1LBZA

Crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 calcium ions and fructose-1,6 bisphosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
total genus 78
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbzA02
4GBWA 4G61A 1FPKA 1FPLA 2BJIA 1K9YA 4QXDA 3QMFA 1XI6A 2R8TA 1YZ0A 1CNQA 4H45A 2OX3A 2WEFA 1JP4A 2F3DA 4GBVA 1RDXA 5FBPA 1EYJA 1LBVA 4AS4A 4GX6A 1LBYA 1FPEA 1DK4A 2Y5LA 1NV3A 4I3YA 1FBCA 1IMAA 1FJ6A 1NV6A 4GWZA 2F3BA 1FSAA 4HE2A 1NV4A 5LDZA 1NUWA 1SPIA 1LBZA 1YYZA 2FIEA 5ET8A 1LBXA 2CZIA 1FBGA 3IFAA 1FRPA 3ROJA 4GWXA 1KZ8A 4HXVA 1FPFA 1NUXA 2FBPA 4O7IA 1FBHA 5EYHA 1K9ZA 1FBDA 1FBPA 5ESYA 4GX3A 3B8BA 2Y5KA 1IMDA 1AWBA 2Q74A 5EQ7A 5IZ3A 1EYKA 4AS5A 3LUZA 1FBEA 4GWUA 1FJ9A 3RPLA 2VT5A 5IZ1A 4IR8A 5ET7A 1BK4A 1QGXA 1DCUA 2CZKA 5J16A 1IMFA 1KA0A 2JJKA 1NV7A 2PCRA 5DW8A 1FPDA 1NV5A 4H46A 2GQ1A 4I3EA 5EQ9A 1VDWA 5IZ3B 3LV0A 4GWSA 1FPJA 3KC0A 3A29A 4FBPA 5ET6A 1NV1A 1NV2A 1NUZA 2CZHA 1LEVA 1YXIA 2Q8MA 1FTAA 1IMCA 4KXPA 4HE0A 1G0HA 4N81A 2OWZA 4GWWA 4MJOA 1FPIA 2QVRA 2QVUA 4I40A 5ET5A 1LBWA 1NUYA 3RYDA 2DDKA 3BIGA 1NI9A 2FHYA 1G0IA 2P3VA 2FIXA 1INPA 2FVZA 5A5LA 3KBZA 4GX4A 2HHMA 2WBBA 5EQ8A 1FPGA 2QFLA 3BIHA 3T0JA 1RDZA 5EYGA 2WBDA 5F24A 3D1RA 4GWYA 1IMBA 1EYIA 1Q9DA 3RPLB 3KC1A 1DBZA 1NV0A 3FBPA 1D9QA 5T3JA 5I3SA 4HE1A 1RDYA 2QVVA 1IMEA 2P3NA 5EQAA 1FBFA 1FPBA 1KA1A 3IFCA 4PTKA
chains in the Genus database with same CATH superfamily
4U2RA 5EHSA 4EDPA 2HEUA 1MS7A 1NNTA 1JP4A 2F3DA 1PDAA 1IXIA 3PPNA 5H8HB 1XHYA 2D5WA 2HCAA 2XD3A 1P99A 2XXKA 4GWZA 3KOSA 4EF1A 5IZZA 4FJPA 4N91A 1US5A 1ZIUA 2DXYA 5B70A 1FPFA 2ANJA 2FBPA 5H8NB 2Z8EA 3B8BA 1ELJA 3HHFA 3FVNA 3CSBA 3LUZA 4LA9A 1B0LA 4OZ9A 4I8CA 1SYIA 4IO6A 4R2FA 2HQ0A 1DPPA 3RN8A 1ATGA 3MW0A 5DT6A 5CBSA 3JZJA 1N76A 2Y7PA 2V3UA 1B1XA 4OEUA 5IAIA 2KR0A 4N81A 1XC1A 4NWDA 4P3LA 4F1VA 3RUMA 3GYYA 3OEMA 3S2VA 5CMMA 2AL5A 3V5AA 2ZYOA 1JQFA 4O94A 3B50A 3KBZA 2VPNA 5TP9A 3H6VA 5H8FB 3U1OA 2VPOA 3C32A 2DVCA 3T9XB 3DP8A 3TTLA 4PF6A 3IFCA 4PTKA 5I59A 2O84X 3KJTA 5KDTA 1NL5A 1PC3A 2VOZA 4H45A 1UTBA 1BKAA 2B4LA 2G93A 4K3FA 2A5TB 4U21A 1FPEA 3TUSA 1B7ZA 4C1TA 1EZOA 1EU8A 4DCXA 4G2ZA 4YICA 5AE4A 1NV4A 2ZXTA 4HS7A 4YU0A 4MLQA 3U93A 1Q35A 3B7DA 3KG2A 3PGFA 4O7IA 1K9ZA 1FBDA 3L6GA 1IMDA 2B3FA 2RF1A 3MVWA 4DI3D 3IB1A 2ONRA 2CZKA 3U65A 1KA0A 2JJKA 2F34A 2PCRA 2VD2A 4LQ2A 3BKIB 2KQZA 1LFHA 3E9XA 1YTVA 4TLMB 5H8SA 1NUZA 3O29A 3K6UA 3EHSA 2FYIA 4HE0A 3CRBA 3SEXA 1WDNA 2H9BA 4LZ7A 4KFQA 5EHMA 4R73A 2Q9TA 3G3FA 4NF4B 2I4BA 4NG7A 3UN6A 3KOTA 4TQUQ 3TKDA 2ZZXA 4PFYA 4JWXA 3S9NC 4GX4A 2WBBA 3T66A 4LVQA 4RJZA 3RPWA 5I2KB 2HPGA 3R7XA 4O3BA 1FTLA 2XXUA 4OVRA 1MDQA 2BJJX 3KSXA 2DP8A 3HV1A 2LAOA 4L17A 4OMBA 4QSEA 3TQLA 2RKMA 2QVVA 1IMEA 5EQAA 4FEBA 5A5XA 4YAHX 3K00A 1QUIA 4YB7A 1K9YA 1D4NA 2R8TA 2OX3A 3RQTA 2PT2A 3PD9A 3PUZE 2IEEA 1QKAA 2XXPA 2XHDA 4KI0E 4H1XA 1B4ZA 1T0KA 1LAXA 1NH8A 5AA3A 2FIEA 1KZ8A 1POY1 2ESNA 1QW0A 5ESYA 2Y5KA 2REGA 3OO9A 3TDJA 3B6TA 1BIYA 3M8UA 2ZNSA 1FTKA 2XXWA 2GHBA 1OQHA 2WKYA 4XF5A 2HFBA 1B40A 1I69A 4FEDA 5CM6A 3VDFA 1JETA 1S7YA 2VHAA 4XKPA 5I59B 3KC0A 1IXGA 5ET6A 4FBPA 3MC2A 1F9BA 5BUUA 3IJOB 3MQ9A 3OEKA 3VVEA 5HM4B 4PDDA 5CMBA 4KYDA 4KYEA 4GWWA 4RPOA 2FNCA 1I6BA 1NUYA 3RYDA 3JYRA 4GL8A 1G0IA 4NF0A 5CI5A 4N6KA 3OOAA 4RYAA 3TELA 4U4SA 5FTHA 2CEXA 2I3VA 4AB6A 3D1RA 3I3VA 1Q9DA 1USYH 3TPAA 2UYFA 1RDYA 1IXCA 3Q27A 2P3NA 1R1NA 1UTBB 1ZLQA 5A5XB 1YPNA 1MXUA 1USYE 1KA1A 4G61A 2O68A 1FPLA 3K2DA 2Q88A 3FXQA 4ZZAA 5I7IA 4G4PA 4AQ4A 4GBVA 1RDXA 5I57B 4P1EA 3UGWA 3H6WA 3DELB 1DMBA 4U4XA 4X1BA 1IMAA 4N6PA 1FJ6A 2F3BA 1MY3A 4F3BA 3FUZA 2F7BA 2XXTA 3V83A 1XT8A 4KCDA 3CFZA 4ESWA 1LBXA 1MPCA 1FBGA 4I9DA 4RNSA 4QHQA 2D3IA 4BDNA 2DWJA 2WYKA 3C35A 1I6AA 4GXAA 1AIVA 5AA2B 5LTCA 4XXUA 4G68C 1FQAA 5ICQA 4I3EA 1SD3A 3DP4A 3LV0A 5L8DA 3PPPA 1II5A 4R75A 1Y1ZA 4JSOA 1A40A 4R9GA 3QUJA 4PAKA 1URSA 4PQJA 1PBPA 5ET5A 4Q8RA 1B51A 5I84A 3BIGA 2E1SA 4NE4A 4PC9A 3IR1A 2YLNA 1FTJA 1OMPA 5I2NA 5EYGA 3CFLA 4PAFA 1LAGE 4P8BA 3ZSFA 4U22A 3C31A 5DVJA 3TTRA 1MXZA 1AOVA 4GBWA 4QFKA 3T96B 3KN3A 1Y4TA 2X7QA 3O6IA 1QUJA 1LBVA 4FIMA 1RYOA 2F35A 4RK9A 2Y7RA 3W9VA 2PFYA 1FBCA 4GXSB 3VVDA 2V4CA 3HFUA 1B7HA 4NTLA 4NF5B 4LZ5A 