1G0HA

Crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of the MJ0109 gene product: a bifunctional enzyme with inositol monophosphatase and fructose 1,6-bisphosphatase activities.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 74
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2000-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1g0hA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1g0hA02
5IZ3A 4H46A 5IZ1A 2F3BA 1IMFA 1FJ6A 1FBGA 1YYZA 5LDZA 2OX3A 3D1RA 3IFCA 1NV7A 1FPLA 1EYIA 3RPLA 4GWWA 1DCUA 1RDYA 2BJIA 3KC1A 1BK4A 1KA0A 1LEVA 1FPBA 1D9QA 1FBEA 5EQAA 5ET8A 5EQ7A 4O7IA 5ESYA 3T0JA 2QFLA 3RYDA 1FBHA 1NUWA 5ET7A 1YXIA 3LV0A 4I3YA 1DBZA 2OWZA 2P3NA 3IFAA 4HE0A 4GX4A 5ET5A 1FBPA 4I40A 2FHYA 2QVUA 1YZ0A 4MJOA 1IMEA 4GWSA 1NI9A 5FBPA 2FIEA 1LBWA 1NV2A 1FPKA 2Q74A 1NV5A 1LBZA 2HHMA 3KC0A 4QXDA 1FRPA 2WBBA 1LBYA 4H45A 4FBPA 5F24A 1IMBA 1NUZA 4GWZA 2CZIA 2JJKA 1QGXA 1NV0A 1FPDA 3B8BA 3ROJA 3RPLB 1G0HA 1NV3A 1CNQA 1LBVA 2QVRA 1LBXA 1FBCA 1NV1A 2PCRA 4N81A 1NUXA 5IZ3B 4GBVA 2Y5LA 1SPIA 1K9ZA 1NV4A 5A5LA 1FBDA 4KXPA 4HXVA 1EYKA 1VDWA 3LUZA 2WBDA 1INPA 2R8TA 5EYGA 5EQ8A 1EYJA 2GQ1A 4GWYA 4GWUA 2DDKA 4HE2A 1IMCA 1JP4A 5J16A 4GWXA 4G61A 2F3DA 4GBWA 2Y5KA 2FIXA 4GX3A 4PTKA 1FPJA 1NUYA 4I3EA 1FSAA 5I3SA 2P3VA 4GX6A 2WEFA 3A29A 1KA1A 1IMAA 2CZHA 1FPIA 1XI6A 5EQ9A 1AWBA 3FBPA 1K9YA 2QVVA 5DW8A 5T3JA 2CZKA 2FVZA 2FBPA 1KZ8A 2Q8MA 3BIGA 3QMFA 1FTAA 1NV6A 5EYHA 4AS4A 1IMDA 3BIHA 5ET6A 1G0IA 4AS5A 2VT5A 3KBZA 1Q9DA 1DK4A 1FPEA 1RDXA 4IR8A 1FBFA 1FJ9A 1FPFA 1RDZA 1FPGA 4HE1A
chains in the Genus database with same CATH superfamily
1B0HA 1B7UA 4QFLA 4F3BA 1YYZA 2A5TA 1AIVA 5LDZA 2DSFA 4GOTA 1DCUA 1I69A 4BDMA 3T1BA 3HO7A 2Z8DA 1B58A 5DTBA 1Y3PA 1YXIA 4ZE8A 1B4ZA 5ET5A 1FBPA 2DWIA 2FIEA 3KC0A 3Q27A 1JW1A 1MDP1 1MY4A 4BDNA 4UABA 4MH5A 4XXUA 2F7CA 4GF8A 5F24A 2ONKE 2JJKA 3VDFA 3TTNA 4IY5A 1R1NA 1BIYA 3C31A 5KZTA 4NWDA 1A54A 3E13X 3FVOA 1NUXA 4R2BA 2YLNA 5IGAA 1NV4A 1URGA 4KXPA 2PVUA 1XVXA 1HSLA 4R9FA 4F29A 3FIRA 4GWYA 4NF6B 4H65A 3QUJA 2PMSA 3EPEA 1JQFA 2AL5A 4YAHX 4GXSB 1NH8A 3U93A 2RKMA 3K6VA 1FPIA 5H8HB 5A5XA 4I8CA 3Q29A 4EXKA 3O6GA 1Y3QA 1UTBB 4NF8A 1O7TA 2RC8A 2PYYA 4C1UA 2PT2A 3EQ1A 3KBZA 1FPEA 2PX1A 2O7IA 1FPFA 1S50A 4FECA 3ZKKA 4MFIA 5H8FA 4IGTA 4QSDA 1MH4A 1A99A 1IXHA 4XKQA 1P1WA 4LONB 4PGPA 4POXA 1PBPA 1VE4A 1KA0A 4U2RA 1MXUA 1MY3A 1FTJA 1LAFE 4PFUA 1N84A 1PBQA 3V8XB 2I49A 1US4A 1GGGA 4FE8A 1DBZA 4RA1A 4MNPA 3A3UA 3PPOA 4QXDA 1P1QA 3C34A 3IJOB 5CMBA 3O29A 2Y7PA 4R73A 2ONRA 3B8BA 2Y84A 5EHMA 3BFTA 3IB2A 1VFDA 2XD3A 3KSXA 3U8QA 4KYDA 1TFAA 4U1OA 3SEVA 4JSOA 5LOMA 3TPAA 2QPQA 2X26A 3K6UA 3U92A 4O3CA 4U4XA 3G3FA 1SI0A 3H6VA 2WYPA 3ISPA 4NF8B 1UTBA 2DDKA 1FW0A 3H6TA 2ONSA 2Y7IA 1QULA 2XXIA 3ONMA 2FIXA 3ILTB 1XHYA 2DE4A 3JYRA 5DVFA 4IO5A 3IB0A 5H8FB 1KA1A 1UTHB 2CZHA 3IORA 3FBPA 4U23A 1B0LA 4R6YA 2F8DA 3GZGA 3MP1A 1O64A 5ET6A 4AS5A 4G8NA 1FJ9A 4I9DA 4LZ5A 3S2VA 3IB1A 1JNFA 1OVBA 2F97A 2XXHA 1MY2A 2DYXA 4PAKA 4R74A 4X1DA 1BK4A 4N6PA 3C4MA 3O97A 2KR0A 3EHUA 3TCFA 2OWZA 3IFAA 1LLSA 4I40A 3LBSA 4PBQA 5B7DA 5BUUA 1IMEA 1JEUA 2O1MA 1FPKA 1SW5A 3P7IA 5CBRA 1YTVA 3U1OA 1LBYA 4HTGA 4X48A 3TZAA 2UYFA 2Y7RA 1YPNA 4JSDA 3TTRA 2QJEA 4H5FA 2O51A 2XXXA 1DMBA 4O3AA 1LBVA 1LBXA 4NF5A 3CSGA 2HFBA 1D4NA 1NFTA 2ZMBA 1D3KA 3OD7A 4NX1A 3S9NC 3VVDA 2R8TA 4NQ8A 3N6UA 3PUWE 2I4BA 3CFLA 4GWXA 4FORA 2F3DA 1CB6A 1IQ7A 1EZPA 4WXJA 4UACA 2NUVA 4PETA 5B70A 1NNFA 3B7DA 3MW0A 1L5TA 5AA2A 5EYHA 2QS1A 4NE4A 1ZMGA 4N8YA 1Q9DA 1P99A 3CFZA 2OK2A 3PTYA 2F7BA 2D21A 3TEPA 2OBGA 5H8NA 4TQUQ 1POY1 2XXTA 2B3BA 4BDOA 3GYYA 4WEPA 4ESWA 1POTA 3G3KA 3MVZA 5EYFA 3GLBA 4IY6A 5K2YA 3OEMA 1FPBA 1D9QA 4NG7A 5EQAA 4ND9A 4O7IA 4PAFA 4LQ2A 1NUWA 5ET7A 2ZXTA 3LV0A 3UIFA 3TODA 1MS7A 5CMKA 5I56B 3R26A 4KD5A 3UN6A 2HHMA 3G3IA 4PE5B 4MBPA 2D5WA 5AA4B 3MUQA 3BKIB 4XKRA 1FPDA 4EF1A 2O69A 3IOVA 3RGYA 2V3TA 3PMXA 3JV9A 1N3WA 4KCDA 1NV1A 4DXBA 3MZ9A 1SW4A 2Y5LA 3E9XA 3MZBA 4Q8RA 4DLDA 4NMYA 4HXVA 2F5XA 3CG1A 1SW1A 3LUZA 4GQOA 5AE4A 2UVJA 2UVHA 1IMCA 4GWOA 3B6QA 3RN8A 4F1YA 2XX8A 4G61A 1FQCA 3FZVA 3PPPA 2XHDA 2DE3A 4JDFA 1FQFA 2PBWA 4R75A 1BKAA 4MLVA 1KWHA 4PC9A 1B3EA 5L9SA 3T96B 4K3FA 4NF4B 1FTAA 4MCOA 2NVUB 