3LUZA

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
238
Chain Sequence
b'SAVMNVMVQAAMKAGRSLVRDYGEDYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extragenic suppressor protein suhB
molecule tags Hydrolase
source organism Bartonella henselae
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
total genus 78
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3luzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3luzA02
1QGXA 2CZIA 3LUZA 2HHMA 1FBGA 4GWUA 4I3YA 1FBEA 2WEFA 1NV0A 1FSAA 1JP4A 4O7IA 1INPA 1IMDA 2WBBA 1LBXA 5I3SA 2Q8MA 5J16A 4AS4A 1FPEA 1NUWA 2GQ1A 1DK4A 4IR8A 2FIXA 2CZKA 4MJOA 2F3DA 4I3EA 1FBDA 1FJ6A 1LBYA 1FPGA 2F3BA 1NV6A 2OWZA 4GWSA 1IMEA 1FBFA 2VT5A 3LV0A 3RPLA 2QVRA 2PCRA 2QVVA 1FTAA 5EYGA 5IZ3A 3ROJA 4GWWA 1FRPA 5ET5A 5EQ8A 1IMBA 1NUXA 1NV1A 1G0IA 1FPIA 1NV7A 1NV4A 1NV3A 2CZHA 1Q9DA 4GWYA 4GBWA 3BIHA 3BIGA 4GX3A 1EYJA 2QVUA 1K9ZA 3KC1A 4HE1A 1FPJA 1XI6A 2QFLA 1FPFA 1KA0A 1K9YA 2BJIA 2Q74A 5IZ1A 1IMFA 4AS5A 1RDZA 5ET6A 2P3VA 1NV5A 4GWXA 2FIEA 4I40A 1KA1A 1DCUA 1LEVA 4GBVA 1G0HA 2FHYA 2FBPA 1KZ8A 3T0JA 5LDZA 1NI9A 1BK4A 3IFAA 5T3JA 2DDKA 4KXPA 4QXDA 3KBZA 2R8TA 2Y5KA 3A29A 3FBPA 4H46A 5ET7A 4FBPA 1FPBA 1RDYA 3KC0A 1FBPA 5EQ9A 5A5LA 2JJKA 3RYDA 4G61A 1FPLA 2P3NA 1EYKA 3RPLB 1NV2A 4H45A 1NUZA 5ESYA 1IMCA 1YXIA 4HE0A 5EQ7A 4HXVA 4GWZA 1LBVA 1IMAA 1LBWA 5DW8A 2WBDA 5IZ3B 4GX6A 5EYHA 1AWBA 1NUYA 1DBZA 3D1RA 1FPKA 5FBPA 4N81A 1FJ9A 2FVZA 1FPDA 4GX4A 4HE2A 5F24A 1LBZA 3QMFA 1YZ0A 1FBCA 5EQAA 3IFCA 2OX3A 5ET8A 1FBHA 1SPIA 1VDWA 1RDXA 2Y5LA 1CNQA 1D9QA 4PTKA 1YYZA 1EYIA 3B8BA
chains in the Genus database with same CATH superfamily
4HTGA 3LSLA 3GBBA 2A5SA 2B3BA 2WEFA 1FQDA 3IO6A 2DS9A 1PEBA 1BIYA 2I3WA 2FNCA 1ZU0A 2PMSA 4QFNA 4G8NA 4LQ5A 2OWSA 1JEVA 3FV1A 1FPGA 4ZE8A 3LV0A 2R9JA 4QFPA 3FGSA 4RJZA 1B6HA 4EXLA 1NV4A 4GWYA 1SVXB 4KCDA 4R73A 3LBSA 3T93B 2ABHA 4RNSA 4NWCA 5K2XA 1L5TA 1KA1A 1IXGA 4AB6A 4I62A 3RN8A 5L8DA 3MAMA 2UVHA 4U1OA 1KZ8A 3EPEA 1ZKBA 1QKAA 4NF5B 4XIGQ 3KN7A 2D21A 4PQJA 3DLNA 1B46A 4FBPA 1FPBA 3FVOA 4NG7A 3E13X 1WDNA 4F3BA 4JWOA 4OEVA 4OA4A 3K00A 3U93A 5ESYA 3IJXB 3T96B 2REJA 1YXIA 3UK4A 5LOMA 2Q88A 5HM4B 4KQPA 3SEUA 3KG2A 3MPLA 1JVYA 2KQZA 2DYXA 3LSXA 4XKQA 1B7ZA 1RKMA 5CMMA 4O94A 1MH4A 3C33A 4Q0CA 4F3GA 1VR5A 3DP6A 4KCCA 3CSBA 5AA1A 5HPQA 1RYOA 4OERA 1D9QA 3B8BA 4NF8B 3RQTA 5H8SA 5B70A 1NV0A 1HSJA 1JP4A 2Y7IA 2ZMBA 1M5BA 1B1XA 1P1OA 3ILUB 4I1DA 1B4HA 3IB0A 3KBRA 5ELVA 2OZZA 2V4CA 1SQYA 3VFJA 4N15A 3IOWA 4GX3A 2PX1A 3FIRA 1LFHA 3SKPA 3IO4A 2R71A 2ZXTA 4XF5A 3SEYA 1JW1A 1JW4A 3MBPA 4GBVA 3BFTA 4PFWA 2CZLA 1AL3A 1B3GA 3G7WA 4MEVA 3H6VA 2I48A 2R8TA 3OO8A 4LQ2A 5TPAA 1VFDA 1UIVA 3ZKKA 2YLNA 4PCDA 2G29A 4RYAA 1NV2A 1Y1ZA 4GWZA 2O1LA 4MNPA 2GHAA 4PGPA 3CFLA 3PUWE 2XXXA 3OD7A 4C1TA 4YU0A 4MNCA 3RUMA 4Q5TA 4RY1A 4Z7EA 5H8NA 4HCYA 5CM6A 4DXUA 2XX8A 4BDQA 3MPKA 1UTHB 3FVGA 4OWDA 4I3EA 3S2VA 4KD5A 1ZJLA 1QULA 1SDXA 4JSDA 5ITOA 1PB9A 3HFUA 1FBFA 3RPLA 1ELJA 1H45A 3ZS6A 2Q89A 5JK4A 4X48A 2OBGA 1D4NA 3H7MA 2A5TA 2QVUA 2X7PA 1MDP1 4JXIA 3KC1A 3N26A 2W7YA 3R6UA 2AYSA 4DCXA 3OO6A 2FHYA 5LDZA 2Y7PA 4IY6A 3IB1A 2OK2A 1SI0A 5BUUA 3FV2A 2ZZXA 4EDPA 5IAIA 3T9VA 4JVIA 2XXKA 1EZPA 1BLFA 3IL1B 1ZBMA 2PFZA 3SERA 5I59A 1NNKA 2B3FA 1WODA 2R6GE 1XOCA 5H8FA 3MQ9A 1FQAA 4O3BA 1Y1MA 4YZZA 2QRYA 1NUZA 3TYHA 1IMCA 4FIMA 1MQDA 1MPBA 4O8MA 2DE4A 4F29A 1MH3A 2O6AA 1LAXA 4IY5A 4JBZA 4GX6A 3G3IA 5EYHA 4O7MA 4RK2A 2HQ0A 3B6WA 2OPEA 4PBQA 5IZZA 1SPIA 1BP5A 4QFKA 4BLAA 2CZIA 4RPNA 1I6BA 3SEXA 1B3LA 4I3YA 2F8DA 3OOAA 3IAZA 3RY3A 3FXUA 1LBXA 4U21A 1US5A 4IO6A 3EKIA 4MFIA 5A5XB 2CZKA 1TWYA 2I49A 1N7WA 3KZGA 1B3HA 2IEEA 2Y7WA 3MVZA 3TUSA 3FVKA 2PCRA 3ROJA 3PGFA 4LZ5A 2VPOA 2CMOA 3HSTA 1NV7A 1FQFA 3FZVA 1N3XA 3EHTA 3USDA 3S9NC 1VSOA 3KN8A 4IB2A 2HAVA 4IO3A 4PFUA 2Q9TA 4OMBA 4FECA 4I40A 4G8MA 4F1VA 1FQCA 3ISPA 4YKPA 4ZS9A 2Q2CA 1D9YA 1SBPA 4QXDA 3I5OA 4R9GA 1I69A 1NL5A 2H99A 3V83A 3E4RA 2JJKA 3PPRA 2Z8FA 2GRVA 1Z7NE 4LZ8A 1MQIA 1QUIA 2ZZVA 3TELA 1NKXA 3VVEA 3JZJA 4JVCA 3TTLA 2GFEA 3RGYA 3VVDA 1MM7A 5FBPA 3CI8A 3B6TA 3FXBA 3I6VA 1XS5A 3OEKA 1R9LA 1DTGA 4DCYA 3F11A 3TFLA 2HCAA 3H6UA 1FSAA 3GXAA 1FTOA 3W9VA 1POY1 3LUYA 3IOUA 4ELOA 4IR8A 4GD5A 4LN5A 1FJ6A 4MF3A 