1SPIA 2PFZA 2W7YA 1FRPA 4X9TA 2X26A 1FQFA 2X7PA 1FBHA 1J1NA 4KCCA 2Q8JA 1ZKBA 3MSTA 3N94A 3MWBA 3SEYA 4F31B 3E13X 2NXOA 1LB9A 2P0SA 4H5FA 2OJTA 3TTMA 3FIRA 4ELOA 4PFBA 3CIJA 1SBPA 4MMPA 1Z7ME 1VR5A 3O97A 5KCJB 3N6TA 1O64A 1GGGA 2ZNUA 4MX6A 3GLBA 5KCJA 2HZLA 2P1SA 5F7VA 3FVGA 1G0HA 3A3UA 1Y20A 4EF2A 3FXBA 3RGYA 2Z23A 4R6HA 4H0WA 3MUQA 4KPTA 4Z7EA 1SW2A 4MNCA 5M2VA 1FQCA 1INPA 5A5LA 3LSFB 3VLVA 2QFLA 2ZYNA 2P2AA 4I62A 3W15C 1MXYA 3KC1A 2QPQA 2DS9A 1DBZA 1OQGA 2RC8A 3FZVA 4IO3A 3GBAA 3CR9A 4PFRA 4NF6B 2R6GE 3DLNA 3K1MA 1A8FA 4XKRA 4JVDA 4RA1A 4PFWA 1ANFA 5TU0A 3TMGA 2OWTA 5JTYB 4IY6A 3PV0E 1GVCA 4E0WA 1EH3A 3SKPA 1P1WA 2CZIA 2O6AA 1PB9A 1EZ9A 1SVXB 4YKJA 1SW1A 4OHNA 4AB5A 4PF8A 5I56A 4GWUA 1HSEA 3OSRA 2OCUA 5L9MA 4C1UA 1TWYA 2M8CA 4OVSA 2DWIA 2GRVA 1POTA 1MRPA 1B4HA 5L9OA 1LCFA 2WX9A 1B3LA 1N7XA 4ESXA 3PMXA 2PMSA 5IZ3B 3ODBA 4F22A 1N0TA 4G8HA 1MXVA 3T9UA 1JW5A 1IMCA 2O7UA 1IITA 4F1YA 3CFXA 2DE3A 5DVFA 2DSFA 2Z8DA 3QUFA 2ZZWA 3IO4A 4LN5A 5I2NB 5DEXA 2DDKA 4H65A 4JVCA 2FA7A 2QL3A 3G3HA 4FAJA 3BIHA 2HAUA 5DYHA 4H5GA 4NF8B 4JVIA 2NWJA 4OQOA 1HSJA 3TFLA 3T9VA 4F2OA 1NV0A 3KJ7A 4JB7A 3O2AA 3IORA 4MIJA 2QRYA 3IB0A 4M1VA 3K02A 3FJGA 4ISUA 1XI6A 1YZ0A 1CNQA 3L6HA 3ONMA 2XXRA 1P1OA 2I58A 4Q5TA 3W9WA 1H3DA 2B3BA 1R6ZA 4AS4A 3HO7A 4IO5A 3GZGA 1LBYA 4I3YA 3K0VA 4KR5A 3MBPA 2Q89A 5JK4A 1YAEA 1N04A 5LDZA 1YCJA 4JWYA 2YPNA 2DOJA 4MLVA 1MPDA 3CG3A 2R9JA 4WEDA 4O3CA 2XWIA 3Q28A 5TPAB 3P7IA 4NHBA 4RPNA 4PDHA 3H3GA 4R72A 1LLSA 5I57A 1NV7A 1B32A 4U23A 3UP9A 1MH4A 4ZDMA 4H46A 2ZZVA 4QFPA 4JWOA 1MQIA 3MZBA 3ILUB 4PAIA 1B0HA 4NN3A 2VP1A 3VVFA 4DDDA 4G68B 5F1QA 1BP5A 1P1QA 4BLAA 2NOOA 4F3PA 4X04A 4QSDA 1LBCA 2F7CA 4BDRA 4LQ5A 1L5TA 5IM2A 4N4UA 2P3VA 2RC7A 2Y7IA 3E3KA 1FPGA 3MVXA 3CVGA 3OELA 4MH5A 2Q2CA 1S50A 2DVZA 4MNPA 3A3CA 1JNFA 3MPLA 2V84A 4YZZA 5IGAA 2XXIA 3ECRA 4LATA 4OTEA 4ZEKA 2DE2A 1P1NA 2CMOA 2NVUB 3LSLA 4ELPA 3FATA 3H06B 5AA4B 1LCTA 4UABA 2B65A 4ZE9A 4PGNA 1LSTA 4HE2A 1M5EA 4DE8A 3PUYE 3SEVA 3MVYA 2F5XA 3BFTA 3EHUA 4N8GA 4UA8A 4N17A 3KEIA 3M3FA 1FBPA 2A5SA 5H8QA 2H5YA 4OENA 5IZ1A 4MFIA 4QFNA 4F29A 1IMFA 4G77A 1TFDA 3OENA 1BTJA 3ILTB 1B2HA 4NF5A 2V25A 1NV1A 1B5JA 1NV2A 2Q8MA 4PE5B 1M5BA 4KQPA 1M5FA 4XTCQ 4KYSA 4FORA 2THIA 3OXNA 3SESA 1IEJA 1H43A 1VFDA 3MZ1A 4PETA 4OVPA 2HHMA 3GXAA 3EKIA 3HN0A 4GLIA 2WBDA 4HTGA 3RPLB 1VFEA 1NNFA 4ZEIA 4F1UA 2F97A 2XXVA 4OYVA 5LOMA 4DZ1A 2VD3A 1SW4A 2AIXA 4H6DA 2H99A 3PPRA 4G8MA 3MAMA 4MF3A 4P47A 2ONKE 3LUYA 4OVQA 5FBPA 3O66A 4XIGQ 4WEPA 1B3HA 1OVBA 4OVJA 5CBRA 4ELQA 4GFRA 1H76A 3IFAA 1M5DA 4R2BA 5ITPA 2ZYKA 1EZPA 2UVHA 1N3WA 1LGBC 4PE3A 1XVXA 1MH3A 4OANA 1N84A 1FJ9A 2QS3A 3HHGA 3MVZA 1S9TA 5IKBA 2I0CA 4OA4A 1LBBA 1FCKA 1GTKA 2O69A 5CMCA 2ONSA 1P1UA 1RKMA 3C9HA 1A55A 1JW1A 2V93A 4X48A 1FTAA 1Y9UA 3FJ7A 1FPIA 3PD8A 3UORA 2XD2A 4N07A 3C4MA 1DSNA 4EQBA 3MZ9A 4GOTA 3PMWA 1SQYA 4KHZE 4NF4A 3K6VA 4DXBA 3MP1A 1QULA 4P0IA 2V3QA 1PBQA 2HXRA 3MPKA 2QMXA 4DXUA 3T22A 5FHOA 1PB7A 3SEUA 4BDLA 4FECA 2XWVA 3QIMA 3B6WA 3GBBA 1EYJA 1XS5A 4R9FA 3TZAA 1FTOA 4R6YA 3RY3A 3S9LC 1NV3A 1QVSA 4NX1A 1MQGA 4OFOA 4G8NA 3ISPA 4ZECA 3PPQA 3RT6B 5AA4A 1SDXA 4MCOA 3WAFA 3I5OA 1NUXA 1N7WA 4GD5A 5EYHA 4QFLA 4OESA 1MXWA 3RT8A 1B5HA 3RPLA 4IR8A 4JXIA 5J16A 2QS2A 1IUDA 4PP0A 4FE8A 5DW8A 3IOWA 3IOUA 1MM7A 4XFEA 2I0BA 4IY5A 3E4RA 2XWKA 3SZPA 3EQ1A 2PYYA 2DXRA 1SI0A 4OERA 2CZHA 3RLFE 2RC9A 3ZKKA 3MYUA 3K6XA 3UK4A 2OWZA 2L5VA 4GL0A 4ECFA 1TXFA 4H8JA 3DM0A 4F18A 3G3KA 2QVRA 1B46A 1MPBA 1MQHA 2OPEA 2F8DA 2OK2A 4G68A 2FVZA 2QSXA 2F78A 1A8EA 2GFEA 4PBHA 3KZGA 1AMFA 1Y3NA 4N6DA 5K2YA 1FQBA 5T3JA 4P11A 1DTZA 1FBFA 1VSOA 4Q0CA 2I48A 2BJIA 4PBQA 4O3AA 2NUVA 4F19A 3Q25A 2AYSA 1MG1A 4X8RA 3FV1A 1AH5A 3M3LA 4LUBA 4QF9A 3PUVE 2PVUA 2XX8A 1JVYA 1OIBA 1MQDA 1SYHA 3FVKA 4M4GA 1WVJA 4GWOA 5CC2A 2Q74A 1BLFA 1CB6A 3EF7A 1QUKA 4YKIA 1BK4A 2I6EA 2DYXA 4IB2A 1TT1A 2RCAA 2ZNTA 1LAFE 3CI8A 4O8MA 4PGPA 3N6UA 2Q2AA 3FXUA 3G3GA 3QK6A 4I40A 4Q30B 1H45A 1DTGA 1WODA 5JTYA 1B52A 5EQ8A 2OPDA 5ITOA 3T0JA 3SDFA 2Y7KA 5DVIA 3R6UA 3VLUA 4R74A 5I3SA 2ZMBA 2UVIA 5H8FA 5TP9B 2O7IA 3PU5A 4P56A 1HSLA 5BWJA 1Q1KA 2Z22A 5JEIA 4EQ9A 4HW8A 2WEFA 2DWAA 3BFUA 4DCYA 3PUWE 3KN7A 3TEPA 4XKNA 2Y5LA 3QAXA 