3LUZA

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
238
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEDYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Hydrolase
molecule keywords Extragenic suppressor protein suhB
total genus 78
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3luzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3luzA02
2QVUA 4O7IA 1FBGA 2HHMA 1FBFA 2FIEA 1NUWA 4GX3A 2F3DA 2JJKA 1FBPA 1CNQA 4FBPA 4HE0A 1VDWA 1YYZA 4MJOA 4QXDA 5EYGA 4GWSA 1NUYA 5LDZA 1RDZA 2QVVA 1FPEA 5ET6A 3IFAA 5IZ1A 1RDXA 1FPIA 3LUZA 2WBBA 1FBEA 2DDKA 5EQ9A 3FBPA 2OX3A 4I40A 1FPKA 1AWBA 4KXPA 5IZ3A 4HE2A 3KC1A 1KZ8A 1FPDA 1FJ9A 2P3VA 3RPLA 1K9YA 1LBXA 2PCRA 1FTAA 1FPLA 1NI9A 4GWXA 4GWYA 2WEFA 1NV0A 2F3BA 3RYDA 4GBVA 2Y5LA 1FRPA 5EYHA 2P3NA 3QMFA 5J16A 4AS4A 4H46A 3ROJA 1FJ6A 4GBWA 2R8TA 4G61A 2FVZA 2WBDA 2Q74A 1INPA 1NUXA 1SPIA 2GQ1A 1LEVA 1FPFA 5EQ8A 1FPGA 2OWZA 3D1RA 4AS5A 1IMFA 1DBZA 1KA0A 3BIGA 4GX4A 2Q8MA 1NV4A 1IMEA 1NV2A 4IR8A 2VT5A 2BJIA 1LBZA 3B8BA 1XI6A 1FPJA 1NV6A 1RDYA 2CZHA 1NV5A 1LBWA 5ET7A 1EYJA 4I3YA 5DW8A 3LV0A 1NUZA 1LBVA 4N81A 1D9QA 5EQAA 5I3SA 4H45A 1IMDA 3A29A 1YZ0A 1FBDA 2FHYA 1YXIA 1QGXA 1NV3A 5ESYA 4GX6A 1K9ZA 4HXVA 2CZIA 1FBHA 1DK4A 2QVRA 4I3EA 1FPBA 3KC0A 1JP4A 4GWWA 1BK4A 4GWZA 1DCUA 5F24A 4HE1A 2FBPA 1EYKA 1G0IA 1EYIA 2QFLA 5A5LA 1G0HA 4GWUA 1LBYA 4PTKA 2Y5KA 1FSAA 3RPLB 3BIHA 1Q9DA 5FBPA 2FIXA 1KA1A 5ET5A 5ET8A 3IFCA 1NV1A 5IZ3B 1IMCA 1FBCA 2CZKA 1IMAA 3KBZA 5T3JA 1NV7A 5EQ7A 3T0JA 1IMBA
chains in the Genus database with same CATH superfamily
1D9YA 5CMKA 3EPEA 4RJZA 1RYOA 4MJOA 1A40A 1XHYA 2ONSA 4GWSA 4E0WA 5ET6A 3KOTA 3U93A 3CG3A 1QVSA 2AIXA 2OBGA 1B5JA 4GOTA 1UIUA 1B5IA 3FBPA 2F7AA 1LSTA 4OWDA 4WXJA 3HSTA 4AB5A 4HE2A 5I57B 2ZZWA 2XD2A 2ZYNA 4MBPA 2RKMA 2I0BA 3O2AA 1NV0A 1NMUA 3RYDA 1N3XA 4ECFA 4JVDA 4N17A 2F34A 1MY0A 3WAFA 4DXUA 4X04A 1LBCA 1FQBA 5KDTB 3G3HA 3TCHA 2Y7IA 2ZNSA 1YTVA 2F78A 1ATGA 3MP8A 3PGFA 5BUUA 3RUMA 1NV5A 1SYIA 2V93A 4DI3D 1YZ0A 5B70A 1MPBA 1QGXA 5ESYA 2ZMBA 1WODA 1FPBA 1MQGA 3N26A 4QFLA 2QS3A 3TYHA 4GQOA 4NG7A 4DIGA 5CC2A 3T9XB 5ET8A 1XC1A 2UXAA 4G2ZA 1PBPA 4LZ8A 4G8MA 4G77A 2ZNUA 2E0SA 2I4CA 4GRKA 1B3FA 3FVOA 1IXIA 4OTEA 4UACA 1MS7A 4QXDA 4GL8A 1Y4CA 4PBQA 4UA8A 1B1XA 1JW4A 4P56A 4NGUA 4O3CA 1FPIA 2WBBA 3W15C 5L9MA 4NF5A 1FQFA 4DXCA 1LAHE 1A7LA 3RY3A 2XXKA 2RF1A 4TLMB 2PBWA 3KC1A 2NOOA 3B50A 1LCTA 1MQHA 3D4GA 5FHNA 4PFBA 1B3EA 5ICTA 3O9PA 3BKIB 4G61A 1IXHA 4JWYA 1TXFA 4OETA 4PFWA 3UP9A 4OERA 3VLWA 1KWHA 3U1OA 1LFGA 2WYPA 2ZYOA 1XVYA 4ELRA 4PGNA 1AL3A 3USDA 4IO3A 3TZAA 4PGPA 2VHAA 1SD3A 1RDYA 1A99A 2Y7WA 4E0XA 3KOSA 2V3UA 2FNCA 3CIJA 3C9HA 1I6BA 2ZZVA 1H3DA 2I49A 4IB2A 1K9ZA 2QVRA 4THIA 3VXBA 1DCUA 3R26A 3VVEA 3MQ9A 1GR2A 1B9JA 1AIVA 3PD9A 4EF1A 2DVZA 4IGRA 1DPPA 5ET5A 1Q35A 3Q27A 4NF5B 2I6EA 3E9XA 2XWIA 2QS2A 4KYSA 4G8HA 3KSXA 3Q26A 3MSTA 3SDFA 2OCUA 4OQOA 4ESWA 1SVXB 5H8NA 2QL3A 1RKMA 1R6ZA 1LFHA 1AOVA 2PFYA 1FBEA 1FQAA 2DDKA 1MQDA 1MPDA 4OFLA 3QK6A 4JWXA 2OZZA 1FPKA 1AWBA 2Y7PA 1XS5A 3PU5A 1CB6A 2XD3A 3CVGA 2OPDA 2PYYA 2P3NA 5J16A 2ZYMA 1LAXA 4ELOA 1FQCA 3PPPA 5CMMA 3FJ7A 4KCDA 2DXRA 1JEUA 4X1BA 2YJPA 3TUSA 1IEJA 5EQ8A 2OLBA 2Q8MA 3K6VA 1B6HA 5JTYA 4IO5A 5KDTA 2DQVA 3IOVA 3PPRA 2QMWA 4X48A 5H8HB 3QIMA 4NTLA 4OFJA 4GWOA 3RT6B 4PE3A 4H45A 1ZU0A 3CHGA 3OEMA 2G93A 1BTJA 4OVRA 3IK6B 1PC3A 1MPCA 1DK4A 3PMWA 3C31A 3K6XA 2O1MA 3SZPA 3MVYA 4GF8A 5A5LA 1FTKA 1POTA 3EN3A 4PTKA 3RPLB 2WKYA 4DCYA 3KN3A 3QSLA 1NV1A 3OO9A 2XXTA 1LB9A 5I58A 4AQ4A 3SEXA 1OMPA 4ELPA 1CNQA 3ZKKA 2QPQA 4O3BA 2PMSA 2Z8FA 3EHSA 3L6HA 1Y9UA 4HS7A 5EYGA 1A55A 4GIZA 4LZ5A 2WX9A 1Y3NA 1N7WA 5TP9B 4PE5B 4H1XA 1BKAA 1QKAA 2B65A 3N5LA 4NF8B 3MBPA 4OYVA 5EQ9A 4F29A 4O94A 1AMFA 4MF3A 2DXYA 2D3IA 3G3FA 1JVXA 1I69A 5ITPA 3NOHA 2CZLA 3G3KA 2HFBA 2I58A 3N6TA 4LN5A 4HW8A 1M5FA 3LSFB 1EH3A 4LATA 1SPIA 4EQ7A 4NF6A 1PB8A 3KSJA 2THIA 1LBZA 1OLAA 3TDJA 3K2DA 3KBRA 1NFTA 4JB7A 4M4GA 5I84A 1LB8A 4DCXA 4NEDA 4H67A 1JEVA 2OK2A 1O7TA 5DT6A 3MC2A 5AA2B 3A09A 5DEXA 1YCJA 2Y5KA 4M1VA 3C35A 3HHFA 2XX9A 3IFCA 1J1NA 3W9WA 2XWVA 3ILTB 4RA1A 1D3KA 3KBZA 3FV2A 1IMBA 4POWA 4YB6A 4QRZA 3N94A 5IZZA 1JNFA 1FBPA 4XXUA 3PUXE 2BJJX 2Q88A 4OENA 3O29A 4LP2B 