3LUZA

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
238
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEDYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extragenic suppressor protein suhB
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Hydrolase
total genus 78
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3luzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3luzA02
1NV6A 1YZ0A 1NI9A 4GWUA 1RDYA 1FJ6A 5I3SA 1NV4A 1LBXA 2WEFA 1G0HA 1EYKA 3KBZA 1VDWA 3LV0A 1IMEA 1LEVA 1NUWA 3RPLB 2P3VA 2FHYA 1NV7A 5A5LA 2CZHA 1YXIA 3B8BA 5T3JA 2FBPA 2FIEA 1G0IA 4PTKA 2WBDA 1RDXA 5ET8A 1Q9DA 1IMCA 3FBPA 1K9ZA 3KC0A 1FJ9A 3D1RA 5ESYA 1SPIA 4H46A 1FBHA 3IFAA 4HXVA 4GX3A 4FBPA 1NUZA 4O7IA 1NV0A 2F3BA 1CNQA 2FVZA 4MJOA 1FPJA 1LBYA 2FIXA 4HE2A 2Q74A 3BIGA 1KZ8A 1FBPA 1IMDA 4AS4A 2VT5A 4G61A 5ET5A 5ET6A 2R8TA 1FPGA 1FTAA 1FBDA 5IZ3B 3RPLA 5EYHA 4GWSA 3ROJA 2GQ1A 1FBCA 1DK4A 1FPIA 1D9QA 3IFCA 2QVRA 4GBVA 5EQ7A 4GX6A 5J16A 4HE1A 2OWZA 2P3NA 1NV1A 2QFLA 1FPDA 4H45A 2OX3A 3KC1A 1FPEA 2Y5KA 1FBGA 1QGXA 4GBWA 1DBZA 2F3DA 4QXDA 3T0JA 5EQ9A 1XI6A 5DW8A 5IZ1A 1FPBA 5ET7A 1YYZA 5F24A 2HHMA 3LUZA 2CZKA 1AWBA 1NV2A 3BIHA 1FBEA 1JP4A 1NV5A 1LBZA 4GWYA 4I3YA 3RYDA 2JJKA 5EYGA 1BK4A 2CZIA 5IZ3A 1FPKA 1IMBA 1IMFA 5LDZA 5FBPA 1K9YA 4GX4A 4N81A 1KA0A 3A29A 2QVUA 1DCUA 1NV3A 1KA1A 1INPA 2Q8MA 1RDZA 4GWXA 2PCRA 3QMFA 1LBVA 4I3EA 4KXPA 4IR8A 4HE0A 4I40A 5EQAA 2Y5LA 1IMAA 1FRPA 1FPFA 4GWWA 1EYIA 2DDKA 1EYJA 2QVVA 2BJIA 1FPLA 1FSAA 1FBFA 5EQ8A 2WBBA 1NUXA 1NUYA 4AS5A 1LBWA 4GWZA
chains in the Genus database with same CATH superfamily
4JVDA 2AL5A 3TDJA 2VPOA 1XS5A 2V3QA 4ECFA 4DLDA 3KBZA 1VDWA 4P1LA 2F36A 1B51A 1B3EA 3UGWA 3QUFA 2X26A 3VDFA 3O29A 4ZECA 2QSXA 2YPNA 1UTHA 1LBYA 3OO8A 1DMBA 4PFIA 2F34A 1F9BA 2VT5A 4PAKA 4F3SA 5ET5A 5ET6A 4KHZE 3WAEA 4G77A 2Y7PA 4LONB 4NF4B 3TZAA 3VLVA 1PB9A 5K2XA 3RUMA 3KJ7A 4R2FA 2VGQA 4GBVA 4R6KA 1AH5A 3OO9A 4TLLB 3P7IA 3W15C 2DP8A 1FBGA 4QXDA 5EQ9A 2NXOA 3TCFA 3N5LA 2XWVA 4PDHA 3I6VA 3UA8A 3Q25A 4NF5B 3BIHA 5H8QB 1BLFA 3LSXA 1FTJA 3RYDA 1MXYA 5EYGA 4KYEA 4R72A 3IJOB 4WEPA 2NWJA 4OQOA 1DCUA 1D9VA 4WXJA 2V4CA 4I8CA 3EKIA 1POY1 4GRKA 1IMAA 2F8DA 2OJTA 4XKPA 4GWWA 1EYIA 4HCYA 3CFXA 1A8EA 4MIJA 5K2YA 3SERA 1MXUA 3KN8A 3VE1B 1MH3A 4RYAA 4OFOA 3CFLA 1HSJA 2E0SA 4PAIA 5CRYA 3RT6B 4GF8A 1M5FA 3PMWA 1B1XA 4PTKA 2REJA 3SEVA 3MSTA 4H46A 4YMBA 4H8IA 4GD5A 1FQBA 2XD2A 4WKMA 3TTKA 5DEXA 4EXKA 3FXQA 1SQYA 1UIVA 2A5TB 2YJPA 1N0TA 2I58A 4BDNA 2LAOA 2R8TA 3RPLA 4MMPA 3ZS6A 4P0GA 4R73A 1NH8A 3OO6A 3MBPA 2XXWA 1P1UA 1LB8A 4NHBA 2NOOA 1B5IA 4PGPA 1QGXA 2F3DA 2W7YA 3H7MA 1DSNA 2CEXA 2DXRA 2YLNA 4PBHA 5F1QA 1JP4A 5EHSA 1LFIA 2CZIA 2DQVA 1B52A 3D4CA 2V3UA 3FASA 1I6AA 1A8FA 3SDFA 3MJNA 4YB7A 2I3WA 1EZPA 3C9HA 1A54A 4F1YA 5EQAA 2QS3A 5CI5A 4KFQA 3MZ1A 1BKAA 3FD3A 1MM6A 1FBFA 2HAUA 2PMSA 1AMFA 4RJZA 4C1UA 3GBAA 4N07A 1A40A 5A5LA 4OEUA 3B8BA 1ZJLA 4XFEA 1PBPA 4XXUA 3JV9A 1EZ9A 3TTRA 3TTNA 5BWJA 3IB2A 1IQ7A 3S2VA 4YKIA 3OEMA 4U2RA 1CNQA 1A7LA 4G68C 3GYYA 3TCGA 4O7MA 3QIMA 5F7VA 3O6IA 5LTCA 2MKZA 5IM2A 4JWOA 1FBPA 5CC2A 3MVXA 5AA1A 3RT8A 3PPPA 4F3GA 2UVIA 2Z22A 3HPIA 1A99A 4PE5B 4POXA 1WODA 5I56A 1XI6A 5IZZA 4FE8A 5F24A 3W9WA 3ODBA 2HQ0A 4PFYA 5DVJA 4YZZA 2XWKA 5DVFA 4I3YA 2F97A 2O1MA 1B1HA 3MP1A 3PPOA 4F2QA 3A29A 4F3PA 4H1XA 5ICQA 2Q8MA 2H99A 4P1EA 4OENA 5I57A 1P1OA 4N91A 1SYHA 2HPGA 2QS1A 3M3FA 3V5AA 5EHMA 4M1VA 3FVNA 2XXKA 5I3SA 1NV4A 2VP1A 3TAJA 3SEXA 4FIMA 3RGYA 4LQ5A 1O64A 3PPRA 3B6QA 3UN6A 1P1QA 3KN7A 4Z7EA 4OESA 2RC9A 1K9ZA 2ONKE 2F5XA 2NUVA 3B7DA 3G3JA 4OXVA 2DYXA 2RC8A 3H03A 2ZNUA 4F39A 2OCUA 3E78A 1B3LA 1S9TA 2GFEA 1QUKA 4OANA 1JQFA 3RN8A 3TKDA 2UVHA 1WDNA 1B7HA 5JEIA 4MFIA 2QS4A 4HCWA 3G3IA 2I49A 4ELPA 5LOMA 5HPQA 2THIA 5L9MA 3ZKKA 3IK6B 3FATA 1Q1KA 5A5XA 1FPEA 1GVCA 4I62A 4IO7A 1DBZA 3NOHA 3G3HA 2VD2A 4KYDA 4YB5A 2HHMA 3S9LC 1AWBA 2XXYA 3K6XA 1NV5A 3IOVA 4Q8RA 3T1BA 4OZ9A 2DS9A 3KOTA 2Z8EA 3PUWE 1LAGE 3RTFB 3O66A 1H43A 5IGAA 3L6GA 1LAHE 1AIVA 3QMFA 1LBVA 3PMXA 4ZZEA 3FVKA 1H3DA 3G7WA 2WYPA 5H8NA 1OLCA 2XWOA 4OFLA 3G3KA 2L5VA 3SKPA 4IO4A 2PT2A 3ECRA 1RDYA 3H4ZA 2F6PA 2DWIA 2UYFA 1L5TA 3SEUA 4DE8A 1P1NA 4JDFA 5DYHA 5AA3A 4ONYA 5HM4B 5TPAA 5IKBA 2FVZA 