5KDTB 1NFTA 4QFOA 2E0SA 1D9YA 1FSAA 1LFIA 2DQVA 2O51A 3H6TA 1MY1A 3KN8A 3AXFA 1SI1A 4ELRA 3FJMA 3PTYA 4LONB 2R71A 3ROJA 1MY0A 4HXVA 1IIWA 3LBSA 3TCFA 5EYFA 1FTMA 1EYKA 2I4CA 3V8XB 4ZE8A 4H8IA 4GVOA 2AL4A 4HCWA 3G7WA 1FPDA 3O6HA 1B7UA 3B6QA 5DTBA 3T1BA 4LZ8A 4ZEDA 2UVGA 1JEUA 1LEVA 1YXIA 2DWHA 3LSWA 4KXPA 3C36A 3IJXB 1R9LA 2Z8FA 4IO4A 3SEWA 3K01A 2OZZA 1QJMA 3Q29A 1LFGA 5FHNA 4N13A 3BBRA 2XWOA 1PB8A 1RDZA 2XX7A 4O7MA 4GWYA 1IMBA 3VXCA 3FBPA 5I56B 4ZS9A 4F3SA 2F6PA 3IO6A 1UIUA 1DOTA 2ZYMA 4EXKA 2PT1A 2ABHA 4QXDA 4P0GA 4THIA 3TODA 3C33A 4LP2B 1GR2A 4XKQA 5L9SA 4NQ8A 2CEYA 3ZKLA 3RTFB 1IXHA 1NV6A 3USDA 2HAVA 2I3WA 3MP6A 5CMKA 4OETA 3U8QA 3KSJA 1ZJLA 5ISUA 5I2KA 4DIGA 3WAEA 2GH9A 4GX3A 4MBPA 2YJPA 1XVYA 1Y4CA 3U72A 4TLLB 2IA4A 1JW4A 4JDFA 3THIA 2GQ1A 4BDQA 1DPEA 1UIVA 5HPQA 1VDWA 3TYHA 1B3GA 1UQWA 2I49A 3C34A 4PFUA 2QS1A 4QBAA 4WKMA 2O1MA 4GF8A 3SETA 1LBWA 4DLDA 3KGCA 1B1HA 4P9KA 1Y3QA 3IAZA 3K1NA 3UIFA 2XX9A 1PEBA 1MY2A 1OVTA 3IX1A 4POWA 2OWSA 3PUXE 4NEDA 3V89B 1URDA 1D9QA 4HE1A 1Z7NE 5I5PA 1FPBA 4EQ7A 3QYTA 2QMWA 3IL1B 3LSXA 3PPOA 1FPKA 4YKKA 4EXLA 3KBRA 1UTHB 1I6QA 4ZZEA 2A5TA 3IB2A 5I58A 1B9JA 1DK4A 4IGRA 3FD3A 1A7LA 1FQEA 3IOVA 4XEQA 1RYXA 3PMVA 1O7TA 1NUWA 4BDMA 1LBZA 1JVXA 3G3JA 1XOCA 5K2XA 4GWXA 5J1DA 2CZLA 3VXBA 2Y84A 1AWBA 5EQ7A 3LC8A 4PCDA 4OXVA 1QGXA 4NWCA 1DCUA 3H4ZA 2MKZA 5HBCA 4PFIA 1NV5A 1SW5A 4GRKA 3DP6A 3EN3A 1D3KA 3NOHA 4MHFA 5H8QB 4YB6A 3TQWA 1B5IA 4GWSA 1FPJA 3A29A 2XXHA 3EPEA 4QSCA 3S9EA 4U1OA 4IO2A 1MQJA 4R6KA 1OLCA 4OEVA 4GQOA 4WXJA 3HPIA 4H67A 3EHTA 3OO7A 2UXAA 2ALUA 3QXMA 1NI9A 3U94A 2D21A 5DEXB 2HXWA 3RTWB 1B3FA 3K4UA 4UACA 5F24A 4TOZA 1D9VA 3VLWA 1GV8A 4N15A 2H98A 1EYIA 5CRYA 4F39A 1OLAA 2RCBA 1A54A 3UA8A 3KFMA 4MAGA 2RINA 3D4CA 3O6GA 3O28A 3H7MA 1H44A 4N8YA 4MNIA 3CG1A 1N3XA 4GX6A 5B7DA 3MJNA 2VGQA 3TTKA 4Z0IA 3M3KA 1MXXA 1KWHA 3O9PA 1B58A 4E0XA 4NGUA 4IO7A 3I6VA 2Y7WA 1URGA 2PX1A 3D4GA 3FVOA 2B4MA 2HZKA 3K1PA 2H25A 1US4A 1LB8A 3A09A 4RY1A 1ZTYA 3OSQA 1FBEA 2VT5A 1B3EA 4ND9A 1VE4A 3FGSA 3LR1A 2O1LA 4GIZA 1Y3PA 4C0RA 1FW0A 4I1DA 2QS4A 3R26A 2OLBA 3MP8A 5I58B 4OFJA 4YKPA 2XA5A 4JSDA 4NF8A 3QSLA 4U1ZA 2OBGA 2XXQA 2QVUA 4JBZA 1MDP1 4P1LA 3H6UA 3IK6B 1IZ1A 2UVJA 3E78A 5H8NA 4DXCA 3T9HB 4NAPA 4RXLA 2REJA 3TAJA 4ZEBA 1CE2A 3F11A 4KD5A 4YB5A 2UYEA 4EUOA 3U92A 3TCHA 1ZMGA 3JV9A 4X1DA 2QJEA 3HCQA 4YMAA 4F2QA 3S4UA 1B6HA 3IOTA 5FHMA 2PBWA 3S9MC 3N5LA 3FV2A 1A99A 2GHAA 5TPAA 3QMFA 2F6GA 1ZU0A 4RK2A 3OO6A 4MEVA 5AA2A 1IQ7A 1TFAA 3K6WA 1NH7A 1UTHA 4NMYA 5AA2D 1NNPA 3ZS6A 4POXA 5KZTA 2F7AA 3H03A 3OO8A 2F36A 1R9QA 5ELVA 3T93B 3VE1B 1YYZA 1NKXA 5ET8A 3OD7A 5H8HA 1ZBMA 4FATA 3CSGA 4OFLA 3E79A 3Q26A 3TCGA 1JEVA 1LAHE 4YMBA 4ONYA 3OMBA 5IZ3A 4AS5A 2G29A 4QRZA 3SERA 1NMUA 1NNKA 5ICTA 5ET7A 2KLFA 3FXRA 4PFTA 1B05A 4OWDA 5FTIA 1MY4A 5EQ9A 3HSTA 3RNNA 1FQDA 3N26A 4NF6A 3G3IA 3VFJA 4OVTA 3FASA 4IGTA 2XXYA 4HCYA 2WYPA 1MM6A 3VV5A 4MJOA 1Y1MA 1O63A 2FHYA 4ZEFA 2H4IA 2FIXA 2XXXA 1M5CA 4BDOA 4DI4B 2V3TA 1AL3A 4F3GA 2DE4A 3TTNA 5AA1A 3CHGA 1QKBA
chains in the Genus database with same CATH topology
4PFRA 4GBWA 4G61A 1FPKA 1FPLA 4M1VA 4MAGA 4P47A 4OVQA 2BJIA 1K9YA 4QXDA 4P56A 3QMFA 4PBQA 2DE2A 2XWVA 1XI6A 4JVDA 2R8TA 1YZ0A 1CNQA 5I7IA 4H45A 2OX3A 4PBHA 2WEFA 4N8YA 1JP4A 2F3DA 4GBVA 1RDXA 5FBPA 4MNIA 4F19A 1EYJA 2B4LA 4MEVA 4P1EA 3W9WA 1LBVA 4AS4A 4GX6A 1LBYA 1FPEA 4X8RA 3W9VA 1DK4A 2Y5LA 4UABA 2PFYA 4NQ8A 2CEYA 1NV3A 4I3YA 1FBCA 1IMAA 1FJ6A 4NX1A 4PGNA 1NV6A 2XXKA 4GWZA 2F3BA 2V4CA 4YICA 1FSAA 3HFUA 4XEQA 5IZZA 5JK4A 4HE2A 3ISPA 1NV4A 5LDZA 4N91A 1NUWA 1SPIA 1LBZA 2PFZA 4NGUA 2F5XA 1YYZA 2FIEA 5ET8A 3PTYA 1LBXA 2CZIA 1FBGA 3IFAA 4MCOA 1FRPA 3ROJA 4GWXA 1KZ8A 4HXVA 1FPFA 3E79A 4X9TA 1NUXA 5J1DA 2FBPA 4N8GA 4O7IA 1FBHA 5EYHA 2B4MA 2HZKA 4N17A 1K9ZA 1FBDA 1FBPA 5ESYA 2XWIA 4GX3A 2WYKA 3B8BA 4PF8A 2Y5KA 1IMDA 1AWBA 3MSTA 4PE3A 2Q74A 5EQ7A 5IZ3A 1EYKA 4AS5A 4OANA 3LUZA 4NHBA 1FBEA 4GWUA 1FJ9A 3RPLA 4PDHA 2VT5A 4PCDA 5IZ1A 4IR8A 5ET7A 4DI3D 4HCWA 5LTCA 1BK4A 1QGXA 1DCUA 2CZKA 5J16A 1IMFA 2MKZA 4OA4A 1KA0A 2JJKA 1NV7A 4OVSA 4PFIA 4PFBA 3U65A 2PCRA 5DW8A 1FPDA 1NV5A 4H46A 2GQ1A 2ZZVA 4XF5A 4I3EA 5EQ9A 2WX9A 3NOHA 4MHFA 4MMPA 4XFEA 5CM6A 3T1BA 