3THIA 1OQGA 1B0LA 2NVUB 4MEVA 3TODA 3IR1A 5IZ3A 4U23A 1TFDA 1FPLA 5I59B 3FV1A 3FUZA 3T96B 1ZTYA 2R8TA 1INPA 2OPEA 1FPFA 4C1UA 1Y20A 1DBZA 3LSWA 5HBCA 3FVKA 5EHMA 2YPNA 4LONB 5A5XA 2F6PA 1USYH 4O3AA 3T1BA 4RK2A 4XKRA 1VR5A 3A29A 3S9NC 4NHBA 4HE1A 4JSOA 3RT8A 5AA3A 1G0IA 2HAVA 1EYIA 3MUQA 3OO7A 2VGQA 2HEUA 3TPAA 5LTCA 4I8CA 4LZ7A 2UVGA 3PUYE 5I2NB 4ZEBA 2XXVA 1P1QA 3AXFA 4OVTA 4BDLA 2R6GE 4JBZA 2FIEA 3UA8A 2KLFA 4EXLA 4G68B 3O6GA 4Q5TA 1ZJLA 4OEVA 1R9QA 2Z8DA 3SEUA 4WEDA 2V25A 4H0WA 4C1TA 3MJNA 3S4UA 3O6IA 2NUVA 1OVBA 2RC7A 3IFAA 3E4RA 1ANFA 2O51A 4R2BA 5CBRA 3SEVA 3K1PA 1MXZA 2RINA 4OMBA 3FJGA 2F35A 1FPDA 4IY6A 2F6GA 1TFAA 1YPNA 3ZKLA 1LBXA 4GWYA 2F36A 2ZYKA 3QMFA 1FJ6A 1GTKA 4GBWA 1B0HA 1QW0A 4RY1A 1LEVA 4TLLB 4H8JA 3MPKA 2I3VA 4PCDA 2ANJA 1FPJA 5DVFA 3T9HB 3TQLA 1USYE 5JK4A 4RNSA 4Q8RA 2O69A 3TTKA 2XWOA 3EQ1A 3C34A 1JW5A 2X7PA 4PFUA 1BIYA 5CMCA 1M5EA 4JDFA 1B7UA 1M5BA 5FHOA 5AA4B 4R72A 1PDAA 2R71A 1IUDA 1SW1A 3S9EA 5H8QA 1H45A 4FEDA 5AA1A 4NWCA 4OXVA 2VPOA 3VV5A 4OEUA 3H6TA 3L6GA 1FBCA 5EQ7A 4R6YA 4KI0E 3ILUB 3K1NA 4GX3A 1Z7ME 4I62A 4KPTA 4ZZAA 1SYHA 5DVIA 4FBPA 1VE4A 3G3IA 1DMBA 1ELJA 3KG2A 2O68A 2I3WA 2DSFA 4NN3A 1II5A 3LBSA 3CFXA 3IB2A 4IO6A 3FVGA 4F3BA 1LGBC 2O6AA 3TTMA 1GV8A 3G3GA 2QSXA 3F11A 4GWXA 2DE4A 4PF6A 2F3BA 3GXAA 4IO2A 5L9SA 3HO7A 3ROJA 1FTJA 3H7MA 1H43A 4MAGA 3M3KA 3LSLA 3V83A 3SETA 1B5HA 3R6UA 3TCGA 1MH4A 3EHTA 4NMYA 3ECRA 3CG1A 3P7IA 4N6DA 4N07A 4RYAA 3U72A 3S9LC 1NV6A 4DDDA 4ZEKA 4PFYA 3CR9A 2XXQA 1AH5A 4ZE9A 2DWAA 1CE2A 3T22A 3EF7A 3FVNA 4GWZA 2I4BA 3C4MA 1P1OA 5I57A 2QFLA 3HV1A 1B4ZA 4PBHA 1N84A 1Q9DA 4F39A 3TCFA 4ZEFA 1URGA 4DZ1A 5I2KA 2H4IA 1IMAA 2HHMA 2DE3A 2HXWA 3QUFA 4GXAA 1POY1 4FECA 4RPNA 3K01A 4GD5A 4R9GA 2XX8A 4LVQA 2Z8EA 3CFZA 1B58A 2GHBA 2UVJA 3CSBA 3LUZA 4N4UA 3SEYA 3O97A 4QF9A 3RNNA 4IO7A 4GLIA 4GFRA 2P2AA 2RCAA 5I2KB 3PUZE 5M2VA 4DE8A 5K2XA 2V4CA 3GYYA 2NXOA 1L5TA 2DWHA 1N7XA 2OWSA 3TELA 4U2RA 1ZKBA 3TEPA 2HQ0A 4QSDA 2OWZA 4FJPA 4RK9A 1DTGA 3BIGA 3TTNA 2REJA 3K00A 4PAKA 4KQPA 5F1QA 3CI8A 3TQWA 5DW8A 2GHAA 1MDP1 3PUWE 4PFIA 3PPOA 1QUKA 4WKMA 4U4XA 3IORA 1B2HA 3KN8A 1QULA 4GX6A 4EQ9A 2AYSA 4MCOA 3RQTA 3KZGA 2L5VA 4EF2A 2ONRA 1EYKA 3OD7A 4GVOA 4F1UA 1MRPA 1FSAA 4Q30B 1LBBA 3RPWA 4I1DA 1OVTA 5EYFA 2CZKA 5T3JA 4PC9A 3Q25A 2QVUA 1FBFA 3FASA 4BDNA 3IAZA 3U65A 4BDMA 3VDFA 1YYZA 5FTIA 3OOAA 5IKBA 1H76A 1B3GA 3OXNA 4YAHX 5CI5A 5DVJA 2XX7A 1FPEA 4PF8A 3ZS6A 5CMBA 4MX6A 4PDDA 3LC8A 1UTBB 2CEXA 3DM0A 4G68C 4YKIA 2QS4A 3BFTA 2KR0A 4I40A 1XT8A 5I56A 2F8DA 3K02A 2HAUA 2F5XA 4PFTA 3MZ1A 3LUYA 1PB7A 1MG1A 3IB0A 3PMXA 5AA4A 3IB1A 4HTGA 2O7UA 4G4PA 4NAPA 2Q74A 2V3QA 3VVFA 3IOUA 2XXYA 2XXPA 3V8XB 3TTLA 3MVWA 4HCYA 1FTLA 1MXUA 4KR5A 1MXYA 2O7IA 2BJIA 4R9FA 4YMBA 3B8BA 1B51A 2Q8JA 4F3SA 5ITOA 2Y7RA 4K3FA 5KCJB 2Q89A 4U1OA 2D21A 3KEIA 4ZDMA 2CZIA 1Y3QA 2KQZA 4POXA 3R7XA 1Y4TA 3H06B 3MZ9A 4MIJA 1MM6A 4QFNA 2XXHA 2YLNA 1N04A 3OSRA 4PP0A 1A8EA 1MY4A 3RGYA 5TU0A 5AE4A 1IITA 4Q0CA 4TOZA 1LCFA 5HM4B 3BFUA 1NH7A 3DP6A 3TTRA 4FATA 2D5WA 1B40A 2VPNA 1PB9A 1SW5A 4NWDA 1UTHA 5CRYA 2HZKA 2QVVA 4C0RA 3FXRA 3UGWA 3IJXB 4EXKA 1H44A 5FTHA 3GZGA 3T66A 1VSOA 3UK4A 2XA5A 1KZ8A 3DLNA 3O28A 3VLVA 5ELVA 3FZVA 4RXLA 1FCKA 4PAIA 5I2NA 4U4SA 2PX1A 3QXMA 5ICQA 4MMPA 1O64A 4ZEDA 2MKZA 1MQIA 4Z7EA 3MZBA 5L9OA 2OJTA 3D4CA 2Z22A 2VOZA 1ZBMA 3FIRA 4ZEIA 1NUXA 1JQFA 4UABA 2H98A 1QKBA 1JETA 4U22A 2VT5A 5A5XB 3M3FA 1MY2A 4MLQA 4ONYA 1NNFA 3Q28A 2ESNA 1YAEA 3H6VA 4I3YA 2H9BA 5J1DA 3MYUA 4ZECA 1B05A 2DP8A 2UYFA 5HPQA 1YXIA 1MXVA 3C33A 3IX1A 1MQJA 4I3EA 4F3GA 4P3LA 1BK4A 4LQ5A 3E3KA 2UYEA 4ESXA 3T9UA 3MVXA 1FTOA 3FJMA 3QUJA 4QFOA 1B3LA 1KA1A 3FD3A 2CEYA 5KZTA 4KD5A 2WYKA 1MY3A 5I56B 4NQ8A 3TAJA 1UTBA 1UTHB 1DSNA 3CSGA 1Y1MA 2JJKA 2Y7KA 2A5TB 3ONMA 1VDWA 1UQWA 1PBQA 2GRVA 2DE2A 3QYTA 3U8QA 1Z7NE 4MFIA 3B6TA 4U21A 3H6WA 1BLFA 3U92A 4OVSA 4LA9A 4X1DA 4JXIA 4NX1A 3MAMA 3TMGA 5BWJA 1IZ1A 1SQYA 4AB6A 4QFPA 5DEXB 2PT2A 5KCJA 3H4ZA 5L8DA 3MP6A 1IXCA 4F2QA 4XF5A 3M8UA 4F18A 1Y3PA 1FPGA 3D1RA 5CBSA 2I0CA 4R74A 1S50A 3RN8A 2ABHA 4P9KA 1B46A 1DOTA 3K6WA 1ZLQA 3FATA 1MH3A 3O6HA 1LBWA 3LV0A 1DTZA 1NUZA 3LSXA 4MNPA 4N81A 3UIFA 1WVJA 5EQAA 3A3CA 1TT1A 1BP5A 1SW2A 1NV3A 3FGSA 2PFZA 