3Q25A 4MLQA 4PBHA 1H45A 2Z8FA 5A5LA 4HE1A 3TELA 4OEUA 4H8IA 4R2FA 3FJMA 2UVGA 4XTCQ 3FXBA 4GWWA 2P2AA 4GFRA 2MKZA 3VVEA 1MH3A 3ECRA 2AIXA 1IUDA 5I56A 3T0JA 2ESNA 2QFLA 2ZZXA 5CM6A 2HZKA 1RKMA 1B7HA 2VGQA 2OWTA 4MJOA 4NAPA 3GBAA 4GL8A 5LTCA 4MAGA 1LBWA 2L5VA 3E79A 4OERA 2ALUA 4MNCA 2H99A 1FQDA 1NUZA 5I2KB 1SD3A 1MY1A 1Y4TA 3N94A 4OMBA 4F2OA 1ATGA 4ONYA 4O94A 1SPIA 4P11A 1RYOA 1FBDA 2X7PA 2OLBA 3MP8A 1IXIA 3OEKA 1INPA 3KZGA 5EYGA 4ZDMA 2REJA 3PUXE 4GXAA 4P0GA 2BJJX 3OOAA 1LAXA 3K4UA 3T9VA 4YB6A 3IJXB 1OLCA 5H8QA 1B51A 3K00A 2IA4A 4Q30B 4U4SA 4BDQA 4OVPA 3C9HA 1AL3A 2XXQA 4G8MA 3KN8A 3S4UA 2ZNSA 4N6KA 2IEEA 3MBPA 2F3BA 2V4CA 3M3KA 3IX1A 2P1SA 4GVOA 4F18A 4MX6A 4LZ7A 3HHGA 2XWKA 4FJPA 4IO7A 4LATA 1H43A 4G8HA 1S9TA 4F1UA 1B3FA 2OWSA 4GLIA 2VPNA 1M5BA 1LBBA 3MVXA 4QSEA 5TP9B 5AA1A 4JVCA 1BP5A 2Q89A 1G0HA 3PMVA 1XOCA 5ICTA 2CMOA 3SEXA 5IZ3B 3OSRA 1B52A 1HSEA 1ZKBA 1EYKA 1FTMA 2LAOA 2GHBA 3VV5A 2WBDA 1SQYA 4G2ZA 1UTHA 3T9HB 1M5FA 3R6UA 4HE2A 2DXYA 3EKIA 1H76A 1US5A 3SEWA 2HQ0A 4PE3A 2DVCA 2DS9A 4MEVA 1M5CA 3SDFA 5DW8A 3JZJA 5T3JA 5KCJB 5FTHA 4P3LA 1LGBC 4OVRA 1QJMA 3MJNA 4OFOA 3OELA 4HCYA 2QRYA 3MQ9A 4N07A 3V89B 2XXWA 5ISUA 3MVYA 4GL0A 3H7MA 4YKIA 4YMAA 3IO6A 1FPLA 2I3WA 3KC1A 2RC7A 4ZEIA 3IOWA 2H9BA 3IO4A 4RPOA 3SEYA 1P1OA 4F22A 1DPPA 2O7UA 4PDHA 4OVTA 4HE0A 4GX4A 2KQZA 4KFQA 1VFEA 4N6DA 3OENA 3S9EA 3UP9A 4DXUA 4LZ8A 4FEDA 4LA9A 2NXOA 4R9GA 2ANJA 4P0IA 3I6VA 3RT6B 2H4IA 4ECFA 1B9JA 3BFUA 2D3IA 2XWVA 3ROJA 1UIVA 2QVRA 1FBCA 1B5HA 3R7XA 1EZ9A 1SW2A 4EQ9A 3PMWA 1ANFA 1YCJA 2DP8A 3RTFB 3C32A 4ZE9A 4WKMA 4EXLA 3NOHA 5H8HA 4R72A 4KPTA 5HBCA 5L8DA 1PB9A 3PUVE 4AB5A 5J16A 2UYEA 2ZZWA 1LFHA 1B32A 3VXCA 3ZS6A 2Y7KA 2Y5KA 4OENA 2QSXA 1FTKA 4NN3A 3KOTA 1D9VA 1A40A 2E1SA 5I3SA 1VSOA 4O3BA 1WVJA 4F1VA 4YU0A 2CZKA 1H3DA 3G3GA 5DVJA 3E3KA 4ELQA 2THIA 1MXYA 4PFTA 1MPCA 3EHTA 1FBFA 3G3JA 3OMBA 4OESA 4OVQA 2XXPA 3RQTA 4KCCA 3T93B 1PB7A 3HHFA 5HM4B 3IFCA 5I5PA 2XXUA 1RDYA 2BJIA 1B4HA 3OO6A 3O2AA 5EQ7A 5ESYA 2I4CA 3FJ7A 1Z7ME 3RUMA 4ELOA 4OFJA 1USYH 4GWSA 1NI9A 5FBPA 2H98A 4KQPA 3K6XA 4ZEBA 1LBZA 4DXCA 3V83A 3WAEA 1AOVA 1MQGA 1PEBA 4Q5TA 3CHGA 4N8GA 4IO6A 4F3SA 3I5OA 2RCAA 4F39A 2O6AA 4PFBA 2CZIA 5TU0A 4DIGA 3IK6B 1Q1KA 3HPIA 2Q9TA 1LAHE 5BWJA 1Y1ZA 2O84X 4ZEFA 1BTJA 2RCBA 1XC1A 4N13A 4GBVA 3LSWA 2V3UA 4EQ7A 3MWBA 3LUYA 3MC2A 3QSLA 1TT1A 1URDA 3SESA 4JB7A 3FGSA 4OEVA 4PFYA 1MXXA 1QW0A 4MNIA 2ZZVA 4PFWA 3PUZE 1MQIA 2ZYKA 1QVSA 2Q2CA 4XF5A 2OZZA 1IMAA 1NNPA 4JWOA 4KI0E 1DTGA 4FATA 3N5LA 3QMFA 3OSQA 3PD9A 2F78A 5FTIA 4IGRA 5CMCA 2V3QA 3RLFE 1FTOA 3W9VA 1IMFA 5CMMA 1J1NA 1MY0A 3D1RA 3RPLA 1ZBMA 2VP1A 3W15C 3FVNA 2I0BA 3KFMA 4OZ9A 4RPNA 4NWCA 3QUFA 5I57B 3FV1A 4AQ4A 5J1DA 5I7IA 3UK4A 2Q74A 1OQGA 4L17A 2OJTA 2XA5A 4YKPA 3VVFA 1FQEA 4F19A 4YKKA 1MXWA 1IITA 1P1NA 4YICA 4XEQA 2FYIA 3H3GA 3A3CA 4JVIA 4NGUA 1RYXA 3RPWA 3HSTA 2XD2A 3B6WA 1N76A 4GIZA 1VDWA 1A8EA 3UGWA 1LBCA 4KR5A 4Z0IA 1SI1A 1EYJA 4GWUA 4U21A 3DP8A 2OPDA 2PFYA 3SETA 4HW8A 2QS4A 3Q28A 4I3EA 3H6UA 4TLMB 3F11A 3S9LC 4NF0A 4DI4B 2ZYNA 4H8JA 1KZ8A 3EN3A 4ZEKA 5FHOA 1NH7A 4I62A 1FQBA 1G0IA 2XXYA 5IZZA 3H6WA 1R6ZA 4HCWA 4IR8A 1JW4A 4E0WA 4EUOA 3KBRA 3RNNA 2OX3A 5ICQA 3IAZA 3K1PA 2F6GA 4H67A 5H8QB 3TQWA 3H4ZA 4C0RA 3VFJA 1B5JA 3O66A 3TCGA 4KHZE 1HSJA 4MMPA 2WYKA 2P3NA 1ELJA 1Z7NE 3OO8A 2WBBA 1IEJA 3CVGA 3TAJA 1A8FA 4IO4A 4JWYA 3A09A 1JVYA 2DE2A 1DTZA 3QK6A 4QFNA 3TDJA 4N81A 4DI3D 1I6AA 2QL3A 2WX9A 3U72A 5L9MA 1OMPA 3HCQA 2I6EA 2XXVA 3IOTA 1LAGE 3CIJA 1QUJA 1UIUA 2I3VA 4G68B 1JP4A 2DQVA 2B65A 2VD3A 1Y9UA 4PAIA 4P8BA 4PTKA 1NUYA 3KN7A 3VLWA 3LR1A 4OQOA 4N15A 4POWA 3BBRA 2QVVA 4LVQA 4G4PA 2FVZA 4MHFA 3PUYE 4I1DA 4PP0A 4OA4A 1WODA 3KEIA 4TLLB 5F7VA 1EH3A 3VLUA 1LFGA 1B6HA 3K0VA 3OXNA 4ISUA 4YB5A 5IZ1A 2HAVA 4YB7A 4N17A 1FQAA 3DLNA 5TPAA 5EHSA 3E78A 1N7XA 1MXZA 5M2VA 1LSTA 5IAIA 3PPNA 1N7WA 1TXFA 4XKNA 5CI5A 4IO3A 3PPRA 2O1LA 4PFRA 4I3YA 4YKJA 3H06B 3L6GA 1YZ0A 1ZIUA 1URSA 1B2HA 3T22A 3PU5A 4F3PA 1NV5A 1DSNA 1FRPA 3N26A 3K02A 1NV0A 1SDXA 3OO7A 4EQBA 1FCKA 2QS3A 3RPLB 4X04A 4OXVA 3E4RA 3MPLA 2HZLA 1II5A 2RF1A 3UA8A 1LFIA 3G7WA 3KJTA 1K9ZA 2H5YA 1IZ1A 1TWYA 5DEXB 5I57A 2H25A 2ZNTA 1GVCA 1MDQA 5IM2A 3LSLA 5I2NB 2REGA 1SYIA 1NNTA 1MQJA 3K01A 