2KQZA 2XWKA 1VDWA 5IZ3B 3LV0A 4GWSA 1FPJA 3KC0A 3SZPA 3A29A 4FBPA 5ET6A 1NV1A 4PAIA 1NV2A 4OVTA 4MX6A 1NUZA 2CZHA 1LEVA 1YXIA 2Q8MA 4NN3A 1FTAA 1IMCA 3MYUA 4KXPA 2HZLA 4HE0A 2KR0A 4O8MA 2DE3A 4PGPA 4QBAA 1G0HA 4N81A 4HCYA 4P3LA 4F1VA 2OWZA 2L5VA 2ZZWA 2WYPA 2XA5A 4PAKA 4PDDA 4GWWA 4MJOA 4F18A 3FXBA 1FPIA 2Q9TA 2QVRA 2QVUA 4I40A 5ET5A 4LN5A 4NG7A 4X04A 1LBWA 3GYYA 1NUYA 3RYDA 4PETA 2DDKA 4P1LA 4JVCA 2ZZXA 3BIGA 5IM2A 1NI9A 2FHYA 1G0IA 4N4UA 2P3VA 2FIXA 4NF0A 4N6KA 4PC9A 4MNCA 3E78A 1INPA 2FVZA 4O94A 4OVPA 5A5LA 3B50A 4P9KA 3KBZA 4GX4A 2VPNA 4NAPA 2HHMA 2WBBA 5EQ8A 2CEXA 2XWOA 1FPGA 2QFLA 3BIHA 3T0JA 3EKIA 2HPGA 1RDZA 5EYGA 2WBDA 5F24A 4JVIA 4O7MA 3D1RA 4OVRA 2VPOA 4GWYA 2V3QA 4DI4B 2HXRA 1IMBA 4N15A 1EYIA 4PAFA 1Q9DA 3RPLB 4P8BA 3KC1A 2DVZA 2QPQA 4N6DA 1DBZA 4MNPA 1NV0A 3FBPA 4F1UA 2DE4A 1D9QA 5T3JA 5I3SA 4HE1A 1RDYA 2QVVA 1IMEA 2P3NA 5EQAA 5I5PA 1FBFA 1FPBA 4PF6A 4MIJA 1KA1A 3IFCA 3CHGA 4PTKA 4YZZA 5IGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBW A;  4G61 A;  1FPK A;  1FPL A;  2BJI A;  1K9Y A;  4QXD A;  3QMF A;  1XI6 A;  2R8T A;  1YZ0 A;  1CNQ A;  4H45 A;  2OX3 A;  2WEF A;  1JP4 A;  2F3D A;  4GBV A;  1RDX A;  5FBP A;  1EYJ A;  1LBV A;  4AS4 A;  4GX6 A;  1LBY A;  1FPE A;  1DK4 A;  2Y5L A;  1NV3 A;  4I3Y A;  1FBC A;  1IMA A;  1FJ6 A;  1NV6 A;  4GWZ A;  2F3B A;  1FSA A;  4HE2 A;  1NV4 A;  5LDZ A;  1NUW A;  1SPI A;  1LBZ A;  1YYZ A;  2FIE A;  5ET8 A;  1LBX A;  2CZI A;  1FBG A;  3IFA A;  1FRP A;  3ROJ A;  4GWX A;  1KZ8 A;  4HXV A;  1FPF A;  1NUX A;  2FBP A;  4O7I A;  1FBH A;  5EYH A;  1K9Z A;  1FBD A;  1FBP A;  5ESY A;  4GX3 A;  3B8B A;  2Y5K A;  1IMD A;  1AWB A;  2Q74 A;  5EQ7 A;  5IZ3 A;  1EYK A;  4AS5 A;  3LUZ A;  1FBE A;  4GWU A;  1FJ9 A;  3RPL A;  2VT5 A;  5IZ1 A;  4IR8 A;  5ET7 A;  1BK4 A;  1QGX A;  1DCU A;  2CZK A;  5J16 A;  1IMF A;  1KA0 A;  2JJK A;  1NV7 A;  2PCR A;  5DW8 A;  1FPD A;  1NV5 A;  4H46 A;  2GQ1 A;  4I3E A;  5EQ9 A;  1VDW A;  5IZ3 B;  3LV0 A;  4GWS A;  1FPJ A;  3KC0 A;  3A29 A;  4FBP A;  5ET6 A;  1NV1 A;  1NV2 A;  1NUZ A;  2CZH A;  1LEV A;  1YXI A;  2Q8M A;  1FTA A;  1IMC A;  4KXP A;  4HE0 A;  1G0H A;  4N81 A;  2OWZ A;  4GWW A;  4MJO A;  1FPI A;  2QVR A;  2QVU A;  4I40 A;  5ET5 A;  1LBW A;  1NUY A;  3RYD A;  2DDK A;  3BIG A;  1NI9 A;  2FHY A;  1G0I A;  2P3V A;  2FIX A;  1INP A;  2FVZ A;  5A5L A;  3KBZ A;  4GX4 A;  2HHM A;  2WBB A;  5EQ8 A;  1FPG A;  2QFL A;  3BIH A;  3T0J A;  1RDZ A;  5EYG A;  2WBD A;  5F24 A;  3D1R A;  4GWY A;  1IMB A;  1EYI A;  1Q9D A;  3RPL B;  3KC1 A;  1DBZ A;  1NV0 A;  3FBP A;  1D9Q A;  5T3J A;  5I3S A;  4HE1 A;  1RDY A;  2QVV A;  1IME A;  2P3N A;  5EQA A;  1FBF A;  1FPB A;  1KA1 A;  3IFC A;  4PTK A; 
#chains in the Genus database with same CATH topology
 4U2R A;  5EHS A;  4EDP A;  2HEU A;  1MS7 A;  1NNT A;  1JP4 A;  2F3D A;  1PDA A;  1IXI A;  3PPN A;  5H8H B;  1XHY A;  2D5W A;  2HCA A;  2XD3 A;  1P99 A;  2XXK A;  4GWZ A;  3KOS A;  4EF1 A;  5IZZ A;  4FJP A;  4N91 A;  1US5 A;  1ZIU A;  2DXY A;  5B70 A;  1FPF A;  2ANJ A;  2FBP A;  5H8N B;  2Z8E A;  3B8B A;  1ELJ A;  3HHF A;  3FVN A;  3CSB A;  3LUZ A;  4LA9 A;  1B0L A;  4OZ9 A;  4I8C A;  1SYI A;  4IO6 A;  4R2F A;  2HQ0 A;  1DPP A;  3RN8 A;  1ATG A;  3MW0 A;  5DT6 A;  5CBS A;  3JZJ A;  1N76 A;  2Y7P A;  2V3U A;  1B1X A;  4OEU A;  5IAI A;  2KR0 A;  4N81 A;  1XC1 A;  4NWD A;  4P3L A;  4F1V A;  3RUM A;  3GYY A;  3OEM A;  3S2V A;  5CMM A;  2AL5 A;  3V5A A;  2ZYO A;  1JQF A;  4O94 A;  3B50 A;  3KBZ A;  2VPN A;  5TP9 A;  3H6V A;  5H8F B;  3U1O A;  2VPO A;  3C32 A;  2DVC A;  3T9X B;  3DP8 A;  3TTL A;  4PF6 A;  3IFC A;  4PTK A;  5I59 A;  2O84 X;  3KJT A;  5KDT A;  1NL5 A;  1PC3 A;  2VOZ A;  4H45 A;  1UTB A;  1BKA A;  2B4L A;  2G93 A;  4K3F A;  2A5T B;  4U21 A;  1FPE A;  3TUS A;  1B7Z A;  4C1T A;  1EZO A;  1EU8 A;  4DCX A;  4G2Z A;  4YIC A;  5AE4 A;  1NV4 A;  2ZXT A;  4HS7 A;  4YU0 A;  4MLQ A;  3U93 A;  1Q35 A;  3B7D A;  3KG2 A;  3PGF A;  4O7I A;  1K9Z A;  1FBD A;  3L6G A;  1IMD A;  2B3F A;  2RF1 A;  3MVW A;  4DI3 D;  3IB1 A;  2ONR A;  2CZK A;  3U65 A;  1KA0 A;  2JJK A;  2F34 A;  2PCR A;  2VD2 A;  4LQ2 A;  3BKI B;  2KQZ A;  1LFH A;  3E9X A;  