1LBZA

Crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 calcium ions and fructose-1,6 bisphosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
252
structure length
252
Chain Sequence
b'MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 78
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbzA02
1NV2A 4GBVA 1EYKA 4HE0A 1Q9DA 1FPLA 1SPIA 1RDZA 1NI9A 2Y5KA 3KC0A 4GX4A 2F3BA 1NV6A 4I3YA 3A29A 4N81A 2PCRA 2FIXA 5EYHA 5ET6A 1LBWA 3BIGA 3FBPA 1FBCA 5EQ8A 5T3JA 4IR8A 1NUYA 3RPLA 3LV0A 1EYJA 1YXIA 5ESYA 2QVVA 3IFAA 1IMDA 1XI6A 2QVRA 2CZKA 1NV1A 1G0IA 1G0HA 1FPBA 4AS4A 4GWSA 1QGXA 2FIEA 2VT5A 3LUZA 4G61A 5ET7A 3B8BA 1NUXA 4GBWA 4QXDA 3RYDA 5IZ3B 2OX3A 1D9QA 4PTKA 5J16A 5ET5A 1VDWA 2QVUA 2FVZA 4GWYA 4GWWA 1KA1A 4KXPA 1FTAA 1BK4A 5EQ7A 1FPGA 1IMBA 3KBZA 1FJ6A 1YZ0A 1FPIA 4H45A 1FJ9A 5DW8A 4GWZA 2DDKA 1KA0A 2Y5LA 2Q74A 5LDZA 1LBVA 3BIHA 1FRPA 3IFCA 1FPJA 1RDYA 4I40A 3D1RA 1FBFA 4I3EA 1FBGA 3RPLB 2CZIA 1IMCA 5EQ9A 5A5LA 4HXVA 1FBEA 1NV3A 1NV0A 2F3DA 2P3VA 1INPA 3T0JA 2Q8MA 1NV7A 1CNQA 1NUWA 4HE2A 2BJIA 1IMFA 2FBPA 2OWZA 1LBZA 4GX3A 1KZ8A 2HHMA 5F24A 2FHYA 5I3SA 4AS5A 1DBZA 1FPFA 2QFLA 4FBPA 2WBBA 4O7IA 2CZHA 3ROJA 1FSAA 5EYGA 5FBPA 4GWXA 1LBXA 4GX6A 1K9YA 3KC1A 4MJOA 1FPEA 1NUZA 5IZ1A 1FBPA 1IMAA 1AWBA 1YYZA 2P3NA 2GQ1A 1JP4A 1NV4A 1DCUA 2JJKA 3QMFA 1K9ZA 1FPDA 4HE1A 1FPKA 1FBDA 1IMEA 2R8TA 4H46A 1RDXA 5IZ3A 1NV5A 5EQAA 1FBHA 1LBYA 2WEFA 4GWUA 1DK4A 2WBDA 1EYIA 1LEVA 5ET8A
chains in the Genus database with same CATH superfamily
4PC9A 4XKQA 4JVIA 2F7BA 4MEVA 4O3AA 4GX4A 2A5SA 3QIMA 1D4NA 4F22A 1VR5A 3ECRA 4KFQA 4XTCQ 3K6UA 4JSDA 1IXHA 4DDDA 2XXVA 1I6AA 4IR8A 3M3LA 1NUYA 4F2QA 4IGTA 4JWXA 1M5BA 5TP9A 2XA5A 5F1QA 2F34A 3TQLA 5ISUA 2QMXA 3RPWA 3MC2A 4KYSA 3SEUA 4ZEKA 4MH5A 4Z7EA 1FTAA 2R6GE 1US4A 2I58A 3H4ZA 4X8RA 2WYKA 4PAIA 1LCFA 1MRPA 5DW8A 5DVJA 4GWZA 1CE2A 1P1UA 2XX8A 2H99A 2RC8A 1LBVA 2VD3A 3IB1A 3M3FA 1RDYA 1D3KA 1URSA 1B3EA 1IMCA 4PFTA 2I3VA 3P7IA 4XIGQ 3KN8A 4R73A 1P99A 2E1SA 4MNCA 1LAHE 1B2HA 3DELB 4GX3A 3B6QA 1B7HA 4PE3A 4QSCA 5L8DA 3SKPA 4L17A 3A09A 4UACA 4H8IA 1M5FA 5AA4A 3MUQA 4OESA 1PBQA 1QULA 5CMBA 2UXAA 1TFAA 5I5PA 3H03A 2AL4A 2WYPA 1JEUA 4ISUA 3GXAA 3OXNA 1URGA 3MZ9A 1J1NA 4OANA 1Q9DA 1GGGA 4H6DA 1KWHA 4IB2A 3ZKKA 3B50A 1JNFA 2ESNA 1QUIA 2QL3A 3FBPA 5DT6A 3S9MC 1AMFA 2B3FA 4QFLA 1OVTA 1EYJA 1YXIA 2QVVA 1RKMA 4OVRA 2Y7KA 3VVEA 3PMVA 1ZLQA 4FE8A 1TT1A 4JWOA 4O94A 4YKKA 2V25A 3RYDA 5DVIA 4G8HA 3RN8A 1GR2A 4R9GA 3IOUA 2PMSA 2HZKA 4IGRA 2DS9A 1R1NA 3MVZA 1B52A 4THIA 4GVOA 3OO9A 4TLLB 3OMBA 3RPLB 3PPOA 1XVYA 4HS7A 1BIYA 3TELA 3CG3A 1QKBA 2QRYA 4DE8A 2BJIA 4ZZAA 2OWZA 2O1LA 3N26A 5F24A 1SYHA 2Q9TA 3RGYA 2F7CA 4OZ9A 3O97A 5EYFA 1ELJA 4OFJA 5BWJA 5EYGA 1MY3A 2VHAA 5I56B 1B0LA 5CC2A 2OWTA 5CBRA 4JXIA 2JJKA 3T9XB 2CEYA 1LFHA 3E78A 2XX9A 3W15C 4HW8A 1URDA 3T96B 2WEFA 2WBDA 1B46A 1QW0A 1LEVA 2PT2A 1FPLA 3KJ7A 1RDZA 4FATA 4ZECA 1NI9A 4XXUA 3RNNA 4R6HA 3KZGA 1B0HA 2Y7RA 1SW5A 3EKIA 1N3XA 4BDNA 1O7TA 1LBWA 2HQ0A 5T3JA 3PUXE 1M5CA 2ZXTA 4MLVA 1S50A 2I48A 5JK4A 3CFZA 4P56A 1OLCA 3E13X 3VV5A 4C1TA 4KYDA 3CFLA 2HPGA 4EF2A 4G61A 4ZE9A 5K2XA 1O63A 2RCBA 3SERA 4PQJA 3MVWA 4NF5B 4ZEBA 1R6ZA 3EN3A 2NUVA 1PB8A 1FPGA 1QKAA 3G3IA 4JVDA 4ZE8A 5I2NA 5ELVA 4NF0A 2PFZA 2CEXA 5KCJA 1F9BA 1FBGA 1B9JA 5TP9B 4MHFA 3CG1A 2DSFA 1NV0A 2F3DA 4YAHX 4HE2A 1T0KA 4LZ7A 3O9PA 1SQYA 2M8CA 3CI8A 2WX9A 4LQ2A 4AS5A 1Y3NA 2OCUA 2WBBA 5A5XA 2B3BA 3QYTA 4FORA 3VE1B 1LBXA 4YMBA 4NHBA 2H9BA 4DIGA 3OEKA 4KR5A 1B7ZA 3FJ7A 1JP4A 4PAFA 1DCUA 2DWJA 1H3DA 2X26A 3IK6B 4LP2B 1US5A 5I59A 1NV5A 1LBYA 1MDP1 3IJOB 3THIA 5F7VA 4OVJA 3DP6A 1FQBA 3TMGA 4H5FA 2F3BA 3MVXA 4AQ4A 1I6QA 1MH4A 4N81A 4U1ZA 1HSLA 3IB2A 3MZ1A 1YCJA 5I58A 5H8SA 1Q1KA 1LB9A 4ELPA 5AA4B 4PFBA 4M1VA 2XXRA 2QVRA 3EPEA 3SEWA 2Y7IA 3G3GA 4P47A 5FHNA 4X48A 4R9FA 4PBHA 4N17A 2XWVA 1NNKA 2D5WA 3IO4A 4TLMB 3SETA 4KXPA 4LN5A 1ZIUA 3FVGA 4G8MA 4H1XA 4F31B 4G68C 1PBPA 4PGNA 1XHYA 2F7AA 2Y5LA 