3O28A 1R9LA 2M8CA 1JW5A 3PD8A 4ZEDA 3KSJA 3SERA 2ABHA 4OVJA 2WEFA 2RC9A 1ZLQA 1OVTA 1K9YA 3AXFA 3KGCA 3ODBA 5H8NB 2FBPA 3FV2A 1JEVA 4X8RA 3G3HA 3L6HA 3D4GA 4NHBA 3B6TA 1IMDA 2XXRA 4RJZA 5JTYB 2GFEA 1Y4CA 1DOTA 2I58A 1P1UA 2WKYA 4RNSA 5ITOA 2HXRA 4IB2A 2B4LA 4JVDA 4XIGQ 5K2XA 4LQ5A 3U94A 2I48A 3LC8A 4RK2A 2YPNA 2Z23A 1GV8A 2XX9A 4ZZAA 4WEDA 1Y1MA 3RYDA 4QFKA 5I58B 2FHYA 3LSXA 2AYSA 3M3LA 4TOZA 3TMGA 5JK4A 1R9QA 1WDNA 3MVWA 2XWIA 2A5SA 4NF5B 5I59A 1IXCA 5DYHA 3USDA 1JVXA 1NV3A 2VOZA 3VXBA 2XXKA 3DM0A 3FUZA 3T66A 3OO9A 4QFOA 3K1NA 4DZ1A 1GTKA 3IOUA 2GH9A 1T0KA 3K1MA 1O63A 3FJGA 5KDTA 3GBBA 5EQ8A 3QIMA 3C35A 2Q8JA 2Q2AA 1SYHA 2Z22A 4GBWA 1MRPA 2OCUA 3KOSA 2P3VA 4G77A 5KDTB 1AWBA 1N3XA 3MAMA 3FASA 2G29A 4JXIA 2G93A 4C1TA 4PQJA 4KYEA 3QAXA 4YMBA 2HPGA 3WAFA 4N4UA 2VT5A 3TCHA 1RDXA 1NNKA 3CI8A 1N04A 4ZZEA 2Y7WA 1B46A 3VE1B 3C36A 4LUBA 5I59B 1FJ6A 2OPEA 1Y20A 2FA7A 5ELVA 3IR1A 2PT1A 4EF2A 1DPEA 1FBHA 4XFEA 5CC2A 4BLAA 4YZZA 5I58A 3CRBA 3V5AA 2UXAA 3C33A 2DVZA 3MPKA 1H44A 2ZYOA 4NTLA 4FIMA 4JWXA 1BLFA 4GWZA 4HS7A 3MYUA 4R6HA 4E0XA 1I6BA 1S7YA 1CNQA 5JTYA 2VHAA 1B05A 1USYE 2CEYA 1EZOA 3O9PA 1QUIA 1A55A 2F35A 4P56A 4AB6A 1UQWA 4PDDA 1MG1A 1I6QA 3QYTA 1B3HA 5H8SA 4ZECA 1B1HA 3PPQA 4DDDA 2DXRA 3U65A 1FPJA 5I2NA 5L9OA 4O8MA 1XI6A 1Q35A 3KN3A 3H03A 3UORA 5DEXA 1MQDA 5AA2D 2XX7A 1QKBA 2ZYMA 3SEUA 3W9WA 1LCFA 1GR2A 3BIHA 3PGFA 5KCJA 2DWAA 3HFUA 3EF7A 3ILUB 5IZ3A 1AH5A 1FBGA 4H1XA 2Q88A 4OETA 3K6WA 2RINA 5A5XB 2ZNUA 5TP9A 4P47A 4XKPA 4U1ZA 3TQLA 1OIBA 4GRKA 5F1QA 5FHNA 3TKDA 4ZS9A 1B7ZA 4NF6A 4P9KA 2QMXA 3CSBA 2QVUA 3TTMA 2F6PA 3ZSFA 4NEDA 5ITPA 4QF9A 5TPAB 4MF3A 4LN5A 1FTLA 2GRVA 3RT8A 1QGXA 1F9BA 2QMWA 4PFIA 4EDPA 1XVYA 4FEBA 1ZJLA 4OVSA 4H5GA 3FXRA 5CBSA 4QFPA 4M1VA 4RY1A 2R71A 4O7MA 3RTWB 3N6TA 5I84A 3TUSA 4UA8A 4G68C 3MP6A 4G68A 1B5IA 1FSAA 5CRYA 5IKBA 1MPDA 1LCTA 3KG2A 2HCAA 4U22A 1B1XA 2A5TB 2HXWA 2R9JA 4PGNA 1OQHA 2P0SA 4BDLA 1LB8A 2R6GE 4H46A 2FNCA 4DE8A 3DP4A 1OLAA 3D4CA 4ELPA 3T9UA 1NV7A 5AA3A 1EYIA 2KLFA 2DWHA 3DP6A 1QKAA 4OANA 1Y3NA 5I2KA 3T9XB 4H0WA 1FBEA 1IIWA 5JEIA 1MM7A 4DCXA 4Q0CA 4RXLA 4PCDA 4FAJA 3FD3A 4F31B 1NV2A 4PF8A 5DVIA 4R6KA 2HAUA 3Q26A 3CG3A 2DOJA 4H45A 4FBPA 3TTLA 1IMBA 2E0SA 1PB8A 1NMUA 3PV0E 4QHQA 1TFDA 1ZU0A 4F3GA 4THIA 3TYHA 3O6HA 4DCYA 2O68A 3THIA 1EU8A 1AMFA 3SZPA 2CZLA 4ESXA 5FHMA 3LSFB 1NKXA 4OTEA 4OWDA 1M5DA 5HPQA 1N0TA 4QBAA 4BDRA 2GQ1A 3KJ7A 4ELRA 4QSCA 3HV1A 3FATA 4H6DA 2DWJA 3FXUA 3RY3A 3I3VA 3IL1B 3A29A 4X1BA 5EQ9A 1LB9A 3B50A 3CFXA 2NWJA 3BIGA 1NV6A 3DELB 1B3GA 4F2QA 3K2DA 4AS4A 2UVIA 2V25A 4NF4A 1MXVA 1DK4A 1CE2A 1B40A 4RK9A 2I0CA 3FXQA 2NOOA 3VLVA 3O6IA 4P1EA 4OYVA 3M8UA 2V84A 4OFLA 2X7QA 2QS2A 1IXGA 1LEVA 2V93A 5ET8A 4X9TA 1ZTYA 4N91A 3TFLA 4P1LA 1XS5A 3SKPA 1SVXB 2B4MA 2YJPA 2W7YA 4RYAA 2F36A 4M4GA 1VR5A 3EHSA 3GXAA 1PC3A 1XT8A 2VD2A 4JBZA 2F34A 2PFZA 3M3FA 1M5EA 3MZ1A 1PDAA 3MSTA 5AA4A 1SBPA 2CEXA 4GD5A 3ZKLA 3S9MC 2PCRA 1B3LA 1A7LA 2XWOA 3HN0A 2VPOA 2HEUA 1MQHA 2Z8EA 2GHAA 4IO2A 4OHNA 1JETA 1D9YA 1MPBA 1NL5A 4QRZA 5DT6A 4Z7EA 2F7AA 3FVKA 4GX3A 4PF6A 4LP2B 4MIJA 4GX6A 2B3FA 1QUKA 1MM6A 2Q8MA 4KYSA 3QXMA 1YAEA 3CR9A 3TTKA 5AA2B 2AL4A 3FVGA 1RDZA 1FPGA
chains in the Genus database with same CATH topology
3PTYA 5IZ3A 4H46A 2HXRA 2V3QA 5IZ1A 4YZZA 2F3BA 1IMFA 1FJ6A 2B4LA 1FBGA 1YYZA 4JVDA 3W9VA 4P1EA 4N17A 5LDZA 2OX3A 3D1RA 4PAKA 2V4CA 3FXBA 3IFCA 4PGPA 1NV7A 1FPLA 5I5PA 1EYIA 3RPLA 4GWWA 1DCUA 1RDYA 4OANA 3E78A 2MKZA 3T1BA 5I7IA 2BJIA 3GYYA 3KC1A 1BK4A 1KA0A 1LEVA 4NG7A 1FPBA 1D9QA 1FBEA 5EQAA 5ET8A 4P47A 4F18A 4MX6A 5EQ7A 4O7IA 5ESYA 3T0JA 4PAFA 2QFLA 2ZZXA 4X9TA 3RYDA 1FBHA 1NUWA 5ET7A 1YXIA 2KR0A 2XWKA 3LV0A 2HZKA 4MMPA 4N91A 4P1LA 4PFRA 4I3YA 1DBZA 2B4MA 4PDHA 2WYKA 2OWZA 2P3NA 3IFAA 4HE0A 4OVTA 4GX4A 5ET5A 4PCDA 4MNPA 1FBPA 4I40A 4P9KA 4PBQA 2FHYA 2QVUA 1YZ0A 4MJOA 4NAPA 1IMEA 5J1DA 4GWSA 1NI9A 5FBPA 2FIEA 1LBWA 1NV2A 1FPKA 2Q74A 2KQZA 2L5VA 4MAGA 1NV5A 1LBZA 2HHMA 3KC0A 3E79A 4N6DA 4PF8A 4F1UA 4QXDA 1FRPA 2DVZA 2WBBA 3CHGA 5JK4A 4N8GA 4UABA 4MNCA 2VPNA 1LBYA 2XA5A 4H45A 4FBPA 5F24A 1IMBA 2XWIA 1NUZA 4GWZA 2PFZA 3MYUA 2CZIA 2JJKA 4LN5A 4PFBA 4F19A 1QGXA 1NV0A 1FPDA 3MSTA 2XWVA 3B8BA 3ROJA 2Q9TA 2CEXA 3RPLB 4JVCA 4PFIA 