XX9 A;  4DE8 A;  1HSL A;  5ET6 A;  2HZK A;  1XC1 A;  1NFT A;  3N26 A;  1S7Y A;  1LBX A;  2PT1 A;  4PF6 A;  1NV5 A;  3SEU A;  3BFT A;  5ESY A;  4OVQ A;  3KBZ A;  3CG3 A;  3PPO A;  3FXQ A;  4HE1 A;  2O1M A;  4N4U A;  3MP8 A;  3LSL A;  3HN0 A;  4GWO A;  1Y3P A;  2ZXT A;  1SPI A;  4NF6 A;  1MQJ A;  4I3Y A;  4PAK A;  4JDF A;  1B3H A;  5AA2 D;  1NNF A;  4IO5 A;  1LAF E;  1MRP A;  5I58 A;  1XI6 A;  2ONK E;  2FIX A;  2Q8J A;  3B6T A;  4PFY A;  1TFA A;  2F6P A;  3D1R A;  5AA2 B;  1Y20 A;  3VDF A;  3ZKL A;  3KJT A;  1RYO A;  5H8Q B;  1ZTY A;  3MVX A;  2CZL A;  3E3K A;  3OEK A;  1IMF A;  4EF1 A;  1B0L A;  2R9J A;  1NMU A;  3TAJ A;  3U92 A;  4YB7 A;  2PYY A;  2XX8 A;  3T1B A;  2CZK A;  1CB6 A;  3KSX A;  2H98 A;  2BJJ X;  3E4R A;  3W9W A;  4H0W A;  4GRK A;  2ONR A;  1XVY A;  1EYI A;  1FPK A;  3U94 A;  3RPL A;  1A7L A;  4KD5 A;  1UTH B;  3O66 A;  5AA4 A;  4OAN A;  1D9Q A;  1DMB A;  1MXY A;  3A3C A;  4G2Z A;  4MNC A;  1ANF A;  4NAP A;  3SEW A;  3VXC A;  1DPE A;  2ALU A;  4N17 A;  5BUU A;  1RKM A;  4GX4 A;  5I56 B;  3V5A A;  4NED A;  5JTY A;  2B4M A;  4MH5 A;  1VSO A;  1I6Q A;  5H8S A;  4LAT A;  3FAT A;  2P3N A;  2E0S A;  3Q28 A;  5ICQ A;  1S50 A;  2R6G E;  4ZEI A;  1GGG A;  4KXP A;  1AH5 A;  4OEU A;  1D4N A;  1FBP A;  4F18 A;  4EUO A;  5ISU A;  2ZYO A;  3UK4 A;  4IB2 A;  1IXH A;  3K6X A;  3KBR A;  3PPQ A;  1OVB A;  5KCJ A;  5TPA B;  3TTR A;  1QUL A;  1NUY A;  4I1D A;  4KI0 E;  4ESW A;  1A8F A;  3EPE A;  4RYA A;  4TQU Q;  1SW5 A;  4KR5 A;  3ILT B;  1M5D A;  1P1O A;  1FJ6 A;  3T9X B;  5CM6 A;  1LBB A;  4I3E A;  1B3F A;  2V25 A;  2B3F A;  4HTG A;  1FTL A;  1BLF A;  4MF3 A;  2XWO A;  4H5F A;  3EQ1 A;  3C31 A;  5LTC A;  1NUZ A;  4G68 A;  3C9H A;  2DE3 A;  4BDL A;  4N13 A;  4DZ1 A;  3FUZ A;  4U4X A;  2REJ A;  3MPK A;  3ODB A;  4BDM A;  4BDN A;  3K6V A;  4GVO A;  2I0B A;  3QXM A;  3RT6 B;  3THI A;  3T0J A;  1B3E A;  2DXR A;  4PQJ A;  2RKM A;  1MH4 A;  5EHM A;  5I58 B;  1MPD A;  1AL3 A;  2P2A A;  1KA0 A;  4TLM B;  5H8F B;  4XXU A;  1PBQ A;  4OFL A;  3G3F A;  3LSW A;  1ZBM A;  5FBP A;  1B9J A;  4QFO A;  2VOZ A;  3OD7 