4RPOA 1SDXA 3V89B 4OA4A 4KCCA 1US5A 2Q9TA 1PEBA 2H5YA 3MWBA 3E79A 2FBPA 4BDRA 1LBYA 3CFLA 4YZZA 3VFJA 3PV0E 4F1VA 4DXBA 2V3TA 1M5DA 2DWJA 4MNIA 3T0JA 3RLFE 5IGAA 2P0SA 4NF8A 5TP9A 3E13X 1B52A 2X26A 3PUVE 4WEPA 3TKDA 4EQBA 3K0VA 4L17A 4FIMA 4F22A 4N8GA 3SKPA 3KJTA 1P1WA 3H3GA 1B3HA 2ZNTA 4ZZEA 2XXUA 4H5GA 1B7ZA 2LAOA 4N6KA 1P1NA 2PCRA 1NI9A 2AL4A 4N6PA 4H6DA 4JWOA 4JVCA 3O66A 4AS4A 4PFRA 1SW4A 1EZ9A 2O84X 2DVCA 5JEIA 1EZPA 1HSEA 3PTYA 1WDNA 2O1LA 1KA0A 3PPNA 3IJOB 1NH8A 2B3BA 1N0TA 1IIWA 5IM2A 5JTYB 5I3SA 2IA4A 3K1MA 2FHYA 4FORA 4HCWA 4XKQA 3FXQA 3V5AA 4YKJA 4OVQA 3IO6A 4OESA 4XTCQ 1N3WA 4PETA 4BDQA 4OVPA 4P47A 4F2OA 5F7VA 4JVIA 3SEWA 1LLSA 1GVCA 1FTMA 4ELQA 3ODBA 4MH5A 1NUWA 2CMOA 3BBRA 4P1EA 4H65A 3MP1A 4ND9A 4X9TA 3RTFB 4MNCA 5H8NB 4YB7A 1B4HA 4H5FA 3OELA 2A5SA 4BDOA 3U94A 4XFEA 1NNPA 1HSLA 2W7YA 1B7HA 1DPEA 4O7MA 4XKNA 5H8QB 1TWYA 4XEQA 2WEFA 2Y5LA 1T0KA 1N76A 1XVXA 1QUIA 2G29A 1MXXA 4AS5A 1IMFA 2FYIA 4GX4A 1NV4A 1P1UA 4IR8A 3CRBA 1M5CA 2V84A 1S9TA 2GFEA 4LQ2A 1B1HA 5I7IA 3OMBA 3PPQA 2Q2AA 4G8NA 3KJ7A 4IO4A 2P1SA 1FBHA 3E78A 1EU8A 2HPGA 4IY5A 1JP4A 3EKIA 1I6AA 3JYRA 3PD8A 4I9DA 1MDQA 5ISUA 1S7YA 1JW1A 4ISUA 3IL1B 1P99A 2REGA 2VP1A 2B4MA 3UN6A 2DWIA 1IMCA 4LUBA 2E1SA 4O7IA 1FBGA 3OO6A 1O63A 2ONKE 4P1LA 1NKXA 2ZXTA 3K4UA 2A5TA 3JZJA 4EDPA 2RC9A 4EUOA 4QSEA 2X7QA 1RDZA 3HCQA 3OEKA 3OSQA 3TFLA 5FHMA 1IXGA 4N13A 1GGGA 2OX3A 4OHNA 3EHUA 3K6UA 3ISPA 1URDA 2OWTA 4YMAA 1B32A 1FTAA 1FW0A 3DP8A 5EYHA 1F9BA 1R9LA 4QHQA 3OENA 2Y84A 3B7DA 3IOWA 3C36A 3SESA 1XI6A 2QRYA 2UVIA 2CZHA 1A8FA 2FA7A 2XXXA 1SBPA 1OQHA 1IQ7A 2UVHA 2Q2CA 1LBVA 1IMDA 4F19A 1FBDA 4MHFA 3QAXA 3G7WA 4YU0A 4HXVA 5DTBA 3ZSFA 1QUJA 1OLCA 3B6WA 3KC0A 4OZ9A 4GWWA 4PDHA 1US4A 3UORA 1G0HA 3BIHA 1A54A 5FBPA 4YKPA 2B3FA 5IZ3B 1NV7A 1NNTA 3SERA 4HE0A 4P8BA 4G68A 2ALUA 4PQJA 3KFMA 4YB5A 5IZ1A 4MLVA 2I48A 3FXUA 2HXRA 4P11A 3VE1B 3M3LA 3I6VA 4KXPA 1LFIA 2XXIA 1MM7A 3RTWB 1R1NA 4IGTA 3Q29A 4NF4B 4GBVA 2PVUA 1FRPA 2DYXA 1UIVA 1FQEA 5H8FA 2F7CA 2HZLA 4NE4A 3KN7A 2RCBA 4OFOA 1IMEA 2Z23A 1NV2A 4U1ZA 4O8MA 4ZS9A 1D4NA 1VFDA 4BLAA 4KYEA 1ZIUA 1NNKA 5ET7A 1EYJA 1ZMGA 4NF0A 1D9QA 4F3PA 1SI0A 4QFKA 4PAFA 3MPLA 1MXWA 4NF6B 4QBAA 2XWKA 5I5PA 5I59A 2HCAA 5B7DA 5F24A 1EZOA 2XXWA 4P0GA 4N8YA 4FE8A 1QJMA 1VFEA 4TQUQ 3PMVA 3T9VA 3MVZA 3HN0A 3WAEA 2FIXA 4XIGQ 3S2VA 4GL0A 4QSCA 5AA2D 2GQ1A 3H03A 5TPAA 2VD2A 3G3JA 2NWJA 2F3DA 2QJEA 3N6UA 3JV9A 1I6QA 4KFQA 3S9MC 4GXSB 5LDZA 1NUYA 1NL5A 2H99A 4YICA 3A3UA 1RDXA 2PT1A 3GBAA 5TPAB 1MY1A 5I58B 4H8IA 1LAFE 1FQDA 1HSJA 1LAGE 4F31B 3MW0A 4XKPA 5AA2A 1FJ9A 2P3VA 3RPLA 1K9YA 4FAJA 3B6QA 3T93B 4KYDA 1Y1ZA 4R6HA 4OANA 4YKKA 4H46A 2M8CA 2QS1A 3IOTA 4FEBA 1Q1KA 2DOJA 3H6UA 2FVZA 2WBDA 2F7BA 3W9VA 4KHZE 4DI4B 2F97A 3I5OA 3C32A 4P0IA 3KGCA 4Z0IA 3GBBA 5DYHA 3DP4A 4R75A 2XHDA 3VXCA 2AL5A 3I3VA 2GH9A 3FXBA 4N15A 2QMXA 1OIBA 3GLBA 5H8HA 2ZZXA 3HFUA 2DS9A 3LR1A 3HPIA 5EHSA 2RC8A 4X8RA 3OO8A 5CM6A 2B4LA 2R9JA 1JVYA 5H8SA 4N91A 4R73A 1D9VA 3VVDA 3IO4A 4R2FA 2XXRA 4JSDA 5H8FB 3HHGA 4F1YA 4R6KA 4OVJA 3VLUA 4GWUA 4NF4A 5K2YA 1SI1A 2H25A 5LOMA 2VD3A 4DLDA 2IEEA 1XOCA 5IAIA 1RYXA 4ZE8A 3DELB 1URSA
chains in the Genus database with same CATH topology
2QVUA 5IGAA 4O7IA 1FBGA 4MMPA 2HHMA 1FBFA 2FIEA 1NUWA 2DE3A 3U65A 4GX3A 2F3DA 2JJKA 4P1EA 5IZZA 1FBPA 1CNQA 4FBPA 4HE0A 4P1LA 2QPQA 4P8BA 2VPNA 1VDWA 3MSTA 1YYZA 4X9TA 2DE2A 4MNCA 4MJOA 4QXDA 5EYGA 4GWSA 1NUYA 5LDZA 2HZKA 4PBQA 4NN3A 1RDZA 2WX9A 4YICA 2QVVA 1FPEA 5ET6A 3IFAA 5IZ1A 1RDXA 4NGUA 4P56A 1FPIA 3LUZA 2PFYA 4PF8A 2WBBA 4MX6A 4N4UA 4PDDA 1FBEA 4N8GA 2DDKA 2HXRA 4XFEA 2CEXA 5EQ9A 3FBPA 4MEVA 4OVSA 2OX3A 2KR0A 4O94A 4I40A 1FPKA 1AWBA 4KXPA 2XXKA 5IZ3A 3ISPA 4HE2A 3KC1A 3B50A 2XA5A 1KZ8A 2ZZWA 1FPDA 4NX1A 4O7MA 4PAIA 1FJ9A 2P3VA 4N6KA 4XEQA 3RPLA 1K9YA 1LBXA 2PCRA 1FTAA 1FPLA 1NI9A 4GWXA 4GWYA 2DE4A 2WEFA 1NV0A 2F5XA 2F3BA 3NOHA 3RYDA 4GBVA 4JVCA 2Y5LA 1FRPA 2V4CA 5EYHA 2P3NA 2MKZA 3QMFA 5J16A 3GYYA 4AS4A 4H46A 3ROJA 1FJ6A 4OANA 4PFRA 4LN5A 4GBWA 4MAGA 2R8TA 4G61A 2HZLA 4JVDA 2FVZA 2WBDA 2Q74A 4NAPA 2V3QA 4XF5A 3PTYA 1INPA 1NUXA 1SPIA 2GQ1A 4N17A 3W9VA 4DI4B 1LEVA 4F18A 4UABA 1FPFA 5EQ8A 1FPGA 2OWZA 3D1RA 4AS5A 2WYPA 4X04A 1IMFA 4HCYA 1DBZA 1KA0A 