4XEQA 1G0HA 1NV3A 4X04A 4YICA 1CNQA 2DE2A 5LTCA 4JVIA 4NGUA 1LBVA 2HZLA 3SZPA 2QVRA 2XXKA 1LBXA 1FBCA 1NV1A 2PCRA 4N81A 1NUXA 5IZ3B 4GBVA 4OVSA 2Y5LA 2QPQA 4O94A 2CEYA 1SPIA 5CM6A 1K9ZA 5IGAA 2XWOA 4DI3D 1NV4A 5A5LA 1FBDA 4KXPA 2VPOA 4HXVA 2F5XA 1EYKA 2WX9A 4M1VA 1VDWA 4P56A 3NOHA 3LUZA 2WBDA 4NX1A 4O7MA 2WYPA 3ISPA 1INPA 2R8TA 4NQ8A 4QBAA 5IM2A 4PDDA 5EYGA 5EQ8A 1EYJA 2GQ1A 4GWYA 4GWUA 2DDKA 4HE2A 1IMCA 1JP4A 5J16A 3EKIA 2PFYA 2ZZWA 4GWXA 4PAIA 4G61A 2F3DA 4GBWA 4MNIA 2Y5KA 2FIXA 3U65A 4PE3A 2DE3A 4GX3A 2ZZVA 4P8BA 4PTKA 1FPJA 1NUYA 4I3EA 4MIJA 2DE4A 4NN3A 4PF6A 1FSAA 5I3SA 2P3VA 4GX6A 2WEFA 3A29A 4O8MA 4N15A 1KA1A 4MEVA 4XF5A 1IMAA 2CZHA 1FPIA 1XI6A 5EQ9A 4PETA 4F1VA 1AWBA 3FBPA 1K9YA 2QVVA 5DW8A 4PC9A 4XFEA 3B50A 4NF0A 5T3JA 4DI4B 2CZKA 2FVZA 2FBPA 4MHFA 4P3LA 4OVPA 4OVRA 4OA4A 1KZ8A 4X8RA 2Q8MA 3BIGA 3QMFA 1FTAA 1NV6A 5EYHA 4MCOA 4NHBA 4PGNA 3W9WA 4AS4A 1IMDA 2HPGA 4PBHA 3BIHA 5ET6A 1G0IA 4AS5A 4N4UA 2VT5A 3KBZA 4N8YA 1Q9DA 1DK4A 1FPEA 4HCYA 1RDXA 4N6KA 5IZZA 4HCWA 4IR8A 1FBFA 1FJ9A 1FPFA 1RDZA 1FPGA 4HE1A 3HFUA 4OVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ3 A;  4H46 A;  5IZ1 A;  2F3B A;  1IMF A;  1FJ6 A;  1FBG A;  1YYZ A;  5LDZ A;  2OX3 A;  3D1R A;  3IFC A;  1NV7 A;  1FPL A;  1EYI A;  3RPL A;  4GWW A;  1DCU A;  1RDY A;  2BJI A;  3KC1 A;  1BK4 A;  1KA0 A;  1LEV A;  1FPB A;  1D9Q A;  1FBE A;  5EQA A;  5ET8 A;  5EQ7 A;  4O7I A;  5ESY A;  3T0J A;  2QFL A;  3RYD A;  1FBH A;  1NUW A;  5ET7 A;  1YXI A;  3LV0 A;  4I3Y A;  1DBZ A;  2OWZ A;  2P3N A;  3IFA A;  4HE0 A;  4GX4 A;  5ET5 A;  1FBP A;  4I40 A;  2FHY A;  2QVU A;  1YZ0 A;  4MJO A;  1IME A;  4GWS A;  1NI9 A;  5FBP A;  2FIE A;  1LBW A;  1NV2 A;  1FPK A;  2Q74 A;  1NV5 A;  1LBZ A;  2HHM A;  3KC0 A;  4QXD A;  1FRP A;  2WBB A;  1LBY A;  4H45 A;  4FBP A;  5F24 A;  1IMB A;  1NUZ A;  4GWZ A;  2CZI A;  2JJK A;  1QGX A;  1NV0 A;  1FPD A;  3B8B A;  3ROJ A;  3RPL B;  1G0H A;  1NV3 A;  1CNQ A;  1LBV A;  2QVR A;  1LBX A;  1FBC A;  1NV1 A;  2PCR A;  4N81 A;  1NUX A;  5IZ3 B;  4GBV A;  2Y5L A;  1SPI A;  1K9Z A;  1NV4 A;  5A5L A;  1FBD A;  4KXP A;  4HXV A;  1EYK A;  1VDW A;  3LUZ A;  2WBD A;  1INP A;  2R8T A;  5EYG A;  5EQ8 A;  1EYJ A;  2GQ1 A;  4GWY A;  4GWU A;  2DDK A;  4HE2 A;  1IMC A;  1JP4 A;  5J16 A;  4GWX A;  4G61 A;  2F3D A;  4GBW A;  2Y5K A;  2FIX A;  4GX3 A;  4PTK A;  1FPJ A;  1NUY A;  4I3E A;  1FSA A;  5I3S A;  2P3V A;  4GX6 A;  2WEF A;  3A29 A;  1KA1 A;  1IMA A;  2CZH A;  1FPI A;  1XI6 A;  5EQ9 A;  1AWB A;  3FBP A;  1K9Y A;  2QVV A;  5DW8 A;  5T3J A;  2CZK A;  2FVZ A;  2FBP A;  1KZ8 A;  2Q8M A;  3BIG A;  3QMF A;  1FTA A;  1NV6 A;  5EYH A;  4AS4 A;  1IMD A;  3BIH A;  5ET6 A;  1G0I A;  4AS5 A;  2VT5 A;  3KBZ A;  1Q9D A;  1DK4 A;  1FPE A;  1RDX A;  4IR8 A;  1FBF A;  1FJ9 A;  1FPF A;  1RDZ A;  1FPG A;  4HE1 A; 
#chains in the Genus database with same CATH topology
 1B0H A;  1B7U A;  4QFL A;  4F3B A;  1YYZ A;  2A5T A;  1AIV A;  5LDZ A;  2DSF A;  4GOT A;  1DCU A;  1I69 A;  4BDM A;  3T1B A;  3HO7 A;  2Z8D A;  1B58 A;  5DTB A;  1Y3P A;  1YXI A;  4ZE8 A;  1B4Z A;  5ET5 A;  1FBP A;  2DWI A;  2FIE A;  3KC0 A;  3Q27 A;  1JW1 A;  1MDP 1;  1MY4 A;  4BDN A;  4UAB A;  4MH5 A;  4XXU A;  2F7C A;  4GF8 A;  5F24 A;  2ONK E;  2JJK A;  3VDF A;  3TTN A;  4IY5 A;  1R1N A;  1BIY A;  3C31 A;  5KZT A;  4NWD A;  1A54 A;  3E13 X;  3FVO A;  1NUX A;  4R2B A;  2YLN A;  5IGA A;  1NV4 A;  1URG A;  4KXP A;  2PVU A;  1XVX A;  1HSL A;  4R9F A;  4F29 A;  3FIR A;  4GWY A;  4NF6 B;  4H65 A;  3QUJ A;  2PMS A;  3EPE A;  1JQF A;  2AL5 A;  4YAH X;  4GXS B;  1NH8 A;  3U93 A;  2RKM A;  3K6V A;  1FPI A;  5H8H B;  5A5X A;  4I8C A;  3Q29 A;  4EXK A;  3O6G A;  1Y3Q A;  1UTB B;  4NF8 A;  1O7T A;  2RC8 A;  2PYY A;  4C1U A;  2PT2 A;  3EQ1 A;  3KBZ A;  1FPE A;  2PX1 A;  2O7I A;  1FPF A;  1S50 A;  4FEC A;  3ZKK A;  4MFI A;  5H8F A;  4IGT A;  4QSD A;  1MH4 A;  1A99 A;  1IXH A;  4XKQ A;  1P1W A;  4LON B;  4PGP A;  4POX A;  1PBP A;  1VE4 A;  1KA0 A;  4U2R A;  1MXU A;  1MY3 A;  1FTJ A;  1LAF E;  4PFU A;  1N84 A;  1PBQ A;  3V8X B;  2I49 A;  1US4 A;  1GGG A;  4FE8 A;  1DBZ A;  4RA1 A;  4MNP A;  3A3U A;  3PPO A;  4QXD A;  1P1Q A;  3C34 A;  3IJO B;  5CMB