1LBZA

Crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 calcium ions and fructose-1,6 bisphosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 78
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbzA02
3RPLA 2QFLA 4KXPA 1DK4A 1VDWA 4MJOA 1XI6A 3QMFA 3BIHA 4HE2A 4HE0A 1FBFA 2FIEA 5A5LA 5FBPA 4G61A 2R8TA 2WBBA 2JJKA 1K9YA 1NUXA 2DDKA 1LBWA 4GBVA 4GWSA 1EYJA 5ET6A 1IMFA 1AWBA 1FPIA 1G0IA 4GWZA 4PTKA 1FJ9A 1FSAA 1NV3A 1NV7A 5J16A 1FBEA 1RDXA 1LBZA 5IZ3A 1LBYA 3RPLB 3T0JA 5ET5A 2HHMA 3LUZA 1CNQA 1NUYA 4GX4A 2P3NA 2Q8MA 1INPA 1NV1A 1NUWA 4GWUA 1BK4A 2CZHA 4GX3A 1SPIA 2WEFA 1FRPA 5DW8A 5IZ1A 1FBGA 1RDYA 3B8BA 3IFAA 1IMDA 3KBZA 5EYHA 2P3VA 5EQ8A 4AS5A 1RDZA 1IMCA 5IZ3B 1LBVA 1IMEA 1FPFA 1FPJA 2Q74A 4FBPA 5T3JA 1FBHA 1NV5A 1NV4A 4H46A 5EQ9A 1FPDA 5ET7A 1KA0A 4I40A 5EQ7A 3A29A 1NI9A 1FTAA 4QXDA 1DBZA 2VT5A 3LV0A 2PCRA 2Y5KA 2BJIA 4HE1A 1NV6A 3RYDA 3KC1A 1FPBA 2CZKA 4I3YA 1G0HA 1FPKA 2CZIA 4HXVA 4GX6A 3IFCA 2OX3A 4GWXA 2QVVA 4H45A 2Y5LA 5ESYA 1Q9DA 3BIGA 4GBWA 4GWYA 5F24A 1KZ8A 2WBDA 4O7IA 1DCUA 2FIXA 1EYKA 3FBPA 5I3SA 1YZ0A 1IMBA 4N81A 2GQ1A 1EYIA 2FVZA 2F3DA 1QGXA 1K9ZA 2OWZA 1FPEA 2F3BA 4GWWA 1JP4A 1NV2A 1FBPA 1KA1A 1LEVA 2QVRA 1FPGA 1NV0A 5EYGA 4AS4A 5LDZA 1FBDA 2FHYA 5EQAA 3KC0A 1FPLA 1IMAA 2FBPA 5ET8A 1FJ6A 2QVUA 1D9QA 1LBXA 3D1RA 3ROJA 1NUZA 1FBCA 4IR8A 4I3EA 1YXIA 1YYZA
chains in the Genus database with same CATH superfamily
1OMPA 1ZMGA 1N3XA 4PAFA 2FIEA 1IIWA 4G61A 1MXWA 2WBBA 2YLNA 5H8HA 1EYJA 4NEDA 3PV0E 4TQUQ 2HAVA 5ELVA 2GHAA 1LBZA 5TP9B 2Z23A 5IZ3A 3FXQA 4PE3A 4GL0A 1QULA 2OK2A 3PD9A 4GWUA 1SPIA 4DE8A 3DELB 3UN6A 5DVIA 4FAJA 1LB8A 2XXKA 4RXLA 1GVCA 2I0BA 4JWYA 2I48A 3B6QA 3CG1A 3IB1A 2AIXA 1LBBA 2PMSA 3KOTA 2UVHA 4NX1A 4NF5A 5I58B 2O84X 1LLSA 1LAHE 1UIUA 3WAEA 1B40A 3CIJA 4ZE8A 4OVRA 4EUOA 1KA1A 3QSLA 2PFZA 2XXVA 1N7WA 4I9DA 1FPLA 4ZZEA 5CM6A 1IUDA 1NUZA 3G3JA 1MQHA 3KG2A 3FASA 2O51A 4IR8A 1CE2A 3BKIB 4NQ8A 3EPEA 3MVYA 2THIA 4N91A 1FTJA 2F6GA 3TKDA 1A54A 2XXTA 3G3KA 1K9YA 1FJ9A 4IB2A 3HO7A 3K4UA 1UIVA 3CVGA 2DP8A 1QJMA 1MXXA 5EYFA 3T0JA 3D4CA 3OD7A 3R6UA 1SD3A 1PC3A 4NWCA 4QBAA 3S9MC 3FXBA 4MNIA 1VR5A 4K3FA 4FE8A 1JEUA 5H8SA 2QRYA 1TT1A 3O6HA 3QUJA 4IO5A 4PDDA 1Z7ME 2V3UA 4F29A 2XXWA 4FBPA 4OWDA 5T3JA 4G68A 5CMBA 4F31B 5K2XA 3B7DA 5EQ7A 2REJA 4DDDA 2I6EA 3ZKLA 4P3LA 1Y9UA 3SKPA 3V83A 5DYHA 3UK4A 5I57B 2HZKA 3OO6A 4GWYA 2FA7A 5IKBA 2XWIA 4R74A 3QAXA 1MH4A 4N4UA 4OETA 1P1NA 4OENA 2A5SA 1LFHA 4MIJA 4UABA 2IA4A 2PFYA 1POY1 4GWOA 1M5DA 3PPOA 1FBDA 3CRBA 3U72A 2Q8JA 3EHTA 1IMAA 4U1OA 1DPPA 1N04A 3ZS6A 1H76A 2WYKA 1B1HA 1N7XA 5IAIA 5I84A 3H03A 1YTVA 1QUKA 1YYZA 4GFRA 4MBPA 3MJNA 5I56A 5F7VA 3MVXA 3V89B 3FJGA 3C9HA 4YKPA 5FTIA 1NV7A 1AMFA 4HW8A 5ITPA 3L6GA 4HTGA 3PUZE 4F18A 2DWHA 3S2VA 4QFLA 3HN0A 1CNQA 1INPA 4ONYA 4Q0CA 3FJMA 1NKXA 4LZ7A 1TFDA 2FNCA 4UA8A 4LQ5A 1VE4A 5ITOA 3MYUA 4R6YA 4DXCA 4IO6A 3W9WA 5H8FA 2XX7A 3PPPA 1B0LA 2FYIA 2RC9A 2DWIA 4F3SA 3ISPA 4KD5A 4E0WA 3Q27A 2XA5A 3LSLA 2B4LA 2F5XA 3OO7A 2UYFA 3T22A 3ZSFA 2Q88A 5H8QB 2UXAA 4I3YA 3I6VA 3PPNA 3IFCA 1QVSA 1B3GA 4BDQA 4PFUA 4IY5A 1DPEA 4NE4A 4JWXA 2WX9A 2L5VA 1DTZA 1LCFA 2FIXA 3IR1A 4MLQA 4H1XA 4LP2B 5F1QA 3WAFA 3A3UA 2OJTA 2F3BA 1FBPA 1WVJA 2OWTA 4P9KA 3RUMA 1SW1A 4OESA 4ZDMA 3CR9A 2VD3A 4R9FA 4LVQA 2RC7A 4F2OA 1LAFE 4N6DA 2GFEA 3O6IA 3BIHA 5AA1A 1S7YA 4O8MA 5DVJA 4IGTA 2YJPA 1AH5A 1US5A 4GBVA 2XXUA 2XX9A 2A5TB 2RF1A 4RYAA 1P1QA 1J1NA 1IEJA 1SVXB 2B3FA 1QUJA 4OA4A 3QIMA 3FZVA 2VP1A 4L17A 4GX4A 1EU8A 2G93A 3QYTA 2XX8A 2DE4A 5DVFA 1TWYA 1FRPA 3ECRA 4OVTA 3O6GA 2XWOA 2ESNA 5JTYB 2ZZXA 1FBHA 4BDOA 5DEXB 1NV4A 5EQ9A 4UACA 4O3AA 1YCJA 4Q5TA 1B7UA 5I2NB 2HZLA 2OWSA 3CFLA 4NF8A 4N8GA 4KQPA 3FXUA 1PEBA 3SEYA 3KJ7A 1EZ9A 4YKJA 3MPKA 5AA4B 3DP8A 4I62A 1L5TA 4N15A 1QGXA 4XKNA 2XWVA 4OVQA 1MRPA 1FPGA 5EYGA 1N0TA 1B7HA 1ZTYA 2FBPA 1XS5A 4KYEA 3LSWA 3JV9A 3FGSA 1MPCA 3GZGA 4H5GA 2DE2A 1XVXA 1Y3PA 2ALUA 1URDA 4H65A 2RCBA 4GVOA 5EHSA 3BFUA 3Q26A 4GD5A 2CMOA 4PF6A 2F7CA 2QFLA 3C33A 2V25A 1B3HA 2QL3A 3SEUA 3Q29A 2YPNA 3RNNA 4MNCA 2UYEA 2V4CA 4PFYA 1R1NA 2HXRA 4F1VA 1FSAA 4N13A 2HCAA 3LBSA 4NF6A 4GF8A 1P1UA 3RPLB 4GXAA 2P3NA 1MS7A 2R6GE 1NUWA 2QS1A 1OLAA 3ONMA 3H6WA 3IOVA 