3BIGA 4GX4A 2Q8MA 1NV4A 1IMEA 4PGNA 4PCDA 1NV2A 4IR8A 2VT5A 2BJIA 1LBZA 4O8MA 3FXBA 4P9KA 4PAKA 4N15A 3B8BA 4PGPA 1XI6A 4N6DA 1FPJA 2ZZXA 1NV6A 3HFUA 1RDYA 4PFBA 2CZHA 1NV5A 5JK4A 1LBWA 5ET7A 1EYJA 4I3YA 5DW8A 5IM2A 3T1BA 3LV0A 4MNPA 1NUZA 4NF0A 1LBVA 4N81A 4PFIA 5I7IA 4DI3D 5J1DA 1D9QA 5EQAA 5I3SA 4PE3A 4H45A 1IMDA 2XWOA 3MYUA 3A29A 1YZ0A 3CHGA 2ZZVA 4PAFA 4F19A 1FBDA 4OVRA 4MHFA 2FHYA 1YXIA 1QGXA 1NV3A 2PFZA 4QBAA 4HCWA 5ESYA 2XWKA 4GX6A 2B4LA 1K9ZA 4HXVA 4X8RA 2CZIA 5CM6A 2KQZA 1FBHA 4N91A 1DK4A 2QVRA 4MCOA 3E78A 4I3EA 5I5PA 1FPBA 2HPGA 3KC0A 1JP4A 4GWWA 3EKIA 1BK4A 4OA4A 4GWZA 1DCUA 2Q9TA 5F24A 4P3LA 4PDHA 4NHBA 4HE1A 2L5VA 4OVQA 3E79A 2FBPA 3SZPA 1EYKA 1G0IA 1EYIA 2QFLA 5A5LA 1G0HA 4GWUA 4MIJA 1LBYA 4PETA 4F1UA 4PTKA 4N8YA 2Y5KA 4PBHA 4M1VA 4YZZA 1FSAA 3RPLB 3BIHA 2DVZA 4NG7A 4OVPA 1Q9DA 4F1VA 5FBPA 4P47A 5LTCA 2FIXA 1KA1A 5ET5A 5ET8A 2CEYA 4PF6A 2VPOA 2B4MA 3IFCA 1NV1A 3W9WA 2WYKA 4JVIA 5IZ3B 2XWVA 1IMCA 4OVTA 1FBCA 2CZKA 1IMAA 3KBZA 5T3JA 1NV7A 4NQ8A 4PC9A 5EQ7A 2XWIA 4MNIA 3T0JA 1IMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVU A;  4O7I A;  1FBG A;  2HHM A;  1FBF A;  2FIE A;  1NUW A;  4GX3 A;  2F3D A;  2JJK A;  1FBP A;  1CNQ A;  4FBP A;  4HE0 A;  1VDW A;  1YYZ A;  4MJO A;  4QXD A;  5EYG A;  4GWS A;  1NUY A;  5LDZ A;  1RDZ A;  2QVV A;  1FPE A;  5ET6 A;  3IFA A;  5IZ1 A;  1RDX A;  1FPI A;  3LUZ A;  2WBB A;  1FBE A;  2DDK A;  5EQ9 A;  3FBP A;  2OX3 A;  4I40 A;  1FPK A;  1AWB A;  4KXP A;  5IZ3 A;  4HE2 A;  3KC1 A;  1KZ8 A;  1FPD A;  1FJ9 A;  2P3V A;  3RPL A;  1K9Y A;  1LBX A;  2PCR A;  1FTA A;  1FPL A;  1NI9 A;  4GWX A;  4GWY A;  2WEF A;  1NV0 A;  2F3B A;  3RYD A;  4GBV A;  2Y5L A;  1FRP A;  5EYH A;  2P3N A;  3QMF A;  5J16 A;  4AS4 A;  4H46 A;  3ROJ A;  1FJ6 A;  4GBW A;  2R8T A;  4G61 A;  2FVZ A;  2WBD A;  2Q74 A;  1INP A;  1NUX A;  1SPI A;  2GQ1 A;  1LEV A;  1FPF A;  5EQ8 A;  1FPG A;  2OWZ A;  3D1R A;  4AS5 A;  1IMF A;  1DBZ A;  1KA0 A;  3BIG A;  4GX4 A;  2Q8M A;  1NV4 A;  1IME A;  1NV2 A;  4IR8 A;  2VT5 A;  2BJI A;  1LBZ A;  3B8B A;  1XI6 A;  1FPJ A;  1NV6 A;  1RDY A;  2CZH A;  1NV5 A;  1LBW A;  5ET7 A;  1EYJ A;  4I3Y A;  5DW8 A;  3LV0 A;  1NUZ A;  1LBV A;  4N81 A;  1D9Q A;  5EQA A;  5I3S A;  4H45 A;  1IMD A;  3A29 A;  1YZ0 A;  1FBD A;  2FHY A;  1YXI A;  1QGX A;  1NV3 A;  5ESY A;  4GX6 A;  1K9Z A;  4HXV A;  2CZI A;  1FBH A;  1DK4 A;  2QVR A;  4I3E A;  1FPB A;  3KC0 A;  1JP4 A;  4GWW A;  1BK4 A;  4GWZ A;  1DCU A;  5F24 A;  4HE1 A;  2FBP A;  1EYK A;  1G0I A;  1EYI A;  2QFL A;  5A5L A;  1G0H A;  4GWU A;  1LBY A;  4PTK A;  2Y5K A;  1FSA A;  3RPL B;  3BIH A;  1Q9D A;  5FBP A;  2FIX A;  1KA1 A;  5ET5 A;  5ET8 A;  3IFC A;  1NV1 A;  5IZ3 B;  1IMC A;  1FBC A;  2CZK A;  1IMA A;  3KBZ A;  5T3J A;  1NV7 A;  5EQ7 A;  3T0J A;  1IMB A; 
#chains in the Genus database with same CATH topology
 1D9Y A;  5CMK A;  3EPE A;  4RJZ A;  1RYO A;  4MJO A;  1A40 A;  1XHY A;  2ONS A;  4GWS A;  4E0W A;  5ET6 A;  3KOT A;  3U93 A;  3CG3 A;  1QVS A;  2AIX A;  2OBG A;  1B5J A;  4GOT A;  1UIU A;  1B5I A;  3FBP A;  2F7A A;  1LST A;  4OWD A;  4WXJ A;  3HST A;  4AB5 A;  4HE2 A;  5I57 B;  2ZZW A;  2XD2 A;  2ZYN A;  4MBP A;  2RKM A;  2I0B A;  3O2A A;  1NV0 A;  1NMU A;  3RYD A;  1N3X A;  4ECF A;  4JVD A;  4N17 A;  2F34 A;  1MY0 A;  3WAF A;  4DXU A;  4X04 A;  1LBC A;  1FQB A;  5KDT B;  3G3H A;  3TCH A;  2Y7I A;  2ZNS A;  1YTV A;  2F78 A;  1ATG A;  3MP8 A;  3PGF A;  5BUU A;  3RUM A;  1NV5 A;  1SYI A;  2V93 A;  4DI3 D;  1YZ0 A;  5B70 A;  1MPB A;  1QGX A;  5ESY A;  2ZMB A;  1WOD A;  1FPB A;  1MQG A;  3N26 A;  4QFL A;  2QS3 A;  3TYH A;  4GQO A;  4NG7 A;  4DIG A;  5CC2 A;  3T9X B;  5ET8 A;  1XC1 A;  2UXA A;  4G2Z A;  1PBP A;  4LZ8 A;  4G8M A;  4G77 A;  2ZNU A;  2E0S A;  2I4C A;  4GRK A;  1B3F A;  3FVO A;  1IXI A;  4OTE A;  4UAC A;  1MS7 A;  4QXD A;  4GL8 A;  1Y4C A;  4PBQ A;  4UA8 A;  1B1X A;  1JW4 A;  4P56 A;  4NGU A;  4O3C A;  1FPI A;  2WBB A;  3W15 C;  5L9M A;  4NF5 A;  1FQF A;  4DXC A;  1LAH E;  1A7L A;  3RY3 A;  2XXK A;  2RF1 A;  4TLM B;  2PBW A;  3KC1 A;  2NOO A;  3B50 A;  1LCT A;  1MQH A;  3D4G A;  5FHN A;  4PFB A;  1B3E A;  5ICT A;  3O9P A;  3BKI B;  4G61 A;  1IXH A;  