2XXHA 4OTEA 2Q74A 4HTGA 2D21A 1B4HA 1VFDA 4MH5A 1MQDA 4KYSA 2Y7RA 1BIYA 4Q0CA 1OQHA 1QVSA 4K3FA 5I58B 2HEUA 2HZKA 2AL4A 3OELA 4GVOA 3EN3A 4N6KA 4GBWA 3FUZA 1YYZA 3KOSA 2ZZVA 2V93A 3HO7A 4QHQA 1AL3A 3MVZA 5FTIA 1NNFA 4YKJA 1QULA 1B0LA 1LGBC 3SESA 5L9SA 3VXBA 3TYHA 4ELQA 4N4UA 1FQFA 4OFJA 3CVGA 3AXFA 2QMXA 4BDMA 2PCRA 3V89B 1QUJA 4EUOA 1B9JA 3LSLA 4AS5A 1ZTYA 1O63A 5AA4A 4GWUA 4PF6A 4O8MA 4MAGA 1LBXA 1B5HA 5CM6A 4F3BA 3KG2A 3FV2A 3PUYE 3DM0A 2O51A 3RPLB 3R7XA 1RYOA 4RNSA 2CZHA 5T3JA 4P47A 2P2AA 1URSA 4IGRA 1JETA 4X1BA 3CR9A 1FQCA 4ZEFA 3HSTA 4GLIA 5ET8A 2V84A 3HFUA 3K4UA 4AQ4A 1N3WA 3MPKA 4NEDA 2DXYA 2O69A 1FW0A 1Y1MA 3TFLA 3BIGA 4OMBA 4ZEKA 4R75A 2Y7KA 1LBBA 4DI3D 3FZVA 4P11A 2Z8FA 1FBCA 1JNFA 1SYIA 1JW1A 2DVZA 3N26A 1D9QA 1B3FA 2RC7A 4LZ5A 5I59A 1XT8A 2ZZXA 1DTZA 1BTJA 2VPNA 2QJEA 4LN5A 2OZZA 3DP6A 1I6BA 3CG1A 3K1NA 1OVBA 2IA4A 3C35A 3TODA 1NV2A 2ALUA 3MC2A 1S7YA 4RPNA 1IEJA 5J1DA 3A3UA 3OO7A 4Q30B 1SW2A 2XXIA 3IOUA 4U1ZA 3H6UA 1XVXA 1LCFA 3UP9A 2QVUA 3H6TA 4EQ9A 1B32A 2REGA 3CRBA 2DE3A 3DP8A 2F7CA 3V83A 1PB7A 4HE0A 1ZLQA 4KCDA 2Y5LA 2I3VA 4KPTA 5FTHA 1CB6A 4PE3A 1FPLA 1YPNA 5H8FA 1URGA 4GXAA 3E79A 1IUDA 4H65A 1JW5A 2UXAA 2DE2A 1SW5A 5H8HA 3EHUA 3M3KA 2GHBA 2DWJA 3TELA 2XXRA 4G68B 1B5JA 3IX1A 4U21A 4LA9A 1Q9DA 1SW1A 3SZPA 1MXXA 2PBWA 1N76A 2OWSA 4YICA 1MG1A 1GGGA 1NUZA 5I56B 4ESXA 3OMBA 3N94A 3VLWA 1NNPA 3T93B 5AA2B 4QFLA 2I0BA 1T0KA 2PX1A 3UIFA 1D3KA 3KBRA 3S9EA 4NF6A 4XKRA 1EH3A 1OQGA 1US5A 1FPIA 1FQDA 1B3GA 2O84X 5I57B 2OX3A 3I3VA 1MPBA 2O1LA 4P8BA 5I2KA 2ZYMA 5ET7A 5FHMA 3A3CA 1Y9UA 4OWDA 5JTYA 2DSFA 2CZKA 5M2VA 1MY3A 1FBEA 4JBZA 1LBZA 3IOTA 1NH7A 1ANFA 4H5GA 1FPKA 1IMBA 2GHAA 1UTBA 3N6UA 3TTLA 3U8QA 4NX1A 4AB5A 3C36A 5B70A 4LATA 4LZ7A 1XOCA 1I69A 3RTWB 3B6TA 3KFMA 2WBBA 4Q5TA 3C33A 4P56A 2OPEA 2O7UA 3FXRA 3C4MA 2B4MA 3F11A 5CBRA 4L17A 5CMMA 4MHFA 4P3LA 1AOVA 2ANJA 4N8YA 5ESYA 3PTYA 1FBHA 4HXVA 1FTKA 1MQIA 2DWHA 4P9KA 2B4LA 3VLUA 3B6WA 3CHGA 4EXLA 3HN0A 4OEVA 4ZE9A 4OVSA 3KGCA 1ZIUA 1A55A 3O6GA 1M5EA 1FPGA 4GWSA 4IO6A 3PGFA 4NWDA 2XX8A 1USYE 4PDDA 4MBPA 3OSRA 5BUUA 3BFTA 1NV1A 1FPDA 4XIGQ 3KC1A 1Y3QA 3QK6A 3Q29A 3JYRA 2HXWA 3TEPA 1FPBA 3MP6A 3TPAA 1N3XA 5H8NB 4H6DA 4I9DA 2I4BA 3V8XB 5L9OA 4GWYA 4OYVA 4RY1A 5IZ3A 2ZXTA 2Y84A 4PGNA 1J1NA 1RDZA 1SBPA 3MZ9A 3OEKA 1US4A 4G8NA 3E4RA 3MVWA 4PP0A 5TPAB 5ICTA 3I5OA 4PCDA 2H25A 1FPFA 1DPPA 4FORA 1IXHA 3FJGA 4JWYA 5CMCA 2QVVA 3OSQA 5KDTB 1FCKA 4GQOA 1NI9A 1GTKA 2ONRA 4R6YA 1ELJA 4FEDA 1EYKA 1MXVA 1B7ZA 1IMEA 2AIXA 3Q27A 4AB6A 2QPQA 4F31B 4PFBA 4X8RA 3FBPA 4F18A 4G8MA 4GL8A 3IFAA 2NVUB 1M5DA 3QSLA 1SW4A 1MDP1 1R9LA 2P0SA 4OVJA 1IZ1A 4IY6A 4NMYA 2UYEA 1PC3A 3QYTA 4JSDA 4AS4A 5I2NA 2A5TA 2G93A 1P1WA 3M3LA 3K2DA 4MNIA 3ROJA 2FNCA 3Q26A 5ELVA 3SEYA 2I6EA 4R9FA 4FAJA 4E0XA 2QVRA 1YAEA 1MQGA 1FTLA 3VXCA 2H5YA 4QRZA 4EF1A 1PEBA 3IO6A 5IAIA 4ZDMA 4GWOA 1QKBA 1GR2A 3HHGA 4X04A 2RKMA 4R9GA 2H98A 4NF8A 1LAFE 4RK9A 2F7AA 2HFBA 2O6AA 4QFOA 2KQZA 3LR1A 3E3KA 5CBSA 3MP8A 2PYYA 3PV0E 3MYUA 3C34A 2B65A 2O7IA 4F22A 1BP5A 4LZ8A 3H6VA 1MRPA 5AA2D 2CEYA 3LSWA 1ZMGA 4OHNA 3T9XB 3IR1A 2QL3A 5AE4A 1JVXA 5I7IA 3TMGA 2WX9A 3FXBA 5JK4A 2D5WA 3S9MC 3RPWA 5TP9A 1MDQA 3H06B 1G0IA 4XEQA 1LLSA 5H8SA 4F29A 4OETA 2OBGA 4PF8A 3IB0A 1UTHB 4ZEBA 1ZKBA 4QSEA 3PUZE 2FIXA 3T9VA 4KR5A 4TLMB 3MUQA 2A5SA 4KQPA 1KWHA 4JWXA 1NKXA 2GQ1A 2XD3A 2ABHA 3IFCA 5J16A 2ZNTA 4H45A 2PFYA 3U94A 4N13A 2VHAA 3L6HA 4PETA 2Q2CA 3T0JA 4KD5A 1SVXB 2QMWA 2V3TA 1Z7NE 2BJJX 3SETA 1LFHA 3KN3A 1SI0A 5H8FB 1EZOA 2WYKA 2P1SA 3O97A 4XKQA 1OMPA 1R9QA 5H8HB 4NAPA 5FHOA 2R9JA 5FBPA 2F7BA 3K01A 4N6DA 1VE4A 2F35A 2V25A 1KA1A 3G3FA 1POTA 4TOZA 4XF5A 3FXUA 4BDQA 3BFUA 1LFGA 4FECA 3MQ9A 2DDKA 4F1UA 4H0WA 3FIRA 2X7PA 2ZNSA 1IIWA 3LSFB 1IXCA 1XVYA 4BDLA 1O7TA 2P3VA 3PD9A 4NG7A 2PT1A 3OD7A 1MY1A 2ONSA 2PFZA 3IB1A 1IXGA 3MAMA 4EDPA 4G4PA 1LSTA 3OOAA 4NQ8A 5DEXB 3K02A 2F3BA 3ILTB 4OERA 1FTOA 1FPJA 4OVTA 1B05A 3H6WA 4RK2A 4THIA 1KZ8A 5KZTA 4P0IA 4LQ2A 3K1PA 4JVCA 1MQJA 1FBDA 2H4IA 4JSOA 5EYHA 4GL0A 3JZJA 4FJPA 5TU0A 4X48A 1Y3PA 1MY4A 4O3CA 2OWZA 2UVGA 1MQHA 4F1VA 3GXAA 1VFEA 5DW8A 3K6WA 3FGSA 1PBQA 4GFRA 4PFTA 4U1OA 3CIJA 3VFJA 4YKPA 3LBSA 2XXPA 1K9YA 4MCOA 3T9HB 2Q2AA 1KA0A 2I0CA 1INPA 