1LBZA

Crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 calcium ions and fructose-1,6 bisphosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 78
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbzA02
1IMAA 1IMFA 5ET6A 1JP4A 1FBPA 2FIEA 3D1RA 1Q9DA 1RDXA 1NV5A 5I3SA 1LBZA 1IMEA 5IZ3A 1FRPA 5EYGA 4AS5A 4H45A 2WEFA 1VDWA 1NV0A 1RDYA 2JJKA 1NV6A 2OWZA 4HE0A 1FPJA 2VT5A 3B8BA 4PTKA 4GWXA 1IMCA 1K9YA 3RPLB 1YZ0A 4GWZA 4HXVA 4GX6A 2F3BA 2Y5KA 1IMBA 3QMFA 2Q74A 1FJ6A 1LEVA 4I3YA 3IFCA 5EQAA 5ET8A 4G61A 4I40A 1KA0A 5IZ1A 3BIHA 3KC1A 1FPIA 1KZ8A 4GBVA 1CNQA 1NUYA 2FBPA 4GX3A 4O7IA 1LBYA 1LBWA 4GWYA 1FSAA 2P3VA 2FIXA 4HE1A 2FVZA 5DW8A 1FPKA 3A29A 1LBXA 5A5LA 2QVRA 1G0IA 1NV7A 1YXIA 1FBGA 5ET7A 2CZKA 1NUWA 1FBDA 1KA1A 2OX3A 1K9ZA 2P3NA 2Y5LA 5LDZA 1EYIA 1NUZA 2F3DA 1FPGA 1LBVA 4QXDA 1NV3A 1EYJA 2R8TA 1G0HA 2DDKA 3BIGA 4AS4A 5IZ3B 3RPLA 1FTAA 1DCUA 1FBEA 1SPIA 2Q8MA 5F24A 2CZIA 1NV1A 1NUXA 4N81A 3KC0A 1NI9A 1YYZA 2QFLA 4IR8A 2BJIA 2GQ1A 4GWSA 5ET5A 5T3JA 3ROJA 2WBDA 1DBZA 5EQ9A 3RYDA 1FPDA 4I3EA 2HHMA 1D9QA 1DK4A 1FPFA 4HE2A 4GX4A 3T0JA 2QVVA 2QVUA 1IMDA 2CZHA 1FBCA 1EYKA 1FJ9A 2FHYA 3LV0A 4MJOA 1FPBA 3FBPA 4GWWA 3LUZA 1BK4A 1NV2A 5ESYA 5EYHA 2WBBA 2PCRA 4FBPA 1QGXA 1AWBA 1NV4A 1FBHA 1XI6A 5J16A 1INPA 1RDZA 4GWUA 5EQ7A 3KBZA 4KXPA 1FPLA 3IFAA 4H46A 4GBWA 5EQ8A 5FBPA 1FBFA 1FPEA
chains in the Genus database with same CATH superfamily
5ET6A 2Q88A 2HEUA 3C9HA 2FIEA 4NX1A 3IO6A 5A5XA 4YKPA 4AS5A 5ITPA 4EQ9A 3PU5A 3DP8A 2VPOA 1IMCA 2GHBA 2ZZWA 5H8QB 1YZ0A 2ABHA 4HXVA 2XXPA 4YZZA 3SESA 1QKBA 1LEVA 1QULA 4X8RA 3S4UA 3IFCA 2XWIA 1B58A 3MZBA 3EQ1A 3KSJA 3O9PA 1M5DA 3ILTB 1IXCA 5KDTA 2DE2A 4O3CA 4R72A 4C1TA 1H3DA 2XX8A 3OEMA 4LATA 4LQ5A 1B3FA 1US4A 4QXDA 2QMXA 4H5GA 2PT2A 4R2FA 1SI1A 3H6TA 2ZYNA 2BJJX 3NOHA 1FBEA 1SPIA 3W15C 4ZECA 1YYZA 1A8FA 1Y9UA 3MP1A 2GQ1A 4JBZA 2A5TB 4OANA 4LQ2A 4G4PA 3H06B 1P1NA 1MG1A 1IMDA 5KCJA 1FBCA 2UVJA 4F1VA 4GWWA 2D5WA 3TDJA 3N6TA 4P3LA 3FATA 3QAXA 3V8XB 4H1XA 4JWOA 4KYEA 2GRVA 1B40A 2REGA 4NMYA 1SYHA 3OSQA 3QK6A 1Q9DA 3HFUA 5I3SA 3IL1B 2R71A 4G8NA 1TXFA 2V84A 2HFBA 1DTZA 3K4UA 1OLCA 2O51A 3CFXA 1TFDA 2I3WA 4OETA 3KN3A 1MXXA 1YAEA 4N13A 3OO7A 4NWCA 3MPLA 2HQ0A 2VD3A 1CNQA 1B3EA 4R6HA 4KFQA 4GX3A 4O7IA 2FVZA 2PBWA 2XXQA 3H6WA 1EZOA 2XXTA 1MDQA 1G0IA 3MC2A 2HPGA 3FZVA 4G8MA 5LDZA 1T0KA 1LBVA 1O64A 1LGBC 1Y4CA 2AL4A 3L6GA 3ZS6A 4PDDA 2M8CA 1USYH 5FTIA 1MY3A 3IOUA 2HCAA 4PFRA 1VFDA 5H8QA 5ITOA 5H8HB 2XXVA 4XF5A 3KC0A 3FV1A 1DPEA 4GRKA 4YICA 5ET5A 1HSEA 1PC3A 5EQ9A 3ZKKA 2QVVA 3U94A 1EH3A 1FPBA 5TU0A 4LUBA 1N3WA 2W7YA 3CFZA 5ICQA 4K3FA 3K6UA 2VHAA 3RNNA 3S9NC 4ELOA 3RQTA 4U21A 4KXPA 3Q28A 3VV5A 2O1LA 3VVDA 1TWYA 1WDNA 3BFTA 3G3JA 2UYFA 3O97A 4FATA 1IMEA 1B2HA 3MVWA 1BKAA 4BDOA 5EYGA 4BDNA 3EHTA 5F7VA 3FVGA 3IJXB 3IK6B 2A5TA 1K9YA 1EZ9A 1BTJA 3FVKA 2O68A 2F3BA 4JXIA 4FEBA 5TP9B 3QMFA 4MNPA 4H8JA 3RLFE 4I3YA 2L5VA 5ET8A 1MM6A 3T66A 2NVUB 3H6VA 4GBVA 1MXUA 2V3TA 1LBYA 2PYYA 1MQJA 3EPEA 4GQOA 4PC9A 3IR1A 4I62A 5EYFA 2O1MA 3IB1A 2F35A 1NUZA 4PFYA 3ISPA 2PFZA 3LSWA 4KD5A 4XKQA 3T9UA 5I56B 3BIGA 3T93B 1LB9A 1O7TA 1DCUA 4E0XA 1FTJA 2XXIA 3WAFA 1DBZA 1UIUA 4ZEKA 1ZTYA 4R75A 4L17A 3LSLA 4GX4A 2XXHA 3B6QA 3K01A 5KZTA 4BDMA 2I0BA 2OJTA 2HXRA 4RPNA 3SKPA 2WBBA 1MY4A 4IO3A 4FBPA 4FE8A 4JWYA 1HSLA 3QSLA 5TPAB 1PB9A 4AB5A 3JYRA 2HAUA 3PUZE 2VGQA 1FQBA 1FPLA 4HTGA 4H6DA 4YKKA 4U23A 3QYTA 4MLVA 1H45A 4P1EA 2H98A 4OA4A 4OEVA 1MQIA 3C31A 5H8HA 2WEFA 3HHFA 3T9VA 1NV0A 1NNKA 1LFGA 4HW8A 3GZGA 3B6WA 1AMFA 4RY1A 3LSFB 2HXWA 3O66A 3H7MA 5IZ1A 1XVXA 2MKZA 3RN8A 4N91A 3OO6A 3C35A 1B5HA 2OPDA 1ANFA 1D9YA 2XXWA 3FXQA 4PGNA 4PBHA 3MP8A 4POWA 3CIJA 2Z23A 4NF8B 4R73A 4KQPA 1H44A 1FPGA 5CMBA 1B3LA 3HN0A 3K1PA 3TEPA 1NV3A 1DTGA 1SW1A 1MPDA 2F7AA 5TP9A 1RYOA 3UORA 3G3KA 4HCYA 2ZNTA 3IOVA 3RYDA 2XHDA 2FHYA 4LZ8A 4ZEDA 3LV0A 1S50A 3RY3A 3LUZA 3A09A 2F36A 5B7DA 3T96B 2UVHA 2Q89A 3DELB 3DP4A 1XC1A 1SYIA 1ELJA 3OO8A 3VVEA 4ZZEA 3T1BA 1XI6A 3Q25A 3KBZA 3IFAA 5CMMA 1JP4A 1ZIUA 4R9GA 5I56A 4N6DA 1DOTA 2DSFA 5IKBA 1Y3PA 4PE5B 4DXUA 1Y4TA 2F97A 4H45A 5CRYA 4YB5A 2JJKA 3KFMA 3I5OA 4F29A 3B8BA 4GLIA 4U2RA 4UACA 4OERA 1H43A 4GX6A 4ZEIA 4N4UA 3MZ1A 1LAGE 