1G0HA

Crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Crystal structure and catalytic mechanism of the MJ0109 gene product: a bifunctional enzyme with inositol monophosphatase and fructose 1,6-bisphosphatase activities.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 74
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2000-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1g0hA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1g0hA02
4GX3A 3A29A 3ROJA 1NV2A 2QVRA 1YYZA 1IMEA 5ET8A 3B8BA 1NV1A 5I3SA 1FSAA 1RDZA 4AS5A 2DDKA 2CZHA 1FBEA 5FBPA 1FBPA 1NUYA 1NUZA 1LBYA 5IZ1A 1IMBA 2VT5A 4GWYA 2OX3A 3RYDA 1G0IA 2P3NA 2Q74A 2BJIA 4HXVA 4I3EA 1LBZA 2JJKA 3QMFA 1SPIA 1QGXA 1VDWA 2FIXA 3D1RA 1BK4A 1NV3A 4MJOA 4QXDA 1FPFA 3FBPA 2CZIA 1FPEA 4GX6A 1NV6A 1LBXA 2WBBA 3RPLA 5EYHA 1LEVA 3IFAA 1NV7A 4N81A 5ET7A 1IMCA 4IR8A 1D9QA 1FPJA 3KBZA 2WBDA 5F24A 1FBDA 4GWUA 5IZ3A 1NV0A 2R8TA 1FPIA 1FJ9A 1K9ZA 1YZ0A 5ET6A 2OWZA 2FHYA 4O7IA 2F3DA 5EYGA 1NV4A 2F3BA 5EQ7A 1IMFA 1G0HA 1FJ6A 5DW8A 4GX4A 1RDYA 5EQ8A 2FVZA 4AS4A 3KC0A 3T0JA 4GBWA 2HHMA 4I40A 1K9YA 2Q8MA 1EYJA 1LBWA 1FBGA 1RDXA 3KC1A 1IMAA 1AWBA 1Q9DA 3LV0A 1DBZA 1CNQA 1FPLA 4GWZA 2Y5KA 1EYKA 2CZKA 1EYIA 1LBVA 1XI6A 2FBPA 1NUXA 1IMDA 1DK4A 3LUZA 4HE2A 4KXPA 1FPKA 1FBCA 4GBVA 4PTKA 1FBFA 1FBHA 1KA1A 1DCUA 2GQ1A 1NUWA 1FPDA 4H45A 4GWWA 1NI9A 1FPGA 3BIHA 4GWSA 1YXIA 2PCRA 1KZ8A 1KA0A 4FBPA 4H46A 5IZ3B 1FPBA 2P3VA 4G61A 3IFCA 1FRPA 5A5LA 2QVUA 2QFLA 5EQAA 2WEFA 5ESYA 3BIGA 5LDZA 2Y5LA 4GWXA 5ET5A 2QVVA 1JP4A 4HE1A 5J16A 4HE0A 5T3JA 1FTAA 5EQ9A 4I3YA 1INPA 1NV5A 2FIEA 3RPLB
chains in the Genus database with same CATH superfamily
3BKIB 3FXBA 4MAGA 1JQFA 3JYRA 1XS5A 2KQZA 3IO4A 1IXIA 4WEDA 4NE4A 4LVQA 4P1LA 2HEUA 5A5XA 2Q74A 4G77A 5JTYA 1HSJA 4JXIA 2DWIA 5H8SA 1QGXA 4EUOA 3TKDA 3WAEA 3KOTA 3SESA 2DSFA 3ODBA 2CZIA 4P0IA 4F3GA 2Q88A 2XXUA 1QKAA 5DVFA 2V25A 3G3JA 2V4CA 4BDQA 1P99A 1Z7ME 3K4UA 2DS9A 2HAUA 3IO6A 5ICQA 1R6ZA 4OHNA 1POTA 2RF1A 1LBWA 2V93A 2X7PA 1JVYA 4PC9A 2XXKA 5FTIA 4GWZA 3SERA 2WYKA 4PBHA 2A5SA 1FPKA 1A54A 4QFPA 4EDPA 1FPDA 4GWWA 3SEUA 4PCDA 4ZZEA 3UN6A 4GL8A 4P1EA 1MDP1 3ILTB 4U1ZA 4DCYA 5BWJA 3R26A 4FJPA 5ITPA 3MPKA 2H4IA 2XWOA 2XWVA 1LAXA 3E4RA 4MMPA 2ZYNA 5LTCA 4BDLA 3O28A 2XHDA 2CMOA 3T9UA 5I3SA 1B51A 3TCHA 4NF5B 2XXWA 3PUZE 4G68B 5H8QB 5FHMA 1FQAA 3CG3A 3CFZA 4MHFA 2B4LA 4OMBA 4YAHX 2JJKA 4LUBA 4NF6A 2QPQA 2Q9TA 1BK4A 4ZS9A 4DI4B 1OLCA 1FQDA 5AA4B 5KZTA 4XTCQ 3TCFA 3TTMA 4OVRA 1R9QA 1FW0A 1H43A 1CE2A 1H76A 2DYXA 4WEPA 5M2VA 1II5A 5EYGA 5L9OA 4F2OA 1J1NA 1IMFA 2RC9A 2FVZA 3PD8A 3DP6A 4FIMA 1B0HA 3SETA 3KN3A 3DLNA 2Y7IA 1ZKBA 1M5DA 4QRZA 4U21A 2HPGA 4OFJA 3OO7A 4KI0E 4ELOA 4F19A 3TPAA 3HHFA 4IO2A 3SEVA 4IGRA 3A3CA 4OVSA 1FBFA 4TOZA 4N6DA 3L6GA 4GWSA 3CVGA 1Y4TA 4FATA 1N76A 4OVJA 1PC3A 4YKJA 3S4UA 3HHGA 5EYFA 1LAHE 2RC7A 3KJTA 4NWDA 1SW2A 3VLVA 3IK6B 3ZKKA 4L17A 4YMBA 2RCBA 2XXHA 4NF6B 4R9FA 2Y7RA 3FVNA 3Q25A 1SW5A 2O68A 2OJTA 4RA1A 4N8GA 4F2QA 2B3FA 1RDZA 3S9LC 4R2FA 4Q0CA 2CZLA 4KD5A 1IMBA 2H99A 3RYDA 4RYAA 4XKQA 4C0RA 2OPEA 4TQUQ 3K01A 3HN0A 4P56A 4U22A 2XWKA 4IO7A 1EU8A 4R9GA 4NN3A 2ABHA 4KYDA 2DOJA 2R8TA 2NUVA 2D5WA 3LSXA 4NQ8A 2UXAA 2XWIA 3TFLA 2V3QA 3N94A 4ONYA 2DWHA 3MVZA 3C35A 3E3KA 2GHBA 4XFEA 4MIJA 1ANFA 5H8HB 1O63A 2KLFA 4KQPA 4JVDA 2F6PA 1MH4A 2XXPA 2F7BA 3H4ZA 3LSWA 3V83A 2I48A 4EXLA 3R7XA 4ISUA 3K0VA 3MSTA 3P7IA 3KZGA 1MY1A 4H5FA 1S7YA 1SVXB 4TLMB 1JP4A 3FGSA 3K02A 4U2RA 5EQ9A 3MP8A 5L9MA 2VP1A 1JVXA 4F3SA 3B50A 3ECRA 5JK4A 3S9MC 2I49A 3I6VA 4Q5TA 4GWYA 2B4MA 5LOMA 3K1NA 3SEXA 2XXVA 4G68C 1LBZA 3QMFA 4N4UA 4OVQA 4OYVA 4QXDA 3LUYA 3Q27A 2OPDA 1NV6A 3ILUB 5TPAA 4TLLB 4U4SA 2A5TA 4F39A 5BUUA 4YICA 2GH9A 2DE2A 3H6UA 3QUJA 3K6WA 4FORA 1S9TA 3S9NC 1FJ6A 1XT8A 4PE5B 3KC0A 3GBBA 1MM6A 1TXFA 4O3AA 4FE8A 1BKAA 3IX1A 1N7XA 1L5TA 2I58A 1OQHA 4O3CA 2F7CA 3B7DA 3OO6A 1UTBB 3KFMA 3PUYE 3B6WA 3TYHA 1B9JA 4FEDA 4DE8A 2Q2AA 3THIA 4N13A 1Y20A 3V5AA 4F18A 2Z8FA 5IKBA 1TFDA 4ZE8A 1MQHA 3FXQA 3HO7A 4UACA 2O6AA 3O66A 1EZOA 2XX7A 3HFUA 3LSFB 4DCXA 1P1OA 1LBBA 2QS4A 1QW0A 1PDAA 2QS2A 2UVGA 4EF2A 3GXAA 4MNPA 4N07A 3PUWE 4QFLA 5HPQA 5CRYA 2PT1A 3RTFB 4F22A 2ALUA 5HM4B 5JEIA 2F5XA 4R2BA 1MPDA 1LEVA 1LB8A 