3IL1B 3FVGA 2QS2A 3E9XA 1N7XA 4IR8A 3LC8A 3Q28A 2XWIA 2ZYKA 3PU5A 1QJMA 2XXXA 4NGUA 1HSEA 1B6HA 4X9TA 1HSLA 3EQ1A 1FSAA 1URDA 4LP2B 4QFKA 4ZE8A 3K1MA 3GLBA 2WKYA 4QSCA 2FHYA 4IY5A 4C1TA 2FIEA 5KCJA 4H8JA 4DZ1A 3KC0A 5I5PA 1NNTA 3EHTA 1D4NA 4U23A 4WEDA 4FBPA 4O7IA 1SI1A 3VVDA 4MJOA 2X7QA 3ILUB 2OK2A 3EPEA 2HAVA 4R6HA 3TQLA 1Y4TA 1FTAA 5IZ3B 2O68A 3W9VA 3K0VA 4MX6A 4N17A 1M5CA 3QXMA 1SD3A 4ELRA 4Z0IA 2FA7A 5I58A 4HE1A 1P99A 1LBCA 4DCYA 2QFLA 1JEUA 1MM7A 4U22A 3T96B 1S50A 1DPEA 3U92A 3VVEA 4DIGA 4ELOA 4ZEIA 4EQ7A 3PPNA 1N7WA 3O2AA 3IAZA 1TFDA 1H45A 3RNNA 3RQTA 2GRVA 3U72A 2IEEA 4N81A 2FYIA 4QSDA 4IB2A 4MLVA 1Y3NA 4PAFA 4KXPA 3LUYA 1XHYA 4H67A 4YB6A 4O3BA 1FRPA 3UORA 5DTBA 3U93A 2BJIA 3EHSA 3IO4A 3QUJA 1LB9A 3MWBA 3HHFA 4H5FA 2G29A 1DTGA 4RPOA 1NL5A 4RXLA 1G0HA 5I2NB 4RA1A 3O28A 3IOWA 1B4ZA 2AYSA 3B50A 1NV7A 3UK4A 2H9BA 3FVOA 4U4XA 1ZU0A 2I4CA 3KJTA 1MY2A 1RDXA 2RCAA 3T9UA 3PPQA 3KSXA 3A09A 3FV1A 3D1RA 1SPIA 1MY0A 3O6HA 1NNKA 3MZBA 3PUXE 1FQEA 4IO3A 1IXIA 1Y20A 4O94A 1VR5A 2CZLA 1RYXA 1OVTA 4F19A 3OXNA 2Z8DA 4NF8B 4IO5A 5ITOA 4YMAA 3FJMA 4ESWA 1QKAA 3BKIB 4NE4A 3HV1A 5A5XB 1XC1A 1JW4A 3TTMA 1TT1A 1B3HA 1II5A 1JEVA 2M8CA 2HCAA 2OLBA 2XXTA 4FATA 4PFWA 2XXQA 3IORA 2UVJA 2JJKA 1YCJA 4DXBA 3KZGA 4NF4A 5B7DA 1WVJA 5LDZA 3CI8A 4EF2A 1QUIA 5TP9B 1JVYA 3N6TA 2HXRA 4R2BA 3BBRA 4XTCQ 5FHNA 2OWTA 4JXIA 5DT6A 5DVIA 4NF5A 5EQ8A 2HZLA 1NUXA 5H8QA 1B40A 1YZ0A 2ZYNA 2OPDA 4POWA 2ZYOA 3GBBA 1FTMA 1Y1ZA 1B2HA 4UABA 2Y7WA 2FBPA 3U65A 4M4GA 1B46A 1IMCA 4G68A 4F2OA 4IGTA 1LAXA 2Y7IA 3R26A 4KI0E 4OA4A 2B3FA 3M8UA 4LVQA 2VOZA 4OVPA 1SDXA 3MPLA 2ZMBA 5L8DA 3CSBA 4BDOA 5AA2A 4NWCA 3ONMA 2E1SA 1DOTA 3TCHA 3FJ7A 3ZKLA 1PDAA 5EQ7A 1M5BA 3IJXB 3O9PA 1GV8A 1D9YA 3PUVE 4XKNA 3K6VA 1QW0A 4PFRA 3DELB 4ZS9A 3KEIA 5ITPA 3H3GA 3U1OA 4N6PA 4PC9A 3ISPA 4R74A 4MLQA 4GOTA 2DWAA 2XHDA 4DDDA 3OENA 4QBAA 1I6QA 4YAHX 4N15A 3R6UA 1MXZA 1MXWA 2DVCA 1NV3A 3T66A 4QFPA 2KLFA 2R71A 4JB7A 3CG3A 2ESNA 4I40A 4BLAA 1FQAA 3TUSA 5I84A 4DI4B 3ZSFA 5AA4B 1EU8A 1H76A 1Q35A 4QF9A 4MF3A 1NUYA 1LBWA 4NF0A 1RKMA 3K6UA 4G2ZA 4UA8A 3LV0A 2RF1A 1LEVA 1NUWA 2XXVA 1UQWA 4OVQA 4YKKA 4HS7A 3EF7A 4PFUA 4LUBA 2DOJA 4KCCA 3TQWA 4U4SA 4DCXA 4GX3A 4MEVA 2VD3A 1Y4CA 4EQBA 4FEBA 1IMDA 4G61A 1CE2A 1OIBA 5CMBA 4X1DA 1TXFA 5I59B 3DLNA 4GX6A 3USDA 5HBCA 4ISUA 2P3NA 2F6GA 1NMUA 3MW0A 4GXSB 1R6ZA 2KR0A 4MNCA 5IZ1A 2Q9TA 2XX7A 3T22A 3S9NC 3RY3A 4NN3A 4DXUA 4DXCA 1IMFA 4ZEDA 4QFNA 1USYH 3CSGA 3HCQA 2RINA 4GX4A 4BDRA 1B58A 5KCJB 1NFTA 4GWXA 3C32A 4I3EA 4HW8A 3MVYA 4TQUQ 3CFZA 4O3AA 4UACA 1MPCA 1NV6A 1LCTA 4GIZA 2RCBA 3K00A 1FJ6A 2WEFA 5KDTA 4PQJA 1TFAA 1YXIA 5EYFA 2R6GE 3KSJA 2WBDA 1MH4A 2D3IA 1FJ9A 1VSOA 2F78A 3S4UA 5CMKA 3G3GA 1NV0A 3DP4A 5ISUA 4JVIA 4N8GA 1N84A 4ND9A 4HE2A 1MPDA 1MS7A 3C31A 3D4GA 2Q8JA 4NF6B 1TWYA 2I48A 1B0HA 4PBQA 1ZBMA 1UIUA 2XA5A 4I1DA 1OLAA 1DK4A 3RLFE 1ATGA 5I2KB 1YTVA 3VV5A 2Y5KA 2B3BA 2GH9A 2QRYA 4OVRA 4MNPA 5JTYB 2DE4A 2PVUA 1H44A 1Z7ME 3LUZA 3THIA 3PMVA 3VVFA 3GZGA 4IO2A 2CMOA 1BK4A 1UTBB 2Z23A 2Q89A 3PD8A 4ZZAA 3E13X 1N04A 2ZZWA 2Q88A 3SEWA 4G8HA 2XXUA 1IITA 1R1NA 3WAFA 2XX9A 4NTLA 4YU0A 1B7UA 1EYJA 3QAXA 4E0WA 1PB8A 4C0RA 4GWZA
chains in the Genus database with same CATH topology
4JVDA 1NI9A 2VPOA 2V3QA 1RDYA 1G0HA 1EYKA 3KBZA 1VDWA 1IMEA 4P1LA 3B50A 1NV7A 2QPQA 1RDXA 4PFBA 4X8RA 3FBPA 3D1RA 1SPIA 4F18A 3IFAA 2FVZA 1LBYA 4O94A 2Q74A 4F19A 4PFIA 4AS4A 2VT5A 4PAKA 5ET5A 5ET6A 4MNIA 3ROJA 2HZKA 4GBVA 2QVRA 4N6KA 1FBGA 4GBWA 4QXDA 5EQ9A 1YYZA 2XWVA 4PDHA 4X04A 2ZZVA 3BIHA 3RYDA 2JJKA 5EYGA 2KQZA 5LDZA 3MYUA 4N4UA 1DCUA 2HXRA 2V4CA 2PCRA 3EKIA 2CEYA 1IMAA 4GWWA 1EYIA 4HCYA 5EQ8A 4AS5A 2HZLA 1NUXA 5I7IA 4MIJA 1YZ0A 4GWUA 2WX9A 4PF6A 4O8MA 4MAGA 1LBXA 5CM6A 3FXBA 5JK4A 4PAIA 3RPLB 2CZHA 5T3JA 4P47A 4UABA 3U65A 2FBPA 1G0IA 4PTKA 4XEQA 5ET8A 1IMCA 3HFUA 3MSTA 4H46A 4PF8A 4OA4A 2FIXA 4OVPA 3BIGA 4DI3D 2R8TA 3RPLA 4MMPA 2GQ1A 1FBCA 2DVZA 1D9QA 3IFCA 5EQ7A 5J16A 4NHBA 4H45A 2PFYA 2ZZXA 4PETA 4PGPA 2VPNA 1QGXA 2F3DA 4LN5A 3T0JA 4PFRA 2CEXA 1NV2A 4PBHA 4PC9A 3ISPA 1JP4A 5J1DA 2CZIA 2WYKA 4QBAA 4NAPA 4N15A 5FBPA 4N6DA 2QVUA 1NV3A 1KA1A 2DE3A 4XF5A 4HE0A 4I40A 5EQAA 2Y5LA 2DDKA 4DI4B 4F1UA 4PE3A 1FPLA 1FBFA 1NUYA 1LBWA 