2QVRA 5EYGA 1QVSA 1LBBA 4GL8A 1NUXA 4C0RA 2V93A 2B4MA 4N07A 1G0IA 4OVRA 2HZLA 4ELQA 1P99A 3NOHA 3T66A 4ECFA 1AH5A 4ZEIA 4MHFA 5CI5A 4MIJA 3H3GA 1ZTYA 4BDMA 1US4A 4F22A 3T0JA 2XXRA 4R6YA 4G68C 2WYPA 4QSEA 3LSFB 4QRZA 4O3AA 3KBZA 4KPTA 1FBPA 4RXLA 1JEUA 1ZLQA 4JSOA 5H8QB 2DXRA 4OEUA 5EQ7A 4G4PA 2NWJA 4KHZE 5CBSA 4FEDA 3CG3A 3N94A 4NGUA 3TQLA 3O6GA 3MC2A 4MLQA 1LAHE 3OEMA 2OX3A 4PDHA 3A3UA 3B50A 4OFOA 2QMXA 1DSNA 4P0GA 2ZZWA 3KEIA 3G3HA 2HHMA 3KOSA 4O7IA 2I3VA 3UGWA 4FAJA 5TP9A 4N4UA 3MJNA 4P0IA 3RT8A 5I2KB 1FBDA 3K6UA 3MVWA 1LB9A 2VP1A 5JTYB 3GBAA 4TQUQ 3DP8A 3GLBA 4OVQA 3CFZA 3U1OA 3VE1B 2VT5A 3Q26A 1P1NA 5L9SA 2O7IA 5ET5A 3G3GA 1IMBA 5AA3A 3N5LA 3GZGA 4IO5A 3RPWA 1CE2A 4HE1A 3RNNA 5IZ1A 4LA9A 2XD2A 2VGQA 3B6QA 4GVOA 3PD9A 4Z0IA 3ONMA 3VLVA 1Y20A 1SD3A 4OVPA 3TQWA 3H4ZA 3CHGA 4IO2A 4DXBA 2DDKA 4NWDA 2P0SA 2FA7A 5CMCA 1IITA 1NFTA 3PUYE 4QBAA 5LTCA 4MH5A 4H45A 4R6KA 2WYKA 4R6HA 1IMAA 4E0WA 5I56A 4GF8A 1PDAA 3CFXA 1H76A 1GGGA 4H6DA 4N81A 3K0VA 4NF6B 3OMBA 2RCBA 2DXYA 5ET8A 1LGBC 4IGRA 4MCOA 4PE3A 3PPPA 3U65A 3QUJA 4P56A 1QJMA 1Q1KA 2VD2A 1OVTA 4ZE9A 4OHNA 3O2AA 3MYUA 4OFJA 5DVIA 5ITPA 2O7UA 1FPEA 1LCTA 2Y7KA 2DVZA 5I2KA 2F3DA 1FTKA 4POWA 3M3FA 5AA4B 2UYEA 2VD3A 2DWAA 3IORA 2OCUA 3ZSFA 5IZ3A 4PFIA 5EQ8A 3DP4A 4NX1A 2A5TB 4M4GA 5IGAA 5F1QA 3BIHA 1IIWA 3TDJA 4U1ZA 5I59B 1P1UA 3TCGA 1NV5A 1CB6A 4F2OA 2THIA 2AIXA 4YB7A 1R6ZA 4P11A 2FBPA 3QIMA 3KSXA 4NF0A 1B51A 2D3IA 1MXVA 1ZMGA 4F18A 1A8FA 4EQ9A 4LONB 3K1PA 4H46A 5CC2A 5H8FB 3KC0A 5L9MA 3BFUA 1A7LA 2H25A 4HXVA 4OFLA 3BBRA 5IZ3B 3E79A 4PF8A 4R72A 1XT8A 2CEXA 1PBQA 1YAEA 2MKZA 2RCAA 3MUQA 1LFGA 4BDRA 2DE2A 3U72A 5ISUA 1MXZA 4GOTA 3C31A 1IXCA 2XXTA 3TPAA 3KSJA 4ZEKA 3O29A 1B7HA 3LUZA 4YB5A 3KFMA 3RTWB 2NUVA 3QUFA 3K6XA 2QS2A 3E3KA 4DI3D 4QFLA 1N3WA 2ZYKA 1OIBA 1FQEA 1JNFA 2OWZA 4G68B 4N8YA 3OENA 4XEQA 5FHNA 4O3CA 3IX1A 2XX7A 5H8NB 3ODBA 5KCJB 2CZHA 3VDFA 2HFBA 2QFLA 4KFQA 2VHAA 3C34A 4YMBA 2XXQA 5IM2A 1RDZA 3EHSA 1M5CA 3TAJA 3OSQA 1LEVA 1PC3A 1B9JA 3W9WA 4G8HA 1MQJA 4PFRA 3ECRA 5EQ9A 1S9TA 1A40A 1Y4TA 1FTLA 3SEWA 1A8EA 5H8HA 3E78A 5AA2A 3QK6A 3UP9A 4PAKA 4NF5A 1PBPA 4P3LA 4LATA 3V5AA 4WEDA 3JV9A 4XKPA 4ZECA 3FUZA 2E0SA 4H8IA 4X1DA 3S9LC 4DLDA 3TTNA 2UYFA 3EQ1A 5DTBA 1M5EA 3S9MC 1FBEA 1B0HA 1XHYA 3OSRA 4TLMB 1IMDA 1IQ7A 2F5XA 2F7CA 1GV8A 4ZEDA 2F6GA 1SI1A 4F1UA 4OYVA 1SW4A 3PPNA 4YICA 1MQGA 2FIXA 3BKIB 2CEYA 4F2QA 4UACA 1B52A 4XFEA 1JETA 2DOJA 5J1DA 1NV6A 3CR9A 5KDTB 1FRPA 5I7IA 4JWXA 1A99A 4XTCQ 2QMWA 2RC7A 1FPIA 2E1SA 3BIGA 3WAFA 2AL4A 3OO7A 3EN3A 5I58B 1QW0A 2Q8JA 4QSDA 1HSEA 1S7YA 2XXVA 4FJPA 4U4XA 3TTMA 5KDTA 4RK9A 3E9XA 2Q2AA 5AE4A 1DCUA 1J1NA 4OETA 1NMUA 1G0HA 5FHOA 5H8HB 3C35A 4Q30B 5DEXA 4ESWA 5M2VA 4KXPA 4KYEA 4DDDA 3C32A 3V89B 4HS7A 4QSCA 1MXXA 4OZ9A 4H5FA 5TU0A 4OVSA 1XVXA 3K1MA 1YCJA 3MZ1A 2RF1A 2PT2A 2V3UA 2XWOA 1LBWA 3SESA 3SZPA 4F1YA 1TT1A 1N76A 3KJTA 1FJ9A 5HBCA 4FEBA 3RLFE 3QMFA 1MY2A 1PB8A 2Z8EA 1JW5A 1VDWA 1M5DA 4N6KA 4TOZA 1O64A 1B40A 1MPDA 3R7XA 4Q8RA 3N6TA 1VFEA 3CG1A 3KJ7A 4XKNA 4AS4A 2GQ1A 3MSTA 3M8UA 4X04A 3PMXA 4N6DA 3PPQA 3HHFA 3RTFB 1FTAA 3FVNA 4GWWA 4PE5B 4PFBA 4OTEA 2XA5A 1MM6A 3K6WA 1N04A 2F78A 4NEDA 4ONYA 2DWJA 3MVXA 2AL5A 1MG1A 4NQ8A 2XHDA 1XI6A 1A55A 2XWVA 2I4CA 2HXRA 1B3EA 4NF4A 4FORA 3D4GA 1AMFA 3K01A 3C36A 3Q28A 1MXYA 3W15C 2XXHA 3PTYA 3MP8A 1DPPA 2IA4A 3RYDA 1GR2A 1EYKA 1MXWA 3FXRA 2UXAA 4BDNA 4HE0A 2Z22A 1EZ9A 2PBWA 2XWIA 3EHUA 3HPIA 4P1EA 2VPNA 4P47A 3HCQA 3LSWA 3THIA 4NF4B 4X8RA 4IO4A 2XXIA 4IGTA 4OVTA 5AA2D 3P7IA 1SW2A 3PU5A 2F35A 4U2RA 2DQVA 1CNQA 4PTKA 5I57A 1EZOA 1QUJA 4P8BA 1Y3QA 2ESNA 4U23A 3ZKLA 4XXUA 3MW0A 4MAGA 4R9FA 4EXKA 1O63A 2XXYA 1GTKA 1LBYA 1FTMA 4MMPA 1IMEA 3MVYA 4UA8A 2QS1A 3K1NA 5A5XA 3SEVA 3U8QA 4GQOA 3FASA 3IJOB 3V8XB 4AQ4A 3FD3A 2F36A 1FW0A 3CVGA 3TEPA 1EYJA 3UN6A 1ANFA 2BJIA 5ET6A 2P3VA 2FIEA 3QAXA 4PFYA 2UVIA 2ZNTA 2B65A 2F7BA 3IK6B 4E0XA 2F7AA 5CRYA 2PVUA 5CBRA 1NI9A 3IFAA 2ONRA 1N7XA 1UTHA 2G93A 2GH9A 2B4LA 3IOVA 5I56B 4PETA 4MLVA 4G61A 3TCHA 3VV5A 4IO7A 3FXQA 2OJTA 4ZZEA 2RKMA 5K2YA 4H65A 1MY3A 4RA1A 3UORA 3WAEA 2F97A 2WBDA 1LLSA 5DVJA 1B58A 3FATA 1T0KA 4LP2B 1YTVA 2VOZA 4M1VA 3M3LA 3O9PA 2FVZA 2I0BA 4GX4A 4HE2A 1TFDA 4ND9A 5EQAA 4P1LA 3VXCA 4NMYA 