3LSLA 3KG2A 1BP5A 3OEMA 3FATA 4C1UA 4C0RA 3SESA 2D3IA 2UVJA 2YJPA 2HHMA 1B1HA 5FTIA 3B7DA 4FBPA 4RA1A 1D9VA 2REGA 3DP8A 3KC1A 2FYIA 3EHUA 3QMFA 3GBAA 2OWSA 4EUOA 4IO6A 1FPDA 4NF4B 2DVZA 1YTVA 3U93A 5IAIA 5IZ3A 4F1UA 1IIWA 4PDHA 3D4CA 3RUMA 1XT8A 3WAEA 1SYIA 2KLFA 3FXQA 3IJXB 3RQTA 2PCRA 3W9WA 1H45A 1GVCA 1ZTYA 3VFJA 1EU8A 1MM7A 2ZYNA 2Z8EA 1IXIA 1USYE 1POY1 2QMWA 4N4UA 5CMCA 4IY5A 4N6DA 1A55A 2GRVA 2F6PA 4BDMA 3PGFA 1KA1A 3FXBA 3TTMA 3G3FA 2DVCA 3KEIA 3H06B 2ZYKA 2ZZXA 4RJZA 3UIFA 1KA0A 3SZPA 3EF7A 3IFCA 1N04A 3K6XA 3PPQA 5L9MA 2VP1A 1H76A 1NNFA 4OEVA 1FBEA 1MY0A 4PDDA 2XWKA 3A3UA 3CR9A 1CNQA 3K0VA 4R2BA 1H44A 1IMFA 2DOJA 2XD3A 4R6YA 2I49A 1HSJA 3IB0A 1R9QA 3PPPA 2BJJX 3GLBA 3UN6A 2RC9A 3HO7A 3K6WA 2HZLA 4MJOA 1FPEA 3LSXA 1FBPA 2H98A 2I0BA 5DVFA 5I2NB 2GQ1A 3UGWA 1NV4A 4G68A 1IZ1A 1K9ZA 2FNCA 1JW4A 5KCJB 3HHGA 3FIRA 1FPKA 4O3BA 4ZEFA 2R8TA 4R74A 2DWIA 1Z7NE 4O3CA 1NV2A 1P1OA 1EYKA 1RYXA 2P0SA 4PE5B 4MAGA 4LATA 1NV6A 3U1OA 3K1PA 4MNPA 4F3PA 5A5XB 3H7MA 2DP8A 2D21A 3Q25A 5CMKA 4U4XA 2QPQA 5ESYA 2OPDA 3PMWA 1MH3A 3TCGA 3TCHA 4F3BA 2CZKA 1N0TA 3USDA 2ABHA 1OIBA 3LUZA 4IO4A 4DI4B 5H8HA 5I59B 1PB7A 1D9QA 4OYVA 4LA9A 3CVGA 3KOSA 3C34A 4DXBA 3HV1A 3Q27A 4WEPA 2F97A 5I58B 2CZLA 4RY1A 3FZVA 1MXZA 5A5LA 4GRKA 4JBZA 2HAVA 3TAJA 4Q5TA 1LBBA 2GH9A 5CI5A 2AYSA 1MY2A 3FVNA 1JVXA 2YLNA 4P1LA 2AL5A 1A54A 4P11A 3CFXA 4PFUA 5IZ1A 4G77A 4PP0A 4U23A 3HN0A 3TTKA 4PAKA 1M5DA 1QJMA 3KSXA 2VGQA 2I4CA 2XXXA 3ILTB 2OJTA 3MPKA 3PUWE 4HTGA 5IKBA 3PD8A 4HCYA 1SPIA 1CB6A 3FV2A 4DZ1A 4ELQA 3KGCA 1B4HA 4LONB 5FHOA 1PDAA 3Q28A 1FBCA 1B58A 2VOZA 3CSBA 2ALUA 1DMBA 3PUZE 3UK4A 1G0HA 3H6TA 1LAGE 2VPNA 4N8GA 1Y20A 5IZ3B 3OSQA 3LSFB 1I6BA 1ATGA 2R71A 1VDWA 4GF8A 4NX1A 4FAJA 5B70A 5EQ7A 1DPEA 3BKIB 3DP4A 2F5XA 1YZ0A 4H8JA 3IOWA 4KD5A 5CMMA 5KDTB 3FJGA 5LDZA 1B3HA 3HPIA 1UQWA 3MAMA 3TFLA 4I3EA 4YICA 2Z23A 4QFOA 1INPA 4FIMA 2HXRA 2Q8MA 1UTBB 1JW1A 5CM6A 1Y1ZA 1AOVA 4N8YA 1MPBA 3H3GA 2ZYOA 1OMPA 1JQFA 1YAEA 2CZHA 2F78A 3KN7A 1WDNA 4I1DA 2I6EA 3G3KA 3MZBA 2HAUA 4RPNA 1JEVA 1NUZA 4LZ8A 3O6HA 3LSWA 3L6GA 5FHMA 3MSTA 4P8BA 4JB7A 4OVPA 3D4GA 4LUBA 1UIUA 1Q35A 1JW5A 3MBPA 3BIGA 3Q29A 1MY4A 4PETA 3MJNA 3H6WA 3IOTA 5CBSA 2V93A 4G68B 2FIEA 1II5A 4QRZA 3ONMA 1NNPA 1TXFA 2OX3A 4PTKA 2GFEA 5ET5A 2ZMBA 4OFOA 3BFUA 3T9UA 4KCCA 2X7QA 5TPAA 3KFMA 3S9EA 1NH7A 1FTJA 2Y7WA 3TCFA 3HSTA 1MPDA 4XKRA 4RXLA 4KPTA 4XF5A 3K6VA 4MNIA 3TTRA 4YKIA 4HXVA 2I0CA 3N5LA 2P3VA 1NUWA 2DE4A 4MX6A 3L6HA 3JZJA 4ZZEA 4XKNA 4U2RA 5H8HB 2XWOA 1MDQA 1MQHA 4O7IA 5FBPA 2PFYA 3ZSFA 3MYUA 1S7YA 3BFTA 1IMAA 3FV1A 4AB5A 1SVXB 4P0GA 3H6VA 5L9OA 5AA1A 3HHFA 3E4RA 3C33A 4F18A 5AE4A 4OTEA 2Y7PA 2V84A 4Q0CA 2PT1A 1LB8A 4YMAA 4IO7A 4P9KA 1IEJA 3N6UA 3LC8A 3G3HA 1JETA 1SW1A 1AH5A 2B65A 4O8MA 3MWBA 1MQJA 2FIXA 3K2DA 4MFIA 4DLDA 1POTA 1R9LA 2XXHA 3MPLA 3Q26A 1YPNA 1G0IA 4OETA 3A3CA 3RT6B 2Q2AA 1MXXA 4QXDA 2UYEA 5IZZA 3OELA 3OENA 4OEUA 4EDPA 2E0SA 3V8XB 2ONKE 4X1BA 4OVSA 3AXFA 3OSRA 4JWYA 1Y9UA 1DTZA 3G7WA 1VFDA 4NG7A 4GIZA 2QS1A 3ZKLA 2DE3A 4DXUA 4H67A 1N7XA 1FRPA 2F36A 2XXYA 3R26A 1P1QA 1B6HA 1A99A 4ND9A 1ZJLA 1QVSA 1LCTA 2G93A 5I7IA 2HXWA 2Q8JA 4GWOA 3ZS6A 2B4MA 5M2VA 4NWDA 4EF1A 3E79A 3VLWA 1N7WA 1YYZA 3K1NA 4EQ7A 4PF8A 1A40A 3RT8A 1FBDA 3MW0A 1FBHA 4RK2A 2REJA 3PPRA 5I2KA 3B6WA 3KOTA 2I4BA 4G4PA 2XXTA 2DWAA 2FA7A 4U22A 1TFDA 1XS5A 5BUUA 3I6VA 3O66A 3CRBA 4OVTA 5IM2A 1XI6A 4ZEDA 4GWSA 3TZAA 4N15A 3MQ9A 1MQDA 4POWA 4I62A 4ECFA 4I8CA 2ZYMA 1WODA 1XC1A 4GWYA 2RKMA 1USYH 5LTCA 4P1EA 3VLVA 1FPIA 3MP1A 1FJ9A 3S4UA 3UA8A 1I69A 1IXCA 4GD5A 4R72A 1Y4TA 3K1MA 4FECA 3C9HA 1ZKBA 5EQ9A 4NTLA 3TDJA 1EZ9A 3OO7A 5EHSA 4PGPA 5H8NA 1OQGA 2P2AA 1GV8A 3V5AA 2XXWA 4ZS9A 3TPAA 2PYYA 3PUYE 4JVCA 4UA8A 1MPCA 3DLNA 1FPFA 1LFIA 1EZPA 1P1NA 3PV0E 4ELOA 1LGBC 2HEUA 2O68A 3T1BA 2RF1A 4HE1A 1PB9A 1DK4A 5DEXA 1B3FA 1FW0A 4GBVA 3FXUA 4NEDA 4XKPA 4PFIA 2XD2A 4FEDA 3FASA 4GQOA 2V3QA 3TEPA 4X1DA 4QBAA 4GOTA 1IITA 1XVXA 2XXKA 4DI3D 2PX1A 