1D9QA 1FPJA 4R6KA 3OO8A 3CSBA 3RT8A 1QUJA 1FJ9A 3IAZA 3LC8A 1N3XA 3KEIA 5EQ7A 2IEEA 3B6TA 2QS1A 1M5EA 2OWTA 4PF6A 5I2KB 1XHYA 1NL5A 4H8JA 4OFLA 3EHSA 3UP9A 4QSEA 4OERA 3UK4A 5H8FB 3G3FA 3BBRA 4RPOA 1O64A 4H1XA 2OBGA 4O3BA 5KDTB 3QK6A 1LAGE 1VFDA 1FBCA 2UVJA 3PMWA 4NX1A 4OQOA 3FXUA 1B40A 1EZ9A 3RY3A 4P11A 3MZ9A 4ESXA 4R6HA 1LCFA 1JEUA 2DVCA 3UORA 4GXSB 3E9XA 1LCTA 5ESYA 1B7ZA 1RYOA 3BIGA 5J16A 1N7WA 1MQIA 4I62A 2FA7A 4RNSA 3PGFA 3IJXB 3ISPA 5CMMA 3CFLA 4GX3A 3I3VA 1PB9A 3RNNA 3USDA 3T66A 4PDHA 1TT1A 1FBEA 3IOTA 3VVFA 1NUZA 4XKRA 2GRVA 4YMAA 2Y7PA 1ZJLA 2XXQA 3MZ1A 3TTLA 5IAIA 4PFBA 1FPFA 1PB8A 3O9PA 3KBZA 4KFQA 3PPRA 1Y4CA 1B5IA 2V3TA 4OVTA 1QUKA 1MDQA 1I6AA 5EHSA 2HCAA 4IY5A 4X8RA 5IZZA 4PQJA 4MNCA 1GVCA 4KCCA 4MF3A 3T0JA 1B3HA 4I40A 1K9YA 4EQBA 3OENA 4IB2A 2DVZA 1IQ7A 2Z23A 3VVEA 3T96B 4G4PA 2ZMBA 3C31A 2I0BA 1MY0A 1Y3QA 1US4A 2CZKA 4NF5A 2PX1A 1GGGA 3FVOA 2HXWA 3LUZA 4G68A 3OEMA 5H8QA 1MPBA 2VOZA 2GQ1A 2DWAA 3MVWA 1IITA 1FQCA 3BIHA 3RN8A 3OMBA 2PFZA 4EF1A 4G2ZA 1QUIA 2Y7WA 2QMWA 4G61A 1FRPA 4NMYA 2QVUA 2QFLA 2GFEA 2ZNSA 2WEFA 5AA4A 5I59B 2PFYA 3OOAA 4MEVA 1B3FA 3TUSA 5KCJB 2UYEA 2ZXTA 3Q26A 1IMEA 5ET8A 1NV1A 3O29A 1NKXA 1FSAA 1FTMA 2O69A 4LN5A 4PP0A 4GIZA 1FTJA 1VSOA 1URGA 4BDNA 3K2DA 3A3UA 1B3LA 4KPTA 2P3NA 4PFTA 2O51A 4PE3A 4BDMA 2REJA 1MQJA 4ZZAA 2B3BA 1XVXA 1I69A 3FJMA 4G8MA 2UVIA 4GFRA 1B4ZA 1IMCA 4IR8A 3RPWA 1B6HA 3ZSFA 2NXOA 5CMCA 2F36A 2Y7KA 5F7VA 1YZ0A 2OWZA 1KWHA 3OO9A 3VXCA 4KHZE 5AA2B 1G0HA 1PEBA 4Z0IA 2PT2A 3GYYA 3G3GA 1B0LA 4OEVA 1EYJA 3KC1A 5ELVA 1AWBA 1ZBMA 1A55A 5I58B 1OLAA 4ELQA 3EQ1A 4ZE9A 1SBPA 2F7AA 4YU0A 1ZIUA 1VFEA 3VLWA 1DCUA 4RY1A 4LATA 4NAPA 2YPNA 2XX8A 3SKPA 4Z7EA 4H46A 2UVHA 3CG1A 3E79A 5I5PA 4WXJA 4PFYA 5A5LA 4E0WA 1SDXA 5I56B 1NFTA 3OXNA 4KYSA 4QSDA 3C32A 2XD3A 1EZPA 1NH8A 1P1UA 3N5LA 4YKIA 4ZEIA 1IXGA 2H9BA 4NF8B 3TTRA 1DSNA 2DDKA 3TCGA 3MW0A 1LBYA 5H8HA 4LZ5A 1G0IA 5CMKA 4I3EA 2VPOA 3RGYA 1A8FA 2FIXA 5FTHA 2OK2A 5CBRA 3M3KA 1B3GA 3K6VA 1SYIA 3KGCA 2ONKE 1TFAA 3H6VA 3OELA 4IO5A 1JW1A 1AMFA 2F34A 2F35A 4ECFA 4OEUA 1Q1KA 1SYHA 2Z22A 4U23A 3QXMA 1I6QA 5HBCA 3QUFA 3QAXA 1IXHA 4EQ7A 5AA3A 1FBGA 3Q28A 4HS7A 4X48A 2ONSA 1Y9UA 4YB7A 4XKPA 4HE2A 5L9SA 4GBVA 4AB5A 4MX6A 3MP6A 5ITOA 3PUXE 1MXXA 1P1WA 3IB0A 1NNFA 1B3EA 1SW1A 1YXIA 1A40A 3MZBA 2P3VA 4X04A 4OTEA 1YCJA 4NF4B 1ELJA 1SI1A 3FD3A 3AXFA 4JWYA 3T22A 3M3FA 2Y5LA 3TTKA 1LLSA 3K6UA 2NWJA 4HE1A 3D4GA 5T3JA 3PPPA 3C36A 5K2YA 2F8DA 4I3YA 1A8EA 1MQDA 3W9WA 4O94A 3IB2A 3ROJA 4N6KA 5H8NB 1NMUA 2E1SA 3W9VA 3O6IA 2V3UA 4JSOA 2XA5A 1URDA 1R9LA 3PMXA 2I6EA 4DXCA 4I8CA 1XVYA 1ATGA 2F97A 4NF0A 5CBSA 3C4MA 1UQWA 1FQEA 3UGWA 4XF5A 4JVIA 1UTBA 4MJOA 2G29A 3T9XB 5K2XA 4PAIA 1JEVA 4GWUA 1JW4A 2H25A 3C34A 4X1BA 3MJNA 2ZNUA 3KOSA 2XXRA 4RXLA 4PFWA 3S2VA 4F31B 1SQYA 3HSTA 3LSLA 2REGA 3TTNA 3PD9A 1LBVA 4PETA 4YB5A 4ZECA 3PTYA 2P2AA 4WKMA 4DDDA 3ZS6A 5AE4A 4MLQA 1QKBA 4ZEDA 4P3LA 4GF8A 2CEYA 1IIWA 3N6UA 5L8DA 2B65A 4DXUA 2XXYA 4JWOA 4DZ1A 4IGTA 3M3LA 2DE4A 2OLBA 4ZEBA 4ELPA 1MY2A 1FTAA 1BTJA 1FQBA 2QVRA 2OCUA 4YKPA 4ESWA 2Z8DA 4AS5A 5I2KA 4OETA 4JDFA 1XOCA 4POXA 1FBPA 2AIXA 4R72A 4LZ8A 2H5YA 4X9TA 2WYPA 1UTHB 5H8FA 5TP9A 5KDTA 3IOVA 3K00A 1FPEA 1MXYA 4XEQA 3CSGA 3GBAA 2WBDA 2HZKA 2UYFA 3TQLA 4PAFA 2X7QA 3IJOB 2F3BA 1NH7A 2Y84A 4NGUA 5EQ8A 4I1DA 5I2NB 1VE4A 2IA4A 2HHMA 2Q2CA 2XXIA 2ZYOA 5DT6A 1XC1A 3C33A 1ZLQA 3KN7A 1CNQA 5IGAA 2Y5KA 3NOHA 1IMDA 2I4CA 4PTKA 2I3VA 1Y3PA 1FTOA 5DEXB 3KJ7A 2R6GE 4Q8RA 5IZ3B 2F6GA 1FPBA 2RINA 3PU5A 1HSEA 1MG1A 2FNCA 5EQAA 1LFGA 3E13X 4GWXA 3U1OA 3IORA 5TP9B 1US5A 4PF8A 3TODA 4OA4A 2WKYA 3MQ9A 3FJGA 1Y1ZA 3PPOA 1NNPA 3H06B 1B05A 2HAVA 4ZEFA 1NV2A 4H8IA 5F1QA 3SDFA 2CZHA 1OVTA 4MBPA 2QL3A 4XIGQ 4DLDA 3FV2A 2VT5A 2RC8A 3D4CA 2XD2A 4NHBA 4NWCA 4OVPA 3C9HA 3EHTA 3SZPA 3D1RA 4F1YA 2O1LA 5TU0A 4H67A 3I5OA 4GX6A 1DPPA 3K6XA 1LBCA 4PFRA 2ZNTA 4GWOA 4DXBA 3RT6B 3G3KA 1K9ZA 4R73A 1A99A 5ET6A 4GD5A 2VGQA 5I59A 1M5BA 4Q30B 1AIVA 4LQ5A 3VDFA 2ZZWA 2BJJX 4PDDA 1TWYA 3LBSA 4ELRA 5KCJA 4IY6A 3LR1A 4HTGA 4YB6A 2XXTA 1UIUA 3DELB 1DK4A 3CIJA 1LGBC 1SD3A 1B5HA 4H45A 3A09A 1NI9A 3MAMA 4LZ7A 3MVYA 1OIBA 1R1NA 5ISUA 4IO3A 5CMBA 4P8BA 4GL0A 3EPEA 4OFOA 5B7DA 4F1UA 5ET5A 3FZVA 3ZKLA 2PMSA 3T9VA 3BFTA 