1P1OA 1FBGA 3KN3A 1LB9A 3PPRA 3M3FA 3TCHA 1A7LA 1H45A 1B4HA 2P0SA 1B46A 4G68C 1NH8A 1QUIA 2V3QA 4LZ8A 1QKAA 1FTMA 1XVYA 2CZLA 4XIGQ 2CEXA 1EH3A 4HE1A 2XD3A 1FPBA 4Z0IA 4P0IA 4ELOA 2HXWA 4H6DA 1LAXA 2GHBA 3RN8A 2QVVA 3MZBA 3ODBA 4YKKA 1M5BA 5I2KB 1N76A 3HCQA 2X7QA 1MDP1 4EDPA 4XEQA 1PBPA 4ELRA 4R2FA 3RQTA 5IZZA 2G29A 2F8DA 1BKAA 4U4SA 3HHFA 2QS4A 4MAGA 4OEUA 2OBGA 2Y7KA 3VLVA 3MC2A 1PB8A 4GRKA 2ABHA 1B4ZA 4R2BA 1NNFA 4KHZE 2O7IA 4OVPA 4JVCA 4P47A 1I6QA 4OANA 1AWBA 2O69A 3EHSA 1I69A 2XWKA 4PETA 4ELPA 2NVUB 1LFIA 4POWA 4DXUA 1ZLQA 1NV1A 5KDTB 2WEFA 4GQOA 4RK2A 1JW5A 3VXCA 4PFIA 2OZZA 1FPFA 3OELA 3FXRA 5B70A 3M3KA 2ANJA 1US4A 4RJZA 5FHOA 4G2ZA 2UVIA 3KSXA 5L9SA 2H4IA 3TEPA 1IXCA 2WKYA 3RGYA 5KCJB 3VLWA 5CC2A 4AB5A 4MFIA 3K01A 5H8NB 5BUUA 4DCYA 1M5EA 1B3EA 2ZYOA 2GQ1A 5TU0A 4O94A 4F2QA 4FORA 1JP4A 3SEWA 2VOZA 4I1DA 4OFJA 1EZPA 5ET8A 4U22A 1YPNA 4OYVA 3A3CA 5KZTA 5CBRA 3IB0A 3OENA 4ELQA 1NUXA 1FTKA 1MQGA 3C31A 3B6TA 3S9NC 4F1UA 3SEVA 1RYOA 1FTLA 4P1LA 4N17A 3MP8A 5HM4B 3TTMA 4NGUA 3M3LA 3LUZA 2VD2A 4GXSB 3Q28A 4FEBA 3U92A 1USYH 3PGFA 5IZ1A 1RDYA 4YMAA 3PUYE 1P1WA 3EN3A 4IO4A 1LBVA 1RYXA 3TODA 5I57A 3TAJA 2XXIA 1MXVA 1KA0A 1A55A 1SW4A 3OEKA 1FQFA 2BJIA 3RYDA 4TOZA 1MY3A 5AE4A 2HEUA 2WYPA 4MEVA 2QPQA 1NNPA 5ESYA 1HSJA 5ISUA 2XHDA 1A99A 3T9XB 4JDFA 1Q1KA 2P1SA 4O7IA 1A8FA 1MXZA 4FEDA 1B6HA 1B3FA 3TQWA 3U8QA 1EYIA 4DXBA 2D21A 1Y3NA 1JVXA 4IY6A 1FPEA 4GWWA 3R7XA 5AA2B 3MW0A 1FQCA 3OO9A 2FHYA 4LQ2A 3K6UA 4OEVA 1ZKBA 3D4GA 3FUZA 4LATA 1N84A 3OMBA 4NTLA 1B0HA 1GR2A 3QMFA 4EQBA 2HPGA 4ZEIA 4ZEDA 2R9JA 3T1BA 4BDNA 4DIGA 4OTEA 4DI3D 4GWZA 1NV3A 1MY1A 3QUFA 3THIA 5I59A 4DCXA 2DWJA 2Q8MA 4ESXA 3DLNA 4TLMB 3PD8A 1JQFA 4C0RA 4X9TA 5DW8A 3B8BA 1MQDA 1OLCA 5EQ8A 3PMXA 5K2YA 5H8QA 2Q9TA 3K1MA 3C34A 5IM2A 4O7MA 1FPJA 2Q74A 1XC1A 2RC8A 1OVTA 1T0KA 3CI8A 1B05A 3A29A 3H6TA 3PUVE 2I58A 4M1VA 3B50A 4LZ5A 2Q89A 1NMUA 1LBCA 4OMBA 1OQGA 1ZU0A 4LA9A 2OX3A 1YAEA 4H45A 1H43A 4OERA 2ZYNA 4PFRA 3N94A 4GIZA 2ZZWA 4JBZA 3MVZA 1DMBA 3V5AA 4N6KA 4NAPA 3G3FA 5L8DA 2Y7RA 3RTWB 3FV2A 4NWDA 3ROJA 3HHGA 2F6PA 3C36A 4OVSA 2A5TA 5I56B 2Y7PA 4OHNA 3RY3A 3VV5A 2V3TA 1FTOA 1R6ZA 4MJOA 1AL3A 3TDJA 3MZ1A 1UTBB 2NXOA 5ET6A 3SERA 4JVIA 1MPBA 3LUYA 2ZYMA 4YB6A 1RDXA 4DI4B 1OVBA 2I49A 2QSXA 5JTYA 4HCYA 1SI1A 3U1OA 5DEXA 2QS2A 4MH5A 2RKMA 5AA2D 3KBZA 5I2NA 2P3VA 4ZECA 1B5JA 1H44A 2DOJA 3G3GA 4U1ZA 3KBRA 1RDZA 3E78A 4H8JA 4P1EA 1S9TA 3BFTA 4GL8A 2OPDA 2PYYA 2R71A 1NI9A 3TTKA 2VT5A 2ZXTA 3HPIA 1JETA 3ZKKA 4GX6A 1GTKA 1MXYA 2O68A 4WKMA 4HS7A 3TZAA 5A5XA 2Y5LA 3Q25A 4MNPA 2PX1A 4F3GA 4EQ7A 1JW4A 3FATA 3IOWA 2I4BA 2F35A 1YZ0A 4H5FA 3FVGA 4JSDA 1D9YA 3H6VA 2H9BA 4OQOA 1D3KA 3NOHA 4EXKA 1UQWA 1OQHA 3W15C 4PBQA 3B6WA 1O63A 4I3EA 3RPLA 1FBFA 4R9GA 2R8TA 2DSFA 3PMVA 2KLFA 1IMFA 1PB9A 4PTKA 2VHAA 4R75A 2X26A 3K6VA 4MF3A 2OLBA 2ONKE 1WODA 3MBPA 1ZJLA 1B2HA 1PB7A 2O1MA 3DP4A 1IMDA 2RCAA 4PGPA 3CG3A 5DTBA 3PMWA 4FJPA 1Y4TA 4X8RA 2LAOA 3MP1A 1NNTA 4FECA 4YAHX 2XD2A 3LSXA 3M8UA 1FTAA 5I2KA 4NF4B 2UVJA 4DZ1A 4G8NA 2V93A 3MP6A 4QSDA 4NF8B 1SBPA 1UTHB 1G0HA 2VPOA 1FQDA 3JZJA 4GWXA 2AL5A 4N07A 3FV1A 2HAUA 3IJXB 4KFQA 3K02A 4ECFA 3U93A 1QW0A 3O9PA 3T9HB 3H6UA 4AS4A 3CFZA 3IB2A 3P7IA 2H99A 3TTRA 3GBAA 1FJ6A 2Q2CA 1D9QA 4OZ9A 2H98A 3IO6A 4YB7A 1MY0A 4BDMA 1MM7A 3O29A 3TUSA 1VDWA 1XI6A 4HE2A 1TXFA 4NMYA 2QMXA 4G8MA 3U65A 3IOTA 4BLAA 5KDTA 4PC9A 5TPAB 2ZNSA 1HSEA 3MUQA 3T9UA 1DTGA 1G0IA 2ZNUA 2XXRA 4H67A 4XXUA 4ESWA 5L9MA 4P56A 4TLLB 2HQ0A 4QFOA 5CMCA 5TP9A 1B32A 1MH3A 1IXHA 2Z8FA 4N6PA 3MSTA 4F19A 3TTNA 2I3WA 4IO7A 4JXIA 1MDQA 3UP9A 5KCJA 1LGBC 2IEEA 1Q35A 5FHMA 4H46A 4I40A 3F11A 4QXDA 5H8NA 4QFNA 4E0XA 3K6XA 1B52A 2ZZVA 3KN8A 1CB6A 4HXVA 3QXMA 1Y4CA 1MY4A 4LN5A 3BIGA 4GBWA 1A8EA 4PAIA 2QS3A 2H5YA 3OO8A 1P99A 3UIFA 4KPTA 2VPNA 4N81A 5I58A 3PUXE 3K1NA 5HBCA 4QFKA 4OVJA 4AQ4A 1D9VA 2KQZA 3FJ7A 5FTHA 3UGWA 3I5OA 3KFMA 4EF2A 1MY2A 4PBHA 1O7TA 5CBSA 3MAMA 4JB7A 3O28A 3GXAA 2HFBA 2REGA 4WEDA 1YXIA 3E9XA 1LEVA 1D4NA 1NH7A 1I6BA 4MHFA 4U4XA 2D5WA 1VFEA 4N8YA 4ND9A 4MX6A 4PFTA 4YU0A 4IO3A 3O2AA 2P2AA 3VLUA 1BP5A 2M8CA 4JVDA 3IX1A 5EHMA 1LBYA 4KYDA 5ET5A 3K00A 1NUYA 2O1LA 2OCUA 3PPQA 1XT8A 5H8HB 3TYHA 4BDRA 3IFAA 