A;  2NXO A;  3KFM A;  3I3V A;  3PMW A;  1KZ8 A;  2QSX A;  1YYZ A;  2QJE A;  3FJM A;  3ISP A;  2Y7I A;  2HEU A;  1USY E;  1MPB A;  3RTF B;  3KOT A;  4GFR A;  4LN5 A;  4IY5 A;  4RPN A;  4X1D A;  1FPJ A;  3KOS A;  1A99 A;  4O7I A;  3OEL A;  4NHB A;  4ZED A;  1TT1 A;  1NNP A;  4YZZ A;  1NNK A;  2NUV A;  3PMV A;  3IOU A;  3RPL B;  4F3S A;  1Q1K A;  2GHB A;  4AQ4 A;  2I3W A;  1JEV A;  1Y4T A;  2I49 A;  3H4Z A;  4GQO A;  1FPI A;  1US4 A;  4OZ9 A;  1YTV A;  4R6H A;  1QW0 A;  4PTK A;  3IR1 A;  4QFN A;  2B3B A;  3GBA A;  3CR9 A;  3DM0 A;  1FBF A;  5AE4 A;  3UGW A;  1Y1M A;  4N6D A;  3UN6 A;  4MAG A;  4YIC A;  4G61 A;  3C32 A;  4Q0C A;  5IM2 A;  3GLB A;  4GL0 A;  3SET A;  1SVX B;  3U65 A;  4I40 A;  4LZ8 A;  5TP9 A;  4JVC A;  1YXI A;  3CI8 A;  3HCQ A;  4BLA A;  1LAH E;  4FBP A;  4P8B A;  1SW4 A;  1B4Z A;  4NWC A;  4GWS A;  3VLV A;  1AOV A;  1NV4 A;  2WYK A;  2HHM A;  5KCJ B;  3M3L A;  5IZ3 B;  3U1O A;  3PD8 A;  1OQG A;  1B3G A;  4XKP A;  1N76 A;  2F5X A;  1EZP A;  3T66 A;  3C35 A;  5ET7 A;  4KQP A;  4OXV A;  2XXT A;  4FED A;  1FQE A;  2G93 A;  4RK2 A;  1H44 A;  4PGN A;  4GXA A;  3PU5 A;  1IMD A;  5KDT B;  3G3J A;  2P3V A;  2XXU A;  2BJI A;  1Y3Q A;  3GZG A;  3A3U A;  2GHA A;  1JP4 A;  3T96 B;  4AB5 A;  4GBV A;  4F39 A;  4H8J A;  3TQL A;  1II5 A;  4OES A;  3OXN A;  4PFB A;  5DEX B;  3I5O A;  2HFB A;  5HM4 B;  4XKN A;  4O3C A;  4R9F A;  4NN3 A;  1B5J A;  3TKD A;  3ZKK A;  4H46 A;  5CMB A;  4TLL B;  1UIV A;  4LA9 A;  4PE5 B;  3S2V A;  4H1X A;  2AL4 A;  4LQ2 A;  3TTM A;  3SDF A;  2OK2 A;  2O68 A;  5DTB A;  4MBP A;  5A5X B;  4F19 A;  3VVE A;  3TQW A;  3FXB A;  2FYI A;  1H3D A;  1OLA A;  2DWH A;  1TXF A;  4MX6 A;  1N3W A;  4DI4 B;  4H8I A;  1B51 A;  1JVY A;  2Z8F A;  2V93 A;  1LB9 A;  4P11 A;  4ZEC A;  1SW1 A;  5FHN A;  4G8H A;  1ATG A;  1A54 A;  2LAO A;  1B7H A;  3IO6 A;  3U72 A;  3FVK A;  5IGA A;  2F35 A;  5I2K A;  3MC2 A;  3D4G A;  4F2Q A;  5AA1 A;  1FW0 A;  4UAB A;  2Z22 A;  3PUY E;  1MY4 A;  2B4L A;  3PUW E;  4WKM A;  3QAX A;  2MKZ A;  1B2H A;  2F97 A;  4KYS A;  3K00 A;  3B7D A;  1IXG A;  3MAM A;  4EQ7 