2HXRA 2Z8EA 3U93A 2X26A 4YKKA 4H0WA 1INPA 2HZLA 3H6TA 4LP2B 1MY4A 1GTKA 3OD7A 3HCQA 4O8MA 3PPNA 5AA2A 2VD3A 5I57B 3TQWA 1URSA 3MBPA 3G3HA 5FBPA 1B1HA 3TELA 2DWJA 1B46A 1DOTA 4I9DA 4MLVA 2OX3A 2DP8A 5I58A 4OENA 4HXVA 1BP5A 1F9BA 3SEWA 1NV3A 3CR9A 1VR5A 1YTVA 3FBPA 1AOVA 2WX9A 1CB6A 1LSTA 2I3WA 3IFAA 1PB7A 3FVGA 1MY3A 5F24A 4M1VA 1FBDA 1NV0A 1OMPA 2D3IA 1MXUA 1S50A 4C1UA 4OXVA 2F3DA 4U1OA 4NEDA 5I56A 4C1TA 4FECA 3VVDA 4AS4A 1DMBA 2FYIA 4MH5A 3TAJA 2P0SA 4H65A 2OWSA 4PAKA 1DTGA 3DM0A 4E0XA 3LV0A 5A5XB 2AL5A 5JTYB 4F1VA 1EYKA 4NF8A 1XI6A 1ZTYA 3KG2A 1P1QA 3DP8A 3FV1A 1O7TA 1WDNA 1KZ8A 1KA0A 4JB7A 3QIMA 1AL3A 3OEKA 3PV0E 2ZYMA 3O97A 1B4HA 4GLIA 3T9HB 2I4BA 3JZJA 1D3KA 3EF7A 5DTBA 4QF9A 1B2HA 3K1PA 2RCAA 4PGPA 4ND9A 3FIRA 4U4XA 1Z7NE 4RK9A 1OQGA 1YYZA 3CFXA 3ONMA 2DXYA 4FEBA 2D21A 3GLBA 3Q29A 1NUYA 5CI5A 4BDRA 4OZ9A 4EXKA 1MH3A 1VDWA 4LA9A 5CM6A 3IOUA 2L5VA 3IOWA 1HSLA 1JNFA 4N15A 1MXWA 3N6TA 1FPIA 1M5FA 3FATA 4NF4A 3UA8A 2CEXA 3KSXA 3U72A 4QBAA 1RDYA 5AA1A 3H03A 5IM2A 3KBRA 2HQ0A 1D9YA 1T0KA 3B6QA 2THIA 2YLNA 3RUMA 3EN3A 2W7YA 5H8NA 3BFUA 3U8QA 1EYIA 3O2AA 4QSCA 4XXUA 5DVJA 3N26A 4OESA 4THIA 4F3BA 2PBWA 3FVKA 1KA1A 3OSQA 3PMVA 4N8YA 1JW5A 1FCKA 2PYYA 2PCRA 3KSJA 1N3WA 2MKZA 1MXZA 5I84A 1PBQA 4BDOA 3TEPA 5LDZA 3SEYA 3T93B 4GOTA 4JVCA 3QYTA 3KN8A 4MCOA 5ICTA 3O6GA 1H3DA 3FUZA 4NG7A 2NOOA 3A29A 4QFNA 2VD2A 5J1DA 3CHGA 4KCDA 4ZEKA 3PPQA 4IO4A 3FJ7A 4MFIA 2ZYKA 2O1MA 2YJPA 4KYEA 3VFJA 4QFOA 4POWA 3CI8A 3MP1A 4P0GA 3OSRA 4RJZA 4IO6A 1M5CA 1I6BA 5AA2D 1LBXA 3HV1A 3RPLA 2O7IA 4N81A 2XX9A 4F3PA 1AH5A 2DQVA 3RQTA 4GVOA 3MUQA 4KR5A 1P1NA 1GR2A 1NNKA 4RPNA 4O7IA 3T1BA 1QULA 2ANJA 4K3FA 2NVUB 3JV9A 4M4GA 3V8XB 1FTKA 4AQ4A 4F29A 2V84A 2DE3A 2O7UA 3G7WA 2P1SA 2Q8JA 1RYXA 4R75A 1IEJA 1FPLA 1ZU0A 1SW4A 1NUXA 1Q35A 3W15C 4KXPA 5FHOA 3U65A 2ZZVA 4N6PA 4R74A 1ZMGA 3WAFA 1USYE 1UTHA 1B7UA 3H7MA 4JSDA 1A7LA 3VLUA 3MYUA 1H45A 4GRKA 1B1XA 4RK2A 2RKMA 2HFBA 4HE0A 1B7HA 4QHQA 2VHAA 1FQFA 3RPLB 2AYSA 4HW8A 5I2NA 4DIGA 3VV5A 1NNTA 1WVJA 4JBZA 1PBPA 4H5GA 1DTZA 5IZ1A 3VXBA 4GQOA 2Q89A 1MQGA 5CC2A 1D4NA 3L6HA 1USYH 2WBBA 2GHAA 4ZDMA 4EQ9A 1NV7A 5ET7A 4HCYA 5DEXA 3MPLA 1MPCA 3MVXA 4QFKA 1N04A 2KR0A 4MNIA 2LAOA 4UABA 5IZ3A 2PVUA 3EHUA 4OANA 3K1MA 4G8HA 1Y3NA 2I0CA 3FASA 5B70A 2QRYA 2R9JA 3O6HA 3UIFA 3H6WA 1JETA 3TZAA 4GBWA 1BLFA 2Q8MA 1RDXA 2QSXA 3M8UA 5I7IA 4HCWA 4PFUA 4BLAA 2DXRA 4JWXA 5DYHA 4XKNA 4YZZA 1QJMA 4N17A 1FBHA 1LFHA 2VPNA 5TPAB 1MXVA 2ESNA 4FAJA 1B58A 4UA8A 1GV8A 1IXCA 1FTLA 4FBPA 3RLFE 2A5TB 3F11A 5EHMA 4PBQA 2QMXA 1MS7A 4LONB 5DVIA 5FHNA 2R71A 3HPIA 3TMGA 1IZ1A 3G3IA 1B5JA 3FXRA 1MM7A 2OZZA 3B8BA 1BIYA 3MC2A 1OVBA 3RTWB 4NTLA 1RKMA 4OWDA 3DP4A 2E0SA 3IL1B 2BJIA 4N91A 4P47A 2QS3A 4R6YA 3EKIA 1SPIA 1N0TA 1H44A 2G93A 1D9VA 1QVSA 2AL4A 3MWBA 1MRPA 2ZZXA 3QSLA 5EYHA 3V89B 4AB6A 4GXAA 2O84X 2H98A 1IUDA 4PFIA 1POY1 1YPNA 4P9KA 3GZGA 2FHYA 1NV4A 5DW8A 4GX4A 4H6DA 4PGNA 3R6UA 3TDJA 1B32A 1IMAA 3H3GA 1EH3A 1Q9DA 1DBZA 5I57A 1DPEA 2XXXA 1LB9A 3VE1B 2FBPA 1LFIA 1UIVA 3IB1A 2ONRA 1SI0A 1B52A 1NUWA 1FPGA 2QJEA 3U92A 3IR1A 3IFCA 1WODA 3E78A 3S9EA 1Y1MA 2M8CA 4LQ2A 4O7MA 2QVVA 1LAFE 1N84A 4X1DA 3U94A 4DI3D 1YAEA 4G8NA 2F78A 3CRBA 3PUVE 1NV5A 2FIEA
chains in the Genus database with same CATH topology
3ROJA 4N6KA 3FXBA 1YYZA 3W9VA 4MAGA 2XA5A 2KQZA 4MNPA 1NUYA 4NF0A 4P1LA 2Q74A 4XF5A 4JVIA 1QGXA 1VDWA 4MJOA 2CZIA 5CM6A 2F5XA 1LEVA 2L5VA 1D9QA 4PAIA 1FPJA 4N15A 4GWUA 1FPIA 1FJ9A 2CEXA 2V4CA 5EQ7A 4QBAA 1RDYA 4PF6A 5IM2A 1LBWA 4PC9A 2XXKA 4GWZA 2WYKA 1EYIA 1LBVA 4PETA 4PBHA 1FPKA 1FBCA 4NX1A 3PTYA 1KA1A 1FPDA 4GWWA 4N8YA 4P3LA 4PCDA 2PCRA 2CEYA 4P1EA 2MKZA 5ESYA 3BIGA 5LDZA 2DE4A 5J16A 2XWOA 2XWVA 1FTAA 4JVCA 4MMPA 5LTCA 3ISPA 4MCOA 4NG7A 4GX3A 3A29A 5J1DA 2QVRA 3CHGA 5I3SA 4PDHA 4AS5A 1FBEA 1FBPA 1NUZA 4MHFA 2B4LA 4X9TA 2WYPA 2JJKA 4PFBA 2QPQA 2Q9TA 1BK4A 4DI4B 1FPFA 1FPEA 1LBXA 4XEQA 3RPLA 4N81A 3KBZA 4OVRA 2WBDA 2HZKA 4OVTA 4PAFA 4O7IA 5EYGA 3T1BA 2F3BA 1IMFA 4X8RA 5IZZA 4NGUA 5EQ8A 2FVZA 4MNCA 3T0JA 2DE3A 2HHMA 4I40A 1K9YA 2DVZA 2HPGA 1CNQA 4F19A 1FPLA 5IGAA 2Y5KA 2CZKA 3NOHA 1NUXA 1IMDA 3LUZA 4KXPA 3U65A 4OVSA 4PTKA 2ZZVA 1FBFA 2GQ1A 4N6DA 3BIHA 4GWSA 2PFZA 5IZ3B 1FPBA 4G61A 1FRPA 2QVUA 2QFLA 