4JWY A;  1TXF A;  4OET A;  4PFW A;  3UP9 A;  4OER A;  3VLW A;  1KWH A;  3U1O A;  1LFG A;  2WYP A;  2ZYO A;  1XVY A;  4ELR A;  4PGN A;  1AL3 A;  3USD A;  4IO3 A;  3TZA A;  4PGP A;  2VHA A;  1SD3 A;  1RDY A;  1A99 A;  2Y7W A;  4E0X A;  3KOS A;  2V3U A;  2FNC A;  3CIJ A;  3C9H A;  1I6B A;  2ZZV A;  1H3D A;  2I49 A;  4IB2 A;  1K9Z A;  2QVR A;  4THI A;  3VXB A;  1DCU A;  3R26 A;  3VVE A;  3MQ9 A;  1GR2 A;  1B9J A;  1AIV A;  3PD9 A;  4EF1 A;  2DVZ A;  4IGR A;  1DPP A;  5ET5 A;  1Q35 A;  3Q27 A;  4NF5 B;  2I6E A;  3E9X A;  2XWI A;  2QS2 A;  4KYS A;  4G8H A;  3KSX A;  3Q26 A;  3MST A;  3SDF A;  2OCU A;  4OQO A;  4ESW A;  1SVX B;  5H8N A;  2QL3 A;  1RKM A;  1R6Z A;  1LFH A;  1AOV A;  2PFY A;  1FBE A;  1FQA A;  2DDK A;  1MQD A;  1MPD A;  4OFL A;  3QK6 A;  4JWX A;  2OZZ A;  1FPK A;  1AWB A;  2Y7P A;  1XS5 A;  3PU5 A;  1CB6 A;  2XD3 A;  3CVG A;  2OPD A;  2PYY A;  2P3N A;  5J16 A;  2ZYM A;  1LAX A;  4ELO A;  1FQC A;  3PPP A;  5CMM A;  3FJ7 A;  4KCD A;  2DXR A;  1JEU A;  4X1B A;  2YJP A;  3TUS A;  1IEJ A;  5EQ8 A;  2OLB A;  2Q8M A;  3K6V A;  1B6H A;  5JTY A;  4IO5 A;  5KDT A;  2DQV A;  3IOV A;  3PPR A;  2QMW A;  4X48 A;  5H8H B;  3QIM A;  4NTL A;  4OFJ A;  4GWO A;  3RT6 B;  4PE3 A;  4H45 A;  1ZU0 A;  3CHG A;  3OEM A;  2G93 A;  1BTJ A;  4OVR A;  3IK6 B;  1PC3 A;  1MPC A;  1DK4 A;  3PMW A;  3C31 A;  3K6X A;  2O1M A;  3SZP A;  3MVY A;  4GF8 A;  5A5L A;  1FTK A;  1POT A;  3EN3 A;  4PTK A;  3RPL B;  2WKY A;  4DCY A;  3KN3 A;  3QSL A;  1NV1 A;  3OO9 A;  2XXT A;  1LB9 A;  5I58 A;  4AQ4 A;  3SEX A;  1OMP A;  4ELP A;  1CNQ A;  3ZKK A;  2QPQ A;  4O3B A;  2PMS A;  2Z8F A;  3EHS A;  3L6H A;  1Y9U A;  4HS7 A;  5EYG A;  1A55 A;  4GIZ A;  4LZ5 A;  2WX9 A;  1Y3N A;  1N7W A;  5TP9 B;  4PE5 B;  4H1X A;  1BKA A;  1QKA A;  2B65 A;  3N5L A;  4NF8 B;  3MBP A;  4OYV A;  5EQ9 A;  4F29 A;  4O94 A;  1AMF A;  4MF3 A;  2DXY A;  2D3I A;  3G3F A;  1JVX A;  1I69 A;  5ITP A;  3NOH A;  2CZL A;  3G3K A;  2HFB A;  2I58 A;  3N6T A;  4LN5 A;  4HW8 A;  1M5F A;  3LSF B;  1EH3 A;  4LAT A;  1SPI A;  4EQ7 A;  4NF6 A;  1PB8 A;  3KSJ A;  2THI A;  1LBZ A;  1OLA A;  3TDJ A;  3K2D A;  3KBR A;  1NFT A;  4JB7 A;  4M4G A;  5I84 A;  1LB8 A;  4DCX A;  4NED A;  4H67 A;  1JEV A;  2OK2 A;  1O7T A;  5DT6 A;  3MC2 A;  5AA2 B;  3A09 A;  5DEX A;  1YCJ A;  2Y5K A;  4M1V A;  3C35 A;  3HHF A;  2XX9 A;  3IFC A;  1J1N A;  3W9W A;  2XWV A;  3ILT B;  4RA1 A;  1D3K A;  3KBZ A;  3FV2 A;  1IMB A;  4POW A;  4YB6 A;  4QRZ A;  3N94 A;  5IZZ A;  1JNF A;  1FBP A;  4XXU A;  3PUX E;  2BJJ X;  2Q88 A;  4OEN A;  3O29 A;  4LP2 B;  3THI A;  1OQG A;  1B0L A;  2NVU B;  4MEV A;  3TOD A;  3IR1 A;  5IZ3 A;  4U23 A;  1TFD A;  1FPL A;  5I59 B;  3FV1 A;  3FUZ A;  3T96 B;  1ZTY A;  2R8T A;  1INP A;  2OPE A;  1FPF A;  4C1U A;  1Y20 A;  1DBZ A;  3LSW A;  5HBC A;  3FVK A;  5EHM A;  2YPN A;  4LON B;  5A5X A;  2F6P A;  1USY H;  4O3A A;  3T1B A;  4RK2 A;  4XKR A;  1VR5 A;  3A29 A;  3S9N C;  4NHB A;  4HE1 A;  4JSO A;  3RT8 A;  5AA3 A;  1G0I A;  2HAV A;  1EYI A;  3MUQ A;  3OO7 A;  2VGQ A;  2HEU A;  3TPA A;  5LTC A;  4I8C A;  4LZ7 A;  2UVG A;  3PUY E;  5I2N B;  4ZEB A;  2XXV A;  1P1Q A;  3AXF A;  4OVT A;  4BDL A;  2R6G E;  4JBZ A;  2FIE A;  3UA8 A;  2KLF A;  4EXL A;  4G68 B;  3O6G A;  4Q5T A;  1ZJL A;  4OEV A;  1R9Q A;  2Z8D A;  3SEU A;  4WED A;  2V25 A;  4H0W A;  4C1T A;  3MJN A;  3S4U A;  3O6I A;  2NUV A;  1OVB A;  2RC7 A;  3IFA A;  3E4R A;  1ANF A;  2O51 A;  4R2B A;  5CBR A;  3SEV A;  3K1P A;  1MXZ A;  2RIN A;  4OMB A;  3FJG A;  2F35 A;  1FPD A;  4IY6 A;  2F6G A;  1TFA A;  1YPN A;  3ZKL A;  1LBX A;  4GWY A;  2F36 A;  2ZYK A;  3QMF A;  1FJ6 A;  1GTK A;  4GBW A;  1B0H A;  1QW0 A;  4RY1 A;  1LEV A;  4TLL B;  4H8J A;  3MPK A;  2I3V A;  4PCD A;  2ANJ A;  1FPJ A;  5DVF A;  3T9H B;  3TQL A;  1USY E;  5JK4 A;  4RNS A;  4Q8R A;  2O69 A;  3TTK A;  2XWO A;  3EQ1 A;  3C34 A;  1JW5 A;  2X7P A;  4PFU A;  1BIY A;  5CMC A;  1M5E A;  4JDF A;  1B7U A;  1M5B A;  5FHO A;  5AA4 B;  4R72 A;  1PDA A;  2R71 A;  1IUD A;  1SW1 A;  3S9E A;  5H8Q A;  1H45 A;  4FED A;  5AA1 A;  4NWC A;  4OXV A;  2VPO A;  3VV5 A;  4OEU A;  3H6T A;  3L6G A;  1FBC A;  5EQ7 A;  4R6Y A;  4KI0 E;  3ILU