1JVXA 1EH3A 1FBHA 4AB5A 3DM0A 3PMWA 2Y5LA 3LC8A 2I4BA 1MY0A 3O97A 2OWTA 4L17A 1B3FA 3A3CA 4ESXA 4GIZA 4PC9A 1INPA 2WBBA 1D3KA 1Y3NA 4QHQA 5F7VA 1R9QA 4YB6A 2F34A 4YKIA 2O68A 1M5FA 4FE8A 5KZTA 1FTJA 4GWSA 2DSFA 1IXHA 3VXBA 4N13A 2REGA 4QF9A 5JTYA 4BDLA 1DTZA 4PDDA 3T9XB 2V25A 3T9HB 4EF1A 2H98A 5TP9B 4GBWA 1URSA 4JB7A 1II5A 4RPOA 1KA0A 1IMFA 3CIJA 4NTLA 4H5GA 2ZYNA 4KYSA 2ZYOA 2PT1A 4I9DA 4R2FA 2QS4A 3MZ9A 3KGCA 4NE4A 1USYE 1B05A 5FTIA 2UVGA 3UIFA 3QSLA 4UABA 4NF8A 1LAGE 3FJGA 1H44A 1I6QA 1OQHA 4P9KA 2KLFA 5CMBA 2DE3A 2Y84A 3D4CA 1I6AA 3TMGA 1NNFA 3RT6B 1AWBA 1KWHA 1MY1A 5TPAB 1DBZA 1OLAA 3KN3A 3D1RA 4WEPA 4THIA 4H8JA 1FPDA 1LBZA 1B5JA 5ICQA 3IFCA 4DE8A 1B5HA 3HV1A 4EF2A 4OVJA 1Y9UA 4QFOA 4I8CA 1MY4A 2XXPA 3VLWA 1FBGA 4GWUA 4U22A 1IUDA 4G68A 1RYXA 2NXOA 2Q8MA 5J16A 4OQOA 1DK4A 5DEXB 4MJOA 2X7QA 4N6PA 1USYH 1UTBA 1YPNA 4MNIA 4OESA 3S9EA 2XWKA 4N91A 1NV1A 3L6HA 3C4MA 3OXNA 4F39A 1NV3A 1Q9DA 4JWYA 1N84A 4PF6A 4EUOA 1UIUA 3JYRA 1K9ZA 3IR1A 1HSLA 2P2AA 1NH7A 4NHBA 4ZZAA 4F3SA 1OLCA 1DOTA 1BK4A 2ANJA 1TXFA 4YMAA 2Y5KA 3A29A 3FBPA 4NN3A 1RDYA 2O69A 4EQ7A 1XVYA 3TODA 3MP1A 4X1BA 4GLIA 3K2DA 1B1HA 4F19A 1B5IA 1SYHA 1GVCA 1BTJA 2RC8A 5I84A 5F24A 3OELA 4H67A 2I6EA 4GXSB 4NAPA 1OQGA 2DP8A 2HXWA 4X9TA 2ALUA 3R26A 5KCJA 1Y3PA 3K4UA 3H03A 3O6IA 2DWHA 4PGNA 2H4IA 2XX9A 1LCFA 2ZNSA 4LVQA 2X26A 5I2NB 5AA2B 4GL0A 1NNTA 1UTBB 2YJPA 5AA4A 1DPEA 4FATA 1B32A 3LR1A 3PMVA 3HO7A 2FYIA 2HEUA 1D9VA 2V3TA 1UQWA 5IKBA 3PUVE 4OXVA 2QVVA 1MXUA 1AOVA 1QKBA 3PUXE 1ATGA 1B2HA 1IXIA 3UA8A 2ZNUA 1IZ1A 1FPJA 4MBPA 3MP6A 3Q29A 2WKYA 1AIVA 1QUKA 4PBHA 1NNPA 3N6UA 2O1MA 3G3FA 3CRBA 2YPNA 3K02A 4G77A 4YAHX 3SDFA 3FJ7A 1MPCA 2QJEA 4PP0A 2DVCA 3IOTA 5FHMA 3U92A 4DIGA 4EQBA 3O6HA 2PFYA 2HAUA 2ONSA 2P3NA 3RPLB 4ISUA 3TTRA 2O84X 2QPQA 2QL3A 1LBVA 1SW5A 4N8GA 5DVFA 4HW8A 4BDOA 1F9BA 2L5VA 2OLBA 2Z23A 1FBCA 1LB8A 3G3KA 3Q25A 3MWBA 4K3FA 1SW1A 1O7TA 2NOOA 1LSTA 4XKRA 4C1UA 5BWJA 4DI4B 1EYIA 1QGXA 4PAFA 5ICTA 3TCFA 4R74A 2HPGA 4YKKA 3T1BA 3HN0A 2D5WA 3Q27A 3TTKA 1MS7A 4NF6A 3PPOA 1PB7A 3DELB 3S4UA 5CMKA 2F3BA 2RC9A 1B4ZA 2UVJA 4KYDA 1OMPA 4POXA 2I58A 2Z8DA 4OANA 3VVFA 2Y7RA 4OENA 2I0CA 4GFRA 4KR5A 5EHSA 4GWOA 2Q74A 2RINA 2PYYA 2H9BA 1MQHA 5I5PA 3PD8A 3TKDA 2NVUB 4GWXA 1LBCA 3B7DA 3KOTA 3HHGA 3OO9A 2HZKA 4HCWA 2LAOA 3A09A 4ELPA 3H6WA 4N17A 5T3JA 1XC1A 4F3PA 3H6TA 1BKAA 1URDA 1URGA 5ET7A 1NH8A 1H43A 5A5LA 1ZIUA 1B0LA 5I57B 3L6GA 3PV0E 4JDFA 2V84A 1TFAA 2QS3A 5DW8A 1POTA 1MDQA 4JVDA 4H1XA 5DYHA 2XD3A 2ONKE 2ZYMA 1FPKA 2P1SA 1Y4CA 3T22A 4H0WA 5L9OA 1R1NA 4ZDMA 3CSGA 1MRPA 5B7DA 1RDXA 1B7UA 3TZAA 1A54A 4TLLB 1YYZA 3VLUA 1EU8A 3U94A 2WX9A 4PFTA 5DT6A 4R75A 1DMBA 4LZ7A 4R2BA 4DZ1A 5I3SA 2XXWA 3AXFA 3QXMA 1NUWA 1Q35A 3MZBA 5EYFA 4YKJA 3ILTB 5JEIA 2F6PA 1IEJA 4DXCA 1S50A 2OPDA 4WKMA 1H3DA 3QYTA 1WVJA 4PAIA 1LFIA 3T9UA 3G3JA 2BJJX 1FPFA 1K9YA 1P1WA 4F31B 4AS5A 2KR0A 4ELRA 1LAFE 1N0TA 1P1QA 2QSXA 4WXJA 1Z7ME 3SETA 3EF7A 3C9HA 1FCKA 3IB2A 4U4SA 5I58A 1VE4A 4GRKA 4GXAA 5I2NA 3I3VA 3PUZE 3O66A 1JQFA 2V3QA 5EHMA 1FPLA 2O51A 2H5YA 1SYIA 3O28A 4ZEFA 2DWIA 4G2ZA 3M3KA 1OVBA 2M8CA 3H06B 4ZEBA 4KI0E 1NUYA 2XXUA 3FJMA 4MX6A 1YZ0A 2GHBA 3K6VA 5FTHA 1FQBA 3GYYA 4LUBA 5H8QA
chains in the Genus database with same CATH topology
1QGXA 2CZIA 4PAFA 4P8BA 2WX9A 2ZZWA 5CM6A 3LUZA 2HHMA 4PGNA 1FBGA 4GWUA 4I3YA 1FBEA 3MYUA 2WEFA 1NV0A 1FSAA 1JP4A 2HPGA 4O7IA 4PC9A 3T1BA 1INPA 1IMDA 2WBBA 2F5XA 1LBXA 3W9VA 5I3SA 4MAGA 3EKIA 4N4UA 2Q8MA 4P56A 5J16A 4AS4A 1FPEA 1NUWA 2GQ1A 3MSTA 4DI3D 1DK4A 4F1UA 4IR8A 4YICA 4LN5A 2FIXA 2CZKA 4MJOA 2CEYA 2F3DA 4I3EA 2DVZA 1FBDA 1FJ6A 4X04A 4XFEA 1LBYA 3HFUA 4N6DA 1FPGA 2F3BA 5J1DA 1NV6A 2OWZA 4GWSA 2V4CA 4OVQA 4MMPA 1IMEA 1FBFA 4N8YA 2VT5A 3LV0A 3RPLA 2QVRA 4MNIA 2PCRA 2QVVA 1FTAA 5EYGA 5IZ3A 3ROJA 4PDDA 4PFIA 4GWWA 1FRPA 5ET5A 4XEQA 5I7IA 5EQ8A 4N15A 4NX1A 4OANA 5JK4A 2XWKA 1IMBA 4N91A 4PFBA 1NUXA 1NV1A 2VPOA 2B4MA 1G0IA 1FPIA 1NV7A 1NV4A 1NV3A 2CZHA 1Q9DA 4GWYA 2HZLA 2XA5A 4OVRA 5IGAA 4PF6A 4GBWA 4PAIA 3BIHA 3BIGA 4GX3A 1EYJA 2QVUA 3NOHA 4NQ8A 1K9ZA 3KC1A 4HE1A 1FPJA 1XI6A 2QFLA 1FPFA 1KA0A 1K9YA 2BJIA 2Q74A 5IZ1A 4XF5A 4MHFA 2XWVA 1IMFA 4AS5A 5IM2A 5I5PA 1RDZA 2HXRA 2Q9TA 4MIJA 5ET6A 2KR0A 2P3VA 1NV5A 