1NH8A 5ICTA 1FTOA 1Y3QA 3SEXA 1MXUA 1S9TA 1IMDA 4AS4A 5ITOA 4N91A 2VT5A 2X7PA 3FXRA 1MM6A 1N76A 1HSEA 3U94A 3B6TA 3EQ1A 2PVUA 3R6UA 3M8UA 4ESWA 2HFBA 1MXWA 1D9YA 1IMBA 2A5TA 3KBZA 3NOHA 3VLUA 4H45A 4F29A 3S9LC 3KN3A 1EH3A 2O7IA 3RTFB 5K2YA 1FPJA 1MY1A 3FGSA 3SEVA 3DM0A 1VFEA 4QFPA 1Y1MA 1NV7A 4JSOA 1H43A 3PTYA 1MXVA 1LBZA 1DBZA 3CSGA 5AA2D 4AB6A 4N6KA 3FVOA 2XWIA 4NF8A 3FVKA 4PFRA 3TTLA 4U21A 1UIVA 1OLAA 3PPNA 2RC7A 3C36A 2Z8FA 4PBQA 4R6KA 1EYIA 1QUJA 4OA4A 3V83A 3R7XA 2H25A 3T66A 4R75A 2QSXA 2Y5KA 3KC0A 3OO6A 1MS7A 2F35A 4MIJA 3U92A 1B1XA 3HCQA 3SEYA 3T9VA 2UVHA 3UP9A 4LZ5A 5CRYA 3K00A 5H8QA 4PCDA 1Y4CA 2LAOA 3IX1A 5I2KB 4GWWA 1MQGA 2F6GA 1IXGA 4JDFA 4X9TA 3PD9A 1PEBA 4BDRA 2DDKA 3VDFA 2Q74A 1M5EA 3LR1A 3E9XA 4I40A 3D1RA 1FBFA 2OK2A 4H0WA 1FQDA 1EZOA 1NV3A 2VPOA 1MQIA 3GBBA 4QFKA 2Q88A 4OWDA 3T93B 4IY6A 4P0IA 2KR0A 2O6AA 5DYHA 1A7LA 5JTYA 2QS3A 3OO8A 3U72A 3GYYA 2DXRA 2OBGA 4R2FA 1FSAA 2Q2CA 2XHDA 4N6PA 4ELRA 4OHNA 5HM4B 2P3NA 2NOOA 4YB5A 5AA2A 4MF3A 1SW2A 4POXA 2G29A 1B05A 1OVBA 3BBRA 2ONRA 4QHQA 1TWYA 4LQ5A 5EHMA 5H8NB 3GZGA 1MXYA 4NGUA 1BTJA 1SDXA 2F8DA 4NQ8A 3C31A 3LBSA 4G2ZA 4MLQA 3RTWB 2CMOA 3A29A 3TQWA 2UVGA 1FCKA 4YB7A 4FEBA 2I3WA 4O7MA 4TOZA 4OXVA 3SDFA 4PF6A 3FUZA 3C35A 4NWCA 2ZNTA 3ISPA 2ZNUA 4H5GA 5I57A 4NMYA 2IEEA 3N6TA 4NF4A 3IO6A 2KQZA 4F3SA 3UORA 3IOVA 1Z7ME 1NUXA 4ONYA 1B5IA 5DEXB 4WKMA 1B3GA 3MP6A 3N94A 1SI1A 4RYAA 1FJ6A 2PBWA 2P1SA 1FTMA 4KCDA 4OQOA 4IO2A 2VD2A 3U65A 3O29A 5TU0A 5L9SA 1B40A 3K02A 1WVJA 4OVQA 1RYOA 2OLBA 1VSOA 3T22A 4ZDMA 3QXMA 4N07A 5HBCA 2RINA 4BDLA 4YB6A 1NL5A 2FBPA 1KZ8A 4GXAA 4YU0A 1O64A 3E3KA 2HCAA 2ANJA 3S2VA 4M4GA 1JVYA 4GWXA 1AL3A 1LSTA 4MMPA 4EQBA 2A5TB 1ZMGA 2W7YA 4F39A 1QUKA 3G3JA 2H4IA 3VXCA 3MVYA 2XXPA 3CIJA 3PMXA 3FD3A 4EXKA 1RDXA 2XXUA 3IAZA 2NVUB 4GFRA 4NF6A 3QK6A 4ZEIA 5ET8A 4XFEA 5ITPA 3TUSA 1BLFA 4EXLA 1B51A 1XOCA 3PU5A 1FTLA 1P1WA 5ET6A 1MG1A 2ZZWA 1NMUA 1LBCA 5JEIA 1N3WA 1PC3A 4LVQA 3RY3A 2Z22A 1LFGA 4NF8B 2B4LA 2QS4A 3M3KA 1QGXA 3MP8A 3ODBA 4MCOA 4QFNA 2XX7A 2DWHA 2ZZVA 4U4SA 5LOMA 2FVZA 4KQPA 1B32A 5H8FA 3W9VA 4GLIA 4E0WA 3QAXA 4N13A 4F2OA 1SW4A 3EHTA 1SD3A 3VVFA 1SBPA 1UTHA 4QSDA 4MBPA 4F3GA 2O7UA 4OMBA 3QUJA 2CZIA 2L5VA 4E0XA 5I84A 3T0JA 2OPEA 3I3VA 5H8QB 1AIVA 1NNTA 1IQ7A 4YKPA 1ZU0A 3FJMA 3ROJA 1FQFA 1B4ZA 2QJEA 3QUFA 4RK9A 4UABA 2DYXA 2QS2A 2GHBA 3VXBA 4FJPA 1B5JA 4NN3A 1GTKA 2YPNA 5IGAA 4PFYA 1LAXA 4Q8RA 4GWUA 2DQVA 2NXOA 4Z0IA 3OOAA 1B3LA 4I3YA 5JTYB 3PUVE 3O6IA 2Q89A 5EYHA 3OD7A 1LLSA 4IO3A 4HCWA 1OQHA 3KJTA 1N84A 2Z8DA 4KHZE 3WAFA 2GHAA 1NV1A 2RCAA 5AA2B 1ZBMA 2AIXA 2O1MA 1DSNA 4GL8A 4X04A 3C4MA 3JYRA 4H65A 2THIA 4NAPA 1ANFA 5J16A 2DXYA 1BK4A 2V3TA 2NWJA 4EQ9A 2IA4A 1A8FA 4F1VA 4DCXA 3BIHA 4OFLA 3F11A 4WEDA 1FTKA 3TKDA 5I57B 5B7DA 4BLAA 3JV9A 2Y84A 3RLFE 4IO5A 4GXSB 4QSEA 2FHYA 5I3SA 2ZNSA 4U1OA 1K9YA 1BKAA 1FQAA 4WXJA 5KZTA 5KDTA 4NE4A 3O2AA 1AWBA 1DOTA 3K4UA 2XXIA 3HFUA 1IMEA 4G8NA 4H46A 5EQAA 4BDQA 1UTBA 2V3UA 4HE0A 4PFWA 3IR1A 4DXCA 3TYHA 2WKYA 2OZZA 1NKXA 3TODA 5TPAB 1B7UA 2UVIA 5AA3A 5EQ8A 3RPLA 1A8EA 3LV0A 1FQCA 3IFAA 3KBRA 4XEQA 3QSLA 4QF9A 1FPBA 3EHSA 1L5TA 4YZZA 2O84X 5ET7A 3B8BA 4GBWA 4OERA 3I5OA 2QVUA 4NF6B 3VVDA 4I9DA 1DPPA 1VE4A 4BDOA 5DTBA 1IUDA 4RNSA 2O51A 3K01A 2MKZA 4K3FA 5I56A 2XXQA 4RPOA 5HPQA 3O28A 4KI0E 1SI0A 2R9JA 3S9NC 2ONSA 5ICQA 3IORA 4OENA 1DTGA 2O69A 4P3LA 4F1YA 3LUYA 3H6UA 5FTHA 3O6GA 3IL1B 2QFLA 3TTNA 3V89B 1LAFE 2V4CA 4GX6A 3CHGA 4DCYA 4TQUQ 5H8FB 1B5HA 3ILUB 4KYEA 2UYFA 3C32A 4GL0A 4YKJA 4ESXA 4Q30B 3T9HB 1UTHB 4F19A 2DE2A 1FQEA 5J1DA 2H5YA 1NFTA 4NF5A 1Y3PA 3KSJA 3U8QA
chains in the Genus database with same CATH topology