A;  3O29 A;  2Y7P A;  4R73 A;  2ONR A;  3B8B A;  2Y84 A;  5EHM A;  3BFT A;  3IB2 A;  1VFD A;  2XD3 A;  3KSX A;  3U8Q A;  4KYD A;  1TFA A;  4U1O A;  3SEV A;  4JSO A;  5LOM A;  3TPA A;  2QPQ A;  2X26 A;  3K6U A;  3U92 A;  4O3C A;  4U4X A;  3G3F A;  1SI0 A;  3H6V A;  2WYP A;  3ISP A;  4NF8 B;  1UTB A;  2DDK A;  1FW0 A;  3H6T A;  2ONS A;  2Y7I A;  1QUL A;  2XXI A;  3ONM A;  2FIX A;  3ILT B;  1XHY A;  2DE4 A;  3JYR A;  5DVF A;  4IO5 A;  3IB0 A;  5H8F B;  1KA1 A;  1UTH B;  2CZH A;  3IOR A;  3FBP A;  4U23 A;  1B0L A;  4R6Y A;  2F8D A;  3GZG A;  3MP1 A;  1O64 A;  5ET6 A;  4AS5 A;  4G8N A;  1FJ9 A;  4I9D A;  4LZ5 A;  3S2V A;  3IB1 A;  1JNF A;  1OVB A;  2F97 A;  2XXH A;  1MY2 A;  2DYX A;  4PAK A;  4R74 A;  4X1D A;  1BK4 A;  4N6P A;  3C4M A;  3O97 A;  2KR0 A;  3EHU A;  3TCF A;  2OWZ A;  3IFA A;  1LLS A;  4I40 A;  3LBS A;  4PBQ A;  5B7D A;  5BUU A;  1IME A;  1JEU A;  2O1M A;  1FPK A;  1SW5 A;  3P7I A;  5CBR A;  1YTV A;  3U1O A;  1LBY A;  4HTG A;  4X48 A;  3TZA A;  2UYF A;  2Y7R A;  1YPN A;  4JSD A;  3TTR A;  2QJE A;  4H5F A;  2O51 A;  2XXX A;  1DMB A;  4O3A A;  1LBV A;  1LBX A;  4NF5 A;  3CSG A;  2HFB A;  1D4N A;  1NFT A;  2ZMB A;  1D3K A;  3OD7 A;  4NX1 A;  3S9N C;  3VVD A;  2R8T A;  4NQ8 A;  3N6U A;  3PUW E;  2I4B A;  3CFL A;  4GWX A;  4FOR A;  2F3D A;  1CB6 A;  1IQ7 A;  1EZP A;  4WXJ A;  4UAC A;  2NUV A;  4PET A;  5B70 A;  1NNF A;  3B7D A;  3MW0 A;  1L5T A;  5AA2 A;  5EYH A;  2QS1 A;  4NE4 A;  1ZMG A;  4N8Y A;  1Q9D A;  1P99 A;  3CFZ A;  2OK2 A;  3PTY A;  2F7B A;  2D21 A;  3TEP A;  2OBG A;  5H8N A;  4TQU Q;  1POY 1;  2XXT A;  2B3B A;  4BDO A;  3GYY A;  4WEP A;  4ESW A;  1POT A;  3G3K A;  3MVZ A;  5EYF A;  3GLB A;  4IY6 A;  5K2Y A;  3OEM A;  1FPB A;  1D9Q A;  4NG7 A;  5EQA A;  4ND9 A;  4O7I A;  4PAF A;  4LQ2 A;  1NUW A;  5ET7 A;  2ZXT A;  3LV0 A;  3UIF A;  3TOD A;  1MS7 A;  5CMK A;  5I56 B;  3R26 A;  4KD5 A;  3UN6 A;  2HHM A;  3G3I A;  4PE5 B;  4MBP A;  2D5W A;  5AA4 B;  3MUQ A;  3BKI B;  4XKR A;  1FPD A;  4EF1 A;  2O69 A;  3IOV A;  3RGY A;  2V3T A;  3PMX A;  3JV9 A;  1N3W A;  4KCD A;  1NV1 A;  4DXB A;  3MZ9 A;  1SW4 A;  2Y5L A;  3E9X A;  3MZB A;  4Q8R A;  4DLD A;  4NMY A;  4HXV A;  2F5X A;  3CG1 A;  1SW1 A;  3LUZ A;  4GQO A;  5AE4 A;  2UVJ A;  2UVH A;  1IMC A;  4GWO A;  3B6Q A;  3RN8 A;  4F1Y A;  2XX8 A;  4G61 A;  1FQC A;  3FZV A;  3PPP A;  2XHD A;  2DE3 A;  4JDF A;  1FQF A;  2PBW A;  4R75 A;  1BKA A;  4MLV A;  1KWH A;  4PC9 A;  1B3E A;  5L9S A;  3T96 B;  4K3F A;  4NF4 B;  1FTA A;  4MCO A;  2NVU B;  3Q25 A;  4MLQ A;  4PBH A;  1H45 A;  2Z8F A;  5A5L A;  4HE1 A;  3TEL A;  4OEU A;  4H8I A;  4R2F A;  3FJM A;  2UVG A;  4XTC Q;  3FXB A;  4GWW A;  2P2A A;  4GFR A;  2MKZ A;  3VVE A;  1MH3 A;  3ECR A;  2AIX A;  1IUD A;  5I56 A;  3T0J A;  2ESN A;  2QFL A;  2ZZX A;  5CM6 A;  2HZK A;  1RKM A;  1B7H A;  2VGQ A;  2OWT A;  4MJO A;  4NAP A;  3GBA A;  4GL8 A;  5LTC A;  4MAG A;  1LBW A;  2L5V A;  3E79 A;  4OER A;  2ALU A;  4MNC A;  2H99 A;  1FQD A;  1NUZ A;  5I2K B;  1SD3 A;  1MY1 A;  1Y4T A;  3N94 A;  4OMB A;  4F2O A;  1ATG A;  4ONY A;  4O94 A;  1SPI A;  4P11 A;  1RYO A;  1FBD A;  2X7P A;  2OLB A;  3MP8 A;  1IXI A;  3OEK A;  1INP A;  3KZG A;  5EYG A;  4ZDM A;  2REJ A;  3PUX E;  4GXA A;  4P0G A;  2BJJ X;  3OOA A;  1LAX A;  3K4U A;  3T9V A;  4YB6 A;  3IJX B;  1OLC A;  5H8Q A;  1B51 A;  3K00 A;  2IA4 A;  4Q30 B;  4U4S A;  4BDQ A;  4OVP A;  3C9H A;  1AL3 A;  2XXQ A;  4G8M A;  3KN8 A;  3S4U A;  2ZNS A;  4N6K A;  2IEE A;  3MBP A;  2F3B A;  2V4C A;  3M3K A;  3IX1 A;  2P1S A;  4GVO A;  4F18 A;  4MX6 A;  4LZ7 A;  3HHG A;  2XWK A;  4FJP A;  4IO7 A;  4LAT A;  1H43 A;  4G8H A;  1S9T A;  4F1U A;  1B3F A;  2OWS A;  4GLI A;  2VPN A;  1M5B A;  1LBB A;  3MVX A;  4QSE A;  5TP9 B;  5AA1 A;  4JVC A;  1BP5 A;  2Q89 A;  1G0H A;  3PMV A;  1XOC A;  5ICT A;  2CMO A;  3SEX A;  5IZ3 B;  3OSR A;  1B52 A;  1HSE A;  1ZKB A;  1EYK A;  1FTM A;  2LAO A;  2GHB A;  3VV5 A;  2WBD A;  1SQY A;  4G2Z A;  1UTH A;  3T9H B;  1M5F A;  3R6U A;  4HE2 A;  2DXY A;  3EKI A;  1H76 A;  1US5 A;  3SEW A;  2HQ0 A;  4PE3 A;  2DVC A;  2DS9 A;  4MEV A;  1M5C A;  3SDF A;  5DW8 A;  3JZJ A;  5T3J A;  5KCJ B;  5FTH A;  4P3L A;  1LGB