4GWXA 4PBHA 2FIEA 4I40A 1KA1A 4F1VA 1DCUA 1LEVA 4GBVA 1G0HA 4NHBA 2FHYA 2FBPA 3ISPA 2HZKA 4OVPA 4HCWA 1KZ8A 3T0JA 4NF0A 5LDZA 4MEVA 3W9WA 3CHGA 1NI9A 1BK4A 3IFAA 5T3JA 4N17A 2ZZXA 2DDKA 2WYPA 4F18A 4KXPA 4QXDA 3KBZA 2R8TA 2Y5KA 3A29A 3FBPA 4JVIA 2XXKA 4H46A 5ET7A 4FBPA 1FPBA 4NN3A 1RDYA 4PFRA 3PTYA 3KC0A 2PFZA 4NG7A 1FBPA 5EQ9A 5A5LA 2B4LA 2JJKA 4PETA 3RYDA 4PCDA 4G61A 4QBAA 2PFYA 2V3QA 4UABA 5LTCA 1FPLA 2P3NA 1EYKA 3RPLB 1NV2A 4OA4A 4OVSA 4YZZA 4H45A 4P9KA 1NUZA 5ESYA 1IMCA 2ZZVA 1YXIA 4HE0A 5EQ7A 2WYKA 4HXVA 2QPQA 4GWZA 2DE3A 4MNPA 4O8MA 2DE4A 1LBVA 2XWIA 1IMAA 2XWOA 4N8GA 1LBWA 5DW8A 2WBDA 4JVCA 2VPNA 5IZ3B 4P1EA 4PGPA 3SZPA 3E79A 4P47A 4F19A 4GX6A 4JVDA 5EYHA 2KQZA 3E78A 4O7MA 1AWBA 4PF8A 4NGUA 2L5VA 1NUYA 1DBZA 4X8RA 2CEXA 3D1RA 4M1VA 1FPKA 4MX6A 5FBPA 4N81A 1FJ9A 2FVZA 1FPDA 4GX4A 4HE2A 5F24A 1LBZA 4O94A 4OVTA 4PAKA 3QMFA 1YZ0A 1FBCA 5EQAA 4MNCA 4P1LA 4P3LA 3IFCA 2MKZA 4NAPA 3FXBA 4PBQA 2OX3A 5ET8A 4PDHA 2DE2A 5IZZA 1FBHA 3B50A 4MCOA 1SPIA 1VDWA 4X9TA 1RDXA 4N6KA 2Y5LA 4PE3A 1CNQA 1D9QA 4PTKA 3U65A 3GYYA 1YYZA 4DI4B 1EYIA 4HCYA 3B8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGX A;  2CZI A;  3LUZ A;  2HHM A;  1FBG A;  4GWU A;  4I3Y A;  1FBE A;  2WEF A;  1NV0 A;  1FSA A;  1JP4 A;  4O7I A;  1INP A;  1IMD A;  2WBB A;  1LBX A;  5I3S A;  2Q8M A;  5J16 A;  4AS4 A;  1FPE A;  1NUW A;  2GQ1 A;  1DK4 A;  4IR8 A;  2FIX A;  2CZK A;  4MJO A;  2F3D A;  4I3E A;  1FBD A;  1FJ6 A;  1LBY A;  1FPG A;  2F3B A;  1NV6 A;  2OWZ A;  4GWS A;  1IME A;  1FBF A;  2VT5 A;  3LV0 A;  3RPL A;  2QVR A;  2PCR A;  2QVV A;  1FTA A;  5EYG A;  5IZ3 A;  3ROJ A;  4GWW A;  1FRP A;  5ET5 A;  5EQ8 A;  1IMB A;  1NUX A;  1NV1 A;  1G0I A;  1FPI A;  1NV7 A;  1NV4 A;  1NV3 A;  2CZH A;  1Q9D A;  4GWY A;  4GBW A;  3BIH A;  3BIG A;  4GX3 A;  1EYJ A;  2QVU A;  1K9Z A;  3KC1 A;  4HE1 A;  1FPJ A;  1XI6 A;  2QFL A;  1FPF A;  1KA0 A;  1K9Y A;  2BJI A;  2Q74 A;  5IZ1 A;  1IMF A;  4AS5 A;  1RDZ A;  5ET6 A;  2P3V A;  1NV5 A;  4GWX A;  2FIE A;  4I40 A;  1KA1 A;  1DCU A;  1LEV A;  4GBV A;  1G0H A;  2FHY A;  2FBP A;  1KZ8 A;  3T0J A;  5LDZ A;  1NI9 A;  1BK4 A;  3IFA A;  5T3J A;  2DDK A;  4KXP A;  4QXD A;  3KBZ A;  2R8T A;  2Y5K A;  3A29 A;  3FBP A;  4H46 A;  5ET7 A;  4FBP A;  1FPB A;  1RDY A;  3KC0 A;  1FBP A;  5EQ9 A;  5A5L A;  2JJK A;  3RYD A;  4G61 A;  1FPL A;  2P3N A;  1EYK A;  3RPL B;  1NV2 A;  4H45 A;  1NUZ A;  5ESY A;  1IMC A;  1YXI A;  4HE0 A;  5EQ7 A;  4HXV A;  4GWZ A;  1LBV A;  1IMA A;  1LBW A;  5DW8 A;  2WBD A;  5IZ3 B;  4GX6 A;  5EYH A;  1AWB A;  1NUY A;  1DBZ A;  3D1R A;  1FPK A;  5FBP A;  4N81 A;  1FJ9 A;  2FVZ A;  1FPD A;  4GX4 A;  4HE2 A;  5F24 A;  1LBZ A;  3QMF A;  1YZ0 A;  1FBC A;  5EQA A;  3IFC A;  2OX3 A;  5ET8 A;  1FBH A;  1SPI A;  1VDW A;  1RDX A;  2Y5L A;  1CNQ A;  1D9Q A;  4PTK A;  1YYZ A;  1EYI A;  3B8B A; 
#chains in the Genus database with same CATH topology
 4HTG A;  3LSL A;  3GBB A;  2A5S A;  2B3B A;  2WEF A;  1FQD A;  3IO6 A;  2DS9 A;  1PEB A;  1BIY A;  2I3W A;  2FNC A;  1ZU0 A;  2PMS A;  4QFN A;  4G8N A;  4LQ5 A;  2OWS A;  1JEV A;  3FV1 A;  1FPG A;  4ZE8 A;  3LV0 A;  2R9J A;  4QFP A;  3FGS A;  4RJZ A;  1B6H A;  4EXL A;  1NV4 A;  4GWY A;  1SVX B;  4KCD A;  4R73 A;  3LBS A;  3T93 B;  2ABH A;  4RNS A;  4NWC A;  5K2X A;  1L5T A;  1KA1 A;  1IXG A;  4AB6 A;  4I62 A;  3RN8 A;  5L8D A;  3MAM A;  2UVH A;  4U1O A;  1KZ8 A;  3EPE A;  1ZKB A;  1QKA A;  4NF5 B;  4XIG Q;  3KN7 A;  2D21 A;  4PQJ A;  3DLN A;  1B46 A;  4FBP A;  1FPB A;  3FVO A;  4NG7 A;  3E13 X;  1WDN A;  4F3B A;  4JWO A;  4OEV A;  4OA4 A;  3K00 A;  3U93 A;  5ESY A;  3IJX B;  3T96 B;  2REJ A;  1YXI A;  3UK4 A;  5LOM A;  2Q88 A;  5HM4 B;  4KQP A;  3SEU A;  3KG2 A;  3MPL A;  1JVY A;  2KQZ A;  2DYX A;  3LSX A;  4XKQ A;  1B7Z A;  1RKM A;  5CMM A;  4O94 A;  1MH4 A;  3C33 A;  4Q0C A;  4F3G A;  1VR5 A;  3DP6 A;  4KCC A;  3CSB A;  5AA1 A;  5HPQ A;  1RYO A;  4OER A;  1D9Q A;  3B8B A;  4NF8 B;  3RQT A;  5H8S A;  5B70 A;  1NV0 A;  1HSJ A;  1JP4 A;  2Y7I A;  2ZMB A;  1M5B A;  1B1X A;  1P1O A;  3ILU B;  4I1D A;  1B4H A;  3IB0 A;  3KBR A;  5ELV A;  2OZZ A;  2V4C A;  1SQY A;  3VFJ A;  4N15 A;  3IOW A;  4GX3 A;  2PX1 A;  3FIR A;  1LFH A;  