A;  3DEL B;  2XXQ A;  4ZE8 A;  3WAE A;  3SKP A;  1WDN A;  2YPN A;  4U2R A;  4N91 A;  3PUX E;  1SBP A;  2Q89 A;  2GH9 A;  4JXI A;  2AYS A;  4PFI A;  5TP9 B;  1G0H A;  1UTH A;  4ND9 A;  2H5Y A;  3T9U A;  1XVX A;  1NV7 A;  4YU0 A;  2Z8D A;  4X9T A;  3TZA A;  5I56 A;  3K01 A;  1L5T A;  3ONM A;  1MM6 A;  3O28 A;  4EQB A;  1OLC A;  2VP1 A;  2I48 A;  5I84 A;  4MIJ A;  4P1E A;  4G77 A;  3HHG A;  1PDA A;  4N81 A;  4FE8 A;  5K2X A;  1R9L A;  3KEI A;  1SDX A;  4XIG Q;  2PVU A;  3LUZ A;  3PPP A;  3IFA A;  1N7W A;  1M5F A;  2Y7R A;  2KQZ A;  4OYV A;  3KC1 A;  3V8X B;  1FTM A;  3PMX A;  1JW5 A;  4PAF A;  2VD3 A;  1RYX A;  2OPD A;  1JNF A;  5DYH A;  2QS3 A;  2QMW A;  3K02 A;  4MLQ A;  3G3I A;  3MQ9 A;  5F1Q A;  2O69 A;  3IB0 A;  3KG2 A;  4JBZ A;  1J1N A;  5I2N B;  3O9P A;  4GL8 A;  3TTL A;  3ZS6 A;  3T9V A;  4P47 A;  3IJX B;  5ICT A;  4XFE A;  4ZEF A;  5CMM A;  5L8D A;  3V89 B;  4H45 A;  3FV2 A;  3UOR A;  1JQF A;  2I3V A;  3CSB A;  2FVZ A;  1B40 A;  5IKB A;  5H8F A;  1SQY A;  2A5T B;  5I2K B;  5ET5 A;  4WXJ A;  5FTI A;  4OFJ A;  2O51 A;  3IK6 B;  2FA7 A;  1FBH A;  1HSE A;  1LCF A;  4GD5 A;  4F22 A;  4QSE A;  3M8U A;  3K6W A;  5ET8 A;  3R26 A;  1FQA A;  4OFO A;  1QKA A;  1SW2 A;  2OX3 A;  1FQC A;  5EQ8 A;  1URD A;  2ZNT A;  3MST A;  2OLB A;  5HBC A;  1A55 A;  2UVJ A;  2HCA A;  1NV6 A;  1ZIU A;  4U1Z A;  4G4P A;  2RC8 A;  1RDZ A;  2ZYK A;  4MNI A;  5CBS A;  3B6Q A;  5EHS A;  1SI1 A;  1MH3 A;  4RXL A;  2Q88 A;  4IO4 A;  3C34 A;  1B0H A;  4X04 A;  3JV9 A;  3ZSF A;  5EQA A;  2Q9T A;  1S9T A;  1SI0 A;  2RF1 A;  1FSA A;  1YPN A;  2D3I A;  1IEJ A;  3OEN A;  4THI A;  1MXX A;  4ONY A;  4P0G A;  3K1P A;  2WKY A;  3KJ7 A;  4JVD A;  3KC0 A;  2HQ0 A;  3TEP A;  3QMF A;  4ZZE A;  4OER A;  1JET A;  4NWD A;  1Y1Z A;  4G68 C;  2Q2C A;  1USY H;  1ZMG A;  3A09 A;  1MQD A;  5ELV A;  2KLF A;  5DT6 A;  3O6H A;  4MJO A;  1FBG A;  2ZNS A;  3TUS A;  4BDR A;  1IMA A;  1N3X A;  2D21 A;  1N0T A;  3CFZ A;  1VFE A;  3IOV A;  4NQ8 A;  4U4S A;  4C1U A;  3HHF A;  5I7I A;  4JB7 A;  5IZ3 A;  4MNP A;  4R2F A;  1US5 A;  1NUX A;  3HPI A;  3FXR