1IMBA 2QS2A 4NF4B 1L5TA 2OPEA 1MXWA 2VOZA 4N07A 1B3HA 1MY2A 2ONSA 1KA0A 4MBPA 3E4RA 1ZKBA 1ZBMA 5TPAA 2FBPA 3FJGA 3RGYA 1CB6A 3TAJA 2B3BA 2YPNA 4PDHA 2O7IA 1FCKA 4UABA 4I1DA 3SDFA 1YXIA 4OMBA 1VFEA 2DWHA 1EYIA 1WODA 1PEBA 2Y84A 3ZKLA 1SW5A 2I58A 4BDLA 2DDKA 4XKRA 1MXZA 1Y20A 4JSOA 1D4NA 1LB8A 4WEPA 3OSRA 4IR8A 4MX6A 2BJIA 4F31B 4PE3A 2QS1A 2B4LA 5L9SA 1SW2A 3M3LA 1FPDA 3Q29A 3G3IA 5F1QA 1QUJA 1Q35A 4XKNA 1MH4A 3O28A 3IX1A 4N6KA 4MNCA 1B3GA 4U1OA 1Y1MA 2DWAA 3MZ9A 4NF5B 4KI0E 4NF8A 4F3PA 1INPA 5LTCA 1SVXB 4ZE9A 5BWJA 3TKDA 1FQDA 5AE4A 2FNCA 1LBCA 2OLBA 4FIMA 3FJ7A 3HPIA 3PV0E 2OWZA 3M8UA 4PTKA 5DEXB 3PMXA 4ONYA 1B0LA 4HCWA 2X26A 2A5SA 1RYXA 2G93A 2H4IA 2DP8A 2Q9TA 2XXUA 1GTKA 2DVCA 4GD5A 1XHYA 2ANJA 3VFJA 5I2KB 2OWTA 1DMBA 3N94A 4G68C 4GWYA 4ZZAA 1MRPA 2P3VA 4PFWA 1B51A 3PGFA 4QFNA 3QXMA 4QBAA 1MS7A 4Q0CA 3MVZA 3LSXA 1TT1A 1FBGA 2DQVA 3LUYA 5BUUA 4GL8A 5K2YA 3L6HA 4DI4B 1QJMA 3TQLA 5ELVA 3U93A 1MDP1 4N81A 2CMOA 3CR9A 4NF4A 2F6GA 1ZJLA 3MQ9A 5AA1A 4F39A 1NL5A 1D9QA 1BLFA 1FPFA 4OVSA 4LZ5A 3OEKA 2I6EA 3T9XB 4LN5A 3IOTA 3G3FA 4GXAA 3RTWB 1NH8A 2V4CA 1FQEA 2Y7WA 1MQHA 3B7DA 1XVYA 3KGCA 4I9DA 4PAKA 1US5A 4OENA 4OVTA 1ATGA 1NNTA 2WYKA 2ZZXA 3FXRA 2XD3A 1Y3NA 3E3KA 3R6UA 1VSOA 5CBRA 4M1VA 4LONB 3TCGA 3ONMA 2Q8JA 2OK2A 3FXUA 2UXAA 1B5JA 3WAEA 2Y5KA 4GL0A 5JTYB 4ELRA 3EN3A 3PD9A 3E9XA 2R6GE 2CZLA 3E79A 1ZMGA 1LFHA 1B32A 4NF5A 3B6TA 1LBWA 2P2AA 1MQDA 1M5BA 3SEWA 4U4SA 2AIXA 2GH9A 3KN8A 1A99A 3TCHA 1NMUA 1M5CA 1JW4A 3FASA 4F2OA 4PGPA 3DP6A 1UQWA 3PPQA 4GVOA 5CMCA 3BBRA 4R2BA 5DEXA 5LOMA 4KYDA 1B7ZA 4QFLA 5I59B 4F19A 1P1WA 5ICTA 4M4GA 4O94A 4EUOA 3UIFA 4R6YA 5I2KA 4LVQA 2QS3A 3A3UA 2KR0A 2FA7A 3RT6B 4KCCA 4PFIA 4MH5A 2OBGA 3VLVA 3MUQA 3Q27A 1S9TA 3EHUA 1RDZA 5EQ7A 2F6PA 1URSA 3H6UA 3U8QA 4YMAA 1B05A 5FBPA 4KYSA 4O8MA 1YTVA 1JEUA 3U1OA 1DSNA 1PDAA 2AL5A 5L9OA 1JEVA 4JDFA 3TYHA 4DCXA 2B65A 4AB6A 4BDRA 2Y7RA 4ZEFA 1NNFA 3VXCA 2I0CA 1FJ6A 3S9MC 4RXLA 3KC1A 3FXBA 4EF2A 3CG3A 3LC8A 2QSXA 3EF7A 4XIGQ 5FHMA 1PBPA 1XT8A 1FTKA 1BIYA 1FSAA 2NWJA 4OVPA 5DW8A 1OMPA 4XXUA 5HM4B 4JVDA 3TTKA 1AOVA 5A5LA 1O63A 2D21A 4RA1A 3PMVA 1EU8A 3K6VA 4UA8A 2H99A 4C0RA 1B1HA 4LZ7A 3TTRA 4OQOA 4PFBA 3PPPA 3BKIB 4PCDA 1EZPA 3E13X 2XXXA 1N76A 2DYXA 3C4MA 1N84A 3B50A 2Y7IA 1NV1A 2UVGA 2VP1A 5JTYA 3K0VA 3PUWE 1LCFA 3T0JA 4HE2A 3M3FA 2QVUA 3H4ZA 1SW4A 3K6XA 1JVYA 4IY6A 3N5LA 3MJNA 2V3UA 4QF9A 4YAHX 1R9QA 4F18A 4OXVA 3E78A 3TMGA 5EQ8A 1I6BA 5AA2B 1Y1ZA 3KZGA 4EF1A 4H8IA 1JW1A 3ECRA 1R1NA 3PUXE 5I59A 3MVYA 1S7YA 1NV6A 4HE0A 4KR5A 4GWZA 1URGA 1SQYA 3TTLA 3LR1A 1LAHE 3RUMA 3PUVE 5HBCA 2I3VA 4RK2A 2WYPA 2DWJA 1A8EA 1Q1KA 4G68B 1IXIA 2I4CA 2X7QA 1FPKA 3MW0A 2OX3A 1NUWA 1KA1A 1QUIA 4O7MA 3OOAA 4R74A 1AIVA 3K2DA 4NG7A 3RPWA 2R8TA 3O6GA 5IZ3B 2KQZA 4F22A 2REJA 1CE2A 2WKYA 3T9HB 4X1DA 1B9JA 3SZPA 1N7WA 4OWDA 3DLNA 4OEUA 2OWSA 4PAIA 1LSTA 3O2AA 1FTOA 4IO2A 1EYKA 5I5PA 2KLFA 4MJOA 1BK4A 1P1QA 2DOJA 4WEDA 4JVIA 4MEVA 3CSGA 3W9VA 3O6IA 3G3GA 1QGXA 1OLAA 4P47A 1MXVA 1B6HA 4PF8A 3VXBA 3FUZA 5IGAA 3MSTA 4PQJA 5I7IA 2XXYA 4NAPA 1F9BA 3D1RA 2PX1A 5HPQA 4PETA 2DE4A 1BP5A 1QUKA 3OELA 4TLMB 3QUFA 4H5FA 3RPLB 1A40A 3JZJA 3O6HA 4IO6A 4NHBA 4R9FA 2XWOA 4O3AA 1VE4A 4YKJA 5EQAA 3S9EA 5EHMA 2DWIA 1FPIA 4P0IA 4OVJA 5M2VA 2V25A 1PB7A 3UP9A 3IB2A 3TTMA 3A3CA 4P9KA 4P11A 4MFIA 1MY1A 1SBPA 3N6UA 5AA2A 2YJPA 2Y5LA 4R6KA 5AA4B 1JW5A 1J1NA 4IO5A 5K2XA 1AH5A 3IO4A 3HCQA 1Y3QA 1FTAA 1YPNA 2Q8MA 4YB6A 2DS9A 2RF1A 4POXA 5KDTB 2P0SA 1IIWA 3KG2A 3QIMA 4NTLA 4X04A 4G68A 4RYAA 3K00A 3I6VA 3MP6A 5ESYA 4NN3A 5H8NB 2THIA 3FIRA 3PPOA 2ZYOA 3U72A 2DXRA 4QFKA 2ZNUA 4O3BA 1JNFA 1Z7ME 4RJZA 3OXNA 4MIJA 1IMFA 1YCJA 2QMWA 2Z8FA 1IUDA 1MPCA 1B4ZA 3C32A 3UGWA 5IZ3A 1QVSA 1IXGA 5KCJB 3U92A 3PMWA 2G29A 1R9LA 3MPKA 1AL3A 2E1SA 4ZE8A 5AA2D 4YB7A 4MMPA 4NF6B 1P99A 3HO7A 2RKMA 3TZAA 2O7UA 2Q74A 2O84X 4H65A 4NWDA 1NUYA 3RTFB 3M3KA 1A7LA 5JEIA 2RINA 1Z7NE 5L9MA 1IZ1A 2H25A 4MLQA 3A29A 3USDA 3IB0A 2X7PA 4QFOA 1SI0A 1R6ZA 1I6AA 4OESA 5CM6A 1MH3A 1IITA 4GXSB 1I69A 4PFUA 4F1UA 3OMBA 3TUSA 3HV1A 3CVGA 3RPLA 4ZEBA 1B0HA 1B52A 1FQFA 3FD3A 1RKMA 4GWSA 2WBDA 5H8FB 2LAOA 4H0WA 2HHMA 3I3VA 2CZHA 3FBPA 2ZNSA 1NV2A 2H9BA 5EYHA 3PPNA 4OVRA 2QL3A 