3SKP A;  3IO4 A;  2R71 A;  2ZXT A;  4XF5 A;  3SEY A;  1JW1 A;  1JW4 A;  3MBP A;  4GBV A;  3BFT A;  4PFW A;  2CZL A;  1AL3 A;  1B3G A;  3G7W A;  4MEV A;  3H6V A;  2I48 A;  2R8T A;  3OO8 A;  4LQ2 A;  5TPA A;  1VFD A;  1UIV A;  3ZKK A;  2YLN A;  4PCD A;  2G29 A;  4RYA A;  1NV2 A;  1Y1Z A;  4GWZ A;  2O1L A;  4MNP A;  2GHA A;  4PGP A;  3CFL A;  3PUW E;  2XXX A;  3OD7 A;  4C1T A;  4YU0 A;  4MNC A;  3RUM A;  4Q5T A;  4RY1 A;  4Z7E A;  5H8N A;  4HCY A;  5CM6 A;  4DXU A;  2XX8 A;  4BDQ A;  3MPK A;  1UTH B;  3FVG A;  4OWD A;  4I3E A;  3S2V A;  4KD5 A;  1ZJL A;  1QUL A;  1SDX A;  4JSD A;  5ITO A;  1PB9 A;  3HFU A;  1FBF A;  3RPL A;  1ELJ A;  1H45 A;  3ZS6 A;  2Q89 A;  5JK4 A;  4X48 A;  2OBG A;  1D4N A;  3H7M A;  2A5T A;  2QVU A;  2X7P A;  1MDP 1;  4JXI A;  3KC1 A;  3N26 A;  2W7Y A;  3R6U A;  2AYS A;  4DCX A;  3OO6 A;  2FHY A;  5LDZ A;  2Y7P A;  4IY6 A;  3IB1 A;  2OK2 A;  1SI0 A;  5BUU A;  3FV2 A;  2ZZX A;  4EDP A;  5IAI A;  3T9V A;  4JVI A;  2XXK A;  1EZP A;  1BLF A;  3IL1 B;  1ZBM A;  2PFZ A;  3SER A;  5I59 A;  1NNK A;  2B3F A;  1WOD A;  2R6G E;  1XOC A;  5H8F A;  3MQ9 A;  1FQA A;  4O3B A;  1Y1M A;  4YZZ A;  2QRY A;  1NUZ A;  3TYH A;  1IMC A;  4FIM A;  1MQD A;  1MPB A;  4O8M A;  2DE4 A;  4F29 A;  1MH3 A;  2O6A A;  1LAX A;  4IY5 A;  4JBZ A;  4GX6 A;  3G3I A;  5EYH A;  4O7M A;  4RK2 A;  2HQ0 A;  3B6W A;  2OPE A;  4PBQ A;  5IZZ A;  1SPI A;  1BP5 A;  4QFK A;  4BLA A;  2CZI A;  4RPN A;  1I6B A;  3SEX A;  1B3L A;  4I3Y A;  2F8D A;  3OOA A;  3IAZ A;  3RY3 A;  3FXU A;  1LBX A;  4U21 A;  1US5 A;  4IO6 A;  3EKI A;  4MFI A;  5A5X B;  2CZK A;  1TWY A;  2I49 A;  1N7W A;  3KZG A;  1B3H A;  2IEE A;  2Y7W A;  3MVZ A;  3TUS A;  3FVK A;  2PCR A;  3ROJ A;  3PGF A;  4LZ5 A;  2VPO A;  2CMO A;  3HST A;  1NV7 A;  1FQF A;  3FZV A;  1N3X A;  3EHT A;  3USD A;  3S9N C;  1VSO A;  3KN8 A;  4IB2 A;  2HAV A;  4IO3 A;  4PFU A;  2Q9T A;  4OMB A;  4FEC A;  4I40 A;  4G8M A;  4F1V A;  1FQC A;  3ISP A;  4YKP A;  4ZS9 A;  2Q2C A;  1D9Y A;  1SBP A;  4QXD A;  3I5O A;  4R9G A;  1I69 A;  1NL5 A;  2H99 A;  3V83 A;  3E4R A;  2JJK A;  3PPR A;  2Z8F A;  2GRV A;  1Z7N E;  4LZ8 A;  1MQI A;  1QUI A;  2ZZV A;  3TEL A;  1NKX A;  3VVE A;  3JZJ A;  4JVC A;  3TTL A;  2GFE A;  3RGY A;  3VVD A;  1MM7 A;  5FBP A;  3CI8 A;  3B6T A;  3FXB A;  3I6V A;  1XS5 A;  3OEK A;  1R9L A;  1DTG A;  4DCY A;  3F11 A;  3TFL A;  2HCA A;  3H6U A;  1FSA A;  3GXA A;  1FTO A;  3W9V A;  1POY 1;  3LUY A;  3IOU A;  4ELO A;  4IR8 A;  4GD5 A;  4LN5 A;  1FJ6 A;  4MF3 A;  2QVR A;  5EYG A;  1QVS A;  1LBB A;  4GL8 A;  1NUX A;  4C0R A;  2V93 A;  2B4M A;  4N07 A;  1G0I A;  4OVR A;  2HZL A;  4ELQ A;  1P99 A;  3NOH A;  3T66 A;  4ECF A;  1AH5 A;  4ZEI A;  4MHF A;  5CI5 A;  4MIJ A;  3H3G A;  1ZTY A;  4BDM A;  1US4 A;  4F22 A;  3T0J A;  2XXR A;  4R6Y A;  4G68 C;  2WYP A;  4QSE A;  3LSF B;  4QRZ A;  4O3A A;  3KBZ A;  4KPT A;  1FBP A;  4RXL A;  1JEU A;  1ZLQ A;  4JSO A;  5H8Q B;  2DXR A;  4OEU A;  5EQ7 A;  4G4P A;  2NWJ A;  4KHZ E;  5CBS A;  4FED A;  3CG3 A;  3N94 A;  4NGU A;  3TQL A;  3O6G A;  3MC2 A;  4MLQ A;  1LAH E;  3OEM A;  2OX3 A;  4PDH A;  3A3U A;  3B50 A;  4OFO A;  2QMX A;  1DSN A;  4P0G A;  2ZZW A;  3KEI A;  3G3H A;  2HHM A;  3KOS A;  4O7I A;  2I3V A;  3UGW A;  4FAJ A;  5TP9 A;  4N4U A;  3MJN A;  4P0I A;  3RT8 A;  5I2K B;  1FBD A;  3K6U A;  3MVW A;  1LB9 A;  2VP1 A;  5JTY B;  3GBA A;  4TQU Q;  3DP8 A;  3GLB A;  4OVQ A;  3CFZ A;  3U1O A;  3VE1 B;  2VT5 A;  3Q26 A;  1P1N A;  5L9S A;  2O7I A;  5ET5 A;  3G3G A;  1IMB A;  5AA3 A;  3N5L A;  3GZG A;  4IO5 A;  3RPW A;  1CE2 A;  4HE1 A;  3RNN A;  5IZ1 A;  4LA9 A;  2XD2 A;  2VGQ A;  3B6Q A;  4GVO A;  3PD9 A;  4Z0I A;  3ONM A;  3VLV A;  1Y20 A;  1SD3 A;  4OVP A;  3TQW A;  3H4Z A;  3CHG A;  4IO2 A;  4DXB A;  2DDK A;  4NWD A;  2P0S A;  2FA7 A;  5CMC A;  1IIT A;  1NFT A;  3PUY E;  4QBA A;  5LTC A;  4MH5 A;  4H45 A;  4R6K A;  2WYK A;  4R6H A;  1IMA A;  4E0W A;  5I56 A;  4GF8 A;  1PDA A;  3CFX A;  1H76 A;  1GGG A;  4H6D A;  4N81 A;  3K0V A;  4NF6 B;  3OMB A;  2RCB A;  2DXY A;  5ET8 A;  1LGB C;  4IGR A;  4MCO A;  4PE3 A;  3PPP A;  3U65 A;  3QUJ A;  4P56 A;  1QJM A;  1Q1K A;  2VD2 A;  1OVT A;  4ZE9 A;  4OHN A;  3O2A