4NF0A 3E79A 2DE2A 3LV0A 1LEVA 1NUWA 2P3VA 5A5LA 3B8BA 4NG7A 4OVQA 4XFEA 2PFZA 1Q9DA 3SZPA 4NQ8A 4GX3A 4YICA 1NUZA 2F3BA 1CNQA 4MEVA 3GYYA 4O7MA 1FPJA 4OVTA 5LTCA 2MKZA 1KZ8A 5IM2A 1FBPA 1IMDA 4G61A 4JVCA 1FBDA 5EYHA 1FPIA 4GX6A 2OWZA 2P3NA 2OX3A 4F1VA 4P8BA 2KR0A 4MNCA 1XI6A 5DW8A 5IZ1A 5IZZA 5ET7A 5F24A 2Q9TA 3W9WA 2CZKA 1FBEA 4YZZA 2XWKA 1LBZA 4I3YA 4NN3A 1FPKA 1IMBA 1IMFA 1K9YA 4MCOA 4GX4A 1KA0A 3A29A 1INPA 2Q8MA 4NX1A 4P1EA 4GWXA 4I3EA 4IR8A 4N91A 2XWIA 2HPGA 4NGUA 4X9TA 1FSAA 2WBBA 1NV6A 4M1VA 4P56A 2XXKA 1FJ6A 5I3SA 1NV4A 2WEFA 2B4MA 2FHYA 1YXIA 4MHFA 4P3LA 2FIEA 2WBDA 4N8YA 1K9ZA 3KC0A 1FJ9A 5ESYA 2F5XA 3PTYA 5I5PA 1FBHA 4HXVA 4P9KA 4FBPA 4O7IA 2B4LA 1NV0A 4MJOA 3CHGA 4JVIA 4N8GA 3E78A 4OANA 4HE2A 4OVSA 1FPGA 1FTAA 5IZ3B 4GWSA 4PBQA 3W9VA 4MX6A 2XA5A 4HCWA 4N17A 1DK4A 4PDDA 4HE1A 1NV1A 2QFLA 1FPDA 3KC1A 1FPEA 2Y5KA 4OVRA 4MNPA 1DBZA 3NOHA 2DE4A 1FPBA 2HHMA 3LUZA 1AWBA 1NV5A 3T1BA 4GWYA 5IZ3A 1BK4A 4PGNA 4N81A 5IGAA 1RDZA 2ZZWA 3QMFA 1LBVA 4PAFA 4KXPA 1FRPA 4PCDA 2WYPA 1FPFA 1EYJA 2QVVA 2XWOA 2BJIA 4GWZA 2L5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV6 A;  1YZ0 A;  1NI9 A;  4GWU A;  1RDY A;  1FJ6 A;  5I3S A;  1NV4 A;  1LBX A;  2WEF A;  1G0H A;  1EYK A;  3KBZ A;  1VDW A;  3LV0 A;  1IME A;  1LEV A;  1NUW A;  3RPL B;  2P3V A;  2FHY A;  1NV7 A;  5A5L A;  2CZH A;  1YXI A;  3B8B A;  5T3J A;  2FBP A;  2FIE A;  1G0I A;  4PTK A;  2WBD A;  1RDX A;  5ET8 A;  1Q9D A;  1IMC A;  3FBP A;  1K9Z A;  3KC0 A;  1FJ9 A;  3D1R A;  5ESY A;  1SPI A;  4H46 A;  1FBH A;  3IFA A;  4HXV A;  4GX3 A;  4FBP A;  1NUZ A;  4O7I A;  1NV0 A;  2F3B A;  1CNQ A;  2FVZ A;  4MJO A;  1FPJ A;  1LBY A;  2FIX A;  4HE2 A;  2Q74 A;  3BIG A;  1KZ8 A;  1FBP A;  1IMD A;  4AS4 A;  2VT5 A;  4G61 A;  5ET5 A;  5ET6 A;  2R8T A;  1FPG A;  1FTA A;  1FBD A;  5IZ3 B;  3RPL A;  5EYH A;  4GWS A;  3ROJ A;  2GQ1 A;  1FBC A;  1DK4 A;  1FPI A;  1D9Q A;  3IFC A;  2QVR A;  4GBV A;  5EQ7 A;  4GX6 A;  5J16 A;  4HE1 A;  2OWZ A;  2P3N A;  1NV1 A;  2QFL A;  1FPD A;  4H45 A;  2OX3 A;  3KC1 A;  1FPE A;  2Y5K A;  1FBG A;  1QGX A;  4GBW A;  1DBZ A;  2F3D A;  4QXD A;  3T0J A;  5EQ9 A;  1XI6 A;  5DW8 A;  5IZ1 A;  1FPB A;  5ET7 A;  1YYZ A;  5F24 A;  2HHM A;  3LUZ A;  2CZK A;  1AWB A;  1NV2 A;  3BIH A;  1FBE A;  1JP4 A;  1NV5 A;  1LBZ A;  4GWY A;  4I3Y A;  3RYD A;  2JJK A;  5EYG A;  1BK4 A;  2CZI A;  5IZ3 A;  1FPK A;  1IMB A;  1IMF A;  5LDZ A;  5FBP A;  1K9Y A;  4GX4 A;  4N81 A;  1KA0 A;  3A29 A;  2QVU A;  1DCU A;  1NV3 A;  1KA1 A;  1INP A;  2Q8M A;  1RDZ A;  4GWX A;  2PCR A;  3QMF A;  1LBV A;  4I3E A;  4KXP A;  4IR8 A;  4HE0 A;  4I40 A;  5EQA A;  2Y5L A;  1IMA A;  1FRP A;  1FPF A;  4GWW A;  1EYI A;  2DDK A;  1EYJ A;  2QVV A;  2BJI A;  1FPL A;  1FSA A;  1FBF A;  5EQ8 A;  2WBB A;  1NUX A;  1NUY A;  4AS5 A;  1LBW A;  4GWZ A; 
#chains in the Genus database with same CATH topology
 4JVD A;  2AL5 A;  3TDJ A;  2VPO A;  1XS5 A;  2V3Q A;  4ECF A;  4DLD A;  3KBZ A;  1VDW A;  4P1L A;  2F36 A;  1B51 A;  1B3E A;  3UGW A;  3QUF A;  2X26 A;  3VDF A;  3O29 A;  4ZEC A;  2QSX A;  2YPN A;  1UTH A;  1LBY A;  3OO8 A;  1DMB A;  4PFI A;  2F34 A;  1F9B A;  2VT5 A;  4PAK A;  4F3S A;  5ET5 A;  5ET6 A;  4KHZ E;  3WAE A;  4G77 A;  2Y7P A;  4LON B;  4NF4 B;  3TZA A;  3VLV A;  1PB9 A;  5K2X A;  3RUM A;  3KJ7 A;  4R2F A;  2VGQ A;  4GBV A;  4R6K A;  1AH5 A;  3OO9 A;  4TLL B;  3P7I A;  3W15 C;  2DP8 A;  1FBG A;  4QXD A;  5EQ9 A;  2NXO A;  3TCF A;  3N5L A;  2XWV A;  4PDH A;  3I6V A;  3UA8 A;  3Q25 A;  4NF5 B;  3BIH A;  5H8Q B;  1BLF A;  3LSX A;  1FTJ A;  3RYD A;  1MXY A;  5EYG A;  4KYE A;  4R72 A;  3IJO B;  4WEP A;  2NWJ A;  4OQO A;  1DCU A;  1D9V A;  4WXJ A;  2V4C A;  4I8C A;  3EKI A;  1POY 1;  4GRK A;  1IMA A;  2F8D A;  2OJT A;  4XKP A;  4GWW A;  1EYI A;  4HCY A;  3CFX A;  1A8E A;  4MIJ A;  5K2Y A;  3SER A;  1MXU A;  3KN8 A;  3VE1 B;  1MH3 A;  4RYA A;  4OFO A;  3CFL A;  1HSJ A;  2E0S A;  4PAI A;  5CRY A;  3RT6 B;  4GF8 A;  1M5F A;  3PMW A;  1B1X A;  4PTK A;  2REJ A;  3SEV A;  3MST A;  4H46 A;  4YMB A;  4H8I A;  4GD5 A;  1FQB A;  2XD2 A;  4WKM A;  3TTK A;  5DEX A;  4EXK A;  3FXQ A;  1SQY A;  1UIV A;  2A5T B;  2YJP A;  1N0T A;  2I58 A;  4BDN A;  