B;  3K1N A;  4GX3 A;  1Z7M E;  4I62 A;  4KPT A;  4ZZA A;  1SYH A;  5DVI A;  4FBP A;  1VE4 A;  3G3I A;  1DMB A;  1ELJ A;  3KG2 A;  2O68 A;  2I3W A;  2DSF A;  4NN3 A;  1II5 A;  3LBS A;  3CFX A;  3IB2 A;  4IO6 A;  3FVG A;  4F3B A;  1LGB C;  2O6A A;  3TTM A;  1GV8 A;  3G3G A;  2QSX A;  3F11 A;  4GWX A;  2DE4 A;  4PF6 A;  2F3B A;  3GXA A;  4IO2 A;  5L9S A;  3HO7 A;  3ROJ A;  1FTJ A;  3H7M A;  1H43 A;  4MAG A;  3M3K A;  3LSL A;  3V83 A;  3SET A;  1B5H A;  3R6U A;  3TCG A;  1MH4 A;  3EHT A;  4NMY A;  3ECR A;  3CG1 A;  3P7I A;  4N6D A;  4N07 A;  4RYA A;  3U72 A;  3S9L C;  1NV6 A;  4DDD A;  4ZEK A;  4PFY A;  3CR9 A;  2XXQ A;  1AH5 A;  4ZE9 A;  2DWA A;  1CE2 A;  3T22 A;  3EF7 A;  3FVN A;  4GWZ A;  2I4B A;  3C4M A;  1P1O A;  5I57 A;  2QFL A;  3HV1 A;  1B4Z A;  4PBH A;  1N84 A;  1Q9D A;  4F39 A;  3TCF A;  4ZEF A;  1URG A;  4DZ1 A;  5I2K A;  2H4I A;  1IMA A;  2HHM A;  2DE3 A;  2HXW A;  3QUF A;  4GXA A;  1POY 1;  4FEC A;  4RPN A;  3K01 A;  4GD5 A;  4R9G A;  2XX8 A;  4LVQ A;  2Z8E A;  3CFZ A;  1B58 A;  2GHB A;  2UVJ A;  3CSB A;  3LUZ A;  4N4U A;  3SEY A;  3O97 A;  4QF9 A;  3RNN A;  4IO7 A;  4GLI A;  4GFR A;  2P2A A;  2RCA A;  5I2K B;  3PUZ E;  5M2V A;  4DE8 A;  5K2X A;  2V4C A;  3GYY A;  2NXO A;  1L5T A;  2DWH A;  1N7X A;  2OWS A;  3TEL A;  4U2R A;  1ZKB A;  3TEP A;  2HQ0 A;  4QSD A;  2OWZ A;  4FJP A;  4RK9 A;  1DTG A;  3BIG A;  3TTN A;  2REJ A;  3K00 A;  4PAK A;  4KQP A;  5F1Q A;  3CI8 A;  3TQW A;  5DW8 A;  2GHA A;  1MDP 1;  3PUW E;  4PFI A;  3PPO A;  1QUK A;  4WKM A;  4U4X A;  3IOR A;  1B2H A;  3KN8 A;  1QUL A;  4GX6 A;  4EQ9 A;  2AYS A;  4MCO A;  3RQT A;  3KZG A;  2L5V A;  4EF2 A;  2ONR A;  1EYK A;  3OD7 A;  4GVO A;  4F1U A;  1MRP A;  1FSA A;  4Q30 B;  1LBB A;  3RPW A;  4I1D A;  1OVT A;  5EYF A;  2CZK A;  5T3J A;  4PC9 A;  3Q25 A;  2QVU A;  1FBF A;  3FAS A;  4BDN A;  3IAZ A;  3U65 A;  4BDM A;  3VDF A;  1YYZ A;  5FTI A;  3OOA A;  5IKB A;  1H76 A;  1B3G A;  3OXN A;  4YAH X;  5CI5 A;  5DVJ A;  2XX7 A;  1FPE A;  4PF8 A;  3ZS6 A;  5CMB A;  4MX6 A;  4PDD A;  3LC8 A;  1UTB B;  2CEX A;  3DM0 A;  4G68 C;  4YKI A;  2QS4 A;  3BFT A;  2KR0 A;  4I40 A;  1XT8 A;  5I56 A;  2F8D A;  3K02 A;  2HAU A;  2F5X A;  4PFT A;  3MZ1 A;  3LUY A;  1PB7 A;  1MG1 A;  3IB0 A;  3PMX A;  5AA4 A;  3IB1 A;  4HTG A;  2O7U A;  4G4P A;  4NAP A;  2Q74 A;  2V3Q A;  3VVF A;  3IOU A;  2XXY A;  2XXP A;  3V8X B;  3TTL A;  3MVW A;  4HCY A;  1FTL A;  1MXU A;  4KR5 A;  1MXY A;  2O7I A;  2BJI A;  4R9F A;  4YMB A;  3B8B A;  1B51 A;  2Q8J A;  4F3S A;  5ITO A;  2Y7R A;  4K3F A;  5KCJ B;  2Q89 A;  4U1O A;  2D21 A;  3KEI A;  4ZDM A;  2CZI A;  1Y3Q A;  2KQZ A;  4POX A;  3R7X A;  1Y4T A;  3H06 B;  3MZ9 A;  4MIJ A;  1MM6 A;  4QFN A;  2XXH A;  2YLN A;  1N04 A;  3OSR A;  4PP0 A;  1A8E A;  1MY4 A;  3RGY A;  5TU0 A;  5AE4 A;  1IIT A;  4Q0C A;  4TOZ A;  1LCF A;  5HM4 B;  3BFU A;  1NH7 A;  3DP6 A;  3TTR A;  4FAT A;  2D5W A;  1B40 A;  2VPN A;  1PB9 A;  1SW5 A;  4NWD A;  1UTH A;  5CRY A;  2HZK A;  2QVV A;  4C0R A;  3FXR A;  3UGW A;  3IJX B;  4EXK A;  1H44 A;  5FTH A;  3GZG A;  3T66 A;  1VSO A;  3UK4 A;  2XA5 A;  1KZ8 A;  3DLN A;  3O28 A;  3VLV A;  5ELV A;  3FZV A;  4RXL A;  1FCK A;  4PAI A;  5I2N A;  4U4S A;  2PX1 A;  3QXM A;  5ICQ A;  4MMP A;  1O64 A;  4ZED A;  2MKZ A;  1MQI A;  4Z7E A;  3MZB A;  5L9O A;  2OJT A;  3D4C A;  2Z22 A;  2VOZ A;  1ZBM A;  3FIR A;  4ZEI A;  1NUX A;  1JQF A;  4UAB A;  2H98 A;  1QKB A;  1JET A;  4U22 A;  2VT5 A;  5A5X B;  3M3F A;  1MY2 A;  4MLQ A;  4ONY A;  1NNF A;  3Q28 A;  2ESN A;  1YAE A;  3H6V A;  4I3Y A;  2H9B A;  5J1D A;  3MYU A;  4ZEC A;  1B05 A;  2DP8 A;  2UYF A;  5HPQ A;  1YXI A;  1MXV A;  3C33 A;  3IX1 A;  1MQJ A;  4I3E A;  4F3G A;  4P3L A;  1BK4 A;  4LQ5 A;  3E3K A;  2UYE A;  4ESX A;  3T9U A;  3MVX A;  1FTO A;  3FJM A;  3QUJ A;  4QFO A;  1B3L A;  1KA1 A;  3FD3 A;  2CEY A;  5KZT A;  4KD5 A;  2WYK A;  1MY3 A;  5I56 B;  4NQ8 A;  3TAJ A;  1UTB A;  1UTH B;  1DSN A;  3CSG A;  1Y1M A;  2JJK A;  2Y7K A;  2A5T B;  3ONM A;  1VDW A;  1UQW A;  1PBQ A;  2GRV A;  2DE2 A;  3QYT A;  3U8Q A;  1Z7N E;  4MFI A;  3B6T A;  4U21 A;  3H6W A;  1BLF A;  3U92 A;  4OVS A;  4LA9 A;  4X1D A;  4JXI A;  4NX1 A;  