A;  3MYU A;  4OFJ A;  5DVI A;  5ITP A;  2O7U A;  1FPE A;  1LCT A;  2Y7K A;  2DVZ A;  5I2K A;  2F3D A;  1FTK A;  4POW A;  3M3F A;  5AA4 B;  2UYE A;  2VD3 A;  2DWA A;  3IOR A;  2OCU A;  3ZSF A;  5IZ3 A;  4PFI A;  5EQ8 A;  3DP4 A;  4NX1 A;  2A5T B;  4M4G A;  5IGA A;  5F1Q A;  3BIH A;  1IIW A;  3TDJ A;  4U1Z A;  5I59 B;  1P1U A;  3TCG A;  1NV5 A;  1CB6 A;  4F2O A;  2THI A;  2AIX A;  4YB7 A;  1R6Z A;  4P11 A;  2FBP A;  3QIM A;  3KSX A;  4NF0 A;  1B51 A;  2D3I A;  1MXV A;  1ZMG A;  4F18 A;  1A8F A;  4EQ9 A;  4LON B;  3K1P A;  4H46 A;  5CC2 A;  5H8F B;  3KC0 A;  5L9M A;  3BFU A;  1A7L A;  2H25 A;  4HXV A;  4OFL A;  3BBR A;  5IZ3 B;  3E79 A;  4PF8 A;  4R72 A;  1XT8 A;  2CEX A;  1PBQ A;  1YAE A;  2MKZ A;  2RCA A;  3MUQ A;  1LFG A;  4BDR A;  2DE2 A;  3U72 A;  5ISU A;  1MXZ A;  4GOT A;  3C31 A;  1IXC A;  2XXT A;  3TPA A;  3KSJ A;  4ZEK A;  3O29 A;  1B7H A;  3LUZ A;  4YB5 A;  3KFM A;  3RTW B;  2NUV A;  3QUF A;  3K6X A;  2QS2 A;  3E3K A;  4DI3 D;  4QFL A;  1N3W A;  2ZYK A;  1OIB A;  1FQE A;  1JNF A;  2OWZ A;  4G68 B;  4N8Y A;  3OEN A;  4XEQ A;  5FHN A;  4O3C A;  3IX1 A;  2XX7 A;  5H8N B;  3ODB A;  5KCJ B;  2CZH A;  3VDF A;  2HFB A;  2QFL A;  4KFQ A;  2VHA A;  3C34 A;  4YMB A;  2XXQ A;  5IM2 A;  1RDZ A;  3EHS A;  1M5C A;  3TAJ A;  3OSQ A;  1LEV A;  1PC3 A;  1B9J A;  3W9W A;  4G8H A;  1MQJ A;  4PFR A;  3ECR A;  5EQ9 A;  1S9T A;  1A40 A;  1Y4T A;  1FTL A;  3SEW A;  1A8E A;  5H8H A;  3E78 A;  5AA2 A;  3QK6 A;  3UP9 A;  4PAK A;  4NF5 A;  1PBP A;  4P3L A;  4LAT A;  3V5A A;  4WED A;  3JV9 A;  4XKP A;  4ZEC A;  3FUZ A;  2E0S A;  4H8I A;  4X1D A;  3S9L C;  4DLD A;  3TTN A;  2UYF A;  3EQ1 A;  5DTB A;  1M5E A;  3S9M C;  1FBE A;  1B0H A;  1XHY A;  3OSR A;  4TLM B;  1IMD A;  1IQ7 A;  2F5X A;  2F7C A;  1GV8 A;  4ZED A;  2F6G A;  1SI1 A;  4F1U A;  4OYV A;  1SW4 A;  3PPN A;  4YIC A;  1MQG A;  2FIX A;  3BKI B;  2CEY A;  4F2Q A;  4UAC A;  1B52 A;  4XFE A;  1JET A;  2DOJ A;  5J1D A;  1NV6 A;  3CR9 A;  5KDT B;  1FRP A;  5I7I A;  4JWX A;  1A99 A;  4XTC Q;  2QMW A;  2RC7 A;  1FPI A;  2E1S A;  3BIG A;  3WAF A;  2AL4 A;  3OO7 A;  3EN3 A;  5I58 B;  1QW0 A;  2Q8J A;  4QSD A;  1HSE A;  1S7Y A;  2XXV A;  4FJP A;  4U4X A;  3TTM A;  5KDT A;  4RK9 A;  3E9X A;  2Q2A A;  5AE4 A;  1DCU A;  1J1N A;  4OET A;  1NMU A;  1G0H A;  5FHO A;  5H8H B;  3C35 A;  4Q30 B;  5DEX A;  4ESW A;  5M2V A;  4KXP A;  4KYE A;  4DDD A;  3C32 A;  3V89 B;  4HS7 A;  4QSC A;  1MXX A;  4OZ9 A;  4H5F A;  5TU0 A;  4OVS A;  1XVX A;  3K1M A;  1YCJ A;  3MZ1 A;  2RF1 A;  2PT2 A;  2V3U A;  2XWO A;  1LBW A;  3SES A;  3SZP A;  4F1Y A;  1TT1 A;  1N76 A;  3KJT A;  1FJ9 A;  5HBC A;  4FEB A;  3RLF E;  3QMF A;  1MY2 A;  1PB8 A;  2Z8E A;  1JW5 A;  1VDW A;  1M5D A;  4N6K A;  4TOZ A;  1O64 A;  1B40 A;  1MPD A;  3R7X A;  4Q8R A;  3N6T A;  1VFE A;  3CG1 A;  3KJ7 A;  4XKN A;  4AS4 A;  2GQ1 A;  3MST A;  3M8U A;  4X04 A;  3PMX A;  4N6D A;  3PPQ A;  3HHF A;  3RTF B;  1FTA A;  3FVN A;  4GWW A;  4PE5 B;  4PFB A;  4OTE A;  2XA5 A;  1MM6 A;  3K6W A;  1N04 A;  2F78 A;  4NED A;  4ONY A;  2DWJ A;  3MVX A;  2AL5 A;  1MG1 A;  4NQ8 A;  2XHD A;  1XI6 A;  1A55 A;  2XWV A;  2I4C A;  2HXR A;  1B3E A;  4NF4 A;  4FOR A;  3D4G A;  1AMF A;  3K01 A;  3C36 A;  3Q28 A;  1MXY A;  3W15 C;  2XXH A;  3PTY A;  3MP8 A;  1DPP A;  2IA4 A;  3RYD A;  1GR2 A;  1EYK A;  1MXW A;  3FXR A;  2UXA A;  4BDN A;  4HE0 A;  2Z22 A;  1EZ9 A;  2PBW A;  2XWI A;  3EHU A;  3HPI A;  4P1E A;  2VPN A;  4P47 A;  3HCQ A;  3LSW A;  3THI A;  4NF4 B;  4X8R A;  4IO4 A;  2XXI A;  4IGT A;  4OVT A;  5AA2 D;  3P7I A;  1SW2 A;  3PU5 A;  2F35 A;  4U2R A;  2DQV A;  1CNQ A;  4PTK A;  5I57 A;  1EZO A;  1QUJ A;  4P8B A;  1Y3Q A;  2ESN A;  4U23 A;  3ZKL A;  4XXU A;  3MW0 A;  4MAG A;  4R9F A;  4EXK A;  1O63 A;  2XXY A;  1GTK A;  1LBY A;  1FTM A;  4MMP A;  1IME A;  3MVY A;  4UA8 A;  2QS1 A;  3K1N A;  5A5X A;  3SEV A;  3U8Q A;  4GQO A;  3FAS A;  3IJO B;  3V8X B;  4AQ4 A;  3FD3 A;  2F36 A;  1FW0 A;  3CVG A;  3TEP A;  1EYJ A;  3UN6 A;  1ANF A;  2BJI A;  5ET6 A;  2P3V A;  2FIE A;  3QAX A;  4PFY A;  2UVI A;  2ZNT A;  2B65 A;  2F7B A;  3IK6 B;  4E0X A;  2F7A A;  5CRY A;  2PVU A;  5CBR A;  1NI9 A;  3IFA A;  2ONR A;  1N7X A;  