2LAO A;  2R8T A;  3RPL A;  4MMP A;  3ZS6 A;  4P0G A;  4R73 A;  1NH8 A;  3OO6 A;  3MBP A;  2XXW A;  1P1U A;  1LB8 A;  4NHB A;  2NOO A;  1B5I A;  4PGP A;  1QGX A;  2F3D A;  2W7Y A;  3H7M A;  1DSN A;  2CEX A;  2DXR A;  2YLN A;  4PBH A;  5F1Q A;  1JP4 A;  5EHS A;  1LFI A;  2CZI A;  2DQV A;  1B52 A;  3D4C A;  2V3U A;  3FAS A;  1I6A A;  1A8F A;  3SDF A;  3MJN A;  4YB7 A;  2I3W A;  1EZP A;  3C9H A;  1A54 A;  4F1Y A;  5EQA A;  2QS3 A;  5CI5 A;  4KFQ A;  3MZ1 A;  1BKA A;  3FD3 A;  1MM6 A;  1FBF A;  2HAU A;  2PMS A;  1AMF A;  4RJZ A;  4C1U A;  3GBA A;  4N07 A;  1A40 A;  5A5L A;  4OEU A;  3B8B A;  1ZJL A;  4XFE A;  1PBP A;  4XXU A;  3JV9 A;  1EZ9 A;  3TTR A;  3TTN A;  5BWJ A;  3IB2 A;  1IQ7 A;  3S2V A;  4YKI A;  3OEM A;  4U2R A;  1CNQ A;  1A7L A;  4G68 C;  3GYY A;  3TCG A;  4O7M A;  3QIM A;  5F7V A;  3O6I A;  5LTC A;  2MKZ A;  5IM2 A;  4JWO A;  1FBP A;  5CC2 A;  3MVX A;  5AA1 A;  3RT8 A;  3PPP A;  4F3G A;  2UVI A;  2Z22 A;  3HPI A;  1A99 A;  4PE5 B;  4POX A;  1WOD A;  5I56 A;  1XI6 A;  5IZZ A;  4FE8 A;  5F24 A;  3W9W A;  3ODB A;  2HQ0 A;  4PFY A;  5DVJ A;  4YZZ A;  2XWK A;  5DVF A;  4I3Y A;  2F97 A;  2O1M A;  1B1H A;  3MP1 A;  3PPO A;  4F2Q A;  3A29 A;  4F3P A;  4H1X A;  5ICQ A;  2Q8M A;  2H99 A;  4P1E A;  4OEN A;  5I57 A;  1P1O A;  4N91 A;  1SYH A;  2HPG A;  2QS1 A;  3M3F A;  3V5A A;  5EHM A;  4M1V A;  3FVN A;  2XXK A;  5I3S A;  1NV4 A;  2VP1 A;  3TAJ A;  3SEX A;  4FIM A;  3RGY A;  4LQ5 A;  1O64 A;  3PPR A;  3B6Q A;  3UN6 A;  1P1Q A;  3KN7 A;  4Z7E A;  4OES A;  2RC9 A;  1K9Z A;  2ONK E;  2F5X A;  2NUV A;  3B7D A;  3G3J A;  4OXV A;  2DYX A;  2RC8 A;  3H03 A;  2ZNU A;  4F39 A;  2OCU A;  3E78 A;  1B3L A;  1S9T A;  2GFE A;  1QUK A;  4OAN A;  1JQF A;  3RN8 A;  3TKD A;  2UVH A;  1WDN A;  1B7H A;  5JEI A;  4MFI A;  2QS4 A;  4HCW A;  3G3I A;  2I49 A;  4ELP A;  5LOM A;  5HPQ A;  2THI A;  5L9M A;  3ZKK A;  3IK6 B;  3FAT A;  1Q1K A;  5A5X A;  1FPE A;  1GVC A;  4I62 A;  4IO7 A;  1DBZ A;  3NOH A;  3G3H A;  2VD2 A;  4KYD A;  4YB5 A;  2HHM A;  3S9L C;  1AWB A;  2XXY A;  3K6X A;  1NV5 A;  3IOV A;  4Q8R A;  3T1B A;  4OZ9 A;  2DS9 A;  3KOT A;  2Z8E A;  3PUW E;  1LAG E;  3RTF B;  3O66 A;  1H43 A;  5IGA A;  3L6G A;  1LAH E;  1AIV A;  3QMF A;  1LBV A;  3PMX A;  4ZZE A;  3FVK A;  1H3D A;  3G7W A;  2WYP A;  5H8N A;  1OLC A;  2XWO A;  4OFL A;  3G3K A;  2L5V A;  3SKP A;  4IO4 A;  2PT2 A;  3ECR A;  1RDY A;  3H4Z A;  2F6P A;  2DWI A;  2UYF A;  1L5T A;  3SEU A;  4DE8 A;  1P1N A;  4JDF A;  5DYH A;  5AA3 A;  4ONY A;  5HM4 B;  5TPA A;  5IKB A;  2FVZ A;  2XXH A;  4OTE A;  2Q74 A;  4HTG A;  2D21 A;  1B4H A;  1VFD A;  4MH5 A;  1MQD A;  4KYS A;  2Y7R A;  1BIY A;  4Q0C A;  1OQH A;  1QVS A;  4K3F A;  5I58 B;  2HEU A;  2HZK A;  2AL4 A;  3OEL A;  4GVO A;  3EN3 A;  4N6K A;  4GBW A;  3FUZ A;  1YYZ A;  3KOS A;  2ZZV A;  2V93 A;  3HO7 A;  4QHQ A;  1AL3 A;  3MVZ A;  5FTI A;  1NNF A;  4YKJ A;  1QUL A;  1B0L A;  1LGB C;  3SES A;  5L9S A;  3VXB A;  3TYH A;  4ELQ A;  4N4U A;  1FQF A;  4OFJ A;  3CVG A;  3AXF A;  2QMX A;  4BDM A;  2PCR A;  3V89 B;  1QUJ A;  4EUO A;  1B9J A;  3LSL A;  4AS5 A;  1ZTY A;  1O63 A;  5AA4 A;  4GWU A;  4PF6 A;  4O8M A;  4MAG A;  1LBX A;  1B5H A;  5CM6 A;  4F3B A;  3KG2 A;  3FV2 A;  3PUY E;  3DM0 A;  2O51 A;  3RPL B;  3R7X A;  1RYO A;  4RNS A;  2CZH A;  5T3J A;  4P47 A;  2P2A A;  1URS A;  4IGR A;  1JET A;  4X1B A;  3CR9 A;  1FQC A;  4ZEF A;  3HST A;  4GLI A;  5ET8 A;  2V84 A;  3HFU A;  3K4U A;  4AQ4 A;  1N3W A;  3MPK A;  4NED A;  2DXY A;  2O69 A;  1FW0 A;  1Y1M A;  3TFL A;  3BIG A;  4OMB A;  4ZEK A;  4R75 A;  2Y7K A;  1LBB A;  4DI3 D;  3FZV A;  4P11 A;  2Z8F A;  1FBC A;  1JNF A;  1SYI A;  1JW1 A;  2DVZ A;  3N26 A;  1D9Q A;  1B3F A;  2RC7 A;  4LZ5 A;  5I59 A;  1XT8 A;  2ZZX A;  1DTZ A;  1BTJ A;  2VPN A;  2QJE A;  4LN5 A;  2OZZ A;  3DP6 A;  1I6B A;  3CG1 A;  3K1N A;  1OVB A;  2IA4 A;  3C35 A;  3TOD A;  1NV2 A;  2ALU A;  3MC2 A;  1S7Y A;  4RPN A;  1IEJ A;  5J1D A;  3A3U A;  3OO7 A;  4Q30 B;  1SW2 A;  2XXI A;  3IOU A;  4U1Z A;  3H6U A;  1XVX A;  1LCF A;  3UP9 A;  2QVU A;  3H6T A;  4EQ9 A;  1B32 A;  2REG A;  3CRB A;  2DE3 A;  3DP8 A;  2F7C A;  3V83 A;  1PB7 A;  4HE0 A;  1ZLQ A;  4KCD A;  