4PC9A 4JVIA 4NGUA 4MEVA 4NQ8A 4GX4A 4O8MA 3A29A 2PCRA 3W9WA 2FIXA 4O7MA 4IR8A 1NUYA 4PF6A 2XA5A 3ISPA 1G0IA 2KQZA 4N4UA 1NUXA 4QXDA 4N6DA 5IZZA 1KA1A 3FXBA 1FTAA 4OVSA 4X8RA 1FJ6A 2WYKA 4PAIA 3U65A 5DW8A 4NG7A 4GWZA 2ZZXA 2DE3A 1KA0A 3SZPA 1LBVA 3IFCA 1FRPA 4OVQA 1RDYA 1IMCA 1FBEA 4PDDA 2XWKA 1CNQA 4MNCA 1IMFA 2FBPA 4GX3A 5I7IA 1KZ8A 4PE3A 2B4MA 4GWXA 2HZLA 4MMPA 4MJOA 1FPEA 3E79A 1FBPA 1YYZA 2GQ1A 5I5PA 1NV4A 2WYPA 1K9ZA 4PF8A 1FPKA 1FBDA 2R8TA 1RDXA 1FBHA 5ET8A 1NV2A 4XFEA 1EYKA 4OANA 1Q9DA 4MAGA 1NV6A 3B50A 4MNPA 5ET6A 3FBPA 2ZZWA 2QPQA 1EYJA 1YXIA 5ESYA 2QVVA 4OVTA 4OVRA 5IM2A 1XI6A 2CZKA 4GWSA 2B4LA 4N15A 1QGXA 4MCOA 3LUZA 4O94A 4DI4B 3RYDA 1D9QA 2ZZVA 2FVZA 4GWYA 2HZKA 5LTCA 4P1EA 3W9VA 1FPIA 1FJ9A 3RPLB 2CZIA 5EQ9A 5A5LA 2L5VA 4PGPA 3T0JA 2BJIA 4JVCA 2OWZA 5F24A 2Q9TA 1FPFA 4P1LA 3ROJA 5EYGA 4UABA 5IZ1A 4NN3A 2JJKA 4PAKA 3T1BA 5IGAA 2CEYA 4HE1A 3E78A 4GWUA 2WEFA 1DK4A 2WBDA 1LEVA 4GBVA 1FPLA 4HCYA 1SPIA 1RDZA 4PFIA 1NI9A 4I3YA 2V3QA 3EKIA 5EYHA 4QBAA 1LBWA 1FBCA 5T3JA 4HCWA 2XXKA 4DI3D 5JK4A 1IMDA 4P56A 1NV1A 1G0HA 4AS4A 4N91A 2VPNA 2VT5A 4N8GA 2HPGA 4G61A 4X04A 4NAPA 5IZ3B 5J16A 1VDWA 4NX1A 1BK4A 5EQ7A 1FPGA 1IMBA 3KBZA 2F5XA 3NOHA 1YZ0A 4JVDA 4H45A 4F1VA 4NF0A 2PFZA 5LDZA 2CEXA 3BIHA 1FPJA 4I3EA 1FBGA 4MHFA 4YICA 1NV0A 2F3DA 1INPA 2HXRA 2Q8MA 1NV7A 4HE2A 3PTYA 5CM6A 1LBZA 2WX9A 4N8YA 2FHYA 5I3SA 4AS5A 1DBZA 2WBBA 2CZHA 1LBXA 1K9YA 4N6KA 4NHBA 1NUZA 1AWBA 2XWIA 4PAFA 1JP4A 1DCUA 3HFUA 4PFRA 1IMEA 4H46A 1NV5A 5EQAA 3MSTA 4P8BA 1LBYA 4PBQA 1EYIA 4OA4A 4OVPA 4HE0A 2Y5KA 3KC0A 2F3BA 4N81A 4MIJA 3BIGA 5EQ8A 3RPLA 3LV0A 4PFBA 3IFAA 4XEQA 4M1VA 2QVRA 4PETA 1FPBA 2FIEA 4YZZA 4P47A 4PCDA 5ET7A 3B8BA 4GBWA 4PBHA 2OX3A 4PTKA 2XWVA 4N17A 5ET5A 2QVUA 4GWWA 4KXPA 4LN5A 2MKZA 4X9TA 2DDKA 4PGNA 2Y5LA 2Q74A 4I40A 3D1RA 1FBFA 4XF5A 4MNIA 4HXVA 1NV3A 4P3LA 2P3VA 2VPOA 1NUWA 2DE4A 4MX6A 2KR0A 2HHMA 2XWOA 3GYYA 2QFLA 4FBPA 4O7IA 5FBPA 1FSAA 2PFYA 2V4CA 3MYUA 4GX6A 3CHGA 3KC1A 1IMAA 2P3NA 3QMFA 1FPDA 4F19A 2DE2A 4F18A 2DVZA 5J1DA 5IZ3A 4F1UA 4PDHA 4P9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV2 A;  4GBV A;  1EYK A;  4HE0 A;  1Q9D A;  1FPL A;  1SPI A;  1RDZ A;  1NI9 A;  2Y5K A;  3KC0 A;  4GX4 A;  2F3B A;  1NV6 A;  4I3Y A;  3A29 A;  4N81 A;  2PCR A;  2FIX A;  5EYH A;  5ET6 A;  1LBW A;  3BIG A;  3FBP A;  1FBC A;  5EQ8 A;  5T3J A;  4IR8 A;  1NUY A;  3RPL A;  3LV0 A;  1EYJ A;  1YXI A;  5ESY A;  2QVV A;  3IFA A;  1IMD A;  1XI6 A;  2QVR A;  2CZK A;  1NV1 A;  1G0I A;  1G0H A;  1FPB A;  4AS4 A;  4GWS A;  1QGX A;  2FIE A;  2VT5 A;  3LUZ A;  4G61 A;  5ET7 A;  3B8B A;  1NUX A;  4GBW A;  4QXD A;  3RYD A;  5IZ3 B;  2OX3 A;  1D9Q A;  4PTK A;  5J16 A;  5ET5 A;  1VDW A;  2QVU A;  2FVZ A;  4GWY A;  4GWW A;  1KA1 A;  4KXP A;  1FTA A;  1BK4 A;  5EQ7 A;  1FPG A;  1IMB A;  3KBZ A;  1FJ6 A;  1YZ0 A;  1FPI A;  4H45 A;  1FJ9 A;  5DW8 A;  4GWZ A;  2DDK A;  1KA0 A;  2Y5L A;  2Q74 A;  5LDZ A;  1LBV A;  3BIH A;  1FRP A;  3IFC A;  1FPJ A;  1RDY A;  4I40 A;  3D1R A;  1FBF A;  4I3E A;  1FBG A;  3RPL B;  2CZI A;  1IMC A;  5EQ9 A;  5A5L A;  4HXV A;  1FBE A;  1NV3 A;  1NV0 A;  2F3D A;  2P3V A;  1INP A;  3T0J A;  2Q8M A;  1NV7 A;  1CNQ A;  1NUW A;  4HE2 A;  2BJI A;  1IMF A;  2FBP A;  2OWZ A;  1LBZ A;  4GX3 A;  1KZ8 A;  2HHM A;  5F24 A;  2FHY A;  5I3S A;  4AS5 A;  1DBZ A;  1FPF A;  2QFL A;  4FBP A;  2WBB A;  4O7I A;  2CZH A;  3ROJ A;  1FSA A;  5EYG A;  5FBP A;  4GWX A;  1LBX A;  4GX6 A;  1K9Y A;  3KC1 A;  4MJO A;  1FPE A;  1NUZ A;  5IZ1 A;  1FBP A;  1IMA A;  1AWB A;  1YYZ A;  2P3N A;  2GQ1 A;  1JP4 A;  1NV4 A;  1DCU A;  2JJK A;  3QMF A;  1K9Z A;  1FPD A;  4HE1 A;  1FPK A;  1FBD A;  1IME A;  2R8T A;  4H46 A;  1RDX A;  5IZ3 A;  1NV5 A;  5EQA A;  1FBH A;  1LBY A;  2WEF A;  4GWU A;  1DK4 A;  2WBD A;  1EYI A;  1LEV A;  5ET8 A; 
#chains in the Genus database with same CATH topology