1YTV A;  4TLM B;  5H8S A;  1NUZ A;  3O29 A;  3K6U A;  3EHS A;  2FYI A;  4HE0 A;  3CRB A;  3SEX A;  1WDN A;  2H9B A;  4LZ7 A;  4KFQ A;  5EHM A;  4R73 A;  2Q9T A;  3G3F A;  4NF4 B;  2I4B A;  4NG7 A;  3UN6 A;  3KOT A;  4TQU Q;  3TKD A;  2ZZX A;  4PFY A;  4JWX A;  3S9N C;  4GX4 A;  2WBB A;  3T66 A;  4LVQ A;  4RJZ A;  3RPW A;  5I2K B;  2HPG A;  3R7X A;  4O3B A;  1FTL A;  2XXU A;  4OVR A;  1MDQ A;  2BJJ X;  3KSX A;  2DP8 A;  3HV1 A;  2LAO A;  4L17 A;  4OMB A;  4QSE A;  3TQL A;  2RKM A;  2QVV A;  1IME A;  5EQA A;  4FEB A;  5A5X A;  4YAH X;  3K00 A;  1QUI A;  4YB7 A;  1K9Y A;  1D4N A;  2R8T A;  2OX3 A;  3RQT A;  2PT2 A;  3PD9 A;  3PUZ E;  2IEE A;  1QKA A;  2XXP A;  2XHD A;  4KI0 E;  4H1X A;  1B4Z A;  1T0K A;  1LAX A;  1NH8 A;  5AA3 A;  2FIE A;  1KZ8 A;  1POY 1;  2ESN A;  1QW0 A;  5ESY A;  2Y5K A;  2REG A;  3OO9 A;  3TDJ A;  3B6T A;  1BIY A;  3M8U A;  2ZNS A;  1FTK A;  2XXW A;  2GHB A;  1OQH A;  2WKY A;  4XF5 A;  2HFB A;  1B40 A;  1I69 A;  4FED A;  5CM6 A;  3VDF A;  1JET A;  1S7Y A;  2VHA A;  4XKP A;  5I59 B;  3KC0 A;  1IXG A;  5ET6 A;  4FBP A;  3MC2 A;  1F9B A;  5BUU A;  3IJO B;  3MQ9 A;  3OEK A;  3VVE A;  5HM4 B;  4PDD A;  5CMB A;  4KYD A;  4KYE A;  4GWW A;  4RPO A;  2FNC A;  1I6B A;  1NUY A;  3RYD A;  3JYR A;  4GL8 A;  1G0I A;  4NF0 A;  5CI5 A;  4N6K A;  3OOA A;  4RYA A;  3TEL A;  4U4S A;  5FTH A;  2CEX A;  2I3V A;  4AB6 A;  3D1R A;  3I3V A;  1Q9D A;  1USY H;  3TPA A;  2UYF A;  1RDY A;  1IXC A;  3Q27 A;  2P3N A;  1R1N A;  1UTB B;  1ZLQ A;  5A5X B;  1YPN A;  1MXU A;  1USY E;  1KA1 A;  4G61 A;  2O68 A;  1FPL A;  3K2D A;  2Q88 A;  3FXQ A;  4ZZA A;  5I7I A;  4G4P A;  4AQ4 A;  4GBV A;  1RDX A;  5I57 B;  4P1E A;  3UGW A;  3H6W A;  3DEL B;  1DMB A;  4U4X A;  4X1B A;  1IMA A;  4N6P A;  1FJ6 A;  2F3B A;  1MY3 A;  4F3B A;  3FUZ A;  2F7B A;  2XXT A;  3V83 A;  1XT8 A;  4KCD A;  3CFZ A;  4ESW A;  1LBX A;  1MPC A;  1FBG A;  4I9D A;  4RNS A;  4QHQ A;  2D3I A;  4BDN A;  2DWJ A;  2WYK A;  3C35 A;  1I6A A;  4GXA A;  1AIV A;  5AA2 B;  5LTC A;  4XXU A;  4G68 C;  1FQA A;  5ICQ A;  4I3E A;  1SD3 A;  3DP4 A;  3LV0 A;  5L8D A;  3PPP A;  1II5 A;  4R75 A;  1Y1Z A;  4JSO A;  1A40 A;  4R9G A;  3QUJ A;  4PAK A;  1URS A;  4PQJ A;  1PBP A;  5ET5 A;  4Q8R A;  1B51 A;  5I84 A;  3BIG A;  2E1S A;  4NE4 A;  4PC9 A;  3IR1 A;  2YLN A;  1FTJ A;  1OMP A;  5I2N A;  5EYG A;  3CFL A;  4PAF A;  1LAG E;  4P8B A;  3ZSF A;  4U22 A;  3C31 A;  5DVJ A;  3TTR A;  1MXZ A;  1AOV A;  4GBW A;  4QFK A;  3T96 B;  3KN3 A;  1Y4T A;  2X7Q A;  3O6I A;  1QUJ A;  1LBV A;  4FIM A;  1RYO A;  2F35 A;  4RK9 A;  2Y7R A;  3W9V A;  2PFY A;  1FBC A;  4GXS B;  3VVD A;  2V4C A;  3HFU A;  1B7H A;  4NTL A;  4NF5 B;  4LZ5 A;  1SPI A;  2PFZ A;  2W7Y A;  1FRP A;  4X9T A;  2X26 A;  1FQF A;  2X7P A;  1FBH A;  1J1N A;  4KCC A;  2Q8J A;  1ZKB A;  3MST A;  3N94 A;  3MWB A;  3SEY A;  4F31 B;  3E13 X;  2NXO A;  1LB9 A;  2P0S A;  4H5F A;  2OJT A;  3TTM A;  3FIR A;  4ELO A;  4PFB A;  3CIJ A;  1SBP A;  4MMP A;  1Z7M E;  1VR5 A;  3O97 A;  5KCJ B;  3N6T A;  1O64 A;  1GGG A;  2ZNU A;  4MX6 A;  3GLB A;  5KCJ A;  2HZL A;  2P1S A;  5F7V A;  3FVG A;  1G0H A;  3A3U A;  1Y20 A;  4EF2 A;  3FXB A;  3RGY A;  2Z23 A;  4R6H A;  4H0W A;  3MUQ A;  4KPT A;  4Z7E A;  1SW2 A;  4MNC A;  5M2V A;  1FQC A;  1INP A;  5A5L A;  3LSF B;  3VLV A;  2QFL A;  2ZYN A;  2P2A A;  4I62 A;  3W15 C;  1MXY A;  3KC1 A;  2QPQ A;  2DS9 A;  1DBZ A;  1OQG A;  2RC8 A;  3FZV A;  4IO3 A;  3GBA A;  3CR9 A;  4PFR A;  4NF6 B;  2R6G E;  3DLN A;  3K1M A;  1A8F A;  4XKR A;  4JVD A;  4RA1 A;  4PFW A;  1ANF A;  5TU0 A;  3TMG A;  2OWT A;  5JTY B;  4IY6 A;  3PV0 E;  1GVC A;  4E0W A;  1EH3 A;  3SKP A;  1P1W A;  2CZI A;  2O6A A;  1PB9 A;  1EZ9 A;  1SVX B;  4YKJ A;  1SW1 A;  4OHN A;  4AB5 A;  4PF8 A;  5I56 A;  4GWU A;  1HSE A;  3OSR A;  2OCU A;  5L9M A;  4C1U A;  1TWY A;  2M8C A;  4OVS A;  2DWI A;  2GRV A;  1POT A;  1MRP A;  1B4H A;  5L9O A;  1LCF A;  2WX9 A;  1B3L A;  1N7X A;  4ESX A;  3PMX A;  2PMS A;  5IZ3 B;  3ODB A;  4F22 A;  1N0T A;  4G8H A;  1MXV A;  3T9U A;  1JW5 A;  1IMC A;  2O7U A;  1IIT A;  4F1Y A;  3CFX A;  2DE3 A;  5DVF A;  2DSF A;  2Z8D A;  3QUF A;  2ZZW A;  3IO4 