2Y5L A;  2I3V A;  4KPT A;  5FTH A;  1CB6 A;  4PE3 A;  1FPL A;  1YPN A;  5H8F A;  1URG A;  4GXA A;  3E79 A;  1IUD A;  4H65 A;  1JW5 A;  2UXA A;  2DE2 A;  1SW5 A;  5H8H A;  3EHU A;  3M3K A;  2GHB A;  2DWJ A;  3TEL A;  2XXR A;  4G68 B;  1B5J A;  3IX1 A;  4U21 A;  4LA9 A;  1Q9D A;  1SW1 A;  3SZP A;  1MXX A;  2PBW A;  1N76 A;  2OWS A;  4YIC A;  1MG1 A;  1GGG A;  1NUZ A;  5I56 B;  4ESX A;  3OMB A;  3N94 A;  3VLW A;  1NNP A;  3T93 B;  5AA2 B;  4QFL A;  2I0B A;  1T0K A;  2PX1 A;  3UIF A;  1D3K A;  3KBR A;  3S9E A;  4NF6 A;  4XKR A;  1EH3 A;  1OQG A;  1US5 A;  1FPI A;  1FQD A;  1B3G A;  2O84 X;  5I57 B;  2OX3 A;  3I3V A;  1MPB A;  2O1L A;  4P8B A;  5I2K A;  2ZYM A;  5ET7 A;  5FHM A;  3A3C A;  1Y9U A;  4OWD A;  5JTY A;  2DSF A;  2CZK A;  5M2V A;  1MY3 A;  1FBE A;  4JBZ A;  1LBZ A;  3IOT A;  1NH7 A;  1ANF A;  4H5G A;  1FPK A;  1IMB A;  2GHA A;  1UTB A;  3N6U A;  3TTL A;  3U8Q A;  4NX1 A;  4AB5 A;  3C36 A;  5B70 A;  4LAT A;  4LZ7 A;  1XOC A;  1I69 A;  3RTW B;  3B6T A;  3KFM A;  2WBB A;  4Q5T A;  3C33 A;  4P56 A;  2OPE A;  2O7U A;  3FXR A;  3C4M A;  2B4M A;  3F11 A;  5CBR A;  4L17 A;  5CMM A;  4MHF A;  4P3L A;  1AOV A;  2ANJ A;  4N8Y A;  5ESY A;  3PTY A;  1FBH A;  4HXV A;  1FTK A;  1MQI A;  2DWH A;  4P9K A;  2B4L A;  3VLU A;  3B6W A;  3CHG A;  4EXL A;  3HN0 A;  4OEV A;  4ZE9 A;  4OVS A;  3KGC A;  1ZIU A;  1A55 A;  3O6G A;  1M5E A;  1FPG A;  4GWS A;  4IO6 A;  3PGF A;  4NWD A;  2XX8 A;  1USY E;  4PDD A;  4MBP A;  3OSR A;  5BUU A;  3BFT A;  1NV1 A;  1FPD A;  4XIG Q;  3KC1 A;  1Y3Q A;  3QK6 A;  3Q29 A;  3JYR A;  2HXW A;  3TEP A;  1FPB A;  3MP6 A;  3TPA A;  1N3X A;  5H8N B;  4H6D A;  4I9D A;  2I4B A;  3V8X B;  5L9O A;  4GWY A;  4OYV A;  4RY1 A;  5IZ3 A;  2ZXT A;  2Y84 A;  4PGN A;  1J1N A;  1RDZ A;  1SBP A;  3MZ9 A;  3OEK A;  1US4 A;  4G8N A;  3E4R A;  3MVW A;  4PP0 A;  5TPA B;  5ICT A;  3I5O A;  4PCD A;  2H25 A;  1FPF A;  1DPP A;  4FOR A;  1IXH A;  3FJG A;  4JWY A;  5CMC A;  2QVV A;  3OSQ A;  5KDT B;  1FCK A;  4GQO A;  1NI9 A;  1GTK A;  2ONR A;  4R6Y A;  1ELJ A;  4FED A;  1EYK A;  1MXV A;  1B7Z A;  1IME A;  2AIX A;  3Q27 A;  4AB6 A;  2QPQ A;  4F31 B;  4PFB A;  4X8R A;  3FBP A;  4F18 A;  4G8M A;  4GL8 A;  3IFA A;  2NVU B;  1M5D A;  3QSL A;  1SW4 A;  1MDP 1;  1R9L A;  2P0S A;  4OVJ A;  1IZ1 A;  4IY6 A;  4NMY A;  2UYE A;  1PC3 A;  3QYT A;  4JSD A;  4AS4 A;  5I2N A;  2A5T A;  2G93 A;  1P1W A;  3M3L A;  3K2D A;  4MNI A;  3ROJ A;  2FNC A;  3Q26 A;  5ELV A;  3SEY A;  2I6E A;  4R9F A;  4FAJ A;  4E0X A;  2QVR A;  1YAE A;  1MQG A;  1FTL A;  3VXC A;  2H5Y A;  4QRZ A;  4EF1 A;  1PEB A;  3IO6 A;  5IAI A;  4ZDM A;  4GWO A;  1QKB A;  1GR2 A;  3HHG A;  4X04 A;  2RKM A;  4R9G A;  2H98 A;  4NF8 A;  1LAF E;  4RK9 A;  2F7A A;  2HFB A;  2O6A A;  4QFO A;  2KQZ A;  3LR1 A;  3E3K A;  5CBS A;  3MP8 A;  2PYY A;  3PV0 E;  3MYU A;  3C34 A;  2B65 A;  2O7I A;  4F22 A;  1BP5 A;  4LZ8 A;  3H6V A;  1MRP A;  5AA2 D;  2CEY A;  3LSW A;  1ZMG A;  4OHN A;  3T9X B;  3IR1 A;  2QL3 A;  5AE4 A;  1JVX A;  5I7I A;  3TMG A;  2WX9 A;  3FXB A;  5JK4 A;  2D5W A;  3S9M C;  3RPW A;  5TP9 A;  1MDQ A;  3H06 B;  1G0I A;  4XEQ A;  1LLS A;  5H8S A;  4F29 A;  4OET A;  2OBG A;  4PF8 A;  3IB0 A;  1UTH B;  4ZEB A;  1ZKB A;  4QSE A;  3PUZ E;  2FIX A;  3T9V A;  4KR5 A;  4TLM B;  3MUQ A;  2A5S A;  4KQP A;  1KWH A;  4JWX A;  1NKX A;  2GQ1 A;  2XD3 A;  2ABH A;  3IFC A;  5J16 A;  2ZNT A;  4H45 A;  2PFY A;  3U94 A;  4N13 A;  2VHA A;  3L6H A;  4PET A;  2Q2C A;  3T0J A;  4KD5 A;  1SVX B;  2QMW A;  2V3T A;  1Z7N E;  2BJJ X;  3SET A;  1LFH A;  3KN3 A;  1SI0 A;  5H8F B;  1EZO A;  2WYK A;  2P1S A;  3O97 A;  4XKQ A;  1OMP A;  1R9Q A;  5H8H B;  4NAP A;  5FHO A;  2R9J A;  5FBP A;  2F7B A;  3K01 A;  4N6D A;  1VE4 A;  2F35 A;  2V25 A;  1KA1 A;  3G3F A;  1POT A;  4TOZ A;  4XF5 A;  3FXU A;  4BDQ A;  3BFU A;  1LFG A;  4FEC A;  3MQ9 A;  2DDK A;  4F1U A;  4H0W A;  3FIR A;  2X7P A;  2ZNS A;  1IIW A;  3LSF B;  1IXC A;  1XVY A;  4BDL A;  1O7T A;  2P3V A;  3PD9 A;  4NG7 A;  2PT1 A;  3OD7 A;  1MY1 A;  2ONS A;  2PFZ A;  3IB1 A;  1IXG A;  3MAM A;  4EDP A;  4G4P A;  1LST A;  3OOA A;  4NQ8 A;  5DEX B;  3K02 A;  2F3B A;  3ILT B;  4OER A;  1FTO A;  1FPJ A;  