3CHGA 3VVEA 3QK6A 3KZGA 4AS5A 5IZ3B 3VE1B 2F97A 1SYHA 3IL1B 3T96B 4ZZAA 4EQ9A 1B9JA 1I6AA 3IK6B 5I7IA 2KR0A 4ZEFA 4IGRA 4P0GA 3KC1A 2CZKA 4O3BA 4ZEBA 1FPKA 4X04A 2CZIA 3O66A 3SZPA 1B51A 3FVOA 5AA2A 2Q2AA 1NFTA 2WBDA 4JWOA 4RY1A 1EYKA 3FBPA 1MQJA 1HSLA 1IMBA 1GV8A 3USDA 1B1XA 3IAZA 4NF5B 1ATGA 4LUBA 4YZZA 4NN3A 3VFJA 4RK9A 4NF0A 4ZE9A 2QJEA 1ELJA 1WDNA 4H0WA 4U21A 3K2DA 1EZOA 4KXPA 1DK4A 2XXYA 1O64A 4F39A 3KOSA 2DDKA 4QSEA 4R6KA 3U94A 3VXBA 1FPIA 4QHQA 3BBRA 2E1SA 4G77A 4C1UA 5BWJA 1DOTA 4FIMA 3C35A 2DVCA 3N6UA 4POXA 2PT1A 4PDHA 4OFLA 2NUVA 1MM6A 2VGQA 1URGA 5EYHA 4BDLA 2XXXA 1II5A 1Y1ZA 4O3CA 2F7BA 2E0SA 2I3VA 2I4CA 2PBWA 1IMCA 1BIYA 1IXGA 1B7ZA 4WEPA 2B65A 4THIA 3PTYA 1N3WA 3RTFB 4IO2A 1IZ1A 3OSRA 1FPDA 1B5HA 1PBQA 3RT8A 5ICTA 2PCRA 2Y5KA 3R26A 4AB6A 4KYSA 2PVUA 1FQAA 4Z7EA 4G68B 3VDFA 1FW0A 4KR5A 1BLFA 4Q8RA 3S9LC 2ONRA 1KZ8A 2DWAA 3PUWE 4RA1A 1IQ7A 4MLVA 4PAKA 3GLBA 1POTA 3S4UA 2F3DA 4G4PA 5IGAA 3N6TA 4QRZA 4F3PA 3JYRA 2UVGA 2Z22A 3IORA 4GLIA 5DT6A 3KEIA 1SI0A 4R73A 2QVUA 3HFUA 4XF5A 3OSQA 1UTBA 3K0VA 5L9OA 1FBCA 5M2VA 4R6HA 1MG1A 4XTCQ 4YB5A 1RKMA 3E3KA 3ILUB 4QFPA 2ZMBA 4XKPA 2BJJX 5A5LA 5FBPA 1JW1A 2JJKA 2NOOA 2O6AA 1LBWA 4FATA 2DXRA 5I59B 2ZNTA 1GGGA 3GBBA 4RNSA 1VSOA 4U23A 4NG7A 1H3DA 2PT2A 2AYSA 3LSFB 3AXFA 3T9VA 2Y7WA 4QSCA 5CRYA 2XXQA 4RPOA 3S9EA 4PF8A 1B58A 2B4MA 4XKQA 4YICA 3OEMA 3VVFA 2I0CA 2B3BA 3E13X 3H3GA 3PU5A 1ZBMA 4NHBA 4PP0A 4H8IA 3TFLA 1R9LA 3G7WA 3TMGA 3CSGA 4ZEKA 5FHNA 4PFWA 5H8FB 3KN7A 2F7AA 1A40A 4OFOA 4P8BA 4HCWA 3ILTB 2DS9A 3H06B 1Q9DA 3HSTA 3MVWA 4M4GA 5F24A 1MQIA 3N5LA 1SW5A 5I5PA 3DM0A 5I3SA 1LAGE 2OWZA 3V8XB 4KCDA 5JEIA 1NV2A 2QVRA 4X1DA 5AA4A 5LDZA 3MQ9A 4G8HA 3SDFA 2O7UA 3H4ZA 3KGCA 3TPAA 1LSTA 4EF1A 1SDXA 2GRVA 2RINA 1F9BA 5CI5A 1Z7NE 1Y1MA 2Y7IA 3HV1A 3TELA 4DLDA 1Y20A 4GWSA 1MPDA 3IO4A 3K1PA 4U2RA 2XXPA 4LONB 3EHUA 5J16A 1AIVA 3TQLA 3OOAA 3OXNA 4JSOA 3RPWA 2HHMA 3N26A 1ZIUA 3MPLA 4RPNA 2X7PA 3IJOB 1ANFA 2CZHA 1KWHA 4PQJA 4NF4A 2DVZA 2OPEA 1NNKA 1UTHA 3C32A 1BTJA 3IOUA 3SETA 1VFDA 4KI0E 4QF9A 3RLFE 5ET7A 1SYIA 1DBZA 2AL4A 1DSNA 4YKIA 4PCDA 4X1BA 4OXVA 1NV6A 5A5XB 4R72A 3KSJA 2DE3A 5LOMA 1LCTA 1XOCA 3KJTA 3SESA 4F3BA 5CMMA 1M5CA 3FIRA 2DXYA 1B3LA 3EF7A 1LFGA 5HPQA 1MXUA 3W9VA 5J1DA 4GOTA 4PE5B 2ONSA 5B7DA 2Z8DA 3E4RA 1DCUA 3I3VA 2FVZA 1FQBA 3RT6B 4PGNA 2DYXA 3CFXA 2NWJA 2F78A 1QKBA 5EQAA 1SW2A 1AOVA 5ICQA 4ZS9A 1OIBA 4I8CA 5TPAA 3D1RA 3C4MA 4PFBA 3FD3A 1XHYA 3T66A 2ZYKA 3A09A 3VVDA 3T93B 4HE0A 3SEXA 3TCFA 4C1TA 4F22A 1FBEA 1JVYA 3G3IA 4ISUA 1S50A 2W7YA 3GYYA 3UA8A 1BK4A 4GX3A 4X48A 1PDAA 4XFEA 3UORA 5JK4A 3FVNA 4NF6B 3G3HA 4P11A 5LTCA 1FCKA 4EXLA 2MKZA 1IMEA 3DP6A 3TCGA 2Z8EA 4Q30B 2V84A 1NV5A 1SQYA 1TFAA 3EQ1A 4WXJA 3CSBA 5AA3A 4MCOA 2CEYA 1Y3QA 4KCCA 3LV0A 1USYE 3MWBA 3K6WA 3E79A 1M5FA 3LC8A 1R9QA 3EKIA 2Y84A 3O97A 5CMKA 4MMPA 3FVKA 2D3IA 2GH9A 4F1YA 1B5IA 3TTLA 2DQVA 2F34A 2H25A 1K9ZA 1IXIA 1JNFA 2XXHA 2F36A 4YMBA 1NV0A 4XKRA 3MZ9A 1IITA 3KC0A 1NL5A 1FQEA 1LBXA 3LR1A 1URSA 1JEVA 2QMWA 3L6HA 3H7MA
chains in the Genus database with same CATH topology
2QFLA 4KXPA 1DK4A 4MJOA 4PAFA 2FIEA 4G61A 4MNCA 2WBBA 2DDKA 2V4CA 1EYJA 5ET6A 2HXRA 1FPIA 4F1VA 4JVIA 1FSAA 1RDXA 1LBZA 4DI4B 5IZ3A 3RPLB 2P3NA 4HCYA 4PE3A 4PDHA 1NUWA 4GWUA 1SPIA 1FBGA 3KBZA 5EYHA 2P3VA 1RDZA 1IMCA 3E78A 4P1EA 2XXKA 3PTYA 2V3QA 1FPDA 1NI9A 2VT5A 2CEXA 2PCRA 2Y5KA 4HE1A 1FPBA 4GX6A 2QVVA 2Y5LA 4NX1A 4MNPA 1KZ8A 4PAKA 1YZ0A 2F3DA 5IGAA 4OVRA 1KA1A 4XEQA 2PFZA 1FPLA 3NOHA 5IZZA 2QVUA 3HFUA 4XF5A 5CM6A 1NUZA 4PBQA 4MAGA 1FBCA 4IR8A 4I3EA 4NQ8A 4N91A 3RPLA 1FBFA 5A5LA 5FBPA 2R8TA 2JJKA 1K9YA 4OVPA 1LBWA 4JVCA 4P47A 4OANA 1IMFA 1AWBA 4PTKA 1FJ9A 2XWKA 4NG7A 4PETA 3T0JA 4QBAA 1NV1A 3FXBA 4PF8A 4MNIA 2WEFA 2B4MA 4YICA 1IMDA 4PDDA 4PGPA 4PFIA 1FPFA 4X8RA 4FBPA 5T3JA 4NHBA 5EQ7A 1FTAA 4P3LA 1G0HA 2VPOA 2HZKA 4GWXA 4P8BA 4HCWA 1Q9DA 4GWYA 5F24A 2XWIA 5I5PA 4N4UA 5I3SA 4MIJA 2GQ1A 4UABA 4O94A 2OWZA 1JP4A 1NV2A 2QVRA 2PFYA 4AS4A 5LDZA 1FBDA 1IMAA 5ET8A 1FJ6A 1D9QA 2WYKA 1YYZA 1VDWA 1XI6A 4HE2A 3U65A 4PC9A 1NUXA 4GWSA 4F1UA 1G0IA 1NV7A 4P1LA 5J16A 4N17A 4F18A 4NGUA 4P56A 2HHMA 3LUZA 1CNQA 1INPA 2CZHA 5IZ1A 2DVZA 1RDYA 3MYUA 3MSTA 4F19A 3W9WA 