1UTH A;  2G93 A;  2GH9 A;  2B4L A;  3IOV A;  5I56 B;  4PET A;  4MLV A;  4G61 A;  3TCH A;  3VV5 A;  4IO7 A;  3FXQ A;  2OJT A;  4ZZE A;  2RKM A;  5K2Y A;  4H65 A;  1MY3 A;  4RA1 A;  3UOR A;  3WAE A;  2F97 A;  2WBD A;  1LLS A;  5DVJ A;  1B58 A;  3FAT A;  1T0K A;  4LP2 B;  1YTV A;  2VOZ A;  4M1V A;  3M3L A;  3O9P A;  2FVZ A;  2I0B A;  4GX4 A;  4HE2 A;  1TFD A;  4ND9 A;  5EQA A;  4P1L A;  3VXC A;  4NMY A;  1JVX A;  1EH3 A;  1FBH A;  4AB5 A;  3DM0 A;  3PMW A;  2Y5L A;  3LC8 A;  2I4B A;  1MY0 A;  3O97 A;  2OWT A;  4L17 A;  1B3F A;  3A3C A;  4ESX A;  4GIZ A;  4PC9 A;  1INP A;  2WBB A;  1D3K A;  1Y3N A;  4QHQ A;  5F7V A;  1R9Q A;  4YB6 A;  2F34 A;  4YKI A;  2O68 A;  1M5F A;  4FE8 A;  5KZT A;  1FTJ A;  4GWS A;  2DSF A;  1IXH A;  3VXB A;  4N13 A;  2REG A;  4QF9 A;  5JTY A;  4BDL A;  1DTZ A;  4PDD A;  3T9X B;  2V25 A;  3T9H B;  4EF1 A;  2H98 A;  5TP9 B;  4GBW A;  1URS A;  4JB7 A;  1II5 A;  4RPO A;  1KA0 A;  1IMF A;  3CIJ A;  4NTL A;  4H5G A;  2ZYN A;  4KYS A;  2ZYO A;  2PT1 A;  4I9D A;  4R2F A;  2QS4 A;  3MZ9 A;  3KGC A;  4NE4 A;  1USY E;  1B05 A;  5FTI A;  2UVG A;  3UIF A;  3QSL A;  4UAB A;  4NF8 A;  1LAG E;  3FJG A;  1H44 A;  1I6Q A;  1OQH A;  4P9K A;  2KLF A;  5CMB A;  2DE3 A;  2Y84 A;  3D4C A;  1I6A A;  3TMG A;  1NNF A;  3RT6 B;  1AWB A;  1KWH A;  1MY1 A;  5TPA B;  1DBZ A;  1OLA A;  3KN3 A;  3D1R A;  4WEP A;  4THI A;  4H8J A;  1FPD A;  1LBZ A;  1B5J A;  5ICQ A;  3IFC A;  4DE8 A;  1B5H A;  3HV1 A;  4EF2 A;  4OVJ A;  1Y9U A;  4QFO A;  4I8C A;  1MY4 A;  2XXP A;  3VLW A;  1FBG A;  4GWU A;  4U22 A;  1IUD A;  4G68 A;  1RYX A;  2NXO A;  2Q8M A;  5J16 A;  4OQO A;  1DK4 A;  5DEX B;  4MJO A;  2X7Q A;  4N6P A;  1USY H;  1UTB A;  1YPN A;  4MNI A;  4OES A;  3S9E A;  2XWK A;  4N91 A;  1NV1 A;  3L6H A;  3C4M A;  3OXN A;  4F39 A;  1NV3 A;  1Q9D A;  4JWY A;  1N84 A;  4PF6 A;  4EUO A;  1UIU A;  3JYR A;  1K9Z A;  3IR1 A;  1HSL A;  2P2A A;  1NH7 A;  4NHB A;  4ZZA A;  4F3S A;  1OLC A;  1DOT A;  1BK4 A;  2ANJ A;  1TXF A;  4YMA A;  2Y5K A;  3A29 A;  3FBP A;  4NN3 A;  1RDY A;  2O69 A;  4EQ7 A;  1XVY A;  3TOD A;  3MP1 A;  4X1B A;  4GLI A;  3K2D A;  1B1H A;  4F19 A;  1B5I A;  1SYH A;  1GVC A;  1BTJ A;  2RC8 A;  5I84 A;  5F24 A;  3OEL A;  4H67 A;  2I6E A;  4GXS B;  4NAP A;  1OQG A;  2DP8 A;  2HXW A;  4X9T A;  2ALU A;  3R26 A;  5KCJ A;  1Y3P A;  3K4U A;  3H03 A;  3O6I A;  2DWH A;  4PGN A;  2H4I A;  2XX9 A;  1LCF A;  2ZNS A;  4LVQ A;  2X26 A;  5I2N B;  5AA2 B;  4GL0 A;  1NNT A;  1UTB B;  2YJP A;  5AA4 A;  1DPE A;  4FAT A;  1B32 A;  3LR1 A;  3PMV A;  3HO7 A;  2FYI A;  2HEU A;  1D9V A;  2V3T A;  1UQW A;  5IKB A;  3PUV E;  4OXV A;  2QVV A;  1MXU A;  1AOV A;  1QKB A;  3PUX E;  1ATG A;  1B2H A;  1IXI A;  3UA8 A;  2ZNU A;  1IZ1 A;  1FPJ A;  4MBP A;  3MP6 A;  3Q29 A;  2WKY A;  1AIV A;  1QUK A;  4PBH A;  1NNP A;  3N6U A;  2O1M A;  3G3F A;  3CRB A;  2YPN A;  3K02 A;  4G77 A;  4YAH X;  3SDF A;  3FJ7 A;  1MPC A;  2QJE A;  4PP0 A;  2DVC A;  3IOT A;  5FHM A;  3U92 A;  4DIG A;  4EQB A;  3O6H A;  2PFY A;  2HAU A;  2ONS A;  2P3N A;  3RPL B;  4ISU A;  3TTR A;  2O84 X;  2QPQ A;  2QL3 A;  1LBV A;  1SW5 A;  4N8G A;  5DVF A;  4HW8 A;  4BDO A;  1F9B A;  2L5V A;  2OLB A;  2Z23 A;  1FBC A;  1LB8 A;  3G3K A;  3Q25 A;  3MWB A;  4K3F A;  1SW1 A;  1O7T A;  2NOO A;  1LST A;  4XKR A;  4C1U A;  5BWJ A;  4DI4 B;  1EYI A;  1QGX A;  4PAF A;  5ICT A;  3TCF A;  4R74 A;  2HPG A;  4YKK A;  3T1B A;  3HN0 A;  2D5W A;  3Q27 A;  3TTK A;  1MS7 A;  4NF6 A;  3PPO A;  1PB7 A;  3DEL B;  3S4U A;  5CMK A;  2F3B A;  2RC9 A;  1B4Z A;  2UVJ A;  4KYD A;  1OMP A;  4POX A;  2I58 A;  2Z8D A;  4OAN A;  3VVF A;  2Y7R A;  4OEN A;  2I0C A;  4GFR A;  4KR5 A;  5EHS A;  4GWO A;  2Q74 A;  2RIN A;  2PYY A;  2H9B A;  1MQH A;  5I5P A;  3PD8 A;  3TKD A;  2NVU B;  4GWX A;  1LBC A;  3B7D A;  3KOT A;  3HHG A;  3OO9 A;  2HZK A;  4HCW A;  2LAO A;  3A09 A;  4ELP A;  3H6W A;  4N17 A;  5T3J A;  1XC1 A;  4F3P A;  3H6T A;  1BKA A;  1URD A;  1URG A;  5ET7 A;  1NH8 A;  1H43 A;  5A5L A;  1ZIU A;  1B0L A;  5I57 B;  3L6G A;  3PV0 E;  4JDF A;  2V84 A;  1TFA A;  2QS3 A;  5DW8 A;  1POT A;  1MDQ A;  4JVD A;  4H1X A;  5DYH A;  2XD3 A;  2ONK E;  2ZYM A;  1FPK A;  2P1S A;  