C;  4OVR A;  1QJM A;  3MJN A;  4OFO A;  3OEL A;  4HCY A;  2QRY A;  3MQ9 A;  4N07 A;  3V89 B;  2XXW A;  5ISU A;  3MVY A;  4GL0 A;  3H7M A;  4YKI A;  4YMA A;  3IO6 A;  1FPL A;  2I3W A;  3KC1 A;  2RC7 A;  4ZEI A;  3IOW A;  2H9B A;  3IO4 A;  4RPO A;  3SEY A;  1P1O A;  4F22 A;  1DPP A;  2O7U A;  4PDH A;  4OVT A;  4HE0 A;  4GX4 A;  2KQZ A;  4KFQ A;  1VFE A;  4N6D A;  3OEN A;  3S9E A;  3UP9 A;  4DXU A;  4LZ8 A;  4FED A;  4LA9 A;  2NXO A;  4R9G A;  2ANJ A;  4P0I A;  3I6V A;  3RT6 B;  2H4I A;  4ECF A;  1B9J A;  3BFU A;  2D3I A;  2XWV A;  3ROJ A;  1UIV A;  2QVR A;  1FBC A;  1B5H A;  3R7X A;  1EZ9 A;  1SW2 A;  4EQ9 A;  3PMW A;  1ANF A;  1YCJ A;  2DP8 A;  3RTF B;  3C32 A;  4ZE9 A;  4WKM A;  4EXL A;  3NOH A;  5H8H A;  4R72 A;  4KPT A;  5HBC A;  5L8D A;  1PB9 A;  3PUV E;  4AB5 A;  5J16 A;  2UYE A;  2ZZW A;  1LFH A;  1B32 A;  3VXC A;  3ZS6 A;  2Y7K A;  2Y5K A;  4OEN A;  2QSX A;  1FTK A;  4NN3 A;  3KOT A;  1D9V A;  1A40 A;  2E1S A;  5I3S A;  1VSO A;  4O3B A;  1WVJ A;  4F1V A;  4YU0 A;  2CZK A;  1H3D A;  3G3G A;  5DVJ A;  3E3K A;  4ELQ A;  2THI A;  1MXY A;  4PFT A;  1MPC A;  3EHT A;  1FBF A;  3G3J A;  3OMB A;  4OES A;  4OVQ A;  2XXP A;  3RQT A;  4KCC A;  3T93 B;  1PB7 A;  3HHF A;  5HM4 B;  3IFC A;  5I5P A;  2XXU A;  1RDY A;  2BJI A;  1B4H A;  3OO6 A;  3O2A A;  5EQ7 A;  5ESY A;  2I4C A;  3FJ7 A;  1Z7M E;  3RUM A;  4ELO A;  4OFJ A;  1USY H;  4GWS A;  1NI9 A;  5FBP A;  2H98 A;  4KQP A;  3K6X A;  4ZEB A;  1LBZ A;  4DXC A;  3V83 A;  3WAE A;  1AOV A;  1MQG A;  1PEB A;  4Q5T A;  3CHG A;  4N8G A;  4IO6 A;  4F3S A;  3I5O A;  2RCA A;  4F39 A;  2O6A A;  4PFB A;  2CZI A;  5TU0 A;  4DIG A;  3IK6 B;  1Q1K A;  3HPI A;  2Q9T A;  1LAH E;  5BWJ A;  1Y1Z A;  2O84 X;  4ZEF A;  1BTJ A;  2RCB A;  1XC1 A;  4N13 A;  4GBV A;  3LSW A;  2V3U A;  4EQ7 A;  3MWB A;  3LUY A;  3MC2 A;  3QSL A;  1TT1 A;  1URD A;  3SES A;  4JB7 A;  3FGS A;  4OEV A;  4PFY A;  1MXX A;  1QW0 A;  4MNI A;  2ZZV A;  4PFW A;  3PUZ E;  1MQI A;  2ZYK A;  1QVS A;  2Q2C A;  4XF5 A;  2OZZ A;  1IMA A;  1NNP A;  4JWO A;  4KI0 E;  1DTG A;  4FAT A;  3N5L A;  3QMF A;  3OSQ A;  3PD9 A;  2F78 A;  5FTI A;  4IGR A;  5CMC A;  2V3Q A;  3RLF E;  1FTO A;  3W9V A;  1IMF A;  5CMM A;  1J1N A;  1MY0 A;  3D1R A;  3RPL A;  1ZBM A;  2VP1 A;  3W15 C;  3FVN A;  2I0B A;  3KFM A;  4OZ9 A;  4RPN A;  4NWC A;  3QUF A;  5I57 B;  3FV1 A;  4AQ4 A;  5J1D A;  5I7I A;  3UK4 A;  2Q74 A;  1OQG A;  4L17 A;  2OJT A;  2XA5 A;  4YKP A;  3VVF A;  1FQE A;  4F19 A;  4YKK A;  1MXW A;  1IIT A;  1P1N A;  4YIC A;  4XEQ A;  2FYI A;  3H3G A;  3A3C A;  4JVI A;  4NGU A;  1RYX A;  3RPW A;  3HST A;  2XD2 A;  3B6W A;  1N76 A;  4GIZ A;  1VDW A;  1A8E A;  3UGW A;  1LBC A;  4KR5 A;  4Z0I A;  1SI1 A;  1EYJ A;  4GWU A;  4U21 A;  3DP8 A;  2OPD A;  2PFY A;  3SET A;  4HW8 A;  2QS4 A;  3Q28 A;  4I3E A;  3H6U A;  4TLM B;  3F11 A;  3S9L C;  4NF0 A;  4DI4 B;  2ZYN A;  4H8J A;  1KZ8 A;  3EN3 A;  4ZEK A;  5FHO A;  1NH7 A;  4I62 A;  1FQB A;  1G0I A;  2XXY A;  5IZZ A;  3H6W A;  1R6Z A;  4HCW A;  4IR8 A;  1JW4 A;  4E0W A;  4EUO A;  3KBR A;  3RNN A;  2OX3 A;  5ICQ A;  3IAZ A;  3K1P A;  2F6G A;  4H67 A;  5H8Q B;  3TQW A;  3H4Z A;  4C0R A;  3VFJ A;  1B5J A;  3O66 A;  3TCG A;  4KHZ E;  1HSJ A;  4MMP A;  2WYK A;  2P3N A;  1ELJ A;  1Z7N E;  3OO8 A;  2WBB A;  1IEJ A;  3CVG A;  3TAJ A;  1A8F A;  4IO4 A;  4JWY A;  3A09 A;  1JVY A;  2DE2 A;  1DTZ A;  3QK6 A;  4QFN A;  3TDJ A;  4N81 A;  4DI3 D;  1I6A A;  2QL3 A;  2WX9 A;  3U72 A;  5L9M A;  1OMP A;  3HCQ A;  2I6E A;  2XXV A;  3IOT A;  1LAG E;  3CIJ A;  1QUJ A;  1UIU A;  2I3V A;  4G68 B;  1JP4 A;  2DQV A;  2B65 A;  2VD3 A;  1Y9U A;  4PAI A;  4P8B A;  4PTK A;  1NUY A;  3KN7 A;  3VLW A;  3LR1 A;  4OQO A;  4N15 A;  4POW A;  3BBR A;  2QVV A;  4LVQ A;  4G4P A;  2FVZ A;  4MHF A;  3PUY E;  4I1D A;  4PP0 A;  4OA4 A;  1WOD A;  3KEI A;  4TLL B;  5F7V A;  1EH3 A;  3VLU A;  1LFG A;  1B6H A;  3K0V A;  3OXN A;  4ISU A;  4YB5 A;  5IZ1 A;  2HAV A;  4YB7 A;  4N17 A;  1FQA A;  3DLN A;  5TPA A;  5EHS A;  3E78 A;  1N7X A;  1MXZ A;  5M2V A;  1LST A;  5IAI A;  3PPN A;  1N7W A;  1TXF A;  4XKN A;  5CI5 A;  4IO3 A;  3PPR A;  2O1L A;  4PFR A;  4I3Y A;  4YKJ A;  3H06 B;  3L6G A;  1YZ0 