3MYUA 5EQAA 2WEFA 4GWXA 2PFYA 4PF8A 4OA4A 4HE0A 4MEVA 3RPLB 1NV2A 1IMEA 4N8GA 5ET8A 1NV1A 1FSAA 1RDZA 4LN5A 2CZHA 5IZ1A 1IMBA 2VT5A 3RYDA 2P3NA 4NHBA 4OVPA 4PE3A 3SZPA 3D1RA 4GX6A 4P56A 2WBBA 2XWKA 4NN3A 1NV7A 5ET7A 4PFRA 1IMCA 4IR8A 4HCYA 2KR0A 4MNIA 4UABA 5IZ3A 2R8TA 1K9ZA 4NQ8A 1YZ0A 5ET6A 2OWZA 4OANA 1G0HA 2XWIA 2V3QA 2ZZWA 3GYYA 4PDDA 4GBWA 4XFEA 4MIJA 2Q8MA 1EYJA 1RDXA 3KC1A 1AWBA 5I7IA 4JVDA 4HCWA 1DK4A 4YZZA 4N17A 1FBHA 1DCUA 2VPNA 4H45A 1NI9A 4NAPA 3MSTA 4FBPA 4H46A 3E79A 5I5PA 4PBQA 5A5LA 4P8BA 4F1UA 5ET5A 1JP4A 2HXRA 5EQ9A 1INPA 2HZLA 4O8MA 3B8BA 3B50A 2DDKA 5JK4A 5FBPA 1LBYA 4GWYA 2B4MA 2OX3A 1G0IA 2BJIA 4HXVA 4I3EA 4N91A 4P47A 2VPOA 1LBZA 3QMFA 4N4UA 3EKIA 4OVQA 1SPIA 2FIXA 1NV3A 4QXDA 3FBPA 2WX9A 1NV6A 2ZZXA 5EYHA 3IFAA 5F24A 4M1VA 1FBDA 4PFIA 1NV0A 4P9KA 4YICA 2DE2A 2FHYA 2F3DA 1NV4A 1FJ6A 5DW8A 4GX4A 4AS4A 4PGNA 3KC0A 1FBGA 4PAKA 1IMAA 1Q9DA 3LV0A 1DBZA 4F1VA 1EYKA 2FBPA 1XI6A 4HE2A 4GBVA 4MX6A 1NUWA 1FPGA 1YXIA 1KZ8A 1KA0A 4F18A 2P3VA 4X04A 3IFCA 3E78A 4O7MA 2Y5LA 2QVVA 4HE1A 4DI3D 5T3JA 3HFUA 4I3YA 1NV5A 2FIEA 3W9WA 4O94A 4PGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX3 A;  3A29 A;  3ROJ A;  1NV2 A;  2QVR A;  1YYZ A;  1IME A;  5ET8 A;  3B8B A;  1NV1 A;  5I3S A;  1FSA A;  1RDZ A;  4AS5 A;  2DDK A;  2CZH A;  1FBE A;  5FBP A;  1FBP A;  1NUY A;  1NUZ A;  1LBY A;  5IZ1 A;  1IMB A;  2VT5 A;  4GWY A;  2OX3 A;  3RYD A;  1G0I A;  2P3N A;  2Q74 A;  2BJI A;  4HXV A;  4I3E A;  1LBZ A;  2JJK A;  3QMF A;  1SPI A;  1QGX A;  1VDW A;  2FIX A;  3D1R A;  1BK4 A;  1NV3 A;  4MJO A;  4QXD A;  1FPF A;  3FBP A;  2CZI A;  1FPE A;  4GX6 A;  1NV6 A;  1LBX A;  2WBB A;  3RPL A;  5EYH A;  1LEV A;  3IFA A;  1NV7 A;  4N81 A;  5ET7 A;  1IMC A;  4IR8 A;  1D9Q A;  1FPJ A;  3KBZ A;  2WBD A;  5F24 A;  1FBD A;  4GWU A;  5IZ3 A;  1NV0 A;  2R8T A;  1FPI A;  1FJ9 A;  1K9Z A;  1YZ0 A;  5ET6 A;  2OWZ A;  2FHY A;  4O7I A;  2F3D A;  5EYG A;  1NV4 A;  2F3B A;  5EQ7 A;  1IMF A;  1G0H A;  1FJ6 A;  5DW8 A;  4GX4 A;  1RDY A;  5EQ8 A;  2FVZ A;  4AS4 A;  3KC0 A;  3T0J A;  4GBW A;  2HHM A;  4I40 A;  1K9Y A;  2Q8M A;  1EYJ A;  1LBW A;  1FBG A;  1RDX A;  3KC1 A;  1IMA A;  1AWB A;  1Q9D A;  3LV0 A;  1DBZ A;  1CNQ A;  1FPL A;  4GWZ A;  2Y5K A;  1EYK A;  2CZK A;  1EYI A;  1LBV A;  1XI6 A;  2FBP A;  1NUX A;  1IMD A;  1DK4 A;  3LUZ A;  4HE2 A;  4KXP A;  1FPK A;  1FBC A;  4GBV A;  4PTK A;  1FBF A;  1FBH A;  1KA1 A;  1DCU A;  2GQ1 A;  1NUW A;  1FPD A;  4H45 A;  4GWW A;  1NI9 A;  1FPG A;  3BIH A;  4GWS A;  1YXI A;  2PCR A;  1KZ8 A;  1KA0 A;  4FBP A;  4H46 A;  5IZ3 B;  1FPB A;  2P3V A;  4G61 A;  3IFC A;  1FRP A;  5A5L A;  2QVU A;  2QFL A;  5EQA A;  2WEF A;  5ESY A;  3BIG A;  5LDZ A;  2Y5L A;  4GWX A;  5ET5 A;  2QVV A;  1JP4 A;  4HE1 A;  5J16 A;  4HE0 A;  5T3J A;  1FTA A;  5EQ9 A;  4I3Y A;  1INP A;  1NV5 A;  2FIE A;  3RPL B; 
#chains in the Genus database with same CATH topology
 3BKI B;  3FXB A;  4MAG A;  1JQF A;  3JYR A;  1XS5 A;  2KQZ A;  3IO4 A;  1IXI A;  4WED A;  4NE4 A;  4LVQ A;  4P1L A;  2HEU A;  5A5X A;  2Q74 A;  4G77 A;  5JTY A;  1HSJ A;  4JXI A;  2DWI A;  5H8S A;  1QGX A;  4EUO A;  3TKD A;  3WAE A;  3KOT A;  3SES A;  2DSF A;  3ODB A;  2CZI A;  4P0I A;  4F3G A;  2Q88 A;  2XXU A;  1QKA A;  5DVF A;  2V25 A;  3G3J A;  2V4C A;  4BDQ A;  1P99 A;  1Z7M E;  3K4U A;  2DS9 A;  2HAU A;  3IO6 A;  5ICQ A;  1R6Z A;  4OHN A;  1POT A;  2RF1 A;  1LBW A;  2V93 A;  2X7P A;  1JVY A;  4PC9 A;  2XXK A;  5FTI A;  4GWZ A;  3SER A;  2WYK A;  4PBH A;  2A5S A;  1FPK A;  1A54 A;  4QFP A;  4EDP A;  1FPD A;  4GWW A;  3SEU A;  4PCD A;  4ZZE A;  3UN6 A;  4GL8 A;  4P1E A;  1MDP 1;  3ILT B;  4U1Z A;  4DCY A;  5BWJ A;  3R26 A;  4FJP A;  5ITP A;  3MPK A;  2H4I A;  2XWO A;  2XWV A;  1LAX A;  3E4R A;  4MMP A;  2ZYN A;  5LTC A;  4BDL A;  3O28 A;  2XHD A;  2CMO A;  3T9U A;  5I3S A;  1B51 A;  3TCH A;  4NF5 B;  2XXW A;  3PUZ E;  4G68 B;  5H8Q B;  5FHM A;  1FQA A;  3CG3 A;  3CFZ A;  4MHF A;  2B4L A;  4OMB A;  4YAH X;  2JJK A;  4LUB A;  4NF6 A;  2QPQ A;  2Q9T A;  1BK4 A;  4ZS9 A;  4DI4 B;  1OLC A;  1FQD A;  5AA4 B;  5KZT A;  4XTC Q;  3TCF A;  3TTM A;  4OVR A;  1R9Q A;  1FW0 A;  1H43 A;  1CE2 A;  1H76 A;  2DYX A;  4WEP A;  