1Y4C A;  3T22 A;  4H0W A;  5L9O A;  1R1N A;  4ZDM A;  3CSG A;  1MRP A;  5B7D A;  1RDX A;  1B7U A;  3TZA A;  1A54 A;  4TLL B;  1YYZ A;  3VLU A;  1EU8 A;  3U94 A;  2WX9 A;  4PFT A;  5DT6 A;  4R75 A;  1DMB A;  4LZ7 A;  4R2B A;  4DZ1 A;  5I3S A;  2XXW A;  3AXF A;  3QXM A;  1NUW A;  1Q35 A;  3MZB A;  5EYF A;  4YKJ A;  3ILT B;  5JEI A;  2F6P A;  1IEJ A;  4DXC A;  1S50 A;  2OPD A;  4WKM A;  1H3D A;  3QYT A;  1WVJ A;  4PAI A;  1LFI A;  3T9U A;  3G3J A;  2BJJ X;  1FPF A;  1K9Y A;  1P1W A;  4F31 B;  4AS5 A;  2KR0 A;  4ELR A;  1LAF E;  1N0T A;  1P1Q A;  2QSX A;  4WXJ A;  1Z7M E;  3SET A;  3EF7 A;  3C9H A;  1FCK A;  3IB2 A;  4U4S A;  5I58 A;  1VE4 A;  4GRK A;  4GXA A;  5I2N A;  3I3V A;  3PUZ E;  3O66 A;  1JQF A;  2V3Q A;  5EHM A;  1FPL A;  2O51 A;  2H5Y A;  1SYI A;  3O28 A;  4ZEF A;  2DWI A;  4G2Z A;  3M3K A;  1OVB A;  2M8C A;  3H06 B;  4ZEB A;  4KI0 E;  1NUY A;  2XXU A;  3FJM A;  4MX6 A;  1YZ0 A;  2GHB A;  3K6V A;  5FTH A;  1FQB A;  3GYY A;  4LUB A;  5H8Q A; 
#chains in the Genus database with same CATH homology
 1QGX A;  2CZI A;  4PAF A;  4P8B A;  2WX9 A;  2ZZW A;  5CM6 A;  3LUZ A;  2HHM A;  4PGN A;  1FBG A;  4GWU A;  4I3Y A;  1FBE A;  3MYU A;  2WEF A;  1NV0 A;  1FSA A;  1JP4 A;  2HPG A;  4O7I A;  4PC9 A;  3T1B A;  1INP A;  1IMD A;  2WBB A;  2F5X A;  1LBX A;  3W9V A;  5I3S A;  4MAG A;  3EKI A;  4N4U A;  2Q8M A;  4P56 A;  5J16 A;  4AS4 A;  1FPE A;  1NUW A;  2GQ1 A;  3MST A;  4DI3 D;  1DK4 A;  4F1U A;  4IR8 A;  4YIC A;  4LN5 A;  2FIX A;  2CZK A;  4MJO A;  2CEY A;  2F3D A;  4I3E A;  2DVZ A;  1FBD A;  1FJ6 A;  4X04 A;  4XFE A;  1LBY A;  3HFU A;  4N6D A;  1FPG A;  2F3B A;  5J1D A;  1NV6 A;  2OWZ A;  4GWS A;  2V4C A;  4OVQ A;  4MMP A;  1IME A;  1FBF A;  4N8Y A;  2VT5 A;  3LV0 A;  3RPL A;  2QVR A;  4MNI A;  2PCR A;  2QVV A;  1FTA A;  5EYG A;  5IZ3 A;  3ROJ A;  4PDD A;  4PFI A;  4GWW A;  1FRP A;  5ET5 A;  4XEQ A;  5I7I A;  5EQ8 A;  4N15 A;  4NX1 A;  4OAN A;  5JK4 A;  2XWK A;  1IMB A;  4N91 A;  4PFB A;  1NUX A;  1NV1 A;  2VPO A;  2B4M A;  1G0I A;  1FPI A;  1NV7 A;  1NV4 A;  1NV3 A;  2CZH A;  1Q9D A;  4GWY A;  2HZL A;  2XA5 A;  4OVR A;  5IGA A;  4PF6 A;  4GBW A;  4PAI A;  3BIH A;  3BIG A;  4GX3 A;  1EYJ A;  2QVU A;  3NOH A;  4NQ8 A;  1K9Z A;  3KC1 A;  4HE1 A;  1FPJ A;  1XI6 A;  2QFL A;  1FPF A;  1KA0 A;  1K9Y A;  2BJI A;  2Q74 A;  5IZ1 A;  4XF5 A;  4MHF A;  2XWV A;  1IMF A;  4AS5 A;  5IM2 A;  5I5P A;  1RDZ A;  2HXR A;  2Q9T A;  4MIJ A;  5ET6 A;  2KR0 A;  2P3V A;  1NV5 A;  4GWX A;  4PBH A;  2FIE A;  4I40 A;  1KA1 A;  4F1V A;  1DCU A;  1LEV A;  4GBV A;  1G0H A;  4NHB A;  2FHY A;  2FBP A;  3ISP A;  2HZK A;  4OVP A;  4HCW A;  1KZ8 A;  3T0J A;  4NF0 A;  5LDZ A;  4MEV A;  3W9W A;  3CHG A;  1NI9 A;  1BK4 A;  3IFA A;  5T3J A;  4N17 A;  2ZZX A;  2DDK A;  2WYP A;  4F18 A;  4KXP A;  4QXD A;  3KBZ A;  2R8T A;  2Y5K A;  3A29 A;  3FBP A;  4JVI A;  2XXK A;  4H46 A;  5ET7 A;  4FBP A;  1FPB A;  4NN3 A;  1RDY A;  4PFR A;  3PTY A;  3KC0 A;  2PFZ A;  4NG7 A;  1FBP A;  5EQ9 A;  5A5L A;  2B4L A;  2JJK A;  4PET A;  3RYD A;  4PCD A;  4G61 A;  4QBA A;  2PFY A;  2V3Q A;  4UAB A;  5LTC A;  1FPL A;  2P3N A;  1EYK A;  3RPL B;  1NV2 A;  4OA4 A;  4OVS A;  4YZZ A;  4H45 A;  4P9K A;  1NUZ A;  5ESY A;  1IMC A;  2ZZV A;  1YXI A;  4HE0 A;  5EQ7 A;  2WYK A;  4HXV A;  2QPQ A;  4GWZ A;  2DE3 A;  4MNP A;  4O8M A;  2DE4 A;  1LBV A;  2XWI A;  1IMA A;  2XWO A;  4N8G A;  1LBW A;  5DW8 A;  2WBD A;  4JVC A;  2VPN A;  5IZ3 B;  4P1E A;  4PGP A;  3SZP A;  3E79 A;  4P47 A;  4F19 A;  4GX6 A;  4JVD A;  5EYH A;  2KQZ A;  3E78 A;  4O7M A;  1AWB A;  4PF8 A;  4NGU A;  2L5V A;  1NUY A;  1DBZ A;  4X8R A;  2CEX A;  3D1R A;  4M1V A;  1FPK A;  4MX6 A;  5FBP A;  4N81 A;  1FJ9 A;  2FVZ A;  1FPD A;  4GX4 A;  4HE2 A;  5F24 A;  1LBZ A;  4O94 A;  4OVT A;  4PAK A;  3QMF A;  1YZ0 A;  1FBC A;  5EQA A;  4MNC A;  4P1L A;  4P3L A;  3IFC A;  2MKZ A;  4NAP A;  3FXB A;  4PBQ A;  2OX3 A;  5ET8 A;  4PDH A;  2DE2 A;  5IZZ A;  1FBH A;  3B50 A;  4MCO A;  1SPI A;  1VDW A;  4X9T A;  1RDX A;  4N6K A;  2Y5L A;  4PE3 A;  1CNQ A;  1D9Q A;  4PTK A;  3U65 A;  3GYY A;  1YYZ A;  4DI4 B;  1EYI A;  4HCY A;  3B8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...