1LBVA 3ISPA 4H46A 5ET7A 1KA0A 4I40A 2XA5A 2B4LA 4QXDA 1DBZA 2F5XA 2BJIA 4PCDA 1NV6A 3RYDA 4I3YA 2DE3A 2WYPA 2ZZVA 4MEVA 4HXVA 2QPQA 3IFCA 5ESYA 4LN5A 3BIGA 4GBWA 3W9VA 5J1DA 4PAIA 2WX9A 2L5VA 4O7IA 1DCUA 2FIXA 2VPNA 4N81A 1EYIA 2FVZA 1FPEA 2F3BA 4GWWA 1FBPA 4PGNA 2KQZA 2FHYA 5EQAA 4P9KA 4PBHA 3D1RA 4PFBA 4N6DA 1YXIA 1LEVA 3QMFA 4MHFA 3BIHA 4HE0A 2HPGA 4O8MA 4N8YA 3T1BA 4MX6A 4GBVA 4DI3D 4GWZA 1NV3A 1FBEA 4JVDA 4OA4A 1LBYA 5ET5A 1NUYA 4GX4A 3GYYA 2Q8MA 1BK4A 2DE4A 4GX3A 4X9TA 1FRPA 5DW8A 3B8BA 3IFAA 3CHGA 4XFEA 5JK4A 5EQ8A 4AS5A 2Q9TA 5LTCA 4OVTA 2MKZA 2XWOA 5IZ3B 5IM2A 1IMEA 4O7MA 1FPJA 2Q74A 2ZZXA 1FBHA 1NV5A 1NV4A 5EQ9A 3A29A 4MCOA 2CEYA 5I7IA 2KR0A 4M1VA 3LV0A 3B50A 2HZLA 3KC1A 3E79A 2CZKA 1FPKA 3EKIA 4X04A 2CZIA 4MMPA 2OX3A 3SZPA 4H45A 4N8GA 4PFRA 2ZZWA 2WBDA 1EYKA 3FBPA 1IMBA 4N15A 1QGXA 1K9ZA 4N6KA 2XWVA 4OVQA 1FPGA 1NV0A 4NAPA 5EYGA 3KC0A 2FBPA 4YZZA 4NN3A 1LBXA 3ROJA 2DE2A 4OVSA 4NF0A 4PF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPL A;  2QFL A;  4KXP A;  1DK4 A;  1VDW A;  4MJO A;  1XI6 A;  3QMF A;  3BIH A;  4HE2 A;  4HE0 A;  1FBF A;  2FIE A;  5A5L A;  5FBP A;  4G61 A;  2R8T A;  2WBB A;  2JJK A;  1K9Y A;  1NUX A;  2DDK A;  1LBW A;  4GBV A;  4GWS A;  1EYJ A;  5ET6 A;  1IMF A;  1AWB A;  1FPI A;  1G0I A;  4GWZ A;  4PTK A;  1FJ9 A;  1FSA A;  1NV3 A;  1NV7 A;  5J16 A;  1FBE A;  1RDX A;  1LBZ A;  5IZ3 A;  1LBY A;  3RPL B;  3T0J A;  5ET5 A;  2HHM A;  3LUZ A;  1CNQ A;  1NUY A;  4GX4 A;  2P3N A;  2Q8M A;  1INP A;  1NV1 A;  1NUW A;  4GWU A;  1BK4 A;  2CZH A;  4GX3 A;  1SPI A;  2WEF A;  1FRP A;  5DW8 A;  5IZ1 A;  1FBG A;  1RDY A;  3B8B A;  3IFA A;  1IMD A;  3KBZ A;  5EYH A;  2P3V A;  5EQ8 A;  4AS5 A;  1RDZ A;  1IMC A;  5IZ3 B;  1LBV A;  1IME A;  1FPF A;  1FPJ A;  2Q74 A;  4FBP A;  5T3J A;  1FBH A;  1NV5 A;  1NV4 A;  4H46 A;  5EQ9 A;  1FPD A;  5ET7 A;  1KA0 A;  4I40 A;  5EQ7 A;  3A29 A;  1NI9 A;  1FTA A;  4QXD A;  1DBZ A;  2VT5 A;  3LV0 A;  2PCR A;  2Y5K A;  2BJI A;  4HE1 A;  1NV6 A;  3RYD A;  3KC1 A;  1FPB A;  2CZK A;  4I3Y A;  1G0H A;  1FPK A;  2CZI A;  4HXV A;  4GX6 A;  3IFC A;  2OX3 A;  4GWX A;  2QVV A;  4H45 A;  2Y5L A;  5ESY A;  1Q9D A;  3BIG A;  4GBW A;  4GWY A;  5F24 A;  1KZ8 A;  2WBD A;  4O7I A;  1DCU A;  2FIX A;  1EYK A;  3FBP A;  5I3S A;  1YZ0 A;  1IMB A;  4N81 A;  2GQ1 A;  1EYI A;  2FVZ A;  2F3D A;  1QGX A;  1K9Z A;  2OWZ A;  1FPE A;  2F3B A;  4GWW A;  1JP4 A;  1NV2 A;  1FBP A;  1KA1 A;  1LEV A;  2QVR A;  1FPG A;  1NV0 A;  5EYG A;  4AS4 A;  5LDZ A;  1FBD A;  2FHY A;  5EQA A;  3KC0 A;  1FPL A;  1IMA A;  2FBP A;  5ET8 A;  1FJ6 A;  2QVU A;  1D9Q A;  1LBX A;  3D1R A;  3ROJ A;  1NUZ A;  1FBC A;  4IR8 A;  4I3E A;  1YXI A;  1YYZ A; 
#chains in the Genus database with same CATH topology
 1OMP A;  1ZMG A;  1N3X A;  4PAF A;  2FIE A;  1IIW A;  4G61 A;  1MXW A;  2WBB A;  2YLN A;  5H8H A;  1EYJ A;  4NED A;  3PV0 E;  4TQU Q;  2HAV A;  5ELV A;  2GHA A;  1LBZ A;  5TP9 B;  2Z23 A;  5IZ3 A;  3FXQ A;  4PE3 A;  4GL0 A;  1QUL A;  2OK2 A;  3PD9 A;  4GWU A;  1SPI A;  4DE8 A;  3DEL B;  3UN6 A;  5DVI A;  4FAJ A;  1LB8 A;  2XXK A;  4RXL A;  1GVC A;  2I0B A;  4JWY A;  2I48 A;  3B6Q A;  3CG1 A;  3IB1 A;  2AIX A;  1LBB A;  2PMS A;  3KOT A;  2UVH A;  4NX1 A;  4NF5 A;  5I58 B;  2O84 X;  1LLS A;  1LAH E;  1UIU A;  3WAE A;  1B40 A;  3CIJ A;  4ZE8 A;  4OVR A;  4EUO A;  1KA1 A;  3QSL A;  2PFZ A;  2XXV A;  1N7W A;  4I9D A;  1FPL A;  4ZZE A;  5CM6 A;  1IUD A;  1NUZ A;  3G3J A;  1MQH A;  3KG2 A;  3FAS A;  2O51 A;  4IR8 A;  1CE2 A;  3BKI B;  4NQ8 A;  3EPE A;  3MVY A;  2THI A;  4N91 A;  1FTJ A;  2F6G A;  3TKD A;  1A54 A;  2XXT A;  3G3K A;  1K9Y A;  1FJ9 A;  4IB2 A;  3HO7 A;  3K4U A;  1UIV A;  3CVG A;  2DP8 A;  1QJM A;  1MXX A;  5EYF A;  3T0J A;  3D4C A;  3OD7 A;  3R6U A;  1SD3 A;  1PC3 A;  4NWC A;  4QBA A;  3S9M C;  3FXB A;  4MNI A;  1VR5 A;  4K3F A;  4FE8 A;  1JEU A;  5H8S A;  2QRY A;  1TT1 A;  3O6H A;  3QUJ A;  4IO5 A;  4PDD A;  1Z7M E;  2V3U A;  4F29 A;  2XXW A;  4FBP A;  4OWD A;  5T3J A;  4G68 A;  5CMB A;  4F31 B;  5K2X A;  3B7D A;  5EQ7 A;  2REJ A;  4DDD A;  2I6E A;  3ZKL A;  4P3L A;  1Y9U A;  3SKP A;  3V83 A;  5DYH A;  3UK4 A;  5I57 B;  2HZK