A;  1IXC A;  1B58 A;  4BDO A;  2DYX A;  4OEN A;  4BDQ A;  2UVG A;  2X7Q A;  1IMC A;  4RY1 A;  4F31 B;  5KDT A;  3FZV A;  1PB9 A;  3LV0 A;  3K1N A;  4R73 A;  4KCD A;  2CZH A;  4PFW A;  1FQD A;  3GYY A;  1NL5 A;  2E1S A;  4H65 A;  5DEX A;  2Y84 A;  2O1L A;  1LCT A;  3L6G A;  2ZYM A;  4KYE A;  2F36 A;  1EYK A;  4RA1 A;  1IIT A;  3L6H A;  5CMK A;  1KWH A;  4X1B A;  1MQG A;  2ZMB A;  3WAF A;  5A5X A;  3MYU A;  1R9Q A;  2YLN A;  1M5E A;  4WEP A;  2HXR A;  3O6G A;  4O3B A;  1FBC A;  3E78 A;  4N6P A;  1SYI A;  3N6U A;  4POW A;  3B6W A;  2V4C A;  3FD3 A;  4IO2 A;  3JYR A;  3RY3 A;  2Q2A A;  2ZZX A;  5CC2 A;  2F3B A;  4NG7 A;  1MY0 A;  5HPQ A;  2W7Y A;  1FRP A;  3PUZ E;  4RNS A;  4F2O A;  3G7W A;  1I6A A;  2QS2 A;  3SER A;  1D3K A;  2H25 A;  1MPC A;  1FTO A;  5B70 A;  3LUY A;  3OOA A;  4QXD A;  4X48 A;  1LFI A;  4TOZ A;  1LGB C;  4YKK A;  2DDK A;  1EYJ A;  1QUJ A;  2HAU A;  1URG A;  2H9B A;  4FEC A;  4U23 A;  1QUK A;  1Y4C A;  4ZEB A;  2R71 A;  3QSL A;  4JSD A;  1JEU A;  4PP0 A;  5IZ1 A;  3R7X A;  1IUD A;  1Z7M E;  3H3G A;  3IOW A;  3RUM A;  1IMB A;  4U22 A;  3TCF A;  3KGC A;  4PBQ A;  4PBH A;  1ZU0 A;  2A5S A;  3R6U A;  3MZ9 A;  2Y7W A;  1B4H A;  5I3S A;  2Q8M A;  2RC7 A;  4DIG A;  2ZNU A;  4XTC Q;  5EQ7 A;  4JWO A;  3MP1 A;  5ITO A;  3DLN A;  5CRY A;  1FTA A;  1FPB A;  3LSX A;  1DTZ A;  1BIY A;  4ZS9 A;  1FCK A;  2QFL A;  1UIU A;  3H6V A;  3VXB A;  4GWU A;  2F7B A;  4LUB A;  4YKI A;  3CVG A;  3SEY A;  4H5G A;  4L17 A;  3C36 A;  2O7I A;  2KR0 A;  2Z23 A;  3VLW A;  2FBP A;  4P3L A;  4F3P A;  3N5L A;  4E0X A;  4O3A A;  1OMP A;  4OHN A;  1A40 A;  3G3G A;  5I57 B;  5FHM A;  1EZ9 A;  1LLS A;  4YAH X;  3Q29 A;  4LQ5 A;  5AA3 A;  1FTJ A;  1H45 A;  2IA4 A;  1VR5 A;  1ZJL A;  3MJN A;  4DLD A;  5B7D A;  3OMB A;  1P1N A;  3B8B A;  3IL1 B;  4R6K A;  4OVR A;  3KZG A;  2XXP A;  1FPF A;  3BFU A;  1AWB A;  1EH3 A;  5I2N A;  3U93 A;  4GWX A;  3RT8 A;  2XD3 A;  4IO6 A;  5DVJ A;  5T3J A;  4NF4 B;  2VPN A;  2ABH A;  2FHY A;  1NV2 A;  2I0C A;  5F7V A;  3VVD A;  4YKJ A;  3M3F A;  2DVZ A;  2ZZV A;  4OA4 A;  1B7Z A;  3RYD A;  