 4PC9 A;  4XKQ A;  4JVI A;  2F7B A;  4MEV A;  4O3A A;  4GX4 A;  2A5S A;  3QIM A;  1D4N A;  4F22 A;  1VR5 A;  3ECR A;  4KFQ A;  4XTC Q;  3K6U A;  4JSD A;  1IXH A;  4DDD A;  2XXV A;  1I6A A;  4IR8 A;  3M3L A;  1NUY A;  4F2Q A;  4IGT A;  4JWX A;  1M5B A;  5TP9 A;  2XA5 A;  5F1Q A;  2F34 A;  3TQL A;  5ISU A;  2QMX A;  3RPW A;  3MC2 A;  4KYS A;  3SEU A;  4ZEK A;  4MH5 A;  4Z7E A;  1FTA A;  2R6G E;  1US4 A;  2I58 A;  3H4Z A;  4X8R A;  2WYK A;  4PAI A;  1LCF A;  1MRP A;  5DW8 A;  5DVJ A;  4GWZ A;  1CE2 A;  1P1U A;  2XX8 A;  2H99 A;  2RC8 A;  1LBV A;  2VD3 A;  3IB1 A;  3M3F A;  1RDY A;  1D3K A;  1URS A;  1B3E A;  1IMC A;  4PFT A;  2I3V A;  3P7I A;  4XIG Q;  3KN8 A;  4R73 A;  1P99 A;  2E1S A;  4MNC A;  1LAH E;  1B2H A;  3DEL B;  4GX3 A;  3B6Q A;  1B7H A;  4PE3 A;  4QSC A;  5L8D A;  3SKP A;  4L17 A;  3A09 A;  4UAC A;  4H8I A;  1M5F A;  5AA4 A;  3MUQ A;  4OES A;  1PBQ A;  1QUL A;  5CMB A;  2UXA A;  1TFA A;  5I5P A;  3H03 A;  2AL4 A;  2WYP A;  1JEU A;  4ISU A;  3GXA A;  3OXN A;  1URG A;  3MZ9 A;  1J1N A;  4OAN A;  1Q9D A;  1GGG A;  4H6D A;  1KWH A;  4IB2 A;  3ZKK A;  3B50 A;  1JNF A;  2ESN A;  1QUI A;  2QL3 A;  3FBP A;  5DT6 A;  3S9M C;  1AMF A;  2B3F A;  4QFL A;  1OVT A;  1EYJ A;  1YXI A;  2QVV A;  1RKM A;  4OVR A;  2Y7K A;  3VVE A;  3PMV A;  1ZLQ A;  4FE8 A;  1TT1 A;  4JWO A;  4O94 A;  4YKK A;  2V25 A;  3RYD A;  5DVI A;  4G8H A;  3RN8 A;  1GR2 A;  4R9G A;  3IOU A;  2PMS A;  2HZK A;  4IGR A;  2DS9 A;  1R1N A;  3MVZ A;  1B52 A;  4THI A;  4GVO A;  3OO9 A;  4TLL B;  3OMB A;  3RPL B;  3PPO A;  1XVY A;  4HS7 A;  1BIY A;  3TEL A;  3CG3 A;  1QKB A;  2QRY A;  4DE8 A;  2BJI A;  4ZZA A;  2OWZ A;  2O1L A;  3N26 A;  5F24 A;  1SYH A;  2Q9T A;  3RGY A;  2F7C A;  4OZ9 A;  3O97 A;  5EYF A;  1ELJ A;  4OFJ A;  5BWJ A;  5EYG A;  1MY3 A;  2VHA A;  5I56 B;  1B0L A;  5CC2 A;  2OWT A;  5CBR A;  4JXI A;  2JJK A;  3T9X B;  2CEY A;  1LFH A;  3E78 A;  2XX9 A;  3W15 C;  4HW8 A;  1URD A;  3T96 B;  2WEF A;  2WBD A;  1B46 A;  1QW0 A;  1LEV A;  2PT2 A;  1FPL A;  3KJ7 A;  1RDZ A;  4FAT A;  4ZEC A;  1NI9 A;  4XXU A;  3RNN A;  4R6H A;  3KZG A;  1B0H A;  2Y7R A;  1SW5 A;  3EKI A;  1N3X A;  4BDN A;  1O7T A;  1LBW A;  2HQ0 A;  5T3J A;  3PUX E;  1M5C A;  2ZXT A;  4MLV A;  1S50 A;  2I48 A;  5JK4 A;  3CFZ A;  4P56 A;  1OLC A;  3E13 X;  3VV5 A;  4C1T A;  4KYD A;  3CFL A;  2HPG A;  4EF2 A;  4G61 A;  4ZE9 A;  5K2X A;  1O63 A;  2RCB A;  3SER A;  4PQJ A;  3MVW A;  4NF5 B;  4ZEB A;  1R6Z A;  3EN3 A;  2NUV A;  1PB8 A;  1FPG A;  1QKA A;  3G3I A;  4JVD A;  4ZE8 A;  5I2N A;  5ELV A;  4NF0 A;  2PFZ A;  2CEX A;  5KCJ A;  1F9B A;  1FBG A;  1B9J A;  5TP9 B;  4MHF A;  3CG1 A;  2DSF A;  1NV0 A;  2F3D A;  4YAH X;  4HE2 A;  1T0K A;  4LZ7 A;  3O9P A;  1SQY A;  2M8C A;  3CI8 A;  2WX9 A;  4LQ2 A;  4AS5 A;  1Y3N A;  2OCU A;  2WBB A;  5A5X A;  2B3B A;  3QYT A;  4FOR A;  3VE1 B;  1LBX A;  4YMB A;  4NHB A;  2H9B A;  4DIG A;  3OEK A;  4KR5 A;  1B7Z A;  3FJ7 A;  1JP4 A;  4PAF A;  1DCU A;  2DWJ A;  1H3D A;  2X26 A;  3IK6 B;  4LP2 B;  1US5 A;  5I59 A;  1NV5 A;  1LBY A;  1MDP 1;  3IJO B;  3THI A;  5F7V A;  4OVJ A;  3DP6 A;  1FQB A;  3TMG A;  4H5F A;  2F3B A;  3MVX A;  4AQ4 A;  1I6Q A;  1MH4 A;  4N81 A;  4U1Z A;  1HSL A;  3IB2 A;  3MZ1 A;  1YCJ A;  5I58 A;  5H8S A;  1Q1K A;  1LB9 A;  4ELP A;  5AA4 B;  4PFB A;  4M1V A;  2XXR A;  2QVR A;  3EPE A;  3SEW A;  2Y7I A;  3G3G A;  4P47 A;  5FHN A;  4X48 A;  4R9F A;  4PBH A;  4N17 A;  2XWV A;  1NNK A;  2D5W A;  3IO4 A;  4TLM B;  3SET A;  4KXP A;  4LN5 A;  1ZIU A;  3FVG A;  4G8M A;  4H1X A;  4F31 B;  4G68 C;  1PBP A;  4PGN A;  1XHY A;  2F7A A;  2Y5L A;  3LSL A;  3KG2 A;  1BP5 A;  3OEM A;  3FAT A;  4C1U A;  4C0R A;  3SES A;  2D3I A;  2UVJ A;  2YJP A;  2HHM A;  1B1H A;  5FTI A;  3B7D A;  4FBP A;  4RA1 A;  1D9V A;  2REG A;  3DP8 A;  3KC1 A;  2FYI A;  3EHU A;  3QMF A;  3GBA A;  2OWS A;  4EUO A;  4IO6 A;  1FPD A;  4NF4 B;  2DVZ A;  1YTV A;  3U93 A;  5IAI A;  5IZ3 A;  4F1U A;  1IIW A;  4PDH A;  3D4C A;  3RUM A;  1XT8 A;  3WAE A;  1SYI A;  2KLF A;  3FXQ A;  3IJX B;  3RQT A;  2PCR A;  3W9W A;  1H45 A;  1GVC A;  1ZTY A;  3VFJ A;  1EU8 A;  1MM7 A;  2ZYN A;  2Z8E A;  1IXI A;  1USY E;  1POY 1;  2QMW A;  4N4U A;  5CMC A;  4IY5 A;  4N6D A;  1A55 A;  2GRV A;  2F6P A;  4BDM A;  3PGF A;  1KA1 A;  3FXB A;  