A;  3OO6 A;  4GWY A;  2FA7 A;  5IKB A;  2XWI A;  4R74 A;  3QAX A;  1MH4 A;  4N4U A;  4OET A;  1P1N A;  4OEN A;  2A5S A;  1LFH A;  4MIJ A;  4UAB A;  2IA4 A;  2PFY A;  1POY 1;  4GWO A;  1M5D A;  3PPO A;  1FBD A;  3CRB A;  3U72 A;  2Q8J A;  3EHT A;  1IMA A;  4U1O A;  1DPP A;  1N04 A;  3ZS6 A;  1H76 A;  2WYK A;  1B1H A;  1N7X A;  5IAI A;  5I84 A;  3H03 A;  1YTV A;  1QUK A;  1YYZ A;  4GFR A;  4MBP A;  3MJN A;  5I56 A;  5F7V A;  3MVX A;  3V89 B;  3FJG A;  3C9H A;  4YKP A;  5FTI A;  1NV7 A;  1AMF A;  4HW8 A;  5ITP A;  3L6G A;  4HTG A;  3PUZ E;  4F18 A;  2DWH A;  3S2V A;  4QFL A;  3HN0 A;  1CNQ A;  1INP A;  4ONY A;  4Q0C A;  3FJM A;  1NKX A;  4LZ7 A;  1TFD A;  2FNC A;  4UA8 A;  4LQ5 A;  1VE4 A;  5ITO A;  3MYU A;  4R6Y A;  4DXC A;  4IO6 A;  3W9W A;  5H8F A;  2XX7 A;  3PPP A;  1B0L A;  2FYI A;  2RC9 A;  2DWI A;  4F3S A;  3ISP A;  4KD5 A;  4E0W A;  3Q27 A;  2XA5 A;  3LSL A;  2B4L A;  2F5X A;  3OO7 A;  2UYF A;  3T22 A;  3ZSF A;  2Q88 A;  5H8Q B;  2UXA A;  4I3Y A;  3I6V A;  3PPN A;  3IFC A;  1QVS A;  1B3G A;  4BDQ A;  4PFU A;  4IY5 A;  1DPE A;  4NE4 A;  4JWX A;  2WX9 A;  2L5V A;  1DTZ A;  1LCF A;  2FIX A;  3IR1 A;  4MLQ A;  4H1X A;  4LP2 B;  5F1Q A;  3WAF A;  3A3U A;  2OJT A;  2F3B A;  1FBP A;  1WVJ A;  2OWT A;  4P9K A;  3RUM A;  1SW1 A;  4OES A;  4ZDM A;  3CR9 A;  2VD3 A;  4R9F A;  4LVQ A;  2RC7 A;  4F2O A;  1LAF E;  4N6D A;  2GFE A;  3O6I A;  3BIH A;  5AA1 A;  1S7Y A;  4O8M A;  5DVJ A;  4IGT A;  2YJP A;  1AH5 A;  1US5 A;  4GBV A;  2XXU A;  2XX9 A;  2A5T B;  2RF1 A;  4RYA A;  1P1Q A;  1J1N A;  1IEJ A;  1SVX B;  2B3F A;  1QUJ A;  4OA4 A;  3QIM A;  3FZV A;  2VP1 A;  4L17 A;  4GX4 A;  1EU8 A;  2G93 A;  3QYT A;  2XX8 A;  2DE4 A;  5DVF A;  1TWY A;  1FRP A;  3ECR A;  4OVT A;  3O6G A;  2XWO A;  2ESN A;  5JTY B;  2ZZX A;  1FBH A;  4BDO A;  5DEX B;  1NV4 A;  5EQ9 A;  4UAC A;  4O3A A;  1YCJ A;  4Q5T A;  1B7U A;  5I2N B;  2HZL A;  2OWS A;  3CFL A;  4NF8 A;  4N8G A;  4KQP A;  3FXU A;  1PEB A;  3SEY A;  3KJ7 A;  1EZ9 A;  4YKJ A;  3MPK A;  5AA4 B;  3DP8 A;  4I62 A;  1L5T A;  4N15 A;  1QGX A;  4XKN A;  2XWV A;  4OVQ A;  1MRP A;  1FPG A;  5EYG A;  1N0T A;  1B7H A;  1ZTY A;  2FBP A;  1XS5 A;  4KYE A;  3LSW A;  3JV9 A;  3FGS A;  1MPC A;  3GZG A;  4H5G A;  2DE2 A;  1XVX A;  1Y3P A;  2ALU A;  1URD A;  4H65 A;  2RCB A;  4GVO A;  5EHS A;  3BFU A;  3Q26 A;  4GD5 A;  2CMO A;  4PF6 A;  2F7C A;  2QFL A;  3C33 A;  2V25 A;  1B3H A;  2QL3 A;  3SEU A;  3Q29 A;  2YPN A;  3RNN A;  4MNC A;  2UYE A;  2V4C A;  4PFY A;  1R1N A;  2HXR A;  4F1V A;  1FSA A;  4N13 A;  2HCA A;  3LBS A;  4NF6 A;  4GF8 A;  1P1U A;  3RPL B;  4GXA A;  2P3N A;  1MS7 A;  2R6G E;  1NUW A;  2QS1 A;  1OLA A;  3ONM A;  3H6W A;  3IOV A;  1P1O A;  1FBG A;  3KN3 A;  1LB9 A;  3PPR A;  3M3F A;  3TCH A;  1A7L A;  1H45 A;  1B4H A;  2P0S A;  1B46 A;  4G68 C;  1NH8 A;  1QUI A;  2V3Q A;  4LZ8 A;  1QKA A;  1FTM A;  1XVY A;  2CZL A;  4XIG Q;  2CEX A;  1EH3 A;  4HE1 A;  2XD3 A;  1FPB A;  4Z0I A;  4P0I A;  4ELO A;  2HXW A;  4H6D A;  1LAX A;  2GHB A;  3RN8 A;  2QVV A;  3MZB A;  3ODB A;  4YKK A;  1M5B A;  5I2K B;  1N76 A;  3HCQ A;  2X7Q A;  1MDP 1;  4EDP A;  4XEQ A;  1PBP A;  4ELR A;  4R2F A;  3RQT A;  5IZZ A;  2G29 A;  2F8D A;  1BKA A;  4U4S A;  3HHF A;  2QS4 A;  4MAG A;  4OEU A;  2OBG A;  2Y7K A;  3VLV A;  3MC2 A;  1PB8 A;  4GRK A;  2ABH A;  1B4Z A;  4R2B A;  1NNF A;  4KHZ E;  2O7I A;  4OVP A;  4JVC A;  4P47 A;  1I6Q A;  4OAN A;  1AWB A;  2O69 A;  3EHS A;  1I69 A;  2XWK A;  4PET A;  4ELP A;  2NVU B;  1LFI A;  4POW A;  4DXU A;  1ZLQ A;  1NV1 A;  5KDT B;  2WEF A;  4GQO A;  4RK2 A;  1JW5 A;  3VXC A;  4PFI A;  2OZZ A;  1FPF A;  3OEL A;  3FXR A;  5B70 A;  3M3K A;  2ANJ A;  1US4 A;  4RJZ A;  5FHO A;  4G2Z A;  2UVI A;  3KSX A;  5L9S A;  2H4I A;  3TEP A;  1IXC A;  2WKY A;  3RGY A;  5KCJ B;  3VLW A;  5CC2 A;  4AB5 A;  4MFI A;  3K01 A;  5H8N B;  5BUU A;  4DCY A;  1M5E A;  1B3E A;  2ZYO A;  2GQ1 A;  5TU0 A;  4O94 A;  4F2Q A;  4FOR A;  1JP4 A;  3SEW A;  2VOZ A;  4I1D A;  4OFJ A;  1EZP A;  5ET8 A;  4U22 A;  1YPN A;  4OYV A;  3A3C A;  5KZT A;  5CBR A;  3IB0 A;  3OEN A;  4ELQ A;  1NUX A;  1FTK A;  1MQG A;  3C31 A;  3B6T A;  3S9N C;  