2L5V A;  3EN3 A;  4GF8 A;  1QKB A;  2UYF A;  3EHS A;  1QGX A;  1MQI A;  3FIR A;  3TTK A;  2F6G A;  1R6Z A;  4ZZA A;  2A5T A;  3QUF A;  4OTE A;  1P1Q A;  2UXA A;  3G3H A;  2QMX A;  4QF9 A;  1ELJ A;  3O29 A;  1XHY A;  3IOR A;  1IIW A;  1UTB B;  2V3T A;  1MXV A;  4ELR A;  1MDP 1;  3T9H B;  1FQB A;  4MLV A;  3F11 A;  3ILU B;  1GR2 A;  4HXV A;  1NV1 A;  4LZ5 A;  4ZDM A;  2V3U A;  2HZL A;  2O7U A;  3OO7 A;  3A29 A;  1FPG A;  1NH8 A;  3EHU A;  3B50 A;  1NKX A;  2V3Q A;  1VDW A;  4ISU A;  4DCX A;  4GWZ A;  2WEF A;  2H4I A;  4AB6 A;  1B52 A;  1EU8 A;  2X26 A;  3CRB A;  1PC3 A;  1IQ7 A;  2AIX A;  1N7X A;  1LEV A;  3RQT A;  1MDQ A;  3T22 A;  1INP A;  3KN8 A;  4IGT A;  2VD2 A;  1MY1 A;  1I6B A;  3IO4 A;  3DP4 A;  1DBZ A;  3H06 B;  2DWA A;  3SEV A;  4IR8 A;  3ECR A;  1B05 A;  4PET A;  1NV3 A;  1QUI A;  3M3K A;  4POX A;  3FJ7 A;  1R1N A;  2WBB A;  3OO6 A;  3W9V A;  4PF8 A;  2WX9 A;  3FXU A;  1M5C A;  3Q26 A;  3FGS A;  3USD A;  2M8C A;  3MVY A;  5F24 A;  1SD3 A;  2DOJ A;  1ZKB A;  1Z7N E;  2VGQ A;  4YKP A;  4Q30 B;  1POT A;  4NX1 A;  4R72 A;  3S9E A;  4NF5 A;  4YMB A;  1H76 A;  3IFC A;  4KPT A;  2QVU A;  1B1X A;  5L9O A;  2QS1 A;  2B65 A;  2Y5L A;  4NMY A;  4XKR A;  1GVC A;  1NH7 A;  3C4M A;  4K3F A;  4DXB A;  3DP8 A;  1P1U A;  4FJP A;  3TTN A;  2XX7 A;  1MM7 A;  2PT2 A;  2XXW A;  3JZJ A;  3MVW A;  3P7I A;  3VV5 A;  2OBG A;  2Y5K A;  3BIH A;  2RCA A;  5K2Y A;  2G29 A;  1I69 A;  3QUJ A;  4U1O A;  2Y7K A;  1SYH A;  4EXK A;  3IB1 A;  4H67 A;  1LST A;  3DP6 A;  4HE0 A;  1BK4 A;  1CNQ A;  4PDH A;  2DVC A;  1Y3N A;  3K1M A;  1NUW A;  2XWK A;  5L9S A;  2UYE A;  1B5H A;  4JWX A;  4OVP A;  4QRZ A;  4PCD A;  4FIM A;  4GLI A;  4PFT A;  3TCG A;  1MY2 A;  4YMA A;  3RGY A;  4ZEK A;  5J16 A;  4ECF A;  1O64 A;  1OVT A;  3KN7 A;  5EYG A;  1GTK A;  4LZ7 A;  2DXY A;  3H7M A;  4R75 A;  1B6H A;  2I6E A;  3MP6 A;  4QSC A;  4M4G A;  2VPO A;  4QHQ A;  2WYP A;  2XXI A;  1UQW A;  1NV0 A;  4HS7 A;  3MZB A;  3PTY A;  5LDZ A;  5ITP A;  1MG1 A;  2REG A;  3OSR A;  1O7T A;  3UP9 A;  1FBE A;  1DSN A;  4IO3 A;  1B5I A;  2OWT A;  1LFH A;  