5M2V A;  1II5 A;  5EYG A;  5L9O A;  4F2O A;  1J1N A;  1IMF A;  2RC9 A;  2FVZ A;  3PD8 A;  3DP6 A;  4FIM A;  1B0H A;  3SET A;  3KN3 A;  3DLN A;  2Y7I A;  1ZKB A;  1M5D A;  4QRZ A;  4U21 A;  2HPG A;  4OFJ A;  3OO7 A;  4KI0 E;  4ELO A;  4F19 A;  3TPA A;  3HHF A;  4IO2 A;  3SEV A;  4IGR A;  3A3C A;  4OVS A;  1FBF A;  4TOZ A;  4N6D A;  3L6G A;  4GWS A;  3CVG A;  1Y4T A;  4FAT A;  1N76 A;  4OVJ A;  1PC3 A;  4YKJ A;  3S4U A;  3HHG A;  5EYF A;  1LAH E;  2RC7 A;  3KJT A;  4NWD A;  1SW2 A;  3VLV A;  3IK6 B;  3ZKK A;  4L17 A;  4YMB A;  2RCB A;  2XXH A;  4NF6 B;  4R9F A;  2Y7R A;  3FVN A;  3Q25 A;  1SW5 A;  2O68 A;  2OJT A;  4RA1 A;  4N8G A;  4F2Q A;  2B3F A;  1RDZ A;  3S9L C;  4R2F A;  4Q0C A;  2CZL A;  4KD5 A;  1IMB A;  2H99 A;  3RYD A;  4RYA A;  4XKQ A;  4C0R A;  2OPE A;  4TQU Q;  3K01 A;  3HN0 A;  4P56 A;  4U22 A;  2XWK A;  4IO7 A;  1EU8 A;  4R9G A;  4NN3 A;  2ABH A;  4KYD A;  2DOJ A;  2R8T A;  2NUV A;  2D5W A;  3LSX A;  4NQ8 A;  2UXA A;  2XWI A;  3TFL A;  2V3Q A;  3N94 A;  4ONY A;  2DWH A;  3MVZ A;  3C35 A;  3E3K A;  2GHB A;  4XFE A;  4MIJ A;  1ANF A;  5H8H B;  1O63 A;  2KLF A;  4KQP A;  4JVD A;  2F6P A;  1MH4 A;  2XXP A;  2F7B A;  3H4Z A;  3LSW A;  3V83 A;  2I48 A;  4EXL A;  3R7X A;  4ISU A;  3K0V A;  3MST A;  3P7I A;  3KZG A;  1MY1 A;  4H5F A;  1S7Y A;  1SVX B;  4TLM B;  1JP4 A;  3FGS A;  3K02 A;  4U2R A;  5EQ9 A;  3MP8 A;  5L9M A;  2VP1 A;  1JVX A;  4F3S A;  3B50 A;  3ECR A;  5JK4 A;  3S9M C;  2I49 A;  3I6V A;  4Q5T A;  4GWY A;  2B4M A;  5LOM A;  3K1N A;  3SEX A;  2XXV A;  4G68 C;  1LBZ A;  3QMF A;  4N4U A;  4OVQ A;  4OYV A;  4QXD A;  3LUY A;  3Q27 A;  2OPD A;  1NV6 A;  3ILU B;  5TPA A;  4TLL B;  4U4S A;  2A5T A;  4F39 A;  5BUU A;  4YIC A;  2GH9 A;  2DE2 A;  3H6U A;  3QUJ A;  3K6W A;  4FOR A;  1S9T A;  3S9N C;  1FJ6 A;  1XT8 A;  4PE5 B;  3KC0 A;  3GBB A;  1MM6 A;  1TXF A;  4O3A A;  4FE8 A;  1BKA A;  3IX1 A;  1N7X A;  1L5T A;  2I58 A;  1OQH A;  4O3C A;  2F7C A;  3B7D A;  3OO6 A;  1UTB B;  3KFM A;  3PUY E;  3B6W A;  3TYH A;  1B9J A;  4FED A;  4DE8 A;  2Q2A A;  3THI A;  4N13 A;  1Y20 A;  3V5A A;  4F18 A;  2Z8F A;  5IKB A;  1TFD A;  4ZE8 A;  1MQH A;  3FXQ A;  3HO7 A;  4UAC A;  2O6A A;  3O66 A;  1EZO A;  2XX7 A;  3HFU A;  3LSF B;  4DCX A;  1P1O A;  1LBB A;  2QS4 A;  1QW0 A;  1PDA A;  2QS2 A;  2UVG A;  4EF2 A;  3GXA A;  4MNP A;  4N07 A;  3PUW E;  4QFL A;  5HPQ A;  5CRY A;  2PT1 A;  3RTF B;  4F22 A;  2ALU A;  5HM4 B;  5JEI A;  2F5X A;  4R2B A;  1MPD A;  1LEV A;  1LB8 A;  1D9Q A;  1FPJ A;  4R6K A;  3OO8 A;  3CSB A;  3RT8 A;  1QUJ A;  1FJ9 A;  3IAZ A;  3LC8 A;  1N3X A;  3KEI A;  5EQ7 A;  2IEE A;  3B6T A;  2QS1 A;  1M5E A;  2OWT A;  4PF6 A;  5I2K B;  1XHY A;  1NL5 A;  4H8J A;  4OFL A;  3EHS A;  3UP9 A;  4QSE A;  4OER A;  3UK4 A;  5H8F B;  3G3F A;  3BBR A;  4RPO A;  1O64 A;  4H1X A;  2OBG A;  4O3B A;  5KDT B;  3QK6 A;  1LAG E;  1VFD A;  1FBC A;  2UVJ A;  3PMW A;  4NX1 A;  4OQO A;  3FXU A;  1B40 A;  1EZ9 A;  3RY3 A;  4P11 A;  3MZ9 A;  4ESX A;  4R6H A;  1LCF A;  1JEU A;  2DVC A;  3UOR A;  4GXS B;  3E9X A;  1LCT A;  5ESY A;  1B7Z A;  1RYO A;  3BIG A;  5J16 A;  1N7W A;  1MQI A;  4I62 A;  2FA7 A;  4RNS A;  3PGF A;  3IJX B;  3ISP A;  5CMM A;  3CFL A;  4GX3 A;  3I3V A;  1PB9 A;  3RNN A;  3USD A;  3T66 A;  4PDH A;  1TT1 A;  1FBE A;  3IOT A;  3VVF A;  1NUZ A;  4XKR A;  2GRV A;  4YMA A;  2Y7P A;  1ZJL A;  2XXQ A;  3MZ1 A;  3TTL A;  5IAI A;  4PFB A;  1FPF A;  1PB8 A;  3O9P A;  3KBZ A;  4KFQ A;  3PPR A;  1Y4C A;  1B5I A;  2V3T A;  4OVT A;  1QUK A;  1MDQ A;  1I6A A;  5EHS A;  2HCA A;  4IY5 A;  4X8R A;  5IZZ A;  4PQJ A;  4MNC A;  1GVC A;  4KCC A;  4MF3 A;  3T0J A;  1B3H A;  4I40 A;  1K9Y A;  4EQB A;  3OEN A;  4IB2 A;  2DVZ A;  1IQ7 A;  2Z23 A;  3VVE A;  3T96 B;  4G4P A;  2ZMB A;  3C31 A;  2I0B A;  1MY0 A;  1Y3Q A;  1US4 A;  2CZK A;  4NF5 A;  2PX1 A;  1GGG A;  3FVO A;  2HXW A;  3LUZ A;  4G68 A;  3OEM A;  5H8Q A;  1MPB A;  2VOZ A;  2GQ1 A;  2DWA A;  3MVW A;  1IIT A;  1FQC A;  3BIH A;  3RN8 A;  3OMB A;  2PFZ A;  4EF1 A;  4G2Z A;  1QUI A;  2Y7W A;  2QMW A;  4G61 A;  1FRP A;  4NMY A;  2QVU A;  2QFL A;  2GFE A;  2ZNS A;  2WEF A;  5AA4 A;  5I59 B;  2PFY A;  3OOA A;  4MEV A;  1B3F A;  3TUS A;  5KCJ B;  2UYE A;  2ZXT A;  3Q26 A;  1IME A;  5ET8 A;  1NV1 A;  3O29 A;  1NKX A;  1FSA A;  1FTM A;  2O69 A;  4LN5 A;  4PP0 A;  4GIZ A;  1FTJ A;  1VSO A;  1URG A;  4BDN A;  3K2D A;  3A3U A;  1B3L A;  4KPT A;  2P3N A;  4PFT A;  2O51 A;  4PE3 A;  4BDM A;  2REJ A;  1MQJ A;  4ZZA A;  2B3B A;  1XVX A;  1I69 A;  3FJM A;  4G8M A;  2UVI A;  4GFR A;  1B4Z A;  1IMC A;  4IR8 A;  3RPW A;  1B6H A;  3ZSF A;  2NXO A;  5CMC A;  2F36 A;  2Y7K A;  5F7V A;  1YZ0 A;  2OWZ A;  1KWH A;  3OO9 A;  3VXC A;  4KHZ E;  5AA2 B;  1G0H A;  1PEB A;  4Z0I A;  2PT2 A;  3GYY A;  3G3G A;  1B0L A;  4OEV A;  1EYJ A;  3KC1 A;  5ELV A;  1AWB A;  1ZBM A;  1A55 A;  5I58 B;  1OLA A;  4ELQ A;  3EQ1 A;  4ZE9 A;  1SBP A;  2F7A A;  4YU0 A;  1ZIU A;  1VFE A;  3VLW A;  1DCU A;  4RY1 A;  4LAT A;  4NAP A;  2YPN A;  2XX8 A;  3SKP A;  4Z7E A;  4H46 A;  2UVH A;  3CG1 A;  3E79 A;  5I5P A;  4WXJ A;  4PFY A;  5A5L A;  4E0W A;  1SDX A;  5I56 B;  1NFT A;  3OXN A;  4KYS A;  4QSD A;  3C32 A;  2XD3 A;  1EZP A;  1NH8 A;  1P1U A;  3N5L A;  4YKI A;  4ZEI A;  1IXG A;  2H9B A;  4NF8 B;  3TTR A;  1DSN A;  2DDK A;  3TCG A;  3MW0 A;  1LBY A;  5H8H A;  4LZ5 A;  1G0I A;  5CMK A;  4I3E A;  2VPO A;  3RGY A;  1A8F A;  2FIX A;  5FTH A;  2OK2 A;  5CBR A;  3M3K A;  1B3G A;  3K6V A;  1SYI A;  3KGC A;  2ONK E;  1TFA A;  3H6V A;  3OEL A;  4IO5 A;  1JW1 A;  1AMF A;  2F34 A;  2F35 A;  4ECF A;  4OEU A;  1Q1K A;  1SYH A;  2Z22 A;  4U23 A;  3QXM A;  1I6Q A;  5HBC A;  3QUF A;  3QAX A;  1IXH A;  4EQ7 A;  5AA3 A;  1FBG A;  3Q28 A;  4HS7 A;  4X48 A;  2ONS A;  1Y9U A;  4YB7 A;  4XKP A;  4HE2 A;  5L9S A;  4GBV A;  4AB5 A;  4MX6 A;  3MP6 A;  5ITO A;  3PUX E;  1MXX A;  1P1W A;  3IB0 A;  1NNF A;  1B3E A;  1SW1 A;  1YXI A;  1A40 A;  3MZB A;  2P3V A;  4X04 A;  4OTE A;  1YCJ A;  4NF4 B;  1ELJ A;  1SI1 A;  3FD3 A;  3AXF A;  4JWY A;  3T22 A;  3M3F A;  2Y5L A;  3TTK A;  1LLS A;  3K6U A;  2NWJ A;  4HE1 A;  3D4G A;  5T3J A;  3PPP A;  3C36 A;  5K2Y A;  2F8D A;  4I3Y A;  1A8E A;  1MQD A;  3W9W A;  4O94 A;  3IB2 A;  3ROJ A;  4N6K A;  5H8N B;  1NMU A;  2E1S A;  3W9V A;  3O6I A;  2V3U A;  4JSO A;  2XA5 A;  1URD A;  1R9L A;  3PMX A;  2I6E A;  4DXC A;  4I8C A;  1XVY A;  1ATG A;  2F97 A;  4NF0 A;  5CBS A;  3C4M A;  1UQW A;  1FQE A;  3UGW A;  4XF5 A;  4JVI A;  1UTB A;  4MJO A;  2G29 A;  3T9X B;  5K2X A;  4PAI A;  1JEV A;  4GWU A;  1JW4 A;  2H25 A;  3C34 A;  4X1B A;  3MJN A;  2ZNU A;  3KOS A;  2XXR A;  4RXL A;  4PFW A;  3S2V A;  4F31 B;  1SQY A;  3HST A;  3LSL A;  2REG A;  3TTN A;  3PD9 A;  1LBV A;  4PET A;  4YB5 A;  4ZEC A;  3PTY A;  2P2A A;  4WKM A;  4DDD A;  3ZS6 A;  5AE4 A;  4MLQ A;  1QKB A;  4ZED A;  4P3L A;  4GF8 A;  2CEY A;  1IIW A;  3N6U A;  5L8D A;  2B65 A;  4DXU A;  2XXY A;  4JWO A;  4DZ1 A;  4IGT A;  3M3L A;  2DE4 A;  2OLB A;  4ZEB A;  4ELP A;  1MY2 A;  1FTA A;  1BTJ A;  1FQB A;  2QVR A;  2OCU A;  4YKP A;  4ESW A;  2Z8D A;  4AS5 A;  5I2K A;  4OET A;  4JDF A;  1XOC A;  4POX A;  1FBP A;  2AIX A;  4R72 A;  4LZ8 A;  2H5Y A;  4X9T A;  2WYP A;  1UTH B;  5H8F A;  5TP9 A;  5KDT A;  3IOV A;  3K00 A;  1FPE A;  1MXY A;  4XEQ A;  3CSG A;  3GBA A;  2WBD A;  2HZK A;  2UYF A;  3TQL A;  4PAF A;  2X7Q A;  3IJO B;  2F3B A;  1NH7 A;  2Y84 A;  4NGU A;  5EQ8 A;  4I1D A;  5I2N B;  1VE4 A;  2IA4 A;  2HHM A;  2Q2C A;  2XXI A;  2ZYO A;  5DT6 A;  1XC1 A;  3C33 A;  1ZLQ A;  3KN7 A;  1CNQ A;  5IGA A;  2Y5K A;  3NOH A;  1IMD A;  2I4C A;  4PTK A;  2I3V A;  1Y3P A;  1FTO A;  5DEX B;  3KJ7 A;  2R6G E;  4Q8R A;  5IZ3 B;  2F6G A;  1FPB A;  2RIN A;  3PU5 A;  1HSE A;  1MG1 A;  2FNC A;  5EQA A;  1LFG A;  3E13 X;  4GWX A;  3U1O A;  3IOR A;  5TP9 B;  1US5 A;  4PF8 A;  3TOD A;  4OA4 A;  2WKY A;  3MQ9 A;  3FJG A;  1Y1Z A;  3PPO A;  1NNP A;  3H06 B;  1B05 A;  2HAV A;  4ZEF A;  1NV2 A;  4H8I A;  5F1Q A;  3SDF A;  2CZH A;  1OVT A;  4MBP A;  2QL3 A;  4XIG Q;  4DLD A;  3FV2 A;  2VT5 A;  2RC8 A;  3D4C A;  2XD2 A;  4NHB A;  4NWC A;  4OVP A;  3C9H A;  3EHT A;  3SZP A;  3D1R A;  4F1Y A;  2O1L A;  5TU0 A;  4H67 A;  3I5O A;  4GX6 A;  1DPP A;  3K6X A;  1LBC A;  4PFR A;  2ZNT A;  4GWO A;  4DXB A;  3RT6 B;  3G3K A;  1K9Z A;  4R73 A;  1A99 A;  5ET6 A;  4GD5 A;  2VGQ A;  5I59 A;  1M5B A;  4Q30 B;  1AIV A;  4LQ5 