4F1U A;  3SEV A;  1RYO A;  1FTL A;  4P1L A;  4N17 A;  3MP8 A;  5HM4 B;  3TTM A;  4NGU A;  3M3L A;  3LUZ A;  2VD2 A;  4GXS B;  3Q28 A;  4FEB A;  3U92 A;  1USY H;  3PGF A;  5IZ1 A;  1RDY A;  4YMA A;  3PUY E;  1P1W A;  3EN3 A;  4IO4 A;  1LBV A;  1RYX A;  3TOD A;  5I57 A;  3TAJ A;  2XXI A;  1MXV A;  1KA0 A;  1A55 A;  1SW4 A;  3OEK A;  1FQF A;  2BJI A;  3RYD A;  4TOZ A;  1MY3 A;  5AE4 A;  2HEU A;  2WYP A;  4MEV A;  2QPQ A;  1NNP A;  5ESY A;  1HSJ A;  5ISU A;  2XHD A;  1A99 A;  3T9X B;  4JDF A;  1Q1K A;  2P1S A;  4O7I A;  1A8F A;  1MXZ A;  4FED A;  1B6H A;  1B3F A;  3TQW A;  3U8Q A;  1EYI A;  4DXB A;  2D21 A;  1Y3N A;  1JVX A;  4IY6 A;  1FPE A;  4GWW A;  3R7X A;  5AA2 B;  3MW0 A;  1FQC A;  3OO9 A;  2FHY A;  4LQ2 A;  3K6U A;  4OEV A;  1ZKB A;  3D4G A;  3FUZ A;  4LAT A;  1N84 A;  3OMB A;  4NTL A;  1B0H A;  1GR2 A;  3QMF A;  4EQB A;  2HPG A;  4ZEI A;  4ZED A;  2R9J A;  3T1B A;  4BDN A;  4DIG A;  4OTE A;  4DI3 D;  4GWZ A;  1NV3 A;  1MY1 A;  3QUF A;  3THI A;  5I59 A;  4DCX A;  2DWJ A;  2Q8M A;  4ESX A;  3DLN A;  4TLM B;  3PD8 A;  1JQF A;  4C0R A;  4X9T A;  5DW8 A;  3B8B A;  1MQD A;  1OLC A;  5EQ8 A;  3PMX A;  5K2Y A;  5H8Q A;  2Q9T A;  3K1M A;  3C34 A;  5IM2 A;  4O7M A;  1FPJ A;  2Q74 A;  1XC1 A;  2RC8 A;  1OVT A;  1T0K A;  3CI8 A;  1B05 A;  3A29 A;  3H6T A;  3PUV E;  2I58 A;  4M1V A;  3B50 A;  4LZ5 A;  2Q89 A;  1NMU A;  1LBC A;  4OMB A;  1OQG A;  1ZU0 A;  4LA9 A;  2OX3 A;  1YAE A;  4H45 A;  1H43 A;  4OER A;  2ZYN A;  4PFR A;  3N94 A;  4GIZ A;  2ZZW A;  4JBZ A;  3MVZ A;  1DMB A;  3V5A A;  4N6K A;  4NAP A;  3G3F A;  5L8D A;  2Y7R A;  3RTW B;  3FV2 A;  4NWD A;  3ROJ A;  3HHG A;  2F6P A;  3C36 A;  4OVS A;  2A5T A;  5I56 B;  2Y7P A;  4OHN A;  3RY3 A;  3VV5 A;  2V3T A;  1FTO A;  1R6Z A;  4MJO A;  1AL3 A;  3TDJ A;  3MZ1 A;  1UTB B;  2NXO A;  5ET6 A;  3SER A;  4JVI A;  1MPB A;  3LUY A;  2ZYM A;  4YB6 A;  1RDX A;  4DI4 B;  1OVB A;  2I49 A;  2QSX A;  5JTY A;  4HCY A;  1SI1 A;  3U1O A;  5DEX A;  2QS2 A;  4MH5 A;  2RKM A;  5AA2 D;  3KBZ A;  5I2N A;  2P3V A;  4ZEC A;  1B5J A;  1H44 A;  2DOJ A;  3G3G A;  4U1Z A;  3KBR A;  1RDZ A;  3E78 A;  4H8J A;  4P1E A;  1S9T A;  3BFT A;  4GL8 A;  2OPD A;  2PYY A;  2R71 A;  1NI9 A;  3TTK A;  2VT5 A;  2ZXT A;  3HPI A;  1JET A;  3ZKK A;  4GX6 A;  1GTK A;  1MXY A;  2O68 A;  4WKM A;  4HS7 A;  3TZA A;  5A5X A;  2Y5L A;  3Q25 A;  4MNP A;  2PX1 A;  4F3G A;  4EQ7 A;  1JW4 A;  3FAT A;  3IOW A;  2I4B A;  2F35 A;  1YZ0 A;  4H5F A;  3FVG A;  4JSD A;  1D9Y A;  3H6V A;  2H9B A;  4OQO A;  1D3K A;  3NOH A;  4EXK A;  1UQW A;  1OQH A;  3W15 C;  4PBQ A;  3B6W A;  1O63 A;  4I3E A;  3RPL A;  1FBF A;  4R9G A;  2R8T A;  2DSF A;  3PMV A;  2KLF A;  1IMF A;  1PB9 A;  4PTK A;  2VHA A;  4R75 A;  2X26 A;  3K6V A;  4MF3 A;  2OLB A;  2ONK E;  1WOD A;  3MBP A;  1ZJL A;  1B2H A;  1PB7 A;  2O1M A;  3DP4 A;  1IMD A;  2RCA A;  4PGP A;  3CG3 A;  5DTB A;  3PMW A;  4FJP A;  1Y4T A;  4X8R A;  2LAO A;  3MP1 A;  1NNT A;  4FEC A;  4YAH X;  2XD2 A;  3LSX A;  3M8U A;  1FTA A;  5I2K A;  4NF4 B;  2UVJ A;  4DZ1 A;  4G8N A;  2V93 A;  3MP6 A;  4QSD A;  4NF8 B;  1SBP A;  1UTH B;  1G0H A;  2VPO A;  1FQD A;  3JZJ A;  4GWX A;  2AL5 A;  4N07 A;  3FV1 A;  2HAU A;  3IJX B;  4KFQ A;  3K02 A;  4ECF A;  3U93 A;  1QW0 A;  3O9P A;  3T9H B;  3H6U A;  4AS4 A;  3CFZ A;  3IB2 A;  3P7I A;  2H99 A;  3TTR A;  3GBA A;  1FJ6 A;  2Q2C A;  1D9Q A;  4OZ9 A;  2H98 A;  3IO6 A;  4YB7 A;  1MY0 A;  4BDM A;  1MM7 A;  3O29 A;  3TUS A;  1VDW A;  1XI6 A;  4HE2 A;  1TXF A;  4NMY A;  2QMX A;  4G8M A;  3U65 A;  3IOT A;  4BLA A;  5KDT A;  4PC9 A;  5TPA B;  2ZNS A;  1HSE A;  3MUQ A;  3T9U A;  1DTG A;  1G0I A;  2ZNU A;  2XXR A;  4H67 A;  4XXU A;  4ESW A;  5L9M A;  4P56 A;  4TLL B;  2HQ0 A;  4QFO A;  5CMC A;  5TP9 A;  1B32 A;  1MH3 A;  1IXH A;  2Z8F A;  4N6P A;  3MST A;  4F19 A;  3TTN A;  2I3W A;  4IO7 A;  4JXI A;  1MDQ A;  3UP9 A;  5KCJ A;  1LGB C;  2IEE A;  1Q35 A;  5FHM A;  4H46 A;  4I40 A;  3F11 A;  4QXD A;  5H8N A;  4QFN A;  4E0X A;  3K6X A;  1B52 A;  2ZZV A;  3KN8 A;  1CB6 A;  4HXV A;  3QXM A;  1Y4C A;  1MY4 A;  4LN5 A;  3BIG A;  4GBW A;  1A8E A;  4PAI A;  2QS3 A;  2H5Y A;  3OO8 A;  1P99 A;  