2F78 A;  1ZLQ A;  4OMB A;  4EQ9 A;  1GV8 A;  1B7U A;  4N15 A;  2YJP A;  2UVH A;  4R74 A;  5EYH A;  4IY6 A;  3C33 A;  1TWY A;  1NNT A;  1B3L A;  1D9V A;  4DXU A;  3LBS A;  4PC9 A;  2QVV A;  4YB6 A;  2Q74 A;  2OWZ A;  3PV0 E;  1P99 A;  3TPA A;  1EZO A;  4R6Y A;  4U21 A;  1URS A;  2O6A A;  4EXL A;  3K2D A;  3K4U A;  4QFK A;  3HST A;  1PEB A;  1IZ1 A;  5FHO A;  2GFE A;  2X7P A;  3PUV E;  2PMS A;  2QL3 A;  4NF0 A;  3CIJ A;  4O8M A;  1HSJ A;  1A8E A;  2PBW A;  5EQ9 A;  4R2B A;  4LVQ A;  2F34 A;  1LAX A;  4NF8 A;  4NF5 B;  5LOM A;  3QK6 A;  3K0V A;  1FBD A;  2XA5 A;  4Z7E A;  1MS7 A;  3KN3 A;  2I4C A;  3CSG A;  1K9Y A;  4F1V A;  3E13 X;  3TEL A;  1K9Z A;  3LR1 A;  3OO8 A;  4IO7 A;  1BP5 A;  4F1Y A;  1JW4 A;  3LC8 A;  3H6T A;  4GX6 A;  3BKI B;  3GXA A;  4Q5T A;  4OWD A;  1B32 A;  4HW8 A;  5I57 A;  4DCY A;  2OWS A;  4QFP A;  3MW0 A;  1D9Y A;  3FVN A;  2XWI A;  5DVI A;  1YCJ A;  3IOT A;  3VE1 B;  3I6V A;  4Q8R A;  2Z8E A;  3IB2 A;  4FEB A;  3RN8 A;  1MXW A;  1Y9U A;  4XKQ A;  1DOT A; 
#chains in the Genus database with same CATH homology
 2KR0 A;  4PFI A;  1G0H A;  4DI3 D;  2FBP A;  4HCY A;  4P3L A;  1IMF A;  4GWY A;  4GX3 A;  1NV7 A;  4NGU A;  4X9T A;  1FPD A;  1G0I A;  3T1B A;  4QBA A;  4PAI A;  4PGP A;  5I5P A;  2CZK A;  2XWV A;  2CEY A;  4MIJ A;  3W9W A;  1YZ0 A;  4P1E A;  3B8B A;  2VT5 A;  1EYI A;  1FPK A;  3RPL A;  1LBW A;  4OVR A;  4N81 A;  4MMP A;  1FPF A;  4OAN A;  1AWB A;  1D9Q A;  4MNC A;  4PE3 A;  4NAP A;  4GWX A;  3LUZ A;  3IFA A;  4N17 A;  5T3J A;  2CEX A;  2VPN A;  4GX4 A;  2FHY A;  1NV2 A;  2JJK A;  2KQZ A;  2DVZ A;  2ZZV A;  3KC1 A;  2B4M A;  5IZZ A;  4PAF A;  4OA4 A;  4HCW A;  3RYD A;  2L5V A;  2P3N A;  4AS5 A;  4KXP A;  1QGX A;  4M1V A;  1FBP A;  4F18 A;  4N8Y A;  5DW8 A;  2FIE A;  4P47 A;  4XFE A;  4H45 A;  1NUY A;  2QVR A;  1Q9D A;  3E79 A;  4HXV A;  1FJ6 A;  4F1U A;  1NV1 A;  2FVZ A;  5CM6 A;  4XF5 A;  2HZL A;  4I3E A;  4P56 A;  3NOH A;  3A29 A;  1FPG A;  2XWO A;  3B50 A;  2V3Q A;  1VDW A;  5ET5 A;  2PCR A;  4GWZ A;  2WEF A;  5LTC A;  1NUZ A;  2DE3 A;  1FBH A;  2F3D A;  1LEV A;  4P9K