4RNSA 5H8SA 1B1XA 5CMKA 1GV8A 4GIZA 4F3BA 2CEYA 5FHOA 4XKPA 1P1OA 3DM0A 4GBWA 4FORA 4ZDMA 1FQAA 5AA4A 3GBBA 4N8GA 4Z7EA 4ECFA 3SEVA 4QRZA 1GR2A 4LP2B 4EDPA 3K6WA 1PB8A 3KEIA 3FVNA 3OENA 4OFJA 2XX7A 3MBPA 1UTBB 2RCAA 4EXLA 3VLWA 4PFTA 1LFIA 4G61A 5H8NA 3V89B 2UVIA 1KWHA 1DPPA 4YMBA 5I57B 2AYSA 2E0SA 4IY5A 1I6QA 2FIXA 1MXYA 1OQGA 1B4HA 4MAGA 1IEJA 4OTEA 2XWKA 1NV7A 2F34A 1FBDA 2P3NA 1II5A 2RC8A 1VR5A 4N15A 2F3DA 4TOZA 4ISUA 1G0HA 4Q8RA 4ND9A 4NF6A 4C1UA 4QHQA 1N3XA 2V93A 2ZYKA 4F3SA 1JVXA 2RC9A 2HZLA 4I3EA 3AXFA 2ONKE 1B7UA 3QUJA 2PT1A 1LCTA 3KOSA 3MYUA 5DT6A 3G3HA 3KN7A 5J1DA 1FBHA 1GGGA 1FTLA 4X9TA 4RPOA 2DXYA 3KJTA 1LLSA 1FPEA 1H76A 2QPQA 3VE1B 1UTHB 1ZLQA 4OFLA 1IQ7A 4PAFA 1RDYA 4P1LA 2IEEA 3CI8A 5H8FA 1A55A 2QS4A 1IXHA 3OD7A 4YKIA 4G77A 4JSDA 4JWXA 3BIHA 3UK4A 1KZ8A 3KJ7A 1OQHA 2F5XA 4IB2A 1B5IA 3S2VA 1B7HA 4U4XA 4HE1A 1MQGA 4N6PA 3TCFA 2CZKA 1NKXA 5B70A 3G7WA 4FECA 1A54A 4PP0A 4DZ1A 3KOTA 3CSBA 3HHGA 3KBRA 1OIBA 2Z8DA 3FV2A 4MF3A 4FAJA 5I58B 1UTBA 2CEXA 1NI9A 2F7CA 2QFLA 5DVJA 2WX9A 1M5FA 2F78A 2PMSA 2DVZA 4P56A 4DE8A 4PBQA 5I57A 1M5EA 2Z22A 1FJ9A 5IAIA 4FEDA 3SEUA 1FW0A 1N0TA 5DYHA 2Q2CA 2Z8EA 3V83A 4Q30B 1NFTA 1N7XA 2H5YA 2HZKA 3CHGA 1FBFA 1POY1 1FBPA 5DVIA 3H3GA 1LBZA 4EQ7A 3VLUA 4AQ4A 1FRPA 4E0WA 1VDWA 1ZU0A 2VT5A 1POTA 4GWXA 2XXRA 1N04A 2B3FA 5DTBA 3SEXA 3Q26A 5I84A 1LAFE 2B4MA 3SETA 2VD2A 3C36A 4QSDA 1QKAA 4I40A 2OZZA 1UIVA 4HS7A 4WKMA 3VDFA 3P7IA 2V3QA 3CRBA 3LBSA 4GF8A 2XX9A 3GYYA 1NNPA 4XFEA 2QRYA 4IO7A 4BLAA 1UTHA 4OZ9A 3EKIA 5I2NB 3OO9A 4DXBA 1SD3A 4KCDA 3F11A 4AS4A 2ALUA 5CC2A 5EHSA 3D4GA 4I8CA 2O69A 2CZIA 3GXAA 3ROJA 3K1MA 4JVCA 5JK4A 4NQ8A 5FHNA 2I4BA 4FJPA 4MCOA 1HSJA 2NXOA 5IM2A 4X48A 2QJEA 3PUYE 3JV9A 4ELQA 2F8DA 1AWBA 3GBAA 4QFPA 3PD8A 2R9JA 4DI3D 2RCBA 4IO4A 4RK9A 1IMAA 3H03A 3CG1A 1NV5A 4N17A 4TLLB 2OCUA 2XA5A 5I58A 3TODA 2Y7KA 3MAMA 4DXCA 4MNIA 1FTMA 1P1UA 1XOCA 3R7XA 4Q5TA 2IA4A 1FPJA 3FVOA 1D3KA 4IGTA 4OVQA 1JETA 4PF6A 4G8HA 3TQWA 4ELPA 4F1YA 3HSTA 3TFLA 2D3IA 2ZYMA 4TQUQ 4GFRA 2I48A 3S9LC 2Q2AA 1D9VA 2ESNA 2ZXTA 5FTHA 4U22A 3U65A 2VPNA 1SDXA 2P1SA 1PBQA 1WVJA 3D4CA 4JB7A 1EYJA 3BFUA 5A5XB 2ONRA 4NF0A 4NGUA 4ZS9A 5F24A 2YLNA 3FGSA 3C34A 4P8BA 3RT8A 2ZZVA 4U1ZA 4P0GA 4G2ZA 3VVFA 2F7BA 4OHNA 1OVBA 4OFOA 2I49A 3N26A 4GWOA 3IAZA 3TELA 4GWUA 3T22A 4H46A 2FYIA 4N8YA 3EHSA 5I2NA 4ESXA 5ISUA 5AA3A 4XTCQ 3MVXA 4MHFA 1RDXA 3SEYA 1XS5A 3MWBA 5CBSA 1QW0A 3IOWA 4NEDA 3O29A 2HAVA 3K02A 2GFEA 3ILUB 2DE3A 4DCYA 5DVFA 3THIA 1LBBA 2GHAA 3ZSFA 1OVTA 2ZMBA 3ODBA 2Y7PA 4EQBA 1B46A 2PFYA 4NE4A 1LBXA 3KSXA 3GLBA 2QVRA 5CI5A 5ET7A 5J16A 3UN6A 1K9ZA 3C33A 4BDQA 4Z0IA 1MPBA 2RC7A 1NH7A 1JQFA 4H67A 4YU0A 4ESWA 4KHZE 3SERA 3IORA 3PTYA 1GVCA 3TTNA 2O6AA 4XEQA 4DDDA 5L8DA 1MM7A 4WXJA 1NUXA 2PVUA 5IZZA 4LA9A 4QSEA 3TPAA 2NOOA 3UA8A 1FQCA 5T3JA 1LAXA 4IGRA 2XWVA 4EXKA 4F2QA 3K1NA 4OYVA 3IJOB 1DK4A 4DLDA 4F3GA 4DIGA 2XXKA 2UYEA 1MY0A 3FJMA 3R26A 2PCRA 3PPRA 4QSCA 3V5AA 4X1BA 3CFLA 1URDA 1TFAA 2XD2A 1NV4A 4GOTA 4THIA 3W9WA 4KPTA 2NUVA 1USYE
chains in the Genus database with same CATH topology
5ET6A 1JP4A 2QPQA 2FIEA 4N6DA 4NX1A 4PAFA 4AS5A 4H45A 1RDYA 2JJKA 1NV6A 4P1LA 4HE0A 3B8BA 2VPOA 1IMCA 2ZZWA 1YZ0A 4GWZA 4HXVA 4GX6A 4YZZA 4N4UA 1IMBA 1LEVA 4X8RA 3IFCA 2XWIA 1KA0A 3BIHA 2WYPA 1KZ8A 2F5XA 2FBPA 4PDHA 4HE1A 2DE2A 4UABA 1FPKA 1YXIA 2CZKA 1NUWA 1KA1A 2OX3A 4O7MA 1EYIA 4QXDA 4NG7A 2R8TA 2DDKA 5IZ3B 2KQZA 3NOHA 1FBEA 1SPIA 2CEXA 1NI9A 1YYZA 2QFLA 4IR8A 2WX9A 2BJIA 4MX6A 2GQ1A 4PE3A 2B4LA 3SZPA 4OANA 2DVZA 4P56A 1FPDA 4PAIA 4PBQA 1IMDA 1FBCA 1EYKA 1FJ9A 5I5PA 4MJOA 4F1VA 4GWWA 1BK4A 4JVIA 4MEVA 4N6KA 3W9VA 4MNCA 4P3LA 1QGXA 4P47A 3CHGA 2HZKA 1INPA 5LTCA 4PF8A 1FBFA 5IGAA 3MSTA 5I7IA 4NAPA 1FBPA 3D1RA 1Q9DA 3HFUA 5I3SA 1LBZA 4PETA 2DE4A 1FRPA 1VDWA 2OWZA 2VT5A 4PTKA 4GWXA 3RPLB 4HCWA 4NHBA 2XWOA 2B4MA 2Q9TA 5EQAA 4I40A 1FPIA 1CNQA 4GX3A 4O7IA 4GWYA 2P3VA 2V3QA 2FVZA 4P9KA 4QBAA 3GYYA 4XFEA 1G0IA 1FBGA 2HPGA 5LDZA 2Y5LA 3EKIA 1LBVA 4PDDA 4DI4B 4AS4A 4PFRA 1FTAA 2Q8MA 2CZIA 4XF5A 4N81A 3KC0A 4YICA 5ET5A 3ROJA 4JVCA 5JK4A 4NQ8A 5EQ9A 4MCOA 1D9QA 1FPFA 4OVSA 4X04A 2QVVA 4LN5A 1FPBA 5IM2A 5ESYA 4NN3A 1AWBA 2V4CA 4KXPA 4DI3D 4MIJA 1IMAA 1IMFA 