3MAM A;  3TMG A;  5BWJ A;  1IZ1 A;  1SQY A;  4AB6 A;  4QFP A;  5DEX B;  2PT2 A;  5KCJ A;  3H4Z A;  5L8D A;  3MP6 A;  1IXC A;  4F2Q A;  4XF5 A;  3M8U A;  4F18 A;  1Y3P A;  1FPG A;  3D1R A;  5CBS A;  2I0C A;  4R74 A;  1S50 A;  3RN8 A;  2ABH A;  4P9K A;  1B46 A;  1DOT A;  3K6W A;  1ZLQ A;  3FAT A;  1MH3 A;  3O6H A;  1LBW A;  3LV0 A;  1DTZ A;  1NUZ A;  3LSX A;  4MNP A;  4N81 A;  3UIF A;  1WVJ A;  5EQA A;  3A3C A;  1TT1 A;  1BP5 A;  1SW2 A;  1NV3 A;  3FGS A;  2PFZ A;  4RPO A;  1SDX A;  3V89 B;  4OA4 A;  4KCC A;  1US5 A;  2Q9T A;  1PEB A;  2H5Y A;  3MWB A;  3E79 A;  2FBP A;  4BDR A;  1LBY A;  3CFL A;  4YZZ A;  3VFJ A;  3PV0 E;  4F1V A;  4DXB A;  2V3T A;  1M5D A;  2DWJ A;  4MNI A;  3T0J A;  3RLF E;  5IGA A;  2P0S A;  4NF8 A;  5TP9 A;  3E13 X;  1B52 A;  2X26 A;  3PUV E;  4WEP A;  3TKD A;  4EQB A;  3K0V A;  4L17 A;  4FIM A;  4F22 A;  4N8G A;  3SKP A;  3KJT A;  1P1W A;  3H3G A;  1B3H A;  2ZNT A;  4ZZE A;  2XXU A;  4H5G A;  1B7Z A;  2LAO A;  4N6K A;  1P1N A;  2PCR A;  1NI9 A;  2AL4 A;  4N6P A;  4H6D A;  4JWO A;  4JVC A;  3O66 A;  4AS4 A;  4PFR A;  1SW4 A;  1EZ9 A;  2O84 X;  2DVC A;  5JEI A;  1EZP A;  1HSE A;  3PTY A;  1WDN A;  2O1L A;  1KA0 A;  3PPN A;  3IJO B;  1NH8 A;  2B3B A;  1N0T A;  1IIW A;  5IM2 A;  5JTY B;  5I3S A;  2IA4 A;  3K1M A;  2FHY A;  4FOR A;  4HCW A;  4XKQ A;  3FXQ A;  3V5A A;  4YKJ A;  4OVQ A;  3IO6 A;  4OES A;  4XTC Q;  1N3W A;  4PET A;  4BDQ A;  4OVP A;  4P47 A;  4F2O A;  5F7V A;  4JVI A;  3SEW A;  1LLS A;  1GVC A;  1FTM A;  4ELQ A;  3ODB A;  4MH5 A;  1NUW A;  2CMO A;  3BBR A;  4P1E A;  4H65 A;  3MP1 A;  4ND9 A;  4X9T A;  3RTF B;  4MNC A;  5H8N B;  4YB7 A;  1B4H A;  4H5F A;  3OEL A;  2A5S A;  4BDO A;  3U94 A;  4XFE A;  1NNP A;  1HSL A;  2W7Y A;  1B7H A;  1DPE A;  4O7M A;  4XKN A;  5H8Q B;  1TWY A;  4XEQ A;  2WEF A;  2Y5L A;  1T0K A;  1N76 A;  1XVX A;  1QUI A;  2G29 A;  1MXX A;  4AS5 A;  1IMF A;  2FYI A;  4GX4 A;  1NV4 A;  1P1U A;  4IR8 A;  3CRB A;  1M5C A;  2V84 A;  1S9T A;  2GFE A;  4LQ2 A;  1B1H A;  5I7I A;  3OMB A;  3PPQ A;  2Q2A A;  4G8N A;  3KJ7 A;  4IO4 A;  2P1S A;  1FBH A;  3E78 A;  1EU8 A;  2HPG A;  4IY5 A;  1JP4 A;  3EKI A;  1I6A A;  3JYR A;  3PD8 A;  4I9D A;  1MDQ A;  5ISU A;  1S7Y A;  1JW1 A;  4ISU A;  3IL1 B;  1P99 A;  2REG A;  2VP1 A;  2B4M A;  3UN6 A;  2DWI A;  1IMC A;  4LUB A;  2E1S A;  4O7I A;  1FBG A;  3OO6 A;  1O63 A;  2ONK E;  4P1L A;  1NKX A;  2ZXT A;  3K4U A;  2A5T A;  3JZJ A;  4EDP A;  2RC9 A;  4EUO A;  4QSE A;  2X7Q A;  1RDZ A;  3HCQ A;  3OEK A;  3OSQ A;  3TFL A;  5FHM A;  1IXG A;  4N13 A;  1GGG A;  2OX3 A;  4OHN A;  3EHU A;  3K6U A;  3ISP A;  1URD A;  2OWT A;  4YMA A;  1B32 A;  1FTA A;  1FW0 A;  3DP8 A;  5EYH A;  1F9B A;  1R9L A;  4QHQ A;  3OEN A;  2Y84 A;  3B7D A;  3IOW A;  3C36 A;  3SES A;  1XI6 A;  2QRY A;  2UVI A;  2CZH A;  1A8F A;  2FA7 A;  2XXX A;  1SBP A;  1OQH A;  1IQ7 A;  2UVH A;  2Q2C A;  1LBV A;  1IMD A;  4F19 A;  1FBD A;  4MHF A;  3QAX A;  3G7W A;  4YU0 A;  4HXV A;  5DTB A;  3ZSF A;  1QUJ A;  1OLC A;  3B6W A;  3KC0 A;  4OZ9 A;  4GWW A;  4PDH A;  1US4 A;  3UOR A;  1G0H A;  3BIH A;  1A54 A;  5FBP A;  4YKP A;  2B3F A;  5IZ3 B;  1NV7 A;  1NNT A;  3SER A;  4HE0 A;  4P8B A;  4G68 A;  2ALU A;  4PQJ A;  3KFM A;  4YB5 A;  5IZ1 A;  4MLV A;  2I48 A;  3FXU A;  2HXR A;  4P11 A;  3VE1 B;  3M3L A;  3I6V A;  4KXP A;  1LFI A;  2XXI A;  1MM7 A;  3RTW B;  1R1N A;  4IGT A;  3Q29 A;  4NF4 B;  4GBV A;  2PVU A;  1FRP A;  2DYX A;  1UIV A;  1FQE A;  5H8F A;  2F7C A;  2HZL A;  4NE4 A;  3KN7 A;  2RCB A;  4OFO A;  1IME A;  2Z23 A;  1NV2 A;  4U1Z A;  4O8M A;  4ZS9 A;  1D4N A;  1VFD A;  4BLA A;  4KYE A;  1ZIU A;  1NNK A;  5ET7 A;  1EYJ A;  1ZMG A;  4NF0 A;  1D9Q A;  4F3P A;  1SI0 A;  4QFK A;  4PAF A;  3MPL A;  1MXW A;  4NF6 B;  4QBA A;  2XWK A;  5I5P A;  5I59 A;  2HCA A;  5B7D A;  5F24 A;  1EZO A;  2XXW A;  4P0G A;  4N8Y A;  4FE8 A;  1QJM A;  1VFE A;  4TQU Q;  3PMV A;  3T9V A;  3MVZ A;  3HN0 A;  3WAE A;  2FIX A;  4XIG Q;  3S2V A;  4GL0 A;  4QSC A;  5AA2 D;  2GQ1 A;  3H03 A;  5TPA A;  2VD2 A;  3G3J A;  2NWJ A;  2F3D A;  2QJE A;  3N6U A;  3JV9 A;  1I6Q A;  4KFQ A;  3S9M C;  4GXS B;  5LDZ A;  1NUY A;  1NL5 A;  2H99 A;  4YIC A;  