A;  4LN5 A;  5I2N B;  5DEX A;  2DDK A;  4H65 A;  4JVC A;  2FA7 A;  2QL3 A;  3G3H A;  4FAJ A;  3BIH A;  2HAU A;  5DYH A;  4H5G A;  4NF8 B;  4JVI A;  2NWJ A;  4OQO A;  1HSJ A;  3TFL A;  3T9V A;  4F2O A;  1NV0 A;  3KJ7 A;  4JB7 A;  3O2A A;  3IOR A;  4MIJ A;  2QRY A;  3IB0 A;  4M1V A;  3K02 A;  3FJG A;  4ISU A;  1XI6 A;  1YZ0 A;  1CNQ A;  3L6H A;  3ONM A;  2XXR A;  1P1O A;  2I58 A;  4Q5T A;  3W9W A;  1H3D A;  2B3B A;  1R6Z A;  4AS4 A;  3HO7 A;  4IO5 A;  3GZG A;  1LBY A;  4I3Y A;  3K0V A;  4KR5 A;  3MBP A;  2Q89 A;  5JK4 A;  1YAE A;  1N04 A;  5LDZ A;  1YCJ A;  4JWY A;  2YPN A;  2DOJ A;  4MLV A;  1MPD A;  3CG3 A;  2R9J A;  4WED A;  4O3C A;  2XWI A;  3Q28 A;  5TPA B;  3P7I A;  4NHB A;  4RPN A;  4PDH A;  3H3G A;  4R72 A;  1LLS A;  5I57 A;  1NV7 A;  1B32 A;  4U23 A;  3UP9 A;  1MH4 A;  4ZDM A;  4H46 A;  2ZZV A;  4QFP A;  4JWO A;  1MQI A;  3MZB A;  3ILU B;  4PAI A;  1B0H A;  4NN3 A;  2VP1 A;  3VVF A;  4DDD A;  4G68 B;  5F1Q A;  1BP5 A;  1P1Q A;  4BLA A;  2NOO A;  4F3P A;  4X04 A;  4QSD A;  1LBC A;  2F7C A;  4BDR A;  4LQ5 A;  1L5T A;  5IM2 A;  4N4U A;  2P3V A;  2RC7 A;  2Y7I A;  3E3K A;  1FPG A;  3MVX A;  3CVG A;  3OEL A;  4MH5 A;  2Q2C A;  1S50 A;  2DVZ A;  4MNP A;  3A3C A;  1JNF A;  3MPL A;  2V84 A;  4YZZ A;  5IGA A;  2XXI A;  3ECR A;  4LAT A;  4OTE A;  4ZEK A;  2DE2 A;  1P1N A;  2CMO A;  2NVU B;  3LSL A;  4ELP A;  3FAT A;  3H06 B;  5AA4 B;  1LCT A;  4UAB A;  2B65 A;  4ZE9 A;  4PGN A;  1LST A;  4HE2 A;  1M5E A;  4DE8 A;  3PUY E;  3SEV A;  3MVY A;  2F5X A;  3BFT A;  3EHU A;  4N8G A;  4UA8 A;  4N17 A;  3KEI A;  3M3F A;  1FBP A;  2A5S A;  5H8Q A;  2H5Y A;  4OEN A;  5IZ1 A;  4MFI A;  4QFN A;  4F29 A;  1IMF A;  4G77 A;  1TFD A;  3OEN A;  1BTJ A;  3ILT B;  1B2H A;  4NF5 A;  2V25 A;  1NV1 A;  1B5J A;  1NV2 A;  2Q8M A;  4PE5 B;  1M5B A;  4KQP A;  1M5F A;  4XTC Q;  4KYS A;  4FOR A;  2THI A;  3OXN A;  3SES A;  1IEJ A;  1H43 A;  1VFD A;  3MZ1 A;  4PET A;  4OVP A;  2HHM A;  3GXA A;  3EKI A;  3HN0 A;  4GLI A;  2WBD A;  4HTG A;  3RPL B;  1VFE A;  1NNF A;  4ZEI A;  4F1U A;  2F97 A;  2XXV A;  4OYV A;  5LOM A;  4DZ1 A;  2VD3 A;  1SW4 A;  2AIX A;  4H6D A;  2H99 A;  3PPR A;  4G8M A;  3MAM A;  4MF3 A;  4P47 A;  2ONK E;  3LUY A;  4OVQ A;  5FBP A;  3O66 A;  4XIG Q;  4WEP A;  1B3H A;  1OVB A;  4OVJ A;  5CBR A;  4ELQ A;  4GFR A;  1H76 A;  3IFA A;  1M5D A;  4R2B A;  5ITP A;  2ZYK A;  1EZP A;  2UVH A;  1N3W A;  1LGB C;  4PE3 A;  1XVX A;  1MH3 A;  4OAN A;  1N84 A;  1FJ9 A;  2QS3 A;  3HHG A;  3MVZ A;  1S9T A;  5IKB A;  2I0C A;  4OA4 A;  1LBB A;  1FCK A;  1GTK A;  2O69 A;  5CMC A;  2ONS A;  1P1U A;  1RKM A;  3C9H A;  1A55 A;  1JW1 A;  2V93 A;  4X48 A;  1FTA A;  1Y9U A;  3FJ7 A;  1FPI A;  3PD8 A;  3UOR A;  2XD2 A;  4N07 A;  3C4M A;  1DSN A;  4EQB A;  3MZ9 A;  4GOT A;  3PMW A;  1SQY A;  4KHZ E;  4NF4 A;  3K6V A;  4DXB A;  3MP1 A;  1QUL A;  4P0I A;  2V3Q A;  1PBQ A;  2HXR A;  3MPK A;  2QMX A;  4DXU A;  3T22 A;  5FHO A;  1PB7 A;  3SEU A;  4BDL A;  4FEC A;  2XWV A;  3QIM A;  3B6W A;  3GBB A;  1EYJ A;  1XS5 A;  4R9F A;  3TZA A;  1FTO A;  4R6Y A;  3RY3 A;  3S9L C;  1NV3 A;  1QVS A;  4NX1 A;  1MQG A;  4OFO A;  4G8N A;  3ISP A;  4ZEC A;  3PPQ A;  3RT6 B;  5AA4 A;  1SDX A;  4MCO A;  3WAF A;  3I5O A;  1NUX A;  1N7W A;  4GD5 A;  5EYH A;  4QFL A;  4OES A;  1MXW A;  3RT8 A;  1B5H A;  3RPL A;  4IR8 A;  4JXI A;  5J16 A;  2QS2 A;  1IUD A;  4PP0 A;  4FE8 A;  5DW8 A;  3IOW A;  3IOU A;  1MM7 A;  4XFE A;  2I0B A;  4IY5 A;  3E4R A;  2XWK A;  3SZP A;  3EQ1 A;  2PYY A;  2DXR A;  1SI0 A;  4OER A;  2CZH A;  3RLF E;  2RC9 A;  3ZKK A;  3MYU A;  3K6X A;  3UK4 A;  2OWZ A;  2L5V A;  4GL0 A;  4ECF A;  1TXF A;  4H8J A;  3DM0 A;  4F18 A;  3G3K A;  2QVR A;  1B46 A;  1MPB A;  1MQH A;  2OPE A;  2F8D A;  2OK2 A;  4G68 A;  2FVZ A;  2QSX A;  2F78 A;  1A8E A;  2GFE A;  4PBH A;  3KZG A;  1AMF A;  1Y3N A;  4N6D A;  5K2Y A;  1FQB A;  5T3J A;  4P11 A;  1DTZ A;  1FBF A;  1VSO A;  4Q0C A;  2I48 A;  2BJI A;  4PBQ A;  4O3A A;  2NUV A;  4F19 A;  3Q25 A;  2AYS A;  1MG1 A;  4X8R A;  3FV1 A;  1AH5 A;  3M3L A;  4LUB A;  4QF9 A;  3PUV E;  2PVU A;  2XX8 A;  1JVY A;  1OIB A;  1MQD A;  1SYH A;  3FVK A;  4M4G A;  1WVJ A;  4GWO A;  5CC2 A;  2Q74 A;  1BLF A;  1CB6 A;  3EF7 A;  1QUK A;  4YKI A;  1BK4 A;  2I6E A;  2DYX A;  4IB2 A;  1TT1 A;  2RCA A;  2ZNT A;  1LAF E;  3CI8 A;  4O8M A;  4PGP A;  3N6U A;  2Q2A A;  3FXU A;  3G3G A;  3QK6 A;  4I40 A;  4Q30 B;  1H45 A;  1DTG A;  1WOD A;  5JTY A;  1B52 A;  5EQ8 A;  2OPD A;  5ITO A;  3T0J A;  3SDF A;  2Y7K A;  5DVI A;  3R6U A;  3VLU A;  4R74 A;  5I3S A;  2ZMB A;  2UVI A;  5H8F A;  5TP9 B;  2O7I A;  3PU5 A;  4P56 A;  1HSL A;  5BWJ A;  1Q1K A;  2Z22 A;  5JEI A;  4EQ9 A;  4HW8 A;  2WEF A;  2DWA A;  3BFU A;  4DCY A;  3PUW E;  3KN7 A;  3TEP A;  4XKN A;  2Y5L A;  3QAX A;  5KDT B;  1NFT A;  4QFO A;  2E0S A;  1D9Y A;  1FSA A;  1LFI A;  2DQV A;  2O51 A;  3H6T A;  1MY1 A;  3KN8 A;  3AXF A;  1SI1 A;  4ELR A;  3FJM A;  3PTY A;  4LON B;  2R71 A;  3ROJ A;  1MY0 A;  4HXV A;  1IIW A;  3LBS A;  3TCF A;  5EYF A;  1FTM A;  1EYK A;  2I4C A;  3V8X B;  4ZE8 A;  4H8I A;  4GVO A;  2AL4 A;  4HCW A;  3G7W A;  1FPD A;  3O6H A;  1B7U A;  3B6Q A;  5DTB A;  3T1B A;  4LZ8 A;  4ZED A;  2UVG A;  1JEU A;  1LEV A;  1YXI A;  2DWH A;  3LSW A;  4KXP A;  3C36 A;  3IJX B;  1R9L A;  2Z8F A;  4IO4 A;  3SEW A;  3K01 A;  2OZZ A;  1QJM A;  3Q29 A;  1LFG A;  5FHN A;  4N13 A;  3BBR A;  2XWO A;  1PB8 A;  1RDZ A;  2XX7 A;  4O7M A;  4GWY A;  1IMB A;  3VXC A;  3FBP A;  5I56 B;  4ZS9 A;  4F3S A;  2F6P A;  3IO6 A;  1UIU A;  1DOT A;  2ZYM A;  4EXK A;  2PT1 A;  2ABH A;  4QXD A;  4P0G A;  4THI A;  3TOD A;  3C33 A;  4LP2 B;  1GR2 A;  4XKQ A;  5L9S A;  4NQ8 A;  2CEY A;  3ZKL A;  3RTF B;  1IXH A;  1NV6 A;  3USD A;  2HAV A;  2I3W A;  3MP6 A;  5CMK A;  4OET A;  3U8Q A;  3KSJ A;  1ZJL A;  5ISU A;  5I2K A;  4DIG A;  3WAE A;  2GH9 A;  4GX3 A;  4MBP A;  2YJP A;  1XVY A;  1Y4C A;  3U72 A;  4TLL B;  2IA4 A;  1JW4 A;  4JDF A;  3THI A;  2GQ1 A;  4BDQ A;  1DPE A;  1UIV A;  5HPQ A;  1VDW A;  3TYH A;  1B3G A;  1UQW A;  2I49 A;  3C34 A;  4PFU A;  2QS1 A;  4QBA A;  4WKM A;  2O1M A;  4GF8 A;  3SET A;  1LBW A;  4DLD A;  3KGC A;  1B1H A;  4P9K A;  1Y3Q A;  3IAZ A;  3K1N A;  3UIF A;  2XX9 A;  1PEB A;  1MY2 A;  1OVT A;  3IX1 A;  4POW A;  2OWS A;  3PUX E;  4NED A;  3V89 B;  1URD A;  1D9Q A;  4HE1 A;  1Z7N E;  5I5P A;  1FPB A;  4EQ7 A;  3QYT A;  2QMW A;  3IL1 B;  3LSX A;  3PPO A;  1FPK A;  4YKK A;  4EXL A;  3KBR A;  1UTH B;  1I6Q A;  4ZZE A;  2A5T A;  3IB2 A;  5I58 A;  1B9J A;  1DK4 A;  4IGR A;  3FD3 A;  1A7L A;  1FQE A;  3IOV A;  4XEQ A;  1RYX A;  3PMV A;  1O7T A;  1NUW A;  4BDM A;  1LBZ A;  1JVX A;  3G3J A;  1XOC A;  5K2X A;  4GWX A;  5J1D A;  2CZL A;  3VXB A;  2Y84 A;  1AWB A;  5EQ7 A;  3LC8 A;  4PCD A;  4OXV A;  1QGX A;  4NWC A;  1DCU A;  3H4Z A;  2MKZ A;  5HBC A;  4PFI A;  1NV5 A;  1SW5 A;  4GRK A;  3DP6 A;  3EN3 A;  1D3K A;  3NOH A;  4MHF A;  5H8Q B;  4YB6 A;  3TQW A;  1B5I A;  4GWS A;  1FPJ A;  3A29 A;  2XXH A;  3EPE A;  4QSC A;  3S9E A;  4U1O A;  4IO2 A;  1MQJ A;  4R6K A;  1OLC A;  4OEV A;  4GQO A;  4WXJ A;  3HPI A;  4H67 A;  3EHT A;  3OO7 A;  2UXA A;  2ALU A;  3QXM A;  1NI9 A;  3U94 A;  2D21 A;  5DEX B;  2HXW A;  3RTW B;  1B3F A;  3K4U A;  4UAC A;  5F24 A;  4TOZ A;  1D9V A;  3VLW A;  1GV8 A;  4N15 A;  2H98 A;  1EYI A;  5CRY A;  4F39 A;  1OLA A;  2RCB A;  1A54 A;  3UA8 A;  3KFM A;  4MAG A;  2RIN A;  3D4C A;  3O6G A;  3O28 A;  3H7M A;  1H44 A;  4N8Y A;  4MNI A;  3CG1 A;  1N3X A;  4GX6 A;  5B7D A;  3MJN A;  2VGQ A;  3TTK A;  4Z0I A;  3M3K A;  1MXX A;  1KWH A;  3O9P A;  1B58 A;  4E0X A;  4NGU A;  4IO7 A;  3I6V A;  2Y7W A;  1URG A;  2PX1 A;  3D4G A;  3FVO A;  2B4M A;  2HZK A;  3K1P A;  2H25 A;  1US4 A;  1LB8 A;  3A09 A;  4RY1 A;  1ZTY A;  3OSQ A;  1FBE A;  2VT5 A;  1B3E A;  4ND9 A;  1VE4 A;  3FGS A;  3LR1 A;  2O1L A;  4GIZ A;  1Y3P A;  4C0R A;  1FW0 A;  4I1D A;  2QS4 A;  3R26 A;  2OLB A;  3MP8 A;  5I58 B;  4OFJ A;  4YKP A;  2XA5 A;  4JSD A;  4NF8 A;  3QSL A;  4U1Z A;  2OBG A;  2XXQ A;  2QVU A;  4JBZ A;  1MDP 1;  4P1L A;  3H6U A;  3IK6 B;  1IZ1 A;  2UVJ A;  3E78 A;  5H8N A;  4DXC A;  3T9H B;  4NAP A;  4RXL A;  2REJ A;  3TAJ A;  4ZEB A;  1CE2 A;  3F11 A;  4KD5 A;  4YB5 A;  2UYE A;  4EUO A;  3U92 A;  3TCH A;  1ZMG A;  3JV9 A;  4X1D A;  2QJE A;  3HCQ A;  4YMA A;  4F2Q A;  3S4U A;  