A;  3VDF A;  2ZZW A;  2BJJ X;  4PDD A;  1TWY A;  3LBS A;  4ELR A;  5KCJ A;  4IY6 A;  3LR1 A;  4HTG A;  4YB6 A;  2XXT A;  1UIU A;  3DEL B;  1DK4 A;  3CIJ A;  1LGB C;  1SD3 A;  1B5H A;  4H45 A;  3A09 A;  1NI9 A;  3MAM A;  4LZ7 A;  3MVY A;  1OIB A;  1R1N A;  5ISU A;  4IO3 A;  5CMB A;  4P8B A;  4GL0 A;  3EPE A;  4OFO A;  5B7D A;  4F1U A;  5ET5 A;  3FZV A;  3ZKL A;  2PMS A;  3T9V A;  3BFT A;  2HXR A;  2Z8E A;  3U93 A;  2X26 A;  4YKK A;  4H0W A;  1INP A;  2HZL A;  3H6T A;  4LP2 B;  1MY4 A;  1GTK A;  3OD7 A;  3HCQ A;  4O8M A;  3PPN A;  5AA2 A;  2VD3 A;  5I57 B;  3TQW A;  1URS A;  3MBP A;  3G3H A;  5FBP A;  1B1H A;  3TEL A;  2DWJ A;  1B46 A;  1DOT A;  4I9D A;  4MLV A;  2OX3 A;  2DP8 A;  5I58 A;  4OEN A;  4HXV A;  1BP5 A;  1F9B A;  3SEW A;  1NV3 A;  3CR9 A;  1VR5 A;  1YTV A;  3FBP A;  1AOV A;  2WX9 A;  1CB6 A;  1LST A;  2I3W A;  3IFA A;  1PB7 A;  3FVG A;  1MY3 A;  5F24 A;  4M1V A;  1FBD A;  1NV0 A;  1OMP A;  2D3I A;  1MXU A;  1S50 A;  4C1U A;  4OXV A;  2F3D A;  4U1O A;  4NED A;  5I56 A;  4C1T A;  4FEC A;  3VVD A;  4AS4 A;  1DMB A;  2FYI A;  4MH5 A;  3TAJ A;  2P0S A;  4H65 A;  2OWS A;  4PAK A;  1DTG A;  3DM0 A;  4E0X A;  3LV0 A;  5A5X B;  2AL5 A;  5JTY B;  4F1V A;  1EYK A;  4NF8 A;  1XI6 A;  1ZTY A;  3KG2 A;  1P1Q A;  3DP8 A;  3FV1 A;  1O7T A;  1WDN A;  1KZ8 A;  1KA0 A;  4JB7 A;  3QIM A;  1AL3 A;  3OEK A;  3PV0 E;  2ZYM A;  3O97 A;  1B4H A;  4GLI A;  3T9H B;  2I4B A;  3JZJ A;  1D3K A;  3EF7 A;  5DTB A;  4QF9 A;  1B2H A;  3K1P A;  2RCA A;  4PGP A;  4ND9 A;  3FIR A;  4U4X A;  1Z7N E;  4RK9 A;  1OQG A;  1YYZ A;  3CFX A;  3ONM A;  2DXY A;  4FEB A;  2D21 A;  3GLB A;  3Q29 A;  1NUY A;  5CI5 A;  4BDR A;  4OZ9 A;  4EXK A;  1MH3 A;  1VDW A;  4LA9 A;  5CM6 A;  3IOU A;  2L5V A;  3IOW A;  1HSL A;  1JNF A;  4N15 A;  1MXW A;  3N6T A;  1FPI A;  1M5F A;  3FAT A;  4NF4 A;  3UA8 A;  2CEX A;  3KSX A;  3U72 A;  4QBA A;  1RDY A;  5AA1 A;  3H03 A;  5IM2 A;  3KBR A;  2HQ0 A;  1D9Y A;  1T0K A;  3B6Q A;  2THI A;  2YLN A;  3RUM A;  3EN3 A;  2W7Y A;  5H8N A;  3BFU A;  3U8Q A;  1EYI A;  3O2A A;  4QSC A;  4XXU A;  5DVJ A;  3N26 A;  4OES A;  4THI A;  4F3B A;  2PBW A;  3FVK A;  1KA1 A;  3OSQ A;  3PMV A;  4N8Y A;  1JW5 A;  1FCK A;  2PYY A;  2PCR A;  3KSJ A;  1N3W A;  2MKZ A;  1MXZ A;  5I84 A;  1PBQ A;  4BDO A;  3TEP A;  5LDZ A;  3SEY A;  3T93 B;  4GOT A;  4JVC A;  3QYT A;  3KN8 A;  4MCO A;  5ICT A;  3O6G A;  1H3D A;  3FUZ A;  4NG7 A;  2NOO A;  3A29 A;  4QFN A;  2VD2 A;  5J1D A;  3CHG A;  4KCD A;  4ZEK A;  3PPQ A;  4IO4 A;  3FJ7 A;  4MFI A;  2ZYK A;  2O1M A;  2YJP A;  4KYE A;  3VFJ A;  4QFO A;  4POW A;  3CI8 A;  3MP1 A;  4P0G A;  3OSR A;  4RJZ A;  4IO6 A;  1M5C A;  1I6B A;  5AA2 D;  1LBX A;  3HV1 A;  3RPL A;  2O7I A;  4N81 A;  2XX9 A;  4F3P A;  1AH5 A;  2DQV A;  3RQT A;  4GVO A;  3MUQ A;  4KR5 A;  1P1N A;  1GR2 A;  1NNK A;  4RPN A;  4O7I A;  3T1B A;  1QUL A;  2ANJ A;  4K3F A;  2NVU B;  3JV9 A;  4M4G A;  3V8X B;  1FTK A;  4AQ4 A;  4F29 A;  2V84 A;  2DE3 A;  2O7U A;  3G7W A;  2P1S A;  2Q8J A;  1RYX A;  4R75 A;  1IEJ A;  1FPL A;  1ZU0 A;  1SW4 A;  1NUX A;  1Q35 A;  3W15 C;  4KXP A;  5FHO A;  3U65 A;  2ZZV A;  4N6P A;  4R74 A;  1ZMG A;  3WAF A;  1USY E;  1UTH A;  1B7U A;  3H7M A;  4JSD A;  1A7L A;  3VLU A;  3MYU A;  1H45 A;  4GRK A;  1B1X A;  4RK2 A;  2RKM A;  2HFB A;  4HE0 A;  1B7H A;  4QHQ A;  2VHA A;  1FQF A;  3RPL B;  2AYS A;  4HW8 A;  5I2N A;  4DIG A;  3VV5 A;  1NNT A;  1WVJ A;  4JBZ A;  1PBP A;  4H5G A;  1DTZ A;  5IZ1 A;  3VXB A;  4GQO A;  2Q89 A;  1MQG A;  5CC2 A;  1D4N A;  3L6H A;  1USY H;  2WBB A;  2GHA A;  4ZDM A;  4EQ9 A;  1NV7 A;  5ET7 A;  4HCY A;  5DEX A;  3MPL A;  1MPC A;  3MVX A;  4QFK A;  1N04 A;  2KR0 A;  4MNI A;  2LAO A;  4UAB A;  5IZ3 A;  2PVU A;  3EHU A;  4OAN A;  3K1M A;  4G8H A;  1Y3N A;  2I0C A;  3FAS A;  5B70 A;  2QRY A;  2R9J A;  3O6H A;  3UIF A;  3H6W A;  1JET A;  3TZA A;  4GBW A;  1BLF A;  2Q8M A;  1RDX A;  2QSX A;  3M8U A;  5I7I A;  4HCW A;  4PFU A;  4BLA A;  2DXR A;  4JWX A;  5DYH A;  4XKN A;  4YZZ A;  1QJM A;  4N17 A;  1FBH A;  1LFH A;  2VPN A;  5TPA B;  1MXV A;  2ESN A;  4FAJ A;  1B58 A;  4UA8 A;  1GV8 A;  1IXC A;  1FTL A;  4FBP A;  3RLF E;  2A5T B;  3F11 A;  5EHM A;  