3UIF A;  4KPT A;  2VPN A;  4N81 A;  5I58 A;  3PUX E;  3K1N A;  5HBC A;  4QFK A;  4OVJ A;  4AQ4 A;  1D9V A;  2KQZ A;  3FJ7 A;  5FTH A;  3UGW A;  3I5O A;  3KFM A;  4EF2 A;  1MY2 A;  4PBH A;  1O7T A;  5CBS A;  3MAM A;  4JB7 A;  3O28 A;  3GXA A;  2HFB A;  2REG A;  4WED A;  1YXI A;  3E9X A;  1LEV A;  1D4N A;  1NH7 A;  1I6B A;  4MHF A;  4U4X A;  2D5W A;  1VFE A;  4N8Y A;  4ND9 A;  4MX6 A;  4PFT A;  4YU0 A;  4IO3 A;  3O2A A;  2P2A A;  3VLU A;  1BP5 A;  2M8C A;  4JVD A;  3IX1 A;  5EHM A;  1LBY A;  4KYD A;  5ET5 A;  3K00 A;  1NUY A;  2O1L A;  2OCU A;  3PPQ A;  1XT8 A;  5H8H B;  3TYH A;  4BDR A;  3IFA A;  3CHG A;  3VVE A;  3QK6 A;  3KZG A;  4AS5 A;  5IZ3 B;  3VE1 B;  2F97 A;  1SYH A;  3IL1 B;  3T96 B;  4ZZA A;  4EQ9 A;  1B9J A;  1I6A A;  3IK6 B;  5I7I A;  2KR0 A;  4ZEF A;  4IGR A;  4P0G A;  3KC1 A;  2CZK A;  4O3B A;  4ZEB A;  1FPK A;  4X04 A;  2CZI A;  3O66 A;  3SZP A;  1B51 A;  3FVO A;  5AA2 A;  2Q2A A;  1NFT A;  2WBD A;  4JWO A;  4RY1 A;  1EYK A;  3FBP A;  1MQJ A;  1HSL A;  1IMB A;  1GV8 A;  3USD A;  1B1X A;  3IAZ A;  4NF5 B;  1ATG A;  4LUB A;  4YZZ A;  4NN3 A;  3VFJ A;  4RK9 A;  4NF0 A;  4ZE9 A;  2QJE A;  1ELJ A;  1WDN A;  4H0W A;  4U21 A;  3K2D A;  1EZO A;  4KXP A;  1DK4 A;  2XXY A;  1O64 A;  4F39 A;  3KOS A;  2DDK A;  4QSE A;  4R6K A;  3U94 A;  3VXB A;  1FPI A;  4QHQ A;  3BBR A;  2E1S A;  4G77 A;  4C1U A;  5BWJ A;  1DOT A;  4FIM A;  3C35 A;  2DVC A;  3N6U A;  4POX A;  2PT1 A;  4PDH A;  4OFL A;  2NUV A;  1MM6 A;  2VGQ A;  1URG A;  5EYH A;  4BDL A;  2XXX A;  1II5 A;  1Y1Z A;  4O3C A;  2F7B A;  2E0S A;  2I3V A;  2I4C A;  2PBW A;  1IMC A;  1BIY A;  1IXG A;  1B7Z A;  4WEP A;  2B65 A;  4THI A;  3PTY A;  1N3W A;  3RTF B;  4IO2 A;  1IZ1 A;  3OSR A;  1FPD A;  1B5H A;  1PBQ A;  3RT8 A;  5ICT A;  2PCR A;  2Y5K A;  3R26 A;  4AB6 A;  4KYS A;  2PVU A;  1FQA A;  4Z7E A;  4G68 B;  3VDF A;  1FW0 A;  4KR5 A;  1BLF A;  4Q8R A;  3S9L C;  2ONR A;  1KZ8 A;  2DWA A;  3PUW E;  4RA1 A;  1IQ7 A;  4MLV A;  4PAK A;  3GLB A;  1POT A;  3S4U A;  2F3D A;  4G4P A;  5IGA A;  3N6T A;  4QRZ A;  4F3P A;  3JYR A;  2UVG A;  2Z22 A;  3IOR A;  4GLI A;  5DT6 A;  3KEI A;  1SI0 A;  4R73 A;  2QVU A;  3HFU A;  4XF5 A;  3OSQ A;  1UTB A;  3K0V A;  5L9O A;  1FBC A;  5M2V A;  4R6H A;  1MG1 A;  4XTC Q;  4YB5 A;  1RKM A;  3E3K A;  3ILU B;  4QFP A;  2ZMB A;  4XKP A;  2BJJ X;  5A5L A;  5FBP A;  1JW1 A;  2JJK A;  2NOO A;  2O6A A;  1LBW A;  4FAT A;  2DXR A;  5I59 B;  2ZNT A;  1GGG A;  3GBB A;  4RNS A;  1VSO A;  4U23 A;  4NG7 A;  1H3D A;  2PT2 A;  2AYS A;  3LSF B;  3AXF A;  3T9V A;  2Y7W A;  4QSC A;  5CRY A;  2XXQ A;  4RPO A;  3S9E A;  4PF8 A;  1B58 A;  2B4M A;  4XKQ A;  4YIC A;  3OEM A;  3VVF A;  2I0C A;  2B3B A;  3E13 X;  3H3G A;  3PU5 A;  1ZBM A;  4NHB A;  4PP0 A;  4H8I A;  3TFL A;  1R9L A;  3G7W A;  3TMG A;  3CSG A;  4ZEK A;  5FHN A;  4PFW A;  5H8F B;  3KN7 A;  2F7A A;  1A40 A;  4OFO A;  4P8B A;  4HCW A;  3ILT B;  2DS9 A;  3H06 B;  1Q9D A;  3HST A;  3MVW A;  4M4G A;  5F24 A;  1MQI A;  3N5L A;  1SW5 A;  5I5P A;  3DM0 A;  5I3S A;  1LAG E;  2OWZ A;  3V8X B;  4KCD A;  5JEI A;  1NV2 A;  2QVR A;  4X1D A;  5AA4 A;  5LDZ A;  3MQ9 A;  4G8H A;  3SDF A;  2O7U A;  3H4Z A;  3KGC A;  3TPA A;  1LST A;  4EF1 A;  1SDX A;  2GRV A;  2RIN A;  1F9B A;  5CI5 A;  1Z7N E;  1Y1M A;  2Y7I A;  3HV1 A;  3TEL A;  4DLD A;  1Y20 A;  4GWS A;  1MPD A;  3IO4 A;  3K1P A;  4U2R A;  2XXP A;  4LON B;  3EHU A;  5J16 A;  1AIV A;  3TQL A;  3OOA A;  3OXN A;  4JSO A;  3RPW A;  2HHM A;  3N26 A;  1ZIU A;  3MPL A;  4RPN A;  2X7P A;  3IJO B;  1ANF A;  2CZH A;  1KWH A;  4PQJ A;  4NF4 A;  2DVZ A;  2OPE A;  1NNK A;  1UTH A;  3C32 A;  1BTJ A;  3IOU A;  3SET A;  1VFD A;  4KI0 E;  4QF9 A;  3RLF E;  5ET7 A;  1SYI A;  1DBZ A;  2AL4 A;  1DSN A;  4YKI A;  4PCD A;  4X1B A;  4OXV A;  1NV6 A;  5A5X B;  4R72 A;  3KSJ A;  2DE3 A;  5LOM A;  1LCT A;  1XOC A;  3KJT A;  3SES A;  4F3B A;  5CMM A;  1M5C A;  3FIR A;  2DXY A;  1B3L A;  3EF7 A;  1LFG A;  5HPQ A;  1MXU A;  3W9V A;  5J1D A;  4GOT A;  4PE5 B;  2ONS A;  5B7D A;  2Z8D A;  3E4R A;  1DCU A;  3I3V A;  2FVZ A;  1FQB A;  3RT6 B;  4PGN A;  2DYX A;  3CFX A;  2NWJ A;  2F78 A;  1QKB A;  5EQA A;  1SW2 