4OVT A;  1B05 A;  3H6W A;  4RK2 A;  4THI A;  1KZ8 A;  5KZT A;  4P0I A;  4LQ2 A;  3K1P A;  4JVC A;  1MQJ A;  1FBD A;  2H4I A;  4JSO A;  5EYH A;  4GL0 A;  3JZJ A;  4FJP A;  5TU0 A;  4X48 A;  1Y3P A;  1MY4 A;  4O3C A;  2OWZ A;  2UVG A;  1MQH A;  4F1V A;  3GXA A;  1VFE A;  5DW8 A;  3K6W A;  3FGS A;  1PBQ A;  4GFR A;  4PFT A;  4U1O A;  3CIJ A;  3VFJ A;  4YKP A;  3LBS A;  2XXP A;  1K9Y A;  4MCO A;  3T9H B;  2Q2A A;  1KA0 A;  2I0C A;  1INP A;  3IL1 B;  3FVG A;  2QS2 A;  3E9X A;  1N7X A;  4IR8 A;  3LC8 A;  3Q28 A;  2XWI A;  2ZYK A;  3PU5 A;  1QJM A;  2XXX A;  4NGU A;  1HSE A;  1B6H A;  4X9T A;  1HSL A;  3EQ1 A;  1FSA A;  1URD A;  4LP2 B;  4QFK A;  4ZE8 A;  3K1M A;  3GLB A;  2WKY A;  4QSC A;  2FHY A;  4IY5 A;  4C1T A;  2FIE A;  5KCJ A;  4H8J A;  4DZ1 A;  3KC0 A;  5I5P A;  1NNT A;  3EHT A;  1D4N A;  4U23 A;  4WED A;  4FBP A;  4O7I A;  1SI1 A;  3VVD A;  4MJO A;  2X7Q A;  3ILU B;  2OK2 A;  3EPE A;  2HAV A;  4R6H A;  3TQL A;  1Y4T A;  1FTA A;  5IZ3 B;  2O68 A;  3W9V A;  3K0V A;  4MX6 A;  4N17 A;  1M5C A;  3QXM A;  1SD3 A;  4ELR A;  4Z0I A;  2FA7 A;  5I58 A;  4HE1 A;  1P99 A;  1LBC A;  4DCY A;  2QFL A;  1JEU A;  1MM7 A;  4U22 A;  3T96 B;  1S50 A;  1DPE A;  3U92 A;  3VVE A;  4DIG A;  4ELO A;  4ZEI A;  4EQ7 A;  3PPN A;  1N7W A;  3O2A A;  3IAZ A;  1TFD A;  1H45 A;  3RNN A;  3RQT A;  2GRV A;  3U72 A;  2IEE A;  4N81 A;  2FYI A;  4QSD A;  4IB2 A;  4MLV A;  1Y3N A;  4PAF A;  4KXP A;  3LUY A;  1XHY A;  4H67 A;  4YB6 A;  4O3B A;  1FRP A;  3UOR A;  5DTB A;  3U93 A;  2BJI A;  3EHS A;  3IO4 A;  3QUJ A;  1LB9 A;  3MWB A;  3HHF A;  4H5F A;  2G29 A;  1DTG A;  4RPO A;  1NL5 A;  4RXL A;  1G0H A;  5I2N B;  4RA1 A;  3O28 A;  3IOW A;  1B4Z A;  2AYS A;  3B50 A;  1NV7 A;  3UK4 A;  2H9B A;  3FVO A;  4U4X A;  1ZU0 A;  2I4C A;  3KJT A;  1MY2 A;  1RDX A;  2RCA A;  3T9U A;  3PPQ A;  3KSX A;  3A09 A;  3FV1 A;  3D1R A;  1SPI A;  1MY0 A;  3O6H A;  1NNK A;  3MZB A;  3PUX E;  1FQE A;  4IO3 A;  1IXI A;  1Y20 A;  4O94 A;  1VR5 A;  2CZL A;  1RYX A;  1OVT A;  4F19 A;  3OXN A;  2Z8D A;  4NF8 B;  4IO5 A;  5ITO A;  4YMA A;  3FJM A;  4ESW A;  1QKA A;  3BKI B;  4NE4 A;  3HV1 A;  5A5X B;  1XC1 A;  1JW4 A;  3TTM A;  1TT1 A;  1B3H A;  1II5 A;  1JEV A;  2M8C A;  2HCA A;  2OLB A;  2XXT A;  4FAT A;  4PFW A;  2XXQ A;  3IOR A;  2UVJ A;  2JJK A;  1YCJ A;  4DXB A;  3KZG A;  4NF4 A;  5B7D A;  1WVJ A;  5LDZ A;  3CI8 A;  4EF2 A;  1QUI A;  5TP9 B;  1JVY A;  3N6T A;  2HXR A;  4R2B A;  3BBR A;  4XTC Q;  5FHN A;  2OWT A;  4JXI A;  5DT6 A;  5DVI A;  4NF5 A;  5EQ8 A;  2HZL A;  1NUX A;  5H8Q A;  1B40 A;  1YZ0 A;  2ZYN A;  2OPD A;  4POW A;  2ZYO A;  3GBB A;  1FTM A;  1Y1Z A;  1B2H A;  4UAB A;  2Y7W A;  2FBP A;  3U65 A;  4M4G A;  1B46 A;  1IMC A;  4G68 A;  4F2O A;  4IGT A;  1LAX A;  2Y7I A;  3R26 A;  4KI0 E;  4OA4 A;  2B3F A;  3M8U A;  4LVQ A;  2VOZ A;  4OVP A;  1SDX A;  3MPL A;  2ZMB A;  5L8D A;  3CSB A;  4BDO A;  5AA2 A;  4NWC A;  3ONM A;  2E1S A;  1DOT A;  3TCH A;  3FJ7 A;  3ZKL A;  1PDA A;  5EQ7 A;  1M5B A;  3IJX B;  3O9P A;  1GV8 A;  1D9Y A;  3PUV E;  4XKN A;  3K6V A;  1QW0 A;  4PFR A;  3DEL B;  4ZS9 A;  3KEI A;  5ITP A;  3H3G A;  3U1O A;  4N6P A;  4PC9 A;  3ISP A;  4R74 A;  4MLQ A;  4GOT A;  2DWA A;  2XHD A;  4DDD A;  3OEN A;  4QBA A;  1I6Q A;  4YAH X;  4N15 A;  3R6U A;  1MXZ A;  1MXW A;  2DVC A;  1NV3 A;  3T66 A;  4QFP A;  2KLF A;  2R71 A;  4JB7 A;  3CG3 A;  2ESN A;  4I40 A;  4BLA A;  1FQA A;  3TUS A;  5I84 A;  4DI4 B;  3ZSF A;  5AA4 B;  1EU8 A;  1H76 A;  1Q35 A;  4QF9 A;  4MF3 A;  1NUY A;  1LBW A;  4NF0 A;  1RKM A;  3K6U A;  4G2Z A;  4UA8 A;  3LV0 A;  2RF1 A;  1LEV A;  1NUW A;  2XXV A;  1UQW A;  4OVQ A;  4YKK A;  4HS7 A;  3EF7 A;  4PFU A;  4LUB A;  2DOJ A;  4KCC A;  3TQW A;  4U4S A;  4DCX A;  4GX3 A;  4MEV A;  2VD3 A;  1Y4C A;  4EQB A;  4FEB A;  1IMD A;  4G61 A;  1CE2 A;  1OIB A;  5CMB A;  4X1D A;  1TXF A;  5I59 B;  3DLN A;  4GX6 A;  3USD A;  5HBC A;  4ISU A;  2P3N A;  2F6G A;  1NMU A;  3MW0 A;  4GXS B;  1R6Z A;  2KR0 A;  4MNC A;  5IZ1 A;  2Q9T A;  2XX7 A;  3T22 A;  3S9N C;  3RY3 A;  4NN3 A;  4DXU A;  4DXC A;  1IMF A;  4ZED A;  4QFN A;  1USY H;  3CSG A;  3HCQ A;  2RIN A;  4GX4 A;  4BDR A;  1B58 A;  5KCJ B;  1NFT