4PAKA 4OVTA 1NV5A 2WYKA 2ZZXA 4N17A 1IMEA 5IZ3A 2XA5A 5EYGA 4MNIA 4M1VA 1FPJA 4MMPA 1K9YA 4OVQA 4PF6A 2F3BA 2Y5KA 3QMFA 2Q74A 4MNPA 4I3YA 2L5VA 5ET8A 4GBVA 3E79A 1NUYA 1LBYA 1LBWA 4PC9A 3A29A 3U65A 2VPNA 1NUZA 3ISPA 2PFZA 5CM6A 4PGPA 1EYJA 4F1UA 3BIGA 3RPLA 4NF0A 1DCUA 4NGUA 5F24A 4P8BA 4F19A 2ZZVA 4GWSA 2WBDA 1DBZA 4O94A 2HHMA 4GX4A 2CZHA 2KR0A 3FBPA 2HXRA 1NV2A 5EYHA 2WBBA 4FBPA 4PFIA 4OVRA 1RDZA 4GWUA 5EQ7A 2CEYA 1FPLA 4H46A 4GBWA 4N8YA 5FBPA 4O8MA 4N8GA 4MHFA 4P1EA 1RDXA 4OA4A 2WEFA 1NV0A 2DE3A 1FJ6A 4G61A 5IZ1A 3KC1A 3FXBA 2MKZA 4N91A 1FSAA 4PGNA 2FIXA 4OVPA 4PBHA 5DW8A 4MAGA 2PFYA 4JVDA 1LBXA 5A5LA 2QVRA 2XWKA 1NV7A 5ET7A 5J16A 1FBDA 2P3NA 1K9ZA 4N15A 2F3DA 1FPGA 4PFBA 1NV3A 1G0HA 4PCDA 3PTYA 4XEQA 3B50A 1NV1A 1NUXA 5IZZA 5T3JA 2XWVA 4HCYA 3RYDA 4I3EA 2HZLA 3T0JA 1DK4A 4HE2A 2QVUA 2FHYA 3LV0A 2XXKA 3LUZA 2PCRA 3MYUA 5J1DA 1NV4A 1FBHA 1XI6A 3T1BA 3KBZA 3W9WA 4F18A 3IFAA 4X9TA 3E78A 5EQ8A 1FPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMA A;  1IMF A;  5ET6 A;  1JP4 A;  1FBP A;  2FIE A;  3D1R A;  1Q9D A;  1RDX A;  1NV5 A;  5I3S A;  1LBZ A;  1IME A;  5IZ3 A;  1FRP A;  5EYG A;  4AS5 A;  4H45 A;  2WEF A;  1VDW A;  1NV0 A;  1RDY A;  2JJK A;  1NV6 A;  2OWZ A;  4HE0 A;  1FPJ A;  2VT5 A;  3B8B A;  4PTK A;  4GWX A;  1IMC A;  1K9Y A;  3RPL B;  1YZ0 A;  4GWZ A;  4HXV A;  4GX6 A;  2F3B A;  2Y5K A;  1IMB A;  3QMF A;  2Q74 A;  1FJ6 A;  1LEV A;  4I3Y A;  3IFC A;  5EQA A;  5ET8 A;  4G61 A;  4I40 A;  1KA0 A;  5IZ1 A;  3BIH A;  3KC1 A;  1FPI A;  1KZ8 A;  4GBV A;  1CNQ A;  1NUY A;  2FBP A;  4GX3 A;  4O7I A;  1LBY A;  1LBW A;  4GWY A;  1FSA A;  2P3V A;  2FIX A;  4HE1 A;  2FVZ A;  5DW8 A;  1FPK A;  3A29 A;  1LBX A;  5A5L A;  2QVR A;  1G0I A;  1NV7 A;  1YXI A;  1FBG A;  5ET7 A;  2CZK A;  1NUW A;  1FBD A;  1KA1 A;  2OX3 A;  1K9Z A;  2P3N A;  2Y5L A;  5LDZ A;  1EYI A;  1NUZ A;  2F3D A;  1FPG A;  1LBV A;  4QXD A;  1NV3 A;  1EYJ A;  2R8T A;  1G0H A;  2DDK A;  3BIG A;  4AS4 A;  5IZ3 B;  3RPL A;  1FTA A;  1DCU A;  1FBE A;  1SPI A;  2Q8M A;  5F24 A;  2CZI A;  1NV1 A;  1NUX A;  4N81 A;  3KC0 A;  1NI9 A;  1YYZ A;  2QFL A;  4IR8 A;  2BJI A;  2GQ1 A;  4GWS A;  5ET5 A;  5T3J A;  3ROJ A;  2WBD A;  1DBZ A;  5EQ9 A;  3RYD A;  1FPD A;  4I3E A;  2HHM A;  1D9Q A;  1DK4 A;  1FPF A;  4HE2 A;  4GX4 A;  3T0J A;  2QVV A;  2QVU A;  1IMD A;  2CZH A;  1FBC A;  1EYK A;  1FJ9 A;  2FHY A;  3LV0 A;  4MJO A;  1FPB A;  3FBP A;  4GWW A;  3LUZ A;  1BK4 A;  1NV2 A;  5ESY A;  5EYH A;  2WBB A;  2PCR A;  4FBP A;  1QGX A;  1AWB A;  1NV4 A;  1FBH A;  1XI6 A;  5J16 A;  1INP A;  1RDZ A;  4GWU A;  5EQ7 A;  3KBZ A;  4KXP A;  1FPL A;  3IFA A;  4H46 A;  4GBW A;  5EQ8 A;  5FBP A;  1FBF A;  1FPE A; 
#chains in the Genus database with same CATH topology
 5ET6 A;  2Q88 A;  2HEU A;  3C9H A;  2FIE A;  4NX1 A;  3IO6 A;  5A5X A;  4YKP A;  4AS5 A;  5ITP A;  4EQ9 A;  3PU5 A;  3DP8 A;  2VPO A;  1IMC A;  2GHB A;  2ZZW A;  5H8Q B;  1YZ0 A;  2ABH A;  4HXV A;  2XXP A;  4YZZ A;  3SES A;  1QKB A;  1LEV A;  1QUL A;  4X8R A;  3S4U A;  3IFC A;  2XWI A;  1B58 A;  3MZB A;  3EQ1 A;  3KSJ A;  3O9P A;  1M5D A;  3ILT B;  1IXC A;  5KDT A;  2DE2 A;  4O3C A;  4R72 A;  4C1T A;  1H3D A;  2XX8 A;  3OEM A;  4LAT A;  4LQ5 A;  1B3F A;  1US4 A;  4QXD A;  2QMX A;  4H5G A;  2PT2 A;  4R2F A;  1SI1 A;  3H6T A;  2ZYN A;  2BJJ X;  3NOH A;  1FBE A;  1SPI A;  3W15 C;  4ZEC A;  1YYZ A;  1A8F A;  1Y9U A;  3MP1 A;  2GQ1 A;  4JBZ A;  2A5T B;  4OAN A;  4LQ2 A;  4G4P A;  3H06 B;  1P1N A;  1MG1 A;  1IMD A;  5KCJ A;  1FBC A;  2UVJ A;  4F1V A;  4GWW A;  2D5W A;  3TDJ A;  3N6T A;  4P3L A;  3FAT A;  3QAX A;  3V8X B;  4H1X A;  4JWO A;  4KYE A;  2GRV A;  1B40 A;  2REG A;  4NMY A;  1SYH A;  3OSQ A;  3QK6 A;  1Q9D A;  3HFU A;  5I3S A;  3IL1 B;  2R71 A;  4G8N A;  1TXF A;  2V84 A;  2HFB A;  1DTZ A;  3K4U A;  1OLC A;  2O51 A;  3CFX A;  1TFD A;  2I3W A;  4OET A;  3KN3 A;  1MXX A;  1YAE A;  4N13 A;  3OO7 A;  4NWC A;  3MPL A;  2HQ0 A;  2VD3 A;  1CNQ A;  1B3E A;  4R6H A;  4KFQ A;  4GX3 A;  4O7I A;  2FVZ A;  2PBW A;  2XXQ A;  3H6W A;  1EZO A;  2XXT A;  1MDQ A;  1G0I A;  3MC2 A;  2HPG A;  3FZV A;  4G8M A;  5LDZ A;  1T0K A;  1LBV A;  1O64 A;  1LGB