A;  1AOV A;  5ICQ A;  4ZS9 A;  1OIB A;  4I8C A;  5TPA A;  3D1R A;  3C4M A;  4PFB A;  3FD3 A;  1XHY A;  3T66 A;  2ZYK A;  3A09 A;  3VVD A;  3T93 B;  4HE0 A;  3SEX A;  3TCF A;  4C1T A;  4F22 A;  1FBE A;  1JVY A;  3G3I A;  4ISU A;  1S50 A;  2W7Y A;  3GYY A;  3UA8 A;  1BK4 A;  4GX3 A;  4X48 A;  1PDA A;  4XFE A;  3UOR A;  5JK4 A;  3FVN A;  4NF6 B;  3G3H A;  4P11 A;  5LTC A;  1FCK A;  4EXL A;  2MKZ A;  1IME A;  3DP6 A;  3TCG A;  2Z8E A;  4Q30 B;  2V84 A;  1NV5 A;  1SQY A;  1TFA A;  3EQ1 A;  4WXJ A;  3CSB A;  5AA3 A;  4MCO A;  2CEY A;  1Y3Q A;  4KCC A;  3LV0 A;  1USY E;  3MWB A;  3K6W A;  3E79 A;  1M5F A;  3LC8 A;  1R9Q A;  3EKI A;  2Y84 A;  3O97 A;  5CMK A;  4MMP A;  3FVK A;  2D3I A;  2GH9 A;  4F1Y A;  1B5I A;  3TTL A;  2DQV A;  2F34 A;  2H25 A;  1K9Z A;  1IXI A;  1JNF A;  2XXH A;  2F36 A;  4YMB A;  1NV0 A;  4XKR A;  3MZ9 A;  1IIT A;  3KC0 A;  1NL5 A;  1FQE A;  1LBX A;  3LR1 A;  1URS A;  1JEV A;  2QMW A;  3L6H A;  3H7M A; 
#chains in the Genus database with same CATH homology
 2QFL A;  4KXP A;  1DK4 A;  4MJO A;  4PAF A;  2FIE A;  4G61 A;  4MNC A;  2WBB A;  2DDK A;  2V4C A;  1EYJ A;  5ET6 A;  2HXR A;  1FPI A;  4F1V A;  4JVI A;  1FSA A;  1RDX A;  1LBZ A;  4DI4 B;  5IZ3 A;  3RPL B;  2P3N A;  4HCY A;  4PE3 A;  4PDH A;  1NUW A;  4GWU A;  1SPI A;  1FBG A;  3KBZ A;  5EYH A;  2P3V A;  1RDZ A;  1IMC A;  3E78 A;  4P1E A;  2XXK A;  3PTY A;  2V3Q A;  1FPD A;  1NI9 A;  2VT5 A;  2CEX A;  2PCR A;  2Y5K A;  4HE1 A;  1FPB A;  4GX6 A;  2QVV A;  2Y5L A;  4NX1 A;  4MNP A;  1KZ8 A;  4PAK A;  1YZ0 A;  2F3D A;  5IGA A;  4OVR A;  1KA1 A;  4XEQ A;  2PFZ A;  1FPL A;  3NOH A;  5IZZ A;  2QVU A;  3HFU A;  4XF5 A;  5CM6 A;  1NUZ A;  4PBQ A;  4MAG A;  1FBC A;  4IR8 A;  4I3E A;  4NQ8 A;  4N91 A;  3RPL A;  1FBF A;  5A5L A;  5FBP A;  2R8T A;  2JJK A;  1K9Y A;  4OVP A;  1LBW A;  4JVC A;  4P47 A;  4OAN A;  1IMF A;  1AWB A;  4PTK A;  1FJ9 A;  2XWK A;  4NG7 A;  4PET A;  3T0J A;  4QBA A;  1NV1 A;  3FXB A;  4PF8 A;  4MNI A;  2WEF A;  2B4M A;  4YIC A;  1IMD A;  4PDD A;  4PGP A;  4PFI A;  1FPF A;  4X8R A;  4FBP A;  5T3J A;  4NHB A;  5EQ7 A;  1FTA A;  4P3L A;  1G0H A;  2VPO A;  2HZK A;  4GWX A;  4P8B A;  4HCW A;  1Q9D A;  4GWY A;  5F24 A;  2XWI A;  5I5P A;  4N4U A;  5I3S A;  4MIJ A;  2GQ1 A;  4UAB A;  4O94 A;  2OWZ A;  1JP4 A;  1NV2 A;  2QVR A;  2PFY A;  4AS4 A;  5LDZ A;  1FBD A;  1IMA A;  5ET8 A;  1FJ6 A;  1D9Q A;  2WYK A;  1YYZ A;  1VDW A;  1XI6 A;  4HE2 A;  3U65 A;  4PC9 A;  1NUX A;  4GWS A;  4F1U A;  1G0I A;  1NV7 A;  4P1L A;  5J16 A;  4N17 A;  4F18 A;  4NGU A;  4P56 A;  2HHM A;  3LUZ A;  1CNQ A;  1INP A;  2CZH A;  5IZ1 A;  2DVZ A;  1RDY A;  3MYU A;  3MST A;  4F19 A;  3W9W A;  1LBV A;  3ISP A;  4H46 A;  5ET7 A;  1KA0 A;  4I40 A;  2XA5 A;  2B4L A;  4QXD A;  1DBZ A;  2F5X A;  2BJI A;  4PCD A;  1NV6 A;  3RYD A;  4I3Y A;  2DE3 A;  2WYP A;  2ZZV A;  4MEV A;  4HXV A;  2QPQ A;  3IFC A;  5ESY A;  4LN5 A;  3BIG A;  4GBW A;  3W9V A;  5J1D A;  4PAI A;  2WX9 A;  2L5V A;  4O7I A;  1DCU A;  2FIX A;  2VPN A;  4N81 A;  1EYI A;  2FVZ A;  1FPE A;  2F3B A;  4GWW A;  1FBP A;  4PGN A;  2KQZ A;  2FHY A;  5EQA A;  4P9K A;  4PBH A;  3D1R A;  4PFB A;  4N6D A;  1YXI A;  1LEV A;  3QMF A;  4MHF A;  3BIH A;  4HE0 A;  2HPG A;  4O8M A;  4N8Y A;  3T1B A;  4MX6 A;  4GBV A;  4DI3 D;  4GWZ A;  1NV3 A;  1FBE A;  4JVD A;  4OA4 A;  1LBY A;  5ET5 A;  1NUY A;  4GX4 A;  3GYY A;  2Q8M A;  1BK4 A;  2DE4 A;  4GX3 A;  4X9T A;  1FRP A;  5DW8 A;  3B8B A;  3IFA A;  3CHG A;  4XFE A;  5JK4 A;  5EQ8 A;  4AS5 A;  2Q9T A;  5LTC A;  4OVT A;  2MKZ A;  2XWO A;  5IZ3 B;  5IM2 A;  1IME A;  4O7M A;  1FPJ A;  2Q74 A;  2ZZX A;  1FBH A;  1NV5 A;  1NV4 A;  5EQ9 A;  3A29 A;  4MCO A;  2CEY A;  5I7I A;  2KR0 A;  4M1V A;  3LV0 A;  3B50 A;  2HZL A;  3KC1 A;  3E79 A;  2CZK A;  1FPK A;  3EKI A;  4X04 A;  2CZI A;  4MMP A;  2OX3 A;  3SZP A;  4H45 A;  4N8G A;  4PFR A;  2ZZW A;  2WBD A;  1EYK A;  3FBP A;  1IMB A;  4N15 A;  1QGX A;  1K9Z A;  4N6K A;  2XWV A;  4OVQ A;  1FPG A;  1NV0 A;  4NAP A;  5EYG A;  3KC0 A;  2FBP A;  4YZZ A;  4NN3 A;  1LBX A;  3ROJ A;  2DE2 A;  4OVS A;  4NF0 A;  4PF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...