3TTM A;  3G3F A;  2DVC A;  3KEI A;  3H06 B;  2ZYK A;  2ZZX A;  4RJZ A;  3UIF A;  1KA0 A;  3SZP A;  3EF7 A;  3IFC A;  1N04 A;  3K6X A;  3PPQ A;  5L9M A;  2VP1 A;  1H76 A;  1NNF A;  4OEV A;  1FBE A;  1MY0 A;  4PDD A;  2XWK A;  3A3U A;  3CR9 A;  1CNQ A;  3K0V A;  4R2B A;  1H44 A;  1IMF A;  2DOJ A;  2XD3 A;  4R6Y A;  2I49 A;  1HSJ A;  3IB0 A;  1R9Q A;  3PPP A;  2BJJ X;  3GLB A;  3UN6 A;  2RC9 A;  3HO7 A;  3K6W A;  2HZL A;  4MJO A;  1FPE A;  3LSX A;  1FBP A;  2H98 A;  2I0B A;  5DVF A;  5I2N B;  2GQ1 A;  3UGW A;  1NV4 A;  4G68 A;  1IZ1 A;  1K9Z A;  2FNC A;  1JW4 A;  5KCJ B;  3HHG A;  3FIR A;  1FPK A;  4O3B A;  4ZEF A;  2R8T A;  4R74 A;  2DWI A;  1Z7N E;  4O3C A;  1NV2 A;  1P1O A;  1EYK A;  1RYX A;  2P0S A;  4PE5 B;  4MAG A;  4LAT A;  1NV6 A;  3U1O A;  3K1P A;  4MNP A;  4F3P A;  5A5X B;  3H7M A;  2DP8 A;  2D21 A;  3Q25 A;  5CMK A;  4U4X A;  2QPQ A;  5ESY A;  2OPD A;  3PMW A;  1MH3 A;  3TCG A;  3TCH A;  4F3B A;  2CZK A;  1N0T A;  3USD A;  2ABH A;  1OIB A;  3LUZ A;  4IO4 A;  4DI4 B;  5H8H A;  5I59 B;  1PB7 A;  1D9Q A;  4OYV A;  4LA9 A;  3CVG A;  3KOS A;  3C34 A;  4DXB A;  3HV1 A;  3Q27 A;  4WEP A;  2F97 A;  5I58 B;  2CZL A;  4RY1 A;  3FZV A;  1MXZ A;  5A5L A;  4GRK A;  4JBZ A;  2HAV A;  3TAJ A;  4Q5T A;  1LBB A;  2GH9 A;  5CI5 A;  2AYS A;  1MY2 A;  3FVN A;  1JVX A;  2YLN A;  4P1L A;  2AL5 A;  1A54 A;  4P11 A;  3CFX A;  4PFU A;  5IZ1 A;  4G77 A;  4PP0 A;  4U23 A;  3HN0 A;  3TTK A;  4PAK A;  1M5D A;  1QJM A;  3KSX A;  2VGQ A;  2I4C A;  2XXX A;  3ILT B;  2OJT A;  3MPK A;  3PUW E;  4HTG A;  5IKB A;  3PD8 A;  4HCY A;  1SPI A;  1CB6 A;  3FV2 A;  4DZ1 A;  4ELQ A;  3KGC A;  1B4H A;  4LON B;  5FHO A;  1PDA A;  3Q28 A;  1FBC A;  1B58 A;  2VOZ A;  3CSB A;  2ALU A;  1DMB A;  3PUZ E;  3UK4 A;  1G0H A;  3H6T A;  1LAG E;  2VPN A;  4N8G A;  1Y20 A;  5IZ3 B;  3OSQ A;  3LSF B;  1I6B A;  1ATG A;  2R71 A;  1VDW A;  4GF8 A;  4NX1 A;  4FAJ A;  5B70 A;  5EQ7 A;  1DPE A;  3BKI B;  3DP4 A;  2F5X A;  1YZ0 A;  4H8J A;  3IOW A;  4KD5 A;  5CMM A;  5KDT B;  3FJG A;  5LDZ A;  1B3H A;  3HPI A;  1UQW A;  3MAM A;  3TFL A;  4I3E A;  4YIC A;  2Z23 A;  4QFO A;  1INP A;  4FIM A;  2HXR A;  2Q8M A;  1UTB B;  1JW1 A;  5CM6 A;  1Y1Z A;  1AOV A;  4N8Y A;  1MPB A;  3H3G A;  2ZYO A;  1OMP A;  1JQF A;  1YAE A;  2CZH A;  2F78 A;  3KN7 A;  1WDN A;  4I1D A;  2I6E A;  3G3K A;  3MZB A;  2HAU A;  4RPN A;  1JEV A;  1NUZ A;  4LZ8 A;  3O6H A;  3LSW A;  3L6G A;  5FHM A;  3MST A;  4P8B A;  4JB7 A;  4OVP A;  3D4G A;  4LUB A;  1UIU A;  1Q35 A;  1JW5 A;  3MBP A;  3BIG A;  3Q29 A;  1MY4 A;  4PET A;  3MJN A;  3H6W A;  3IOT A;  5CBS A;  2V93 A;  4G68 B;  2FIE A;  1II5 A;  4QRZ A;  3ONM A;  1NNP A;  1TXF A;  2OX3 A;  4PTK A;  2GFE A;  5ET5 A;  2ZMB A;  4OFO A;  3BFU A;  3T9U A;  4KCC A;  2X7Q A;  5TPA A;  3KFM A;  3S9E A;  1NH7 A;  1FTJ A;  2Y7W A;  3TCF A;  3HST A;  1MPD A;  4XKR A;  4RXL A;  4KPT A;  4XF5 A;  3K6V A;  4MNI A;  3TTR A;  4YKI A;  4HXV A;  2I0C A;  3N5L A;  2P3V A;  1NUW A;  2DE4 A;  4MX6 A;  3L6H A;  3JZJ A;  4ZZE A;  4XKN A;  4U2R A;  5H8H B;  2XWO A;  1MDQ A;  1MQH A;  4O7I A;  5FBP A;  2PFY A;  3ZSF A;  3MYU A;  1S7Y A;  3BFT A;  1IMA A;  3FV1 A;  4AB5 A;  1SVX B;  4P0G A;  3H6V A;  5L9O A;  5AA1 A;  3HHF A;  3E4R A;  3C33 A;  4F18 A;  5AE4 A;  4OTE A;  2Y7P A;  2V84 A;  4Q0C A;  2PT1 A;  1LB8 A;  4YMA A;  4IO7 A;  4P9K A;  1IEJ A;  3N6U A;  3LC8 A;  3G3H A;  1JET A;  1SW1 A;  1AH5 A;  2B65 A;  4O8M A;  3MWB A;  1MQJ A;  2FIX A;  3K2D A;  4MFI A;  4DLD A;  1POT A;  1R9L A;  2XXH A;  3MPL A;  3Q26 A;  1YPN A;  1G0I A;  4OET A;  3A3C A;  3RT6 B;  2Q2A A;  1MXX A;  4QXD A;  2UYE A;  5IZZ A;  3OEL A;  3OEN A;  4OEU A;  4EDP A;  2E0S A;  3V8X B;  2ONK E;  4X1B A;  4OVS A;  3AXF A;  3OSR A;  4JWY A;  1Y9U A;  1DTZ A;  3G7W A;  1VFD A;  4NG7 A;  4GIZ A;  2QS1 A;  3ZKL A;  2DE3 A;  4DXU A;  4H67 A;  1N7X A;  1FRP A;  2F36 A;  2XXY A;  3R26 A;  1P1Q A;  1B6H A;  