C;  1Y4C A;  2AL4 A;  3L6G A;  3ZS6 A;  4PDD A;  2M8C A;  1USY H;  5FTI A;  1MY3 A;  3IOU A;  2HCA A;  4PFR A;  1VFD A;  5H8Q A;  5ITO A;  5H8H B;  2XXV A;  4XF5 A;  3KC0 A;  3FV1 A;  1DPE A;  4GRK A;  4YIC A;  5ET5 A;  1HSE A;  1PC3 A;  5EQ9 A;  3ZKK A;  2QVV A;  3U94 A;  1EH3 A;  1FPB A;  5TU0 A;  4LUB A;  1N3W A;  2W7Y A;  3CFZ A;  5ICQ A;  4K3F A;  3K6U A;  2VHA A;  3RNN A;  3S9N C;  4ELO A;  3RQT A;  4U21 A;  4KXP A;  3Q28 A;  3VV5 A;  2O1L A;  3VVD A;  1TWY A;  1WDN A;  3BFT A;  3G3J A;  2UYF A;  3O97 A;  4FAT A;  1IME A;  1B2H A;  3MVW A;  1BKA A;  4BDO A;  5EYG A;  4BDN A;  3EHT A;  5F7V A;  3FVG A;  3IJX B;  3IK6 B;  2A5T A;  1K9Y A;  1EZ9 A;  1BTJ A;  3FVK A;  2O68 A;  2F3B A;  4JXI A;  4FEB A;  5TP9 B;  3QMF A;  4MNP A;  4H8J A;  3RLF E;  4I3Y A;  2L5V A;  5ET8 A;  1MM6 A;  3T66 A;  2NVU B;  3H6V A;  4GBV A;  1MXU A;  2V3T A;  1LBY A;  2PYY A;  1MQJ A;  3EPE A;  4GQO A;  4PC9 A;  3IR1 A;  4I62 A;  5EYF A;  2O1M A;  3IB1 A;  2F35 A;  1NUZ A;  4PFY A;  3ISP A;  2PFZ A;  3LSW A;  4KD5 A;  4XKQ A;  3T9U A;  5I56 B;  3BIG A;  3T93 B;  1LB9 A;  1O7T A;  1DCU A;  4E0X A;  1FTJ A;  2XXI A;  3WAF A;  1DBZ A;  1UIU A;  4ZEK A;  1ZTY A;  4R75 A;  4L17 A;  3LSL A;  4GX4 A;  2XXH A;  3B6Q A;  3K01 A;  5KZT A;  4BDM A;  2I0B A;  2OJT A;  2HXR A;  4RPN A;  3SKP A;  2WBB A;  1MY4 A;  4IO3 A;  4FBP A;  4FE8 A;  4JWY A;  1HSL A;  3QSL A;  5TPA B;  1PB9 A;  4AB5 A;  3JYR A;  2HAU A;  3PUZ E;  2VGQ A;  1FQB A;  1FPL A;  4HTG A;  4H6D A;  4YKK A;  4U23 A;  3QYT A;  4MLV A;  1H45 A;  4P1E A;  2H98 A;  4OA4 A;  4OEV A;  1MQI A;  3C31 A;  5H8H A;  2WEF A;  3HHF A;  3T9V A;  1NV0 A;  1NNK A;  1LFG A;  4HW8 A;  3GZG A;  3B6W A;  1AMF A;  4RY1 A;  3LSF B;  2HXW A;  3O66 A;  3H7M A;  5IZ1 A;  1XVX A;  2MKZ A;  3RN8 A;  4N91 A;  3OO6 A;  3C35 A;  1B5H A;  2OPD A;  1ANF A;  1D9Y A;  2XXW A;  3FXQ A;  4PGN A;  4PBH A;  3MP8 A;  4POW A;  3CIJ A;  2Z23 A;  4NF8 B;  4R73 A;  4KQP A;  1H44 A;  1FPG A;  5CMB A;  1B3L A;  3HN0 A;  3K1P A;  3TEP A;  1NV3 A;  1DTG A;  1SW1 A;  1MPD A;  2F7A A;  5TP9 A;  1RYO A;  3UOR A;  3G3K A;  4HCY A;  2ZNT A;  3IOV A;  3RYD A;  2XHD A;  2FHY A;  4LZ8 A;  4ZED A;  3LV0 A;  1S50 A;  3RY3 A;  3LUZ A;  3A09 A;  2F36 A;  5B7D A;  3T96 B;  2UVH A;  2Q89 A;  3DEL B;  3DP4 A;  1XC1 A;  1SYI A;  1ELJ A;  3OO8 A;  3VVE A;  4ZZE A;  3T1B A;  1XI6 A;  3Q25 A;  3KBZ A;  3IFA A;  5CMM A;  1JP4 A;  1ZIU A;  4R9G A;  5I56 A;  4N6D A;  1DOT A;  2DSF A;  5IKB A;  1Y3P A;  4PE5 B;  4DXU A;  1Y4T A;  2F97 A;  4H45 A;  5CRY A;  4YB5 A;  2JJK A;  3KFM A;  3I5O A;  4F29 A;  3B8B A;  4GLI A;  4U2R A;  4UAC A;  4OER A;  1H43 A;  4GX6 A;  4ZEI A;  4N4U A;  3MZ1 A;  1LAG E;  1IMB A;  2QS2 A;  4NF4 B;  1L5T A;  2OPE A;  1MXW A;  2VOZ A;  4N07 A;  1B3H A;  1MY2 A;  2ONS A;  1KA0 A;  4MBP A;  3E4R A;  1ZKB A;  1ZBM A;  5TPA A;  2FBP A;  3FJG A;  3RGY A;  1CB6 A;  3TAJ A;  2B3B A;  2YPN A;  4PDH A;  2O7I A;  1FCK A;  4UAB A;  4I1D A;  3SDF A;  1YXI A;  4OMB A;  1VFE A;  2DWH A;  1EYI A;  1WOD A;  1PEB A;  2Y84 A;  3ZKL A;  1SW5 A;  2I58 A;  4BDL A;  2DDK A;  4XKR A;  1MXZ A;  1Y20 A;  4JSO A;  1D4N A;  1LB8 A;  4WEP A;  3OSR A;  4IR8 A;  4MX6 A;  2BJI A;  4F31 B;  4PE3 A;  2QS1 A;  2B4L A;  5L9S A;  1SW2 A;  3M3L A;  1FPD A;  3Q29 A;  3G3I A;  5F1Q A;  1QUJ A;  1Q35 A;  4XKN A;  1MH4 A;  3O28 A;  3IX1 A;  4N6K A;  4MNC A;  1B3G A;  4U1O A;  1Y1M A;  2DWA A;  3MZ9 A;  4NF5 B;  4KI0 E;  4NF8 A;  4F3P A;  1INP A;  5LTC A;  1SVX B;  4ZE9 A;  5BWJ A;  3TKD A;  1FQD A;  5AE4 A;  2FNC A;  1LBC A;  2OLB A;  4FIM A;  3FJ7 A;  3HPI A;  3PV0 E;  2OWZ A;  3M8U A;  4PTK A;  5DEX B;  3PMX A;  4ONY A;  1B0L A;  4HCW A;  2X26 A;  2A5S A;  1RYX A;  2G93 A;  2H4I A;  2DP8 A;  2Q9T A;  2XXU A;  1GTK A;  2DVC A;  4GD5 A;  1XHY A;  2ANJ A;  3VFJ A;  5I2K B;  2OWT A;  1DMB A;  3N94 A;  4G68 C;  4GWY A;  4ZZA A;  1MRP A;  2P3V A;  4PFW A;  1B51 A;  3PGF A;  4QFN A;  3QXM A;  4QBA A;  1MS7 A;  4Q0C A;  3MVZ A;  3LSX A;  1TT1 A;  1FBG A;  2DQV A;  3LUY A;  5BUU A;  4GL8 A;  5K2Y A;  3L6H A;  4DI4 B;  1QJM A;  3TQL A;  5ELV A;  3U93 A;  1MDP 1;  4N81 A;  2CMO A;  3CR9 A;  