A;  4GWX A;  3C32 A;  4I3E A;  4HW8 A;  3MVY A;  4TQU Q;  3CFZ A;  4O3A A;  4UAC A;  1MPC A;  1NV6 A;  1LCT A;  4GIZ A;  2RCB A;  3K00 A;  1FJ6 A;  2WEF A;  5KDT A;  4PQJ A;  1TFA A;  1YXI A;  5EYF A;  2R6G E;  3KSJ A;  2WBD A;  1MH4 A;  2D3I A;  1FJ9 A;  1VSO A;  2F78 A;  3S4U A;  5CMK A;  3G3G A;  1NV0 A;  3DP4 A;  5ISU A;  4JVI A;  4N8G A;  1N84 A;  4ND9 A;  4HE2 A;  1MPD A;  1MS7 A;  3C31 A;  3D4G A;  2Q8J A;  4NF6 B;  1TWY A;  2I48 A;  1B0H A;  4PBQ A;  1ZBM A;  1UIU A;  2XA5 A;  4I1D A;  1OLA A;  1DK4 A;  3RLF E;  1ATG A;  5I2K B;  1YTV A;  3VV5 A;  2Y5K A;  2B3B A;  2GH9 A;  2QRY A;  4OVR A;  4MNP A;  5JTY B;  2DE4 A;  2PVU A;  1H44 A;  1Z7M E;  3LUZ A;  3THI A;  3PMV A;  3VVF A;  3GZG A;  4IO2 A;  2CMO A;  1BK4 A;  1UTB B;  2Z23 A;  2Q89 A;  3PD8 A;  4ZZA A;  3E13 X;  1N04 A;  2ZZW A;  2Q88 A;  3SEW A;  4G8H A;  2XXU A;  1IIT A;  1R1N A;  3WAF A;  2XX9 A;  4NTL A;  4YU0 A;  1B7U A;  1EYJ A;  3QAX A;  4E0W A;  1PB8 A;  4C0R A;  4GWZ A; 
#chains in the Genus database with same CATH homology
 4JVD A;  1NI9 A;  2VPO A;  2V3Q A;  1RDY A;  1G0H A;  1EYK A;  3KBZ A;  1VDW A;  1IME A;  4P1L A;  3B50 A;  1NV7 A;  2QPQ A;  1RDX A;  4PFB A;  4X8R A;  3FBP A;  3D1R A;  1SPI A;  4F18 A;  3IFA A;  2FVZ A;  1LBY A;  4O94 A;  2Q74 A;  4F19 A;  4PFI A;  4AS4 A;  2VT5 A;  4PAK A;  5ET5 A;  5ET6 A;  4MNI A;  3ROJ A;  2HZK A;  4GBV A;  2QVR A;  4N6K A;  1FBG A;  4GBW A;  4QXD A;  5EQ9 A;  1YYZ A;  2XWV A;  4PDH A;  4X04 A;  2ZZV A;  3BIH A;  3RYD A;  2JJK A;  5EYG A;  2KQZ A;  5LDZ A;  3MYU A;  4N4U A;  1DCU A;  2HXR A;  2V4C A;  2PCR A;  3EKI A;  2CEY A;  1IMA A;  4GWW A;  1EYI A;  4HCY A;  5EQ8 A;  4AS5 A;  2HZL A;  1NUX A;  5I7I A;  4MIJ A;  1YZ0 A;  4GWU A;  2WX9 A;  4PF6 A;  4O8M A;  4MAG A;  1LBX A;  5CM6 A;  3FXB A;  5JK4 A;  4PAI A;  3RPL B;  2CZH A;  5T3J A;  4P47 A;  4UAB A;  3U65 A;  2FBP A;  1G0I A;  4PTK A;  4XEQ A;  5ET8 A;  1IMC A;  3HFU A;  3MST A;  4H46 A;  4PF8 A;  4OA4 A;  2FIX A;  4OVP A;  3BIG A;  4DI3 D;  2R8T A;  3RPL A;  4MMP A;  2GQ1 A;  1FBC A;  2DVZ A;  1D9Q A;  3IFC A;  5EQ7 A;  5J16 A;  4NHB A;  4H45 A;  2PFY A;  2ZZX A;  4PET A;  4PGP A;  2VPN A;  1QGX A;  2F3D A;  4LN5 A;  3T0J A;  4PFR A;  2CEX A;  1NV2 A;  4PBH A;  4PC9 A;  3ISP A;  1JP4 A;  5J1D A;  2CZI A;  2WYK A;  4QBA A;  4NAP A;  4N15 A;  5FBP A;  4N6D A;  2QVU A;  1NV3 A;  1KA1 A;  2DE3 A;  4XF5 A;  4HE0 A;  4I40 A;  5EQA A;  2Y5L A;  2DDK A;  4DI4 B;  4F1U A;  4PE3 A;  1FPL A;  1FBF A;  1NUY A;  1LBW A;  4NF0 A;  3E79 A;  2DE2 A;  3LV0 A;  1LEV A;  1NUW A;  2P3V A;  5A5L A;  3B8B A;  4NG7 A;  4OVQ A;  4XFE A;  2PFZ A;  1Q9D A;  3SZP A;  4NQ8 A;  4GX3 A;  4YIC A;  1NUZ A;  2F3B A;  1CNQ A;  4MEV A;  3GYY A;  4O7M A;  1FPJ A;  4OVT A;  5LTC A;  2MKZ A;  1KZ8 A;  5IM2 A;  1FBP A;  1IMD A;  4G61 A;  4JVC A;  1FBD A;  5EYH A;  1FPI A;  4GX6 A;  2OWZ A;  2P3N A;  2OX3 A;  4F1V A;  4P8B A;  2KR0 A;  4MNC A;  1XI6 A;  5DW8 A;  5IZ1 A;  5IZZ A;  5ET7 A;  5F24 A;  2Q9T A;  3W9W A;  2CZK A;  1FBE A;  4YZZ A;  2XWK A;  1LBZ A;  4I3Y A;  4NN3 A;  1FPK A;  1IMB A;  1IMF A;  1K9Y A;  4MCO A;  4GX4 A;  1KA0 A;  3A29 A;  1INP A;  2Q8M A;  4NX1 A;  4P1E A;  4GWX A;  4I3E A;  4IR8 A;  4N91 A;  2XWI A;  2HPG A;  4NGU A;  4X9T A;  1FSA A;  2WBB A;  1NV6 A;  4M1V A;  4P56 A;  2XXK A;  1FJ6 A;  5I3S A;  1NV4 A;  2WEF A;  2B4M A;  2FHY A;  1YXI A;  4MHF A;  4P3L A;  2FIE A;  2WBD A;  4N8Y A;  1K9Z A;  3KC0 A;  1FJ9 A;  5ESY A;  2F5X A;  3PTY A;  5I5P A;  1FBH A;  4HXV A;  4P9K A;  4FBP A;  4O7I A;  2B4L A;  1NV0 A;  4MJO A;  3CHG A;  4JVI A;  4N8G A;  3E78 A;  4OAN A;  4HE2 A;  4OVS A;  1FPG A;  1FTA A;  5IZ3 B;  4GWS A;  4PBQ A;  3W9V A;  4MX6 A;  2XA5 A;  4HCW A;  4N17 A;  1DK4 A;  4PDD A;  4HE1 A;  1NV1 A;  2QFL A;  1FPD A;  3KC1 A;  1FPE A;  2Y5K A;  4OVR A;  4MNP A;  1DBZ A;  3NOH A;  2DE4 A;  1FPB A;  2HHM A;  3LUZ A;  1AWB A;  1NV5 A;  3T1B A;  4GWY A;  5IZ3 A;  1BK4 A;  4PGN A;  4N81 A;  5IGA A;  1RDZ A;  2ZZW A;  3QMF A;  1LBV A;  4PAF A;  4KXP A;  1FRP A;  4PCD A;  2WYP A;  1FPF A;  1EYJ A;  2QVV A;  2XWO A;  2BJI A;  4GWZ A;  2L5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...