1A99 A;  4ND9 A;  1ZJL A;  1QVS A;  1LCT A;  2G93 A;  5I7I A;  2HXW A;  2Q8J A;  4GWO A;  3ZS6 A;  2B4M A;  5M2V A;  4NWD A;  4EF1 A;  3E79 A;  3VLW A;  1N7W A;  1YYZ A;  3K1N A;  4EQ7 A;  4PF8 A;  1A40 A;  3RT8 A;  1FBD A;  3MW0 A;  1FBH A;  4RK2 A;  2REJ A;  3PPR A;  5I2K A;  3B6W A;  3KOT A;  2I4B A;  4G4P A;  2XXT A;  2DWA A;  2FA7 A;  4U22 A;  1TFD A;  1XS5 A;  5BUU A;  3I6V A;  3O66 A;  3CRB A;  4OVT A;  5IM2 A;  1XI6 A;  4ZED A;  4GWS A;  3TZA A;  4N15 A;  3MQ9 A;  1MQD A;  4POW A;  4I62 A;  4ECF A;  4I8C A;  2ZYM A;  1WOD A;  1XC1 A;  4GWY A;  2RKM A;  1USY H;  5LTC A;  4P1E A;  3VLV A;  1FPI A;  3MP1 A;  1FJ9 A;  3S4U A;  3UA8 A;  1I69 A;  1IXC A;  4GD5 A;  4R72 A;  1Y4T A;  3K1M A;  4FEC A;  3C9H A;  1ZKB A;  5EQ9 A;  4NTL A;  3TDJ A;  1EZ9 A;  3OO7 A;  5EHS A;  4PGP A;  5H8N A;  1OQG A;  2P2A A;  1GV8 A;  3V5A A;  2XXW A;  4ZS9 A;  3TPA A;  2PYY A;  3PUY E;  4JVC A;  4UA8 A;  1MPC A;  3DLN A;  1FPF A;  1LFI A;  1EZP A;  1P1N A;  3PV0 E;  4ELO A;  1LGB C;  2HEU A;  2O68 A;  3T1B A;  2RF1 A;  4HE1 A;  1PB9 A;  1DK4 A;  5DEX A;  1B3F A;  1FW0 A;  4GBV A;  3FXU A;  4NED A;  4XKP A;  4PFI A;  2XD2 A;  4FED A;  3FAS A;  4GQO A;  2V3Q A;  3TEP A;  4X1D A;  4QBA A;  4GOT A;  1IIT A;  1XVX A;  2XXK A;  4DI3 D;  2PX1 A;  1NH8 A;  5ICT A;  1FTO A;  1Y3Q A;  3SEX A;  1MXU A;  1S9T A;  1IMD A;  4AS4 A;  5ITO A;  4N91 A;  2VT5 A;  2X7P A;  3FXR A;  1MM6 A;  1N76 A;  1HSE A;  3U94 A;  3B6T A;  3EQ1 A;  2PVU A;  3R6U A;  3M8U A;  4ESW A;  2HFB A;  1MXW A;  1D9Y A;  1IMB A;  2A5T A;  3KBZ A;  3NOH A;  3VLU A;  4H45 A;  4F29 A;  3S9L C;  3KN3 A;  1EH3 A;  2O7I A;  3RTF B;  5K2Y A;  1FPJ A;  1MY1 A;  3FGS A;  3SEV A;  3DM0 A;  1VFE A;  4QFP A;  1Y1M A;  1NV7 A;  4JSO A;  1H43 A;  3PTY A;  1MXV A;  1LBZ A;  1DBZ A;  3CSG A;  5AA2 D;  4AB6 A;  4N6K A;  3FVO A;  2XWI A;  4NF8 A;  3FVK A;  4PFR A;  3TTL A;  4U21 A;  1UIV A;  1OLA A;  3PPN A;  2RC7 A;  3C36 A;  2Z8F A;  4PBQ A;  4R6K A;  1EYI A;  1QUJ A;  4OA4 A;  3V83 A;  3R7X A;  2H25 A;  3T66 A;  4R75 A;  2QSX A;  2Y5K A;  3KC0 A;  3OO6 A;  1MS7 A;  2F35 A;  4MIJ A;  3U92 A;  1B1X A;  3HCQ A;  3SEY A;  3T9V A;  2UVH A;  3UP9 A;  4LZ5 A;  5CRY A;  3K00 A;  5H8Q A;  4PCD A;  1Y4C A;  2LAO A;  3IX1 A;  5I2K B;  4GWW A;  1MQG A;  2F6G A;  1IXG A;  4JDF A;  4X9T A;  3PD9 A;  1PEB A;  4BDR A;  2DDK A;  3VDF A;  2Q74 A;  1M5E A;  3LR1 A;  3E9X A;  4I40 A;  3D1R A;  1FBF A;  2OK2 A;  4H0W A;  1FQD A;  1EZO A;  1NV3 A;  2VPO A;  1MQI A;  3GBB A;  4QFK A;  2Q88 A;  4OWD A;  3T93 B;  4IY6 A;  4P0I A;  2KR0 A;  2O6A A;  5DYH A;  1A7L A;  5JTY A;  2QS3 A;  3OO8 A;  3U72 A;  3GYY A;  2DXR A;  2OBG A;  4R2F A;  1FSA A;  2Q2C A;  2XHD A;  4N6P A;  4ELR A;  4OHN A;  5HM4 B;  2P3N A;  2NOO A;  4YB5 A;  5AA2 A;  4MF3 A;  1SW2 A;  4POX A;  2G29 A;  1B05 A;  1OVB A;  3BBR A;  2ONR A;  4QHQ A;  1TWY A;  4LQ5 A;  5EHM A;  5H8N B;  3GZG A;  1MXY A;  4NGU A;  1BTJ A;  1SDX A;  2F8D A;  4NQ8 A;  3C31 A;  3LBS A;  4G2Z A;  4MLQ A;  3RTW B;  2CMO A;  3A29 A;  3TQW A;  2UVG A;  1FCK A;  4YB7 A;  4FEB A;  2I3W A;  4O7M A;  4TOZ A;  4OXV A;  3SDF A;  4PF6 A;  3FUZ A;  3C35 A;  4NWC A;  2ZNT A;  3ISP A;  2ZNU A;  4H5G A;  5I57 A;  4NMY A;  2IEE A;  3N6T A;  4NF4 A;  3IO6 A;  2KQZ A;  4F3S A;  3UOR A;  3IOV A;  1Z7M E;  1NUX A;  4ONY A;  1B5I A;  5DEX B;  4WKM A;  1B3G A;  3MP6 A;  3N94 A;  1SI1 A;  4RYA A;  1FJ6 A;  2PBW A;  2P1S A;  1FTM A;  4KCD A;  4OQO A;  4IO2 A;  2VD2 A;  3U65 A;  3O29 A;  5TU0 A;  5L9S A;  1B40 A;  3K02 A;  1WVJ A;  4OVQ A;  1RYO A;  2OLB A;  1VSO A;  3T22 A;  4ZDM A;  3QXM A;  4N07 A;  5HBC A;  2RIN A;  4BDL A;  4YB6 A;  1NL5 A;  2FBP A;  1KZ8 A;  4GXA A;  4YU0 A;  1O64 A;  3E3K A;  2HCA A;  2ANJ A;  3S2V A;  4M4G A;  1JVY A;  4GWX A;  1AL3 A;  1LST A;  4MMP A;  4EQB A;  2A5T B;  1ZMG A;  2W7Y A;  4F39 A;  1QUK A;  3G3J A;  2H4I A;  3VXC A;  3MVY A;  2XXP A;  3CIJ A;  