4NF4 A;  2F6G A;  1ZJL A;  3MQ9 A;  5AA1 A;  4F39 A;  1NL5 A;  1D9Q A;  1BLF A;  1FPF A;  4OVS A;  4LZ5 A;  3OEK A;  2I6E A;  3T9X B;  4LN5 A;  3IOT A;  3G3F A;  4GXA A;  3RTW B;  1NH8 A;  2V4C A;  1FQE A;  2Y7W A;  1MQH A;  3B7D A;  1XVY A;  3KGC A;  4I9D A;  4PAK A;  1US5 A;  4OEN A;  4OVT A;  1ATG A;  1NNT A;  2WYK A;  2ZZX A;  3FXR A;  2XD3 A;  1Y3N A;  3E3K A;  3R6U A;  1VSO A;  5CBR A;  4M1V A;  4LON B;  3TCG A;  3ONM A;  2Q8J A;  2OK2 A;  3FXU A;  2UXA A;  1B5J A;  3WAE A;  2Y5K A;  4GL0 A;  5JTY B;  4ELR A;  3EN3 A;  3PD9 A;  3E9X A;  2R6G E;  2CZL A;  3E79 A;  1ZMG A;  1LFH A;  1B32 A;  4NF5 A;  3B6T A;  1LBW A;  2P2A A;  1MQD A;  1M5B A;  3SEW A;  4U4S A;  2AIX A;  2GH9 A;  3KN8 A;  1A99 A;  3TCH A;  1NMU A;  1M5C A;  1JW4 A;  3FAS A;  4F2O A;  4PGP A;  3DP6 A;  1UQW A;  3PPQ A;  4GVO A;  5CMC A;  3BBR A;  4R2B A;  5DEX A;  5LOM A;  4KYD A;  1B7Z A;  4QFL A;  5I59 B;  4F19 A;  1P1W A;  5ICT A;  4M4G A;  4O94 A;  4EUO A;  3UIF A;  4R6Y A;  5I2K A;  4LVQ A;  2QS3 A;  3A3U A;  2KR0 A;  2FA7 A;  3RT6 B;  4KCC A;  4PFI A;  4MH5 A;  2OBG A;  3VLV A;  3MUQ A;  3Q27 A;  1S9T A;  3EHU A;  1RDZ A;  5EQ7 A;  2F6P A;  1URS A;  3H6U A;  3U8Q A;  4YMA A;  1B05 A;  5FBP A;  4KYS A;  4O8M A;  1YTV A;  1JEU A;  3U1O A;  1DSN A;  1PDA A;  2AL5 A;  5L9O A;  1JEV A;  4JDF A;  3TYH A;  4DCX A;  2B65 A;  4AB6 A;  4BDR A;  2Y7R A;  4ZEF A;  1NNF A;  3VXC A;  2I0C A;  1FJ6 A;  3S9M C;  4RXL A;  3KC1 A;  3FXB A;  4EF2 A;  3CG3 A;  3LC8 A;  2QSX A;  3EF7 A;  4XIG Q;  5FHM A;  1PBP A;  1XT8 A;  1FTK A;  1BIY A;  1FSA A;  2NWJ A;  4OVP A;  5DW8 A;  1OMP A;  4XXU A;  5HM4 B;  4JVD A;  3TTK A;  1AOV A;  5A5L A;  1O63 A;  2D21 A;  4RA1 A;  3PMV A;  1EU8 A;  3K6V A;  4UA8 A;  2H99 A;  4C0R A;  1B1H A;  4LZ7 A;  3TTR A;  4OQO A;  4PFB A;  3PPP A;  3BKI B;  4PCD A;  1EZP A;  3E13 X;  2XXX A;  1N76 A;  2DYX A;  3C4M A;  1N84 A;  3B50 A;  2Y7I A;  1NV1 A;  2UVG A;  2VP1 A;  5JTY A;  3K0V A;  3PUW E;  1LCF A;  3T0J A;  4HE2 A;  3M3F A;  2QVU A;  3H4Z A;  1SW4 A;  3K6X A;  1JVY A;  4IY6 A;  3N5L A;  3MJN A;  2V3U A;  4QF9 A;  4YAH X;  1R9Q A;  4F18 A;  4OXV A;  3E78 A;  3TMG A;  5EQ8 A;  1I6B A;  5AA2 B;  1Y1Z A;  3KZG A;  4EF1 A;  4H8I A;  1JW1 A;  3ECR A;  1R1N A;  3PUX E;  5I59 A;  3MVY A;  1S7Y A;  1NV6 A;  4HE0 A;  4KR5 A;  4GWZ A;  1URG A;  1SQY A;  3TTL A;  3LR1 A;  1LAH E;  3RUM A;  3PUV E;  5HBC A;  2I3V A;  4RK2 A;  2WYP A;  2DWJ A;  1A8E A;  1Q1K A;  4G68 B;  1IXI A;  2I4C A;  2X7Q A;  1FPK A;  3MW0 A;  2OX3 A;  1NUW A;  1KA1 A;  1QUI A;  4O7M A;  3OOA A;  4R74 A;  1AIV A;  3K2D A;  4NG7 A;  3RPW A;  2R8T A;  3O6G A;  5IZ3 B;  2KQZ A;  4F22 A;  2REJ A;  1CE2 A;  2WKY A;  3T9H B;  4X1D A;  1B9J A;  3SZP A;  1N7W A;  4OWD A;  3DLN A;  4OEU A;  2OWS A;  4PAI A;  1LST A;  3O2A A;  1FTO A;  4IO2 A;  1EYK A;  5I5P A;  2KLF A;  4MJO A;  1BK4 A;  1P1Q A;  2DOJ A;  4WED A;  4JVI A;  4MEV A;  3CSG A;  3W9V A;  3O6I A;  3G3G A;  1QGX A;  1OLA A;  4P47 A;  1MXV A;  1B6H A;  4PF8 A;  3VXB A;  3FUZ A;  5IGA A;  3MST A;  4PQJ A;  5I7I A;  2XXY A;  4NAP A;  1F9B A;  3D1R A;  2PX1 A;  5HPQ A;  4PET A;  2DE4 A;  1BP5 A;  1QUK A;  3OEL A;  4TLM B;  3QUF A;  4H5F A;  3RPL B;  1A40 A;  3JZJ A;  3O6H A;  4IO6 A;  4NHB A;  4R9F A;  2XWO A;  4O3A A;  1VE4 A;  4YKJ A;  5EQA A;  3S9E A;  5EHM A;  2DWI A;  1FPI A;  4P0I A;  4OVJ A;  5M2V A;  2V25 A;  1PB7 A;  3UP9 A;  3IB2 A;  3TTM A;  3A3C A;  4P9K A;  4P11 A;  4MFI A;  1MY1 A;  1SBP A;  3N6U A;  5AA2 A;  2YJP A;  2Y5L A;  4R6K A;  5AA4 B;  1JW5 A;  1J1N A;  4IO5 A;  5K2X A;  1AH5 A;  3IO4 A;  3HCQ A;  1Y3Q A;  1FTA A;  1YPN A;  2Q8M A;  4YB6 A;  2DS9 A;  2RF1 A;  4POX A;  5KDT B;  2P0S A;  1IIW A;  3KG2 A;  3QIM A;  4NTL A;  4X04 A;  4G68 A;  4RYA A;  3K00 A;  3I6V A;  3MP6 A;  5ESY A;  4NN3 A;  5H8N B;  2THI A;  3FIR A;  3PPO A;  2ZYO A;  3U72 A;  2DXR A;  4QFK A;  2ZNU A;  4O3B A;  1JNF A;  1Z7M E;  4RJZ A;  3OXN A;  4MIJ A;  1IMF A;  1YCJ A;  2QMW A;  2Z8F A;  1IUD A;  1MPC A;  1B4Z A;  3C32 A;  3UGW A;  5IZ3 A;  1QVS A;  1IXG A;  5KCJ B;  3U92 A;  3PMW A;  2G29 A;  1R9L A;  3MPK A;  1AL3 A;  2E1S A;  4ZE8 A;  