1B6H A;  3IOT A;  5FHM A;  2PBW A;  3S9M C;  3N5L A;  3FV2 A;  1A99 A;  2GHA A;  5TPA A;  3QMF A;  2F6G A;  1ZU0 A;  4RK2 A;  3OO6 A;  4MEV A;  5AA2 A;  1IQ7 A;  1TFA A;  3K6W A;  1NH7 A;  1UTH A;  4NMY A;  5AA2 D;  1NNP A;  3ZS6 A;  4POX A;  5KZT A;  2F7A A;  3H03 A;  3OO8 A;  2F36 A;  1R9Q A;  5ELV A;  3T93 B;  3VE1 B;  1YYZ A;  1NKX A;  5ET8 A;  3OD7 A;  5H8H A;  1ZBM A;  4FAT A;  3CSG A;  4OFL A;  3E79 A;  3Q26 A;  3TCG A;  1JEV A;  1LAH E;  4YMB A;  4ONY A;  3OMB A;  5IZ3 A;  4AS5 A;  2G29 A;  4QRZ A;  3SER A;  1NMU A;  1NNK A;  5ICT A;  5ET7 A;  2KLF A;  3FXR A;  4PFT A;  1B05 A;  4OWD A;  5FTI A;  1MY4 A;  5EQ9 A;  3HST A;  3RNN A;  1FQD A;  3N26 A;  4NF6 A;  3G3I A;  3VFJ A;  4OVT A;  3FAS A;  4IGT A;  2XXY A;  4HCY A;  2WYP A;  1MM6 A;  3VV5 A;  4MJO A;  1Y1M A;  1O63 A;  2FHY A;  4ZEF A;  2H4I A;  2FIX A;  2XXX A;  1M5C A;  4BDO A;  4DI4 B;  2V3T A;  1AL3 A;  4F3G A;  2DE4 A;  3TTN A;  5AA1 A;  3CHG A;  1QKB A; 
#chains in the Genus database with same CATH homology
 4PFR A;  4GBW A;  4G61 A;  1FPK A;  1FPL A;  4M1V A;  4MAG A;  4P47 A;  4OVQ A;  2BJI A;  1K9Y A;  4QXD A;  4P56 A;  3QMF A;  4PBQ A;  2DE2 A;  2XWV A;  1XI6 A;  4JVD A;  2R8T A;  1YZ0 A;  1CNQ A;  5I7I A;  4H45 A;  2OX3 A;  4PBH A;  2WEF A;  4N8Y A;  1JP4 A;  2F3D A;  4GBV A;  1RDX A;  5FBP A;  4MNI A;  4F19 A;  1EYJ A;  2B4L A;  4MEV A;  4P1E A;  3W9W A;  1LBV A;  4AS4 A;  4GX6 A;  1LBY A;  1FPE A;  4X8R A;  3W9V A;  1DK4 A;  2Y5L A;  4UAB A;  2PFY A;  4NQ8 A;  2CEY A;  1NV3 A;  4I3Y A;  1FBC A;  1IMA A;  1FJ6 A;  4NX1 A;  4PGN A;  1NV6 A;  2XXK A;  4GWZ A;  2F3B A;  2V4C A;  4YIC A;  1FSA A;  3HFU A;  4XEQ A;  5IZZ A;  5JK4 A;  4HE2 A;  3ISP A;  1NV4 A;  5LDZ A;  4N91 A;  1NUW A;  1SPI A;  1LBZ A;  2PFZ A;  4NGU A;  2F5X A;  1YYZ A;  2FIE A;  5ET8 A;  3PTY A;  1LBX A;  2CZI A;  1FBG A;  3IFA A;  4MCO A;  1FRP A;  3ROJ A;  4GWX A;  1KZ8 A;  4HXV A;  1FPF A;  3E79 A;  4X9T A;  1NUX A;  5J1D A;  2FBP A;  4N8G A;  4O7I A;  1FBH A;  5EYH A;  2B4M A;  2HZK A;  4N17 A;  1K9Z A;  1FBD A;  1FBP A;  5ESY A;  2XWI A;  4GX3 A;  2WYK A;  3B8B A;  4PF8 A;  2Y5K A;  1IMD A;  1AWB A;  3MST A;  4PE3 A;  2Q74 A;  5EQ7 A;  5IZ3 A;  1EYK A;  4AS5 A;  4OAN A;  3LUZ A;  4NHB A;  1FBE A;  4GWU A;  1FJ9 A;  3RPL A;  4PDH A;  2VT5 A;  4PCD A;  5IZ1 A;  4IR8 A;  5ET7 A;  4DI3 D;  4HCW A;  5LTC A;  1BK4 A;  1QGX A;  1DCU A;  2CZK A;  5J16 A;  1IMF A;  2MKZ A;  4OA4 A;  1KA0 A;  2JJK A;  1NV7 A;  4OVS A;  4PFI A;  4PFB A;  3U65 A;  2PCR A;  5DW8 A;  1FPD A;  1NV5 A;  4H46 A;  2GQ1 A;  2ZZV A;  4XF5 A;  4I3E A;  5EQ9 A;  2WX9 A;  3NOH A;  4MHF A;  4MMP A;  4XFE A;  5CM6 A;  3T1B A;  2KQZ A;  2XWK A;  1VDW A;  5IZ3 B;  3LV0 A;  4GWS A;  1FPJ A;  3KC0 A;  3SZP A;  3A29 A;  4FBP A;  5ET6 A;  1NV1 A;  4PAI A;  1NV2 A;  4OVT A;  4MX6 A;  1NUZ A;  2CZH A;  1LEV A;  1YXI A;  2Q8M A;  4NN3 A;  1FTA A;  1IMC A;  3MYU A;  4KXP A;  2HZL A;  4HE0 A;  2KR0 A;  4O8M A;  2DE3 A;  4PGP A;  4QBA A;  1G0H A;  4N81 A;  4HCY A;  4P3L A;  4F1V A;  2OWZ A;  2L5V A;  2ZZW A;  2WYP A;  2XA5 A;  4PAK A;  4PDD A;  4GWW A;  4MJO A;  4F18 A;  3FXB A;  1FPI A;  2Q9T A;  2QVR A;  2QVU A;  4I40 A;  5ET5 A;  4LN5 A;  4NG7 A;  4X04 A;  1LBW A;  3GYY A;  1NUY A;  3RYD A;  4PET A;  2DDK A;  4P1L A;  4JVC A;  2ZZX A;  3BIG A;  5IM2 A;  1NI9 A;  2FHY A;  1G0I A;  4N4U A;  2P3V A;  2FIX A;  4NF0 A;  4N6K A;  4PC9 A;  4MNC A;  3E78 A;  1INP A;  2FVZ A;  4O94 A;  4OVP A;  5A5L A;  3B50 A;  4P9K A;  3KBZ A;  4GX4 A;  2VPN A;  4NAP A;  2HHM A;  2WBB A;  5EQ8 A;  2CEX A;  2XWO A;  1FPG A;  2QFL A;  3BIH A;  3T0J A;  3EKI A;  2HPG A;  1RDZ A;  5EYG A;  2WBD A;  5F24 A;  4JVI A;  4O7M A;  3D1R A;  4OVR A;  2VPO A;  4GWY A;  2V3Q A;  4DI4 B;  2HXR A;  1IMB A;  4N15 A;  1EYI A;  4PAF A;  1Q9D A;  3RPL B;  4P8B A;  3KC1 A;  2DVZ A;  2QPQ A;  4N6D A;  1DBZ A;  4MNP A;  1NV0 A;  3FBP A;  4F1U A;  2DE4 A;  1D9Q A;  5T3J A;  5I3S A;  4HE1 A;  1RDY A;  2QVV A;  1IME A;  2P3N A;  5EQA A;  5I5P A;  1FBF A;  1FPB A;  4PF6 A;  4MIJ A;  1KA1 A;  3IFC A;  3CHG A;  4PTK A;  4YZZ A;  5IGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...