4PBQ A;  2QMX A;  1MS7 A;  4LON B;  5DVI A;  5FHN A;  2R71 A;  3HPI A;  3TMG A;  1IZ1 A;  3G3I A;  1B5J A;  3FXR A;  1MM7 A;  2OZZ A;  3B8B A;  1BIY A;  3MC2 A;  1OVB A;  3RTW B;  4NTL A;  1RKM A;  4OWD A;  3DP4 A;  2E0S A;  3IL1 B;  2BJI A;  4N91 A;  4P47 A;  2QS3 A;  4R6Y A;  3EKI A;  1SPI A;  1N0T A;  1H44 A;  2G93 A;  1D9V A;  1QVS A;  2AL4 A;  3MWB A;  1MRP A;  2ZZX A;  3QSL A;  5EYH A;  3V89 B;  4AB6 A;  4GXA A;  2O84 X;  2H98 A;  1IUD A;  4PFI A;  1POY 1;  1YPN A;  4P9K A;  3GZG A;  2FHY A;  1NV4 A;  5DW8 A;  4GX4 A;  4H6D A;  4PGN A;  3R6U A;  3TDJ A;  1B32 A;  1IMA A;  3H3G A;  1EH3 A;  1Q9D A;  1DBZ A;  5I57 A;  1DPE A;  2XXX A;  1LB9 A;  3VE1 B;  2FBP A;  1LFI A;  1UIV A;  3IB1 A;  2ONR A;  1SI0 A;  1B52 A;  1NUW A;  1FPG A;  2QJE A;  3U92 A;  3IR1 A;  3IFC A;  1WOD A;  3E78 A;  3S9E A;  1Y1M A;  2M8C A;  4LQ2 A;  4O7M A;  2QVV A;  1LAF E;  1N84 A;  4X1D A;  3U94 A;  4DI3 D;  1YAE A;  4G8N A;  2F78 A;  3CRB A;  3PUV E;  1NV5 A;  2FIE A; 
#chains in the Genus database with same CATH homology
 3ROJ A;  4N6K A;  3FXB A;  1YYZ A;  3W9V A;  4MAG A;  2XA5 A;  2KQZ A;  4MNP A;  1NUY A;  4NF0 A;  4P1L A;  2Q74 A;  4XF5 A;  4JVI A;  1QGX A;  1VDW A;  4MJO A;  2CZI A;  5CM6 A;  2F5X A;  1LEV A;  2L5V A;  1D9Q A;  4PAI A;  1FPJ A;  4N15 A;  4GWU A;  1FPI A;  1FJ9 A;  2CEX A;  2V4C A;  5EQ7 A;  4QBA A;  1RDY A;  4PF6 A;  5IM2 A;  1LBW A;  4PC9 A;  2XXK A;  4GWZ A;  2WYK A;  1EYI A;  1LBV A;  4PET A;  4PBH A;  1FPK A;  1FBC A;  4NX1 A;  3PTY A;  1KA1 A;  1FPD A;  4GWW A;  4N8Y A;  4P3L A;  4PCD A;  2PCR A;  2CEY A;  4P1E A;  2MKZ A;  5ESY A;  3BIG A;  5LDZ A;  2DE4 A;  5J16 A;  2XWO A;  2XWV A;  1FTA A;  4JVC A;  4MMP A;  5LTC A;  3ISP A;  4MCO A;  4NG7 A;  4GX3 A;  3A29 A;  5J1D A;  2QVR A;  3CHG A;  5I3S A;  4PDH A;  4AS5 A;  1FBE A;  1FBP A;  1NUZ A;  4MHF A;  2B4L A;  4X9T A;  2WYP A;  2JJK A;  4PFB A;  2QPQ A;  2Q9T A;  1BK4 A;  4DI4 B;  1FPF A;  1FPE A;  1LBX A;  4XEQ A;  3RPL A;  4N81 A;  3KBZ A;  4OVR A;  2WBD A;  2HZK A;  4OVT A;  4PAF A;  4O7I A;  5EYG A;  3T1B A;  2F3B A;  1IMF A;  4X8R A;  5IZZ A;  4NGU A;  5EQ8 A;  2FVZ A;  4MNC A;  3T0J A;  2DE3 A;  2HHM A;  4I40 A;  1K9Y A;  2DVZ A;  2HPG A;  1CNQ A;  4F19 A;  1FPL A;  5IGA A;  2Y5K A;  2CZK A;  3NOH A;  1NUX A;  1IMD A;  3LUZ A;  4KXP A;  3U65 A;  4OVS A;  4PTK A;  2ZZV A;  1FBF A;  2GQ1 A;  4N6D A;  3BIH A;  4GWS A;  2PFZ A;  5IZ3 B;  1FPB A;  4G61 A;  1FRP A;  2QVU A;  2QFL A;  3MYU A;  5EQA A;  2WEF A;  4GWX A;  2PFY A;  4PF8 A;  4OA4 A;  4HE0 A;  4MEV A;  3RPL B;  1NV2 A;  1IME A;  4N8G A;  5ET8 A;  1NV1 A;  1FSA A;  1RDZ A;  4LN5 A;  2CZH A;  5IZ1 A;  1IMB A;  2VT5 A;  3RYD A;  2P3N A;  4NHB A;  4OVP A;  4PE3 A;  3SZP A;  3D1R A;  4GX6 A;  4P56 A;  2WBB A;  2XWK A;  4NN3 A;  1NV7 A;  5ET7 A;  4PFR A;  1IMC A;  4IR8 A;  4HCY A;  2KR0 A;  4MNI A;  4UAB A;  5IZ3 A;  2R8T A;  1K9Z A;  4NQ8 A;  1YZ0 A;  5ET6 A;  2OWZ A;  4OAN A;  1G0H A;  2XWI A;  2V3Q A;  2ZZW A;  3GYY A;  4PDD A;  4GBW A;  4XFE A;  4MIJ A;  2Q8M A;  1EYJ A;  1RDX A;  3KC1 A;  1AWB A;  5I7I A;  4JVD A;  4HCW A;  1DK4 A;  4YZZ A;  4N17 A;  1FBH A;  1DCU A;  2VPN A;  4H45 A;  1NI9 A;  4NAP A;  3MST A;  4FBP A;  4H46 A;  3E79 A;  5I5P A;  4PBQ A;  5A5L A;  4P8B A;  4F1U A;  5ET5 A;  1JP4 A;  2HXR A;  5EQ9 A;  1INP A;  2HZL A;  4O8M A;  3B8B A;  3B50 A;  2DDK A;  5JK4 A;  5FBP A;  1LBY A;  4GWY A;  2B4M A;  2OX3 A;  1G0I A;  2BJI A;  4HXV A;  4I3E A;  4N91 A;  4P47 A;  2VPO A;  1LBZ A;  3QMF A;  4N4U A;  3EKI A;  4OVQ A;  1SPI A;  2FIX A;  1NV3 A;  4QXD A;  3FBP A;  2WX9 A;  1NV6 A;  2ZZX A;  5EYH A;  3IFA A;  5F24 A;  4M1V A;  1FBD A;  4PFI A;  1NV0 A;  4P9K A;  4YIC A;  2DE2 A;  2FHY A;  2F3D A;  1NV4 A;  1FJ6 A;  5DW8 A;  4GX4 A;  4AS4 A;  4PGN A;  3KC0 A;  1FBG A;  4PAK A;  1IMA A;  1Q9D A;  3LV0 A;  1DBZ A;  4F1V A;  1EYK A;  2FBP A;  1XI6 A;  4HE2 A;  4GBV A;  4MX6 A;  1NUW A;  1FPG A;  1YXI A;  1KZ8 A;  1KA0 A;  4F18 A;  2P3V A;  4X04 A;  3IFC A;  3E78 A;  4O7M A;  2Y5L A;  2QVV A;  4HE1 A;  4DI3 D;  5T3J A;  3HFU A;  4I3Y A;  1NV5 A;  2FIE A;  3W9W A;  4O94 A;  4PGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...