5AA2 D;  4YB7 A;  4MMP A;  4NF6 B;  1P99 A;  3HO7 A;  2RKM A;  3TZA A;  2O7U A;  2Q74 A;  2O84 X;  4H65 A;  4NWD A;  1NUY A;  3RTF B;  3M3K A;  1A7L A;  5JEI A;  2RIN A;  1Z7N E;  5L9M A;  1IZ1 A;  2H25 A;  4MLQ A;  3A29 A;  3USD A;  3IB0 A;  2X7P A;  4QFO A;  1SI0 A;  1R6Z A;  1I6A A;  4OES A;  5CM6 A;  1MH3 A;  1IIT A;  4GXS B;  1I69 A;  4PFU A;  4F1U A;  3OMB A;  3TUS A;  3HV1 A;  3CVG A;  3RPL A;  4ZEB A;  1B0H A;  1B52 A;  1FQF A;  3FD3 A;  1RKM A;  4GWS A;  2WBD A;  5H8F B;  2LAO A;  4H0W A;  2HHM A;  3I3V A;  2CZH A;  3FBP A;  2ZNS A;  1NV2 A;  2H9B A;  5EYH A;  3PPN A;  4OVR A;  2QL3 A;  4RNS A;  5H8S A;  1B1X A;  5CMK A;  1GV8 A;  4GIZ A;  4F3B A;  2CEY A;  5FHO A;  4XKP A;  1P1O A;  3DM0 A;  4GBW A;  4FOR A;  4ZDM A;  1FQA A;  5AA4 A;  3GBB A;  4N8G A;  4Z7E A;  4ECF A;  3SEV A;  4QRZ A;  1GR2 A;  4LP2 B;  4EDP A;  3K6W A;  1PB8 A;  3KEI A;  3FVN A;  3OEN A;  4OFJ A;  2XX7 A;  3MBP A;  1UTB B;  2RCA A;  4EXL A;  3VLW A;  4PFT A;  1LFI A;  4G61 A;  5H8N A;  3V89 B;  2UVI A;  1KWH A;  1DPP A;  4YMB A;  5I57 B;  2AYS A;  2E0S A;  4IY5 A;  1I6Q A;  2FIX A;  1MXY A;  1OQG A;  1B4H A;  4MAG A;  1IEJ A;  4OTE A;  2XWK A;  1NV7 A;  2F34 A;  1FBD A;  2P3N A;  1II5 A;  2RC8 A;  1VR5 A;  4N15 A;  2F3D A;  4TOZ A;  4ISU A;  1G0H A;  4Q8R A;  4ND9 A;  4NF6 A;  4C1U A;  4QHQ A;  1N3X A;  2V93 A;  2ZYK A;  4F3S A;  1JVX A;  2RC9 A;  2HZL A;  4I3E A;  3AXF A;  2ONK E;  1B7U A;  3QUJ A;  2PT1 A;  1LCT A;  3KOS A;  3MYU A;  5DT6 A;  3G3H A;  3KN7 A;  5J1D A;  1FBH A;  1GGG A;  1FTL A;  4X9T A;  4RPO A;  2DXY A;  3KJT A;  1LLS A;  1FPE A;  1H76 A;  2QPQ A;  3VE1 B;  1UTH B;  1ZLQ A;  4OFL A;  1IQ7 A;  4PAF A;  1RDY A;  4P1L A;  2IEE A;  3CI8 A;  5H8F A;  1A55 A;  2QS4 A;  1IXH A;  3OD7 A;  4YKI A;  4G77 A;  4JSD A;  4JWX A;  3BIH A;  3UK4 A;  1KZ8 A;  3KJ7 A;  1OQH A;  2F5X A;  4IB2 A;  1B5I A;  3S2V A;  1B7H A;  4U4X A;  4HE1 A;  1MQG A;  4N6P A;  3TCF A;  2CZK A;  1NKX A;  5B70 A;  3G7W A;  4FEC A;  1A54 A;  4PP0 A;  4DZ1 A;  3KOT A;  3CSB A;  3HHG A;  3KBR A;  1OIB A;  2Z8D A;  3FV2 A;  4MF3 A;  4FAJ A;  5I58 B;  1UTB A;  2CEX A;  1NI9 A;  2F7C A;  2QFL A;  5DVJ A;  2WX9 A;  1M5F A;  2F78 A;  2PMS A;  2DVZ A;  4P56 A;  4DE8 A;  4PBQ A;  5I57 A;  1M5E A;  2Z22 A;  1FJ9 A;  5IAI A;  4FED A;  3SEU A;  1FW0 A;  1N0T A;  5DYH A;  2Q2C A;  2Z8E A;  3V83 A;  4Q30 B;  1NFT A;  1N7X A;  2H5Y A;  2HZK A;  3CHG A;  1FBF A;  1POY 1;  1FBP A;  5DVI A;  3H3G A;  1LBZ A;  4EQ7 A;  3VLU A;  4AQ4 A;  1FRP A;  4E0W A;  1VDW A;  1ZU0 A;  2VT5 A;  1POT A;  4GWX A;  2XXR A;  1N04 A;  2B3F A;  5DTB A;  3SEX A;  3Q26 A;  5I84 A;  1LAF E;  2B4M A;  3SET A;  2VD2 A;  3C36 A;  4QSD A;  1QKA A;  4I40 A;  2OZZ A;  1UIV A;  4HS7 A;  4WKM A;  3VDF A;  3P7I A;  2V3Q A;  3CRB A;  3LBS A;  4GF8 A;  2XX9 A;  3GYY A;  1NNP A;  4XFE A;  2QRY A;  4IO7 A;  4BLA A;  1UTH A;  4OZ9 A;  3EKI A;  5I2N B;  3OO9 A;  4DXB A;  1SD3 A;  4KCD A;  3F11 A;  4AS4 A;  2ALU A;  5CC2 A;  5EHS A;  3D4G A;  4I8C A;  2O69 A;  2CZI A;  3GXA A;  3ROJ A;  3K1M A;  4JVC A;  5JK4 A;  4NQ8 A;  5FHN A;  2I4B A;  4FJP A;  4MCO A;  1HSJ A;  2NXO A;  5IM2 A;  4X48 A;  2QJE A;  3PUY E;  3JV9 A;  4ELQ A;  2F8D A;  1AWB A;  3GBA A;  4QFP A;  3PD8 A;  2R9J A;  4DI3 D;  2RCB A;  4IO4 A;  4RK9 A;  1IMA A;  3H03 A;  3CG1 A;  1NV5 A;  4N17 A;  4TLL B;  2OCU A;  2XA5 A;  5I58 A;  3TOD A;  2Y7K A;  3MAM A;  4DXC A;  4MNI A;  1FTM A;  1P1U A;  1XOC A;  3R7X A;  4Q5T A;  2IA4 A;  1FPJ A;  3FVO A;  1D3K A;  4IGT A;  4OVQ A;  1JET A;  4PF6 A;  4G8H A;  3TQW A;  4ELP A;  4F1Y A;  3HST A;  3TFL A;  2D3I A;  2ZYM A;  4TQU Q;  4GFR A;  2I48 A;  3S9L C;  2Q2A A;  1D9V A;  2ESN A;  2ZXT A;  5FTH A;  4U22 A;  3U65 A;  2VPN A;  1SDX A;  2P1S A;  1PBQ A;  1WVJ A;  3D4C A;  4JB7 A;  1EYJ A;  3BFU A;  5A5X B;  2ONR A;  4NF0 A;  4NGU A;  4ZS9 A;  5F24 A;  2YLN A;  3FGS A;  3C34 A;  4P8B A;  3RT8 A;  2ZZV A;  4U1Z A;  4P0G A;  4G2Z A;  3VVF A;  2F7B A;  4OHN A;  1OVB A;  4OFO A;  2I49 A;  3N26 A;  4GWO A;  3IAZ A;  3TEL A;  4GWU A;  3T22 A;  4H46 A;  2FYI A;  4N8Y A;  3EHS A;  5I2N A;  4ESX A;  5ISU A;  5AA3 A;  4XTC Q;  3MVX