3A3U A;  1RDX A;  2PT1 A;  3GBA A;  5TPA B;  1MY1 A;  5I58 B;  4H8I A;  1LAF E;  1FQD A;  1HSJ A;  1LAG E;  4F31 B;  3MW0 A;  4XKP A;  5AA2 A;  1FJ9 A;  2P3V A;  3RPL A;  1K9Y A;  4FAJ A;  3B6Q A;  3T93 B;  4KYD A;  1Y1Z A;  4R6H A;  4OAN A;  4YKK A;  4H46 A;  2M8C A;  2QS1 A;  3IOT A;  4FEB A;  1Q1K A;  2DOJ A;  3H6U A;  2FVZ A;  2WBD A;  2F7B A;  3W9V A;  4KHZ E;  4DI4 B;  2F97 A;  3I5O A;  3C32 A;  4P0I A;  3KGC A;  4Z0I A;  3GBB A;  5DYH A;  3DP4 A;  4R75 A;  2XHD A;  3VXC A;  2AL5 A;  3I3V A;  2GH9 A;  3FXB A;  4N15 A;  2QMX A;  1OIB A;  3GLB A;  5H8H A;  2ZZX A;  3HFU A;  2DS9 A;  3LR1 A;  3HPI A;  5EHS A;  2RC8 A;  4X8R A;  3OO8 A;  5CM6 A;  2B4L A;  2R9J A;  1JVY A;  5H8S A;  4N91 A;  4R73 A;  1D9V A;  3VVD A;  3IO4 A;  4R2F A;  2XXR A;  4JSD A;  5H8F B;  3HHG A;  4F1Y A;  4R6K A;  4OVJ A;  3VLU A;  4GWU A;  4NF4 A;  5K2Y A;  1SI1 A;  2H25 A;  5LOM A;  2VD3 A;  4DLD A;  2IEE A;  1XOC A;  5IAI A;  1RYX A;  4ZE8 A;  3DEL B;  1URS A; 
#chains in the Genus database with same CATH homology
 2QVU A;  5IGA A;  4O7I A;  1FBG A;  4MMP A;  2HHM A;  1FBF A;  2FIE A;  1NUW A;  2DE3 A;  3U65 A;  4GX3 A;  2F3D A;  2JJK A;  4P1E A;  5IZZ A;  1FBP A;  1CNQ A;  4FBP A;  4HE0 A;  4P1L A;  2QPQ A;  4P8B A;  2VPN A;  1VDW A;  3MST A;  1YYZ A;  4X9T A;  2DE2 A;  4MNC A;  4MJO A;  4QXD A;  5EYG A;  4GWS A;  1NUY A;  5LDZ A;  2HZK A;  4PBQ A;  4NN3 A;  1RDZ A;  2WX9 A;  4YIC A;  2QVV A;  1FPE A;  5ET6 A;  3IFA A;  5IZ1 A;  1RDX A;  4NGU A;  4P56 A;  1FPI A;  3LUZ A;  2PFY A;  4PF8 A;  2WBB A;  4MX6 A;  4N4U A;  4PDD A;  1FBE A;  4N8G A;  2DDK A;  2HXR A;  4XFE A;  2CEX A;  5EQ9 A;  3FBP A;  4MEV A;  4OVS A;  2OX3 A;  2KR0 A;  4O94 A;  4I40 A;  1FPK A;  1AWB A;  4KXP A;  2XXK A;  5IZ3 A;  3ISP A;  4HE2 A;  3KC1 A;  3B50 A;  2XA5 A;  1KZ8 A;  2ZZW A;  1FPD A;  4NX1 A;  4O7M A;  4PAI A;  1FJ9 A;  2P3V A;  4N6K A;  4XEQ A;  3RPL A;  1K9Y A;  1LBX A;  2PCR A;  1FTA A;  1FPL A;  1NI9 A;  4GWX A;  4GWY A;  2DE4 A;  2WEF A;  1NV0 A;  2F5X A;  2F3B A;  3NOH A;  3RYD A;  4GBV A;  4JVC A;  2Y5L A;  1FRP A;  2V4C A;  5EYH A;  2P3N A;  2MKZ A;  3QMF A;  5J16 A;  3GYY A;  4AS4 A;  4H46 A;  3ROJ A;  1FJ6 A;  4OAN A;  4PFR A;  4LN5 A;  4GBW A;  4MAG A;  2R8T A;  4G61 A;  2HZL A;  4JVD A;  2FVZ A;  2WBD A;  2Q74 A;  4NAP A;  2V3Q A;  4XF5 A;  3PTY A;  1INP A;  1NUX A;  1SPI A;  2GQ1 A;  4N17 A;  3W9V A;  4DI4 B;  1LEV A;  4F18 A;  4UAB A;  1FPF A;  5EQ8 A;  1FPG A;  2OWZ A;  3D1R A;  4AS5 A;  2WYP A;  4X04 A;  1IMF A;  4HCY A;  1DBZ A;  1KA0 A;  3BIG A;  4GX4 A;  2Q8M A;  1NV4 A;  1IME A;  4PGN A;  4PCD A;  1NV2 A;  4IR8 A;  2VT5 A;  2BJI A;  1LBZ A;  4O8M A;  3FXB A;  4P9K A;  4PAK A;  4N15 A;  3B8B A;  4PGP A;  1XI6 A;  4N6D A;  1FPJ A;  2ZZX A;  1NV6 A;  3HFU A;  1RDY A;  4PFB A;  2CZH A;  1NV5 A;  5JK4 A;  1LBW A;  5ET7 A;  1EYJ A;  4I3Y A;  5DW8 A;  5IM2 A;  3T1B A;  3LV0 A;  4MNP A;  1NUZ A;  4NF0 A;  1LBV A;  4N81 A;  4PFI A;  5I7I A;  4DI3 D;  5J1D A;  1D9Q A;  5EQA A;  5I3S A;  4PE3 A;  4H45 A;  1IMD A;  2XWO A;  3MYU A;  3A29 A;  1YZ0 A;  3CHG A;  2ZZV A;  4PAF A;  4F19 A;  1FBD A;  4OVR A;  4MHF A;  2FHY A;  1YXI A;  1QGX A;  1NV3 A;  2PFZ A;  4QBA A;  4HCW A;  5ESY A;  2XWK A;  4GX6 A;  2B4L A;  1K9Z A;  4HXV A;  4X8R A;  2CZI A;  5CM6 A;  2KQZ A;  1FBH A;  4N91 A;  1DK4 A;  2QVR A;  4MCO A;  3E78 A;  4I3E A;  5I5P A;  1FPB A;  2HPG A;  3KC0 A;  1JP4 A;  4GWW A;  3EKI A;  1BK4 A;  4OA4 A;  4GWZ A;  1DCU A;  2Q9T A;  5F24 A;  4P3L A;  4PDH A;  4NHB A;  4HE1 A;  2L5V A;  4OVQ A;  3E79 A;  2FBP A;  3SZP A;  1EYK A;  1G0I A;  1EYI A;  2QFL A;  5A5L A;  1G0H A;  4GWU A;  4MIJ A;  1LBY A;  4PET A;  4F1U A;  4PTK A;  4N8Y A;  2Y5K A;  4PBH A;  4M1V A;  4YZZ A;  1FSA A;  3RPL B;  3BIH A;  2DVZ A;  4NG7 A;  4OVP A;  1Q9D A;  4F1V A;  5FBP A;  4P47 A;  5LTC A;  2FIX A;  1KA1 A;  5ET5 A;  5ET8 A;  2CEY A;  4PF6 A;  2VPO A;  2B4M A;  3IFC A;  1NV1 A;  3W9W A;  2WYK A;  4JVI A;  5IZ3 B;  2XWV A;  1IMC A;  4OVT A;  1FBC A;  2CZK A;  1IMA A;  3KBZ A;  5T3J A;  1NV7 A;  4NQ8 A;  4PC9 A;  5EQ7 A;  2XWI A;  4MNI A;  3T0J A;  1IMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...