A;  1ZIU A;  1URS A;  1B2H A;  3T22 A;  3PU5 A;  4F3P A;  1NV5 A;  1DSN A;  1FRP A;  3N26 A;  3K02 A;  1NV0 A;  1SDX A;  3OO7 A;  4EQB A;  1FCK A;  2QS3 A;  3RPL B;  4X04 A;  4OXV A;  3E4R A;  3MPL A;  2HZL A;  1II5 A;  2RF1 A;  3UA8 A;  1LFI A;  3G7W A;  3KJT A;  1K9Z A;  2H5Y A;  1IZ1 A;  1TWY A;  5DEX B;  5I57 A;  2H25 A;  2ZNT A;  1GVC A;  1MDQ A;  5IM2 A;  3LSL A;  5I2N B;  2REG A;  1SYI A;  1NNT A;  1MQJ A;  3K01 A;  3O28 A;  1R9L A;  2M8C A;  1JW5 A;  3PD8 A;  4ZED A;  3KSJ A;  3SER A;  2ABH A;  4OVJ A;  2WEF A;  2RC9 A;  1ZLQ A;  1OVT A;  1K9Y A;  3AXF A;  3KGC A;  3ODB A;  5H8N B;  2FBP A;  3FV2 A;  1JEV A;  4X8R A;  3G3H A;  3L6H A;  3D4G A;  4NHB A;  3B6T A;  1IMD A;  2XXR A;  4RJZ A;  5JTY B;  2GFE A;  1Y4C A;  1DOT A;  2I58 A;  1P1U A;  2WKY A;  4RNS A;  5ITO A;  2HXR A;  4IB2 A;  2B4L A;  4JVD A;  4XIG Q;  5K2X A;  4LQ5 A;  3U94 A;  2I48 A;  3LC8 A;  4RK2 A;  2YPN A;  2Z23 A;  1GV8 A;  2XX9 A;  4ZZA A;  4WED A;  1Y1M A;  3RYD A;  4QFK A;  5I58 B;  2FHY A;  3LSX A;  2AYS A;  3M3L A;  4TOZ A;  3TMG A;  5JK4 A;  1R9Q A;  1WDN A;  3MVW A;  2XWI A;  2A5S A;  4NF5 B;  5I59 A;  1IXC A;  5DYH A;  3USD A;  1JVX A;  1NV3 A;  2VOZ A;  3VXB A;  2XXK A;  3DM0 A;  3FUZ A;  3T66 A;  3OO9 A;  4QFO A;  3K1N A;  4DZ1 A;  1GTK A;  3IOU A;  2GH9 A;  1T0K A;  3K1M A;  1O63 A;  3FJG A;  5KDT A;  3GBB A;  5EQ8 A;  3QIM A;  3C35 A;  2Q8J A;  2Q2A A;  1SYH A;  2Z22 A;  4GBW A;  1MRP A;  2OCU A;  3KOS A;  2P3V A;  4G77 A;  5KDT B;  1AWB A;  1N3X A;  3MAM A;  3FAS A;  2G29 A;  4JXI A;  2G93 A;  4C1T A;  4PQJ A;  4KYE A;  3QAX A;  4YMB A;  2HPG A;  3WAF A;  4N4U A;  2VT5 A;  3TCH A;  1RDX A;  1NNK A;  3CI8 A;  1N04 A;  4ZZE A;  2Y7W A;  1B46 A;  3VE1 B;  3C36 A;  4LUB A;  5I59 B;  1FJ6 A;  2OPE A;  1Y20 A;  2FA7 A;  5ELV A;  3IR1 A;  2PT1 A;  4EF2 A;  1DPE A;  1FBH A;  4XFE A;  5CC2 A;  4BLA A;  4YZZ A;  5I58 A;  3CRB A;  3V5A A;  2UXA A;  3C33 A;  2DVZ A;  3MPK A;  1H44 A;  2ZYO A;  4NTL A;  4FIM A;  4JWX A;  1BLF A;  4GWZ A;  4HS7 A;  3MYU A;  4R6H A;  4E0X A;  1I6B A;  1S7Y A;  1CNQ A;  5JTY A;  2VHA A;  1B05 A;  1USY E;  2CEY A;  1EZO A;  3O9P A;  1QUI A;  1A55 A;  2F35 A;  4P56 A;  4AB6 A;  1UQW A;  4PDD A;  1MG1 A;  1I6Q A;  3QYT A;  1B3H A;  5H8S A;  4ZEC A;  1B1H A;  3PPQ A;  4DDD A;  2DXR A;  3U65 A;  1FPJ A;  5I2N A;  5L9O A;  4O8M A;  1XI6 A;  1Q35 A;  3KN3 A;  3H03 A;  3UOR A;  5DEX A;  1MQD A;  5AA2 D;  2XX7 A;  1QKB A;  2ZYM A;  3SEU A;  3W9W A;  1LCF A;  1GR2 A;  3BIH A;  3PGF A;  5KCJ A;  2DWA A;  3HFU A;  3EF7 A;  3ILU B;  5IZ3 A;  1AH5 A;  1FBG A;  4H1X A;  2Q88 A;  4OET A;  3K6W A;  2RIN A;  5A5X B;  2ZNU A;  5TP9 A;  4P47 A;  4XKP A;  4U1Z A;  3TQL A;  1OIB A;  4GRK A;  5F1Q A;  5FHN A;  3TKD A;  4ZS9 A;  1B7Z A;  4NF6 A;  4P9K A;  2QMX A;  3CSB A;  2QVU A;  3TTM A;  2F6P A;  3ZSF A;  4NED A;  5ITP A;  4QF9 A;  5TPA B;  4MF3 A;  4LN5 A;  1FTL A;  2GRV A;  3RT8 A;  1QGX A;  1F9B A;  2QMW A;  4PFI A;  4EDP A;  1XVY A;  4FEB A;  1ZJL A;  4OVS A;  4H5G A;  3FXR A;  5CBS A;  4QFP A;  4M1V A;  4RY1 A;  2R71 A;  4O7M A;  3RTW B;  3N6T A;  5I84 A;  3TUS A;  4UA8 A;  4G68 C;  3MP6 A;  4G68 A;  1B5I A;  1FSA A;  5CRY A;  5IKB A;  1MPD A;  1LCT A;  3KG2 A;  2HCA A;  4U22 A;  1B1X A;  2A5T B;  2HXW A;  2R9J A;  4PGN A;  1OQH A;  2P0S A;  4BDL A;  1LB8 A;  2R6G E;  4H46 A;  2FNC A;  4DE8 A;  3DP4 A;  1OLA A;  3D4C A;  4ELP A;  3T9U A;  1NV7 A;  5AA3 A;  1EYI A;  2KLF A;  2DWH A;  3DP6 A;  1QKA A;  4OAN A;  1Y3N A;  5I2K A;  3T9X B;  4H0W A;  1FBE A;  1IIW A;  5JEI A;  1MM7 A;  4DCX A;  4Q0C A;  4RXL A;  4PCD A;  4FAJ A;  3FD3 A;  4F31 B;  1NV2 A;  4PF8 A;  5DVI A;  4R6K A;  2HAU A;  3Q26 A;  3CG3 A;  2DOJ A;  4H45 A;  4FBP A;  3TTL A;  1IMB A;  2E0S A;  1PB8 A;  1NMU A;  3PV0 E;  4QHQ A;  1TFD A;  1ZU0 A;  4F3G A;  4THI A;  3TYH A;  3O6H A;  4DCY A;  2O68 A;  3THI A;  1EU8 A;  1AMF A;  3SZP A;  2CZL A;  4ESX A;  5FHM A;  3LSF B;  1NKX A;  4OTE A;  4OWD A;  1M5D A;  5HPQ A;  1N0T A;  4QBA A;  4BDR A;  2GQ1 A;  3KJ7 A;  4ELR A;  4QSC A;  3HV1 A;  3FAT A;  4H6D A;  2DWJ A;  3FXU A;  3RY3 A;  3I3V A;  3IL1 B;  3A29 A;  4X1B A;  5EQ9 A;  1LB9 A;  3B50 A;  3CFX