A;  4MHF A;  1RDX A;  3SEY A;  1XS5 A;  3MWB A;  5CBS A;  1QW0 A;  3IOW A;  4NED A;  3O29 A;  2HAV A;  3K02 A;  2GFE A;  3ILU B;  2DE3 A;  4DCY A;  5DVF A;  3THI A;  1LBB A;  2GHA A;  3ZSF A;  1OVT A;  2ZMB A;  3ODB A;  2Y7P A;  4EQB A;  1B46 A;  2PFY A;  4NE4 A;  1LBX A;  3KSX A;  3GLB A;  2QVR A;  5CI5 A;  5ET7 A;  5J16 A;  3UN6 A;  1K9Z A;  3C33 A;  4BDQ A;  4Z0I A;  1MPB A;  2RC7 A;  1NH7 A;  1JQF A;  4H67 A;  4YU0 A;  4ESW A;  4KHZ E;  3SER A;  3IOR A;  3PTY A;  1GVC A;  3TTN A;  2O6A A;  4XEQ A;  4DDD A;  5L8D A;  1MM7 A;  4WXJ A;  1NUX A;  2PVU A;  5IZZ A;  4LA9 A;  4QSE A;  3TPA A;  2NOO A;  3UA8 A;  1FQC A;  5T3J A;  1LAX A;  4IGR A;  2XWV A;  4EXK A;  4F2Q A;  3K1N A;  4OYV A;  3IJO B;  1DK4 A;  4DLD A;  4F3G A;  4DIG A;  2XXK A;  2UYE A;  1MY0 A;  3FJM A;  3R26 A;  2PCR A;  3PPR A;  4QSC A;  3V5A A;  4X1B A;  3CFL A;  1URD A;  1TFA A;  2XD2 A;  1NV4 A;  4GOT A;  4THI A;  3W9W A;  4KPT A;  2NUV A;  1USY E; 
#chains in the Genus database with same CATH homology
 5ET6 A;  1JP4 A;  2QPQ A;  2FIE A;  4N6D A;  4NX1 A;  4PAF A;  4AS5 A;  4H45 A;  1RDY A;  2JJK A;  1NV6 A;  4P1L A;  4HE0 A;  3B8B A;  2VPO A;  1IMC A;  2ZZW A;  1YZ0 A;  4GWZ A;  4HXV A;  4GX6 A;  4YZZ A;  4N4U A;  1IMB A;  1LEV A;  4X8R A;  3IFC A;  2XWI A;  1KA0 A;  3BIH A;  2WYP A;  1KZ8 A;  2F5X A;  2FBP A;  4PDH A;  4HE1 A;  2DE2 A;  4UAB A;  1FPK A;  1YXI A;  2CZK A;  1NUW A;  1KA1 A;  2OX3 A;  4O7M A;  1EYI A;  4QXD A;  4NG7 A;  2R8T A;  2DDK A;  5IZ3 B;  2KQZ A;  3NOH A;  1FBE A;  1SPI A;  2CEX A;  1NI9 A;  1YYZ A;  2QFL A;  4IR8 A;  2WX9 A;  2BJI A;  4MX6 A;  2GQ1 A;  4PE3 A;  2B4L A;  3SZP A;  4OAN A;  2DVZ A;  4P56 A;  1FPD A;  4PAI A;  4PBQ A;  1IMD A;  1FBC A;  1EYK A;  1FJ9 A;  5I5P A;  4MJO A;  4F1V A;  4GWW A;  1BK4 A;  4JVI A;  4MEV A;  4N6K A;  3W9V A;  4MNC A;  4P3L A;  1QGX A;  4P47 A;  3CHG A;  2HZK A;  1INP A;  5LTC A;  4PF8 A;  1FBF A;  5IGA A;  3MST A;  5I7I A;  4NAP A;  1FBP A;  3D1R A;  1Q9D A;  3HFU A;  5I3S A;  1LBZ A;  4PET A;  2DE4 A;  1FRP A;  1VDW A;  2OWZ A;  2VT5 A;  4PTK A;  4GWX A;  3RPL B;  4HCW A;  4NHB A;  2XWO A;  2B4M A;  2Q9T A;  5EQA A;  4I40 A;  1FPI A;  1CNQ A;  4GX3 A;  4O7I A;  4GWY A;  2P3V A;  2V3Q A;  2FVZ A;  4P9K A;  4QBA A;  3GYY A;  4XFE A;  1G0I A;  1FBG A;  2HPG A;  5LDZ A;  2Y5L A;  3EKI A;  1LBV A;  4PDD A;  4DI4 B;  4AS4 A;  4PFR A;  1FTA A;  2Q8M A;  2CZI A;  4XF5 A;  4N81 A;  3KC0 A;  4YIC A;  5ET5 A;  3ROJ A;  4JVC A;  5JK4 A;  4NQ8 A;  5EQ9 A;  4MCO A;  1D9Q A;  1FPF A;  4OVS A;  4X04 A;  2QVV A;  4LN5 A;  1FPB A;  5IM2 A;  5ESY A;  4NN3 A;  1AWB A;  2V4C A;  4KXP A;  4DI3 D;  4MIJ A;  1IMA A;  1IMF A;  4PAK A;  4OVT A;  1NV5 A;  2WYK A;  2ZZX A;  4N17 A;  1IME A;  5IZ3 A;  2XA5 A;  5EYG A;  4MNI A;  4M1V A;  1FPJ A;  4MMP A;  1K9Y A;  4OVQ A;  4PF6 A;  2F3B A;  2Y5K A;  3QMF A;  2Q74 A;  4MNP A;  4I3Y A;  2L5V A;  5ET8 A;  4GBV A;  3E79 A;  1NUY A;  1LBY A;  1LBW A;  4PC9 A;  3A29 A;  3U65 A;  2VPN A;  1NUZ A;  3ISP A;  2PFZ A;  5CM6 A;  4PGP A;  1EYJ A;  4F1U A;  3BIG A;  3RPL A;  4NF0 A;  1DCU A;  4NGU A;  5F24 A;  4P8B A;  4F19 A;  2ZZV A;  4GWS A;  2WBD A;  1DBZ A;  4O94 A;  2HHM A;  4GX4 A;  2CZH A;  2KR0 A;  3FBP A;  2HXR A;  1NV2 A;  5EYH A;  2WBB A;  4FBP A;  4PFI A;  4OVR A;  1RDZ A;  4GWU A;  5EQ7 A;  2CEY A;  1FPL A;  4H46 A;  4GBW A;  4N8Y A;  5FBP A;  4O8M A;  4N8G A;  4MHF A;  4P1E A;  1RDX A;  4OA4 A;  2WEF A;  1NV0 A;  2DE3 A;  1FJ6 A;  4G61 A;  5IZ1 A;  3KC1 A;  3FXB A;  2MKZ A;  4N91 A;  1FSA A;  4PGN A;  2FIX A;  4OVP A;  4PBH A;  5DW8 A;  4MAG A;  2PFY A;  4JVD A;  1LBX A;  5A5L A;  2QVR A;  2XWK A;  1NV7 A;  5ET7 A;  5J16 A;  1FBD A;  2P3N A;  1K9Z A;  4N15 A;  2F3D A;  1FPG A;  4PFB A;  1NV3 A;  1G0H A;  4PCD A;  3PTY A;  4XEQ A;  3B50 A;  1NV1 A;  1NUX A;  5IZZ A;  5T3J A;  2XWV A;  4HCY A;  3RYD A;  4I3E A;  2HZL A;  3T0J A;  1DK4 A;  4HE2 A;  2QVU A;  2FHY A;  3LV0 A;  2XXK A;  3LUZ A;  2PCR A;  3MYU A;  5J1D A;  1NV4 A;  1FBH A;  1XI6 A;  3T1B A;  3KBZ A;  3W9W A;  4F18 A;  3IFA A;  4X9T A;  3E78 A;  5EQ8 A;  1FPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...