A;  5ET8 A;  1INP A;  4GBW A;  2OX3 A;  5EQ8 A;  3T0J A;  1FPE A;  3MST A;  4MEV A;  1KA0 A;  1DBZ A;  1NV6 A;  4IR8 A;  4PET A;  1NV3 A;  1RDZ A;  4MNI A;  1FJ9 A;  2WBB A;  4OVS A;  3W9V A;  4PF8 A;  4PDD A;  5FBP A;  2WX9 A;  4AS4 A;  4X04 A;  1DK4 A;  1KZ8 A;  1YYZ A;  5EQA A;  2Q9T A;  3ISP A;  5F24 A;  1FSA A;  2GQ1 A;  2ZZW A;  2XXK A;  4NX1 A;  2QPQ A;  1IME A;  3BIG A;  1RDY A;  4LN5 A;  3IFC A;  2QVU A;  4JVD A;  3KC0 A;  1FPJ A;  3QMF A;  4O7I A;  4NHB A;  2Y5L A;  4YZZ A;  1RDX A;  3RPL B;  4MJO A;  2HPG A;  3ROJ A;  1FBG A;  1IMA A;  1LBZ A;  1FPI A;  4NQ8 A;  5I7I A;  5IZ3 A;  4P1L A;  4PTK A;  2Y5K A;  3BIH A;  4MNP A;  4O7M A;  1LBY A;  1NUX A;  1FBF A;  4N8G A;  4N6D A;  4MAG A;  4YIC A;  4G61 A;  5IM2 A;  4HE0 A;  2DE4 A;  1BK4 A;  1CNQ A;  1IMC A;  2R8T A;  4MCO A;  4PDH A;  3U65 A;  4I40 A;  4JVC A;  1YXI A;  1NUW A;  3LV0 A;  2XWK A;  5A5L A;  4FBP A;  4P8B A;  4OVP A;  2CZH A;  4GWS A;  4PCD A;  4OVT A;  1NV4 A;  2WYK A;  3GYY A;  2HHM A;  5J16 A;  2PFZ A;  5IZ3 B;  2CZI A;  5EYG A;  2DE2 A;  2F5X A;  4HE2 A;  5ET7 A;  4N6K A;  2VPO A;  1EYK A;  2WYP A;  3FBP A;  1NV0 A;  4PGN A;  1IMD A;  1LBV A;  3MYU A;  2P3V A;  2BJI A;  4O94 A;  3PTY A;  1JP4 A;  5LDZ A;  2HXR A;  4GBV A;  1FBC A;  1FBE A;  3E78 A;  4PFB A;  3HFU A;  2WBD A;  2V4C A;  4MHF A;  4GWW A;  1FPL A;  4NN3 A;  4N15 A;  2ZZX A;  4X8R A;  5EYH A;  2F3B A;  4H46 A;  3EKI A;  4NG7 A;  2QVV A;  4PC9 A;  2Q74 A;  2OWZ A;  5JK4 A;  3SZP A;  1FRP A;  4JVI A;  4F19 A;  1DCU A;  3FXB A;  1KA1 A;  3CHG A;  4QXD A;  1NI9 A;  5J1D A;  4XEQ A;  4NF0 A;  4MX6 A;  4O8M A;  4DI4 B;  4PFR A;  2PFY A;  2DDK A;  1EYJ A;  5EQ9 A;  5ET6 A;  2HZK A;  1LBX A;  4PF6 A;  1NV5 A;  5IGA A;  5ESY A;  5IZ1 A;  1FBD A;  4OVQ A;  2XA5 A;  3KBZ A;  1K9Y A;  4HE1 A;  4N4U A;  4UAB A;  4F1V A;  1IMB A;  1K9Z A;  4PBQ A;  2B4L A;  4PBH A;  1SPI A;  4I3Y A;  2MKZ A;  4GX6 A;  5I3S A;  4PAK A;  2Q8M A;  5EQ7 A;  1FTA A;  1FPB A;  2XWI A;  1XI6 A;  2FIX A;  2QFL A;  4GWU A;  4N91 A;  3D1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...