A;  2NWJ A;  3BIG A;  1NV6 A;  3DEL B;  1B3G A;  4F2Q A;  3K2D A;  4AS4 A;  2UVI A;  2V25 A;  4NF4 A;  1MXV A;  1DK4 A;  1CE2 A;  1B40 A;  4RK9 A;  2I0C A;  3FXQ A;  2NOO A;  3VLV A;  3O6I A;  4P1E A;  4OYV A;  3M8U A;  2V84 A;  4OFL A;  2X7Q A;  2QS2 A;  1IXG A;  1LEV A;  2V93 A;  5ET8 A;  4X9T A;  1ZTY A;  4N91 A;  3TFL A;  4P1L A;  1XS5 A;  3SKP A;  1SVX B;  2B4M A;  2YJP A;  2W7Y A;  4RYA A;  2F36 A;  4M4G A;  1VR5 A;  3EHS A;  3GXA A;  1PC3 A;  1XT8 A;  2VD2 A;  4JBZ A;  2F34 A;  2PFZ A;  3M3F A;  1M5E A;  3MZ1 A;  1PDA A;  3MST A;  5AA4 A;  1SBP A;  2CEX A;  4GD5 A;  3ZKL A;  3S9M C;  2PCR A;  1B3L A;  1A7L A;  2XWO A;  3HN0 A;  2VPO A;  2HEU A;  1MQH A;  2Z8E A;  2GHA A;  4IO2 A;  4OHN A;  1JET A;  1D9Y A;  1MPB A;  1NL5 A;  4QRZ A;  5DT6 A;  4Z7E A;  2F7A A;  3FVK A;  4GX3 A;  4PF6 A;  4LP2 B;  4MIJ A;  4GX6 A;  2B3F A;  1QUK A;  1MM6 A;  2Q8M A;  4KYS A;  3QXM A;  1YAE A;  3CR9 A;  3TTK A;  5AA2 B;  2AL4 A;  3FVG A;  1RDZ A;  1FPG A; 
#chains in the Genus database with same CATH homology
 3PTY A;  5IZ3 A;  4H46 A;  2HXR A;  2V3Q A;  5IZ1 A;  4YZZ A;  2F3B A;  1IMF A;  1FJ6 A;  2B4L A;  1FBG A;  1YYZ A;  4JVD A;  3W9V A;  4P1E A;  4N17 A;  5LDZ A;  2OX3 A;  3D1R A;  4PAK A;  2V4C A;  3FXB A;  3IFC A;  4PGP A;  1NV7 A;  1FPL A;  5I5P A;  1EYI A;  3RPL A;  4GWW A;  1DCU A;  1RDY A;  4OAN A;  3E78 A;  2MKZ A;  3T1B A;  5I7I A;  2BJI A;  3GYY A;  3KC1 A;  1BK4 A;  1KA0 A;  1LEV A;  4NG7 A;  1FPB A;  1D9Q A;  1FBE A;  5EQA A;  5ET8 A;  4P47 A;  4F18 A;  4MX6 A;  5EQ7 A;  4O7I A;  5ESY A;  3T0J A;  4PAF A;  2QFL A;  2ZZX A;  4X9T A;  3RYD A;  1FBH A;  1NUW A;  5ET7 A;  1YXI A;  2KR0 A;  2XWK A;  3LV0 A;  2HZK A;  4MMP A;  4N91 A;  4P1L A;  4PFR A;  4I3Y A;  1DBZ A;  2B4M A;  4PDH A;  2WYK A;  2OWZ A;  2P3N A;  3IFA A;  4HE0 A;  4OVT A;  4GX4 A;  5ET5 A;  4PCD A;  4MNP A;  1FBP A;  4I40 A;  4P9K A;  4PBQ A;  2FHY A;  2QVU A;  1YZ0 A;  4MJO A;  4NAP A;  1IME A;  5J1D A;  4GWS A;  1NI9 A;  5FBP A;  2FIE A;  1LBW A;  1NV2 A;  1FPK A;  2Q74 A;  2KQZ A;  2L5V A;  4MAG A;  1NV5 A;  1LBZ A;  2HHM A;  3KC0 A;  3E79 A;  4N6D A;  4PF8 A;  4F1U A;  4QXD A;  1FRP A;  2DVZ A;  2WBB A;  3CHG A;  5JK4 A;  4N8G A;  4UAB A;  4MNC A;  2VPN A;  1LBY A;  2XA5 A;  4H45 A;  4FBP A;  5F24 A;  1IMB A;  2XWI A;  1NUZ A;  4GWZ A;  2PFZ A;  3MYU A;  2CZI A;  2JJK A;  4LN5 A;  4PFB A;  4F19 A;  1QGX A;  1NV0 A;  1FPD A;  3MST A;  2XWV A;  3B8B A;  3ROJ A;  2Q9T A;  2CEX A;  3RPL B;  4JVC A;  4PFI A;  4XEQ A;  1G0H A;  1NV3 A;  4X04 A;  4YIC A;  1CNQ A;  2DE2 A;  5LTC A;  4JVI A;  4NGU A;  1LBV A;  2HZL A;  3SZP A;  2QVR A;  2XXK A;  1LBX A;  1FBC A;  1NV1 A;  2PCR A;  4N81 A;  1NUX A;  5IZ3 B;  4GBV A;  4OVS A;  2Y5L A;  2QPQ A;  4O94 A;  2CEY A;  1SPI A;  5CM6 A;  1K9Z A;  5IGA A;  2XWO A;  4DI3 D;  1NV4 A;  5A5L A;  1FBD A;  4KXP A;  2VPO A;  4HXV A;  2F5X A;  1EYK A;  2WX9 A;  4M1V A;  1VDW A;  4P56 A;  3NOH A;  3LUZ A;  2WBD A;  4NX1 A;  4O7M A;  2WYP A;  3ISP A;  1INP A;  2R8T A;  4NQ8 A;  4QBA A;  5IM2 A;  4PDD A;  5EYG A;  5EQ8 A;  1EYJ A;  2GQ1 A;  4GWY A;  4GWU A;  2DDK A;  4HE2 A;  1IMC A;  1JP4 A;  5J16 A;  3EKI A;  2PFY A;  2ZZW A;  4GWX A;  4PAI A;  4G61 A;  2F3D A;  4GBW A;  4MNI A;  2Y5K A;  2FIX A;  3U65 A;  4PE3 A;  2DE3 A;  4GX3 A;  2ZZV A;  4P8B A;  4PTK A;  1FPJ A;  1NUY A;  4I3E A;  4MIJ A;  2DE4 A;  4NN3 A;  4PF6 A;  1FSA A;  5I3S A;  2P3V A;  4GX6 A;  2WEF A;  3A29 A;  4O8M A;  4N15 A;  1KA1 A;  4MEV A;  4XF5 A;  1IMA A;  2CZH A;  1FPI A;  1XI6 A;  5EQ9 A;  4PET A;  4F1V A;  1AWB A;  3FBP A;  1K9Y A;  2QVV A;  5DW8 A;  4PC9 A;  4XFE A;  3B50 A;  4NF0 A;  5T3J A;  4DI4 B;  2CZK A;  2FVZ A;  2FBP A;  4MHF A;  4P3L A;  4OVP A;  4OVR A;  4OA4 A;  1KZ8 A;  4X8R A;  2Q8M A;  3BIG A;  3QMF A;  1FTA A;  1NV6 A;  5EYH A;  4MCO A;  4NHB A;  4PGN A;  3W9W A;  4AS4 A;  1IMD A;  2HPG A;  4PBH A;  3BIH A;  5ET6 A;  1G0I A;  4AS5 A;  4N4U A;  2VT5 A;  3KBZ A;  4N8Y A;  1Q9D A;  1DK4 A;  1FPE A;  4HCY A;  1RDX A;  4N6K A;  5IZZ A;  4HCW A;  4IR8 A;  1FBF A;  1FJ9 A;  1FPF A;  1RDZ A;  1FPG A;  4HE1 A;  3HFU A;  4OVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...