3PMX A;  3FD3 A;  4EXK A;  1RDX A;  2XXU A;  3IAZ A;  2NVU B;  4GFR A;  4NF6 A;  3QK6 A;  4ZEI A;  5ET8 A;  4XFE A;  5ITP A;  3TUS A;  1BLF A;  4EXL A;  1B51 A;  1XOC A;  3PU5 A;  1FTL A;  1P1W A;  5ET6 A;  1MG1 A;  2ZZW A;  1NMU A;  1LBC A;  5JEI A;  1N3W A;  1PC3 A;  4LVQ A;  3RY3 A;  2Z22 A;  1LFG A;  4NF8 B;  2B4L A;  2QS4 A;  3M3K A;  1QGX A;  3MP8 A;  3ODB A;  4MCO A;  4QFN A;  2XX7 A;  2DWH A;  2ZZV A;  4U4S A;  5LOM A;  2FVZ A;  4KQP A;  1B32 A;  5H8F A;  3W9V A;  4GLI A;  4E0W A;  3QAX A;  4N13 A;  4F2O A;  1SW4 A;  3EHT A;  1SD3 A;  3VVF A;  1SBP A;  1UTH A;  4QSD A;  4MBP A;  4F3G A;  2O7U A;  4OMB A;  3QUJ A;  2CZI A;  2L5V A;  4E0X A;  5I84 A;  3T0J A;  2OPE A;  3I3V A;  5H8Q B;  1AIV A;  1NNT A;  1IQ7 A;  4YKP A;  1ZU0 A;  3FJM A;  3ROJ A;  1FQF A;  1B4Z A;  2QJE A;  3QUF A;  4RK9 A;  4UAB A;  2DYX A;  2QS2 A;  2GHB A;  3VXB A;  4FJP A;  1B5J A;  4NN3 A;  1GTK A;  2YPN A;  5IGA A;  4PFY A;  1LAX A;  4Q8R A;  4GWU A;  2DQV A;  2NXO A;  4Z0I A;  3OOA A;  1B3L A;  4I3Y A;  5JTY B;  3PUV E;  3O6I A;  2Q89 A;  5EYH A;  3OD7 A;  1LLS A;  4IO3 A;  4HCW A;  1OQH A;  3KJT A;  1N84 A;  2Z8D A;  4KHZ E;  3WAF A;  2GHA A;  1NV1 A;  2RCA A;  5AA2 B;  1ZBM A;  2AIX A;  2O1M A;  1DSN A;  4GL8 A;  4X04 A;  3C4M A;  3JYR A;  4H65 A;  2THI A;  4NAP A;  1ANF A;  5J16 A;  2DXY A;  1BK4 A;  2V3T A;  2NWJ A;  4EQ9 A;  2IA4 A;  1A8F A;  4F1V A;  4DCX A;  3BIH A;  4OFL A;  3F11 A;  4WED A;  1FTK A;  3TKD A;  5I57 B;  5B7D A;  4BLA A;  3JV9 A;  2Y84 A;  3RLF E;  4IO5 A;  4GXS B;  4QSE A;  2FHY A;  5I3S A;  2ZNS A;  4U1O A;  1K9Y A;  1BKA A;  1FQA A;  4WXJ A;  5KZT A;  5KDT A;  4NE4 A;  3O2A A;  1AWB A;  1DOT A;  3K4U A;  2XXI A;  3HFU A;  1IME A;  4G8N A;  4H46 A;  5EQA A;  4BDQ A;  1UTB A;  2V3U A;  4HE0 A;  4PFW A;  3IR1 A;  4DXC A;  3TYH A;  2WKY A;  2OZZ A;  1NKX A;  3TOD A;  5TPA B;  1B7U A;  2UVI A;  5AA3 A;  5EQ8 A;  3RPL A;  1A8E A;  3LV0 A;  1FQC A;  3IFA A;  3KBR A;  4XEQ A;  3QSL A;  4QF9 A;  1FPB A;  3EHS A;  1L5T A;  4YZZ A;  2O84 X;  5ET7 A;  3B8B A;  4GBW A;  4OER A;  3I5O A;  2QVU A;  4NF6 B;  3VVD A;  4I9D A;  1DPP A;  1VE4 A;  4BDO A;  5DTB A;  1IUD A;  4RNS A;  2O51 A;  3K01 A;  2MKZ A;  4K3F A;  5I56 A;  2XXQ A;  4RPO A;  5HPQ A;  3O28 A;  4KI0 E;  1SI0 A;  2R9J A;  3S9N C;  2ONS A;  5ICQ A;  3IOR A;  4OEN A;  1DTG A;  2O69 A;  4P3L A;  4F1Y A;  3LUY A;  3H6U A;  5FTH A;  3O6G A;  3IL1 B;  2QFL A;  3TTN A;  3V89 B;  1LAF E;  2V4C A;  4GX6 A;  3CHG A;  4DCY A;  4TQU Q;  5H8F B;  1B5H A;  3ILU B;  4KYE A;  2UYF A;  3C32 A;  4GL0 A;  4YKJ A;  4ESX A;  4Q30 B;  3T9H B;  1UTH B;  4F19 A;  2DE2 A;  1FQE A;  5J1D A;  2H5Y A;  1NFT A;  4NF5 A;  1Y3P A;  3KSJ A;  3U8Q A; 
#chains in the Genus database with same CATH homology
 4PC9 A;  4JVI A;  4NGU A;  4MEV A;  4NQ8 A;  4GX4 A;  4O8M A;  3A29 A;  2PCR A;  3W9W A;  2FIX A;  4O7M A;  4IR8 A;  1NUY A;  4PF6 A;  2XA5 A;  3ISP A;  1G0I A;  2KQZ A;  4N4U A;  1NUX A;  4QXD A;  4N6D A;  5IZZ A;  1KA1 A;  3FXB A;  1FTA A;  4OVS A;  4X8R A;  1FJ6 A;  2WYK A;  4PAI A;  3U65 A;  5DW8 A;  4NG7 A;  4GWZ A;  2ZZX A;  2DE3 A;  1KA0 A;  3SZP A;  1LBV A;  3IFC A;  1FRP A;  4OVQ A;  1RDY A;  1IMC A;  1FBE A;  4PDD A;  2XWK A;  1CNQ A;  4MNC A;  1IMF A;  2FBP A;  4GX3 A;  5I7I A;  1KZ8 A;  4PE3 A;  2B4M A;  4GWX A;  2HZL A;  4MMP A;  4MJO A;  1FPE A;  3E79 A;  1FBP A;  1YYZ A;  2GQ1 A;  5I5P A;  1NV4 A;  2WYP A;  1K9Z A;  4PF8 A;  1FPK A;  1FBD A;  2R8T A;  1RDX A;  1FBH A;  5ET8 A;  1NV2 A;  4XFE A;  1EYK A;  4OAN A;  1Q9D A;  4MAG A;  1NV6 A;  3B50 A;  4MNP A;  5ET6 A;  3FBP A;  2ZZW A;  2QPQ A;  1EYJ A;  1YXI A;  5ESY A;  2QVV A;  4OVT A;  4OVR A;  5IM2 A;  1XI6 A;  2CZK A;  4GWS A;  2B4L A;  4N15 A;  1QGX A;  4MCO A;  3LUZ A;  4O94 A;  4DI4 B;  3RYD A;  1D9Q A;  2ZZV A;  2FVZ A;  4GWY A;  2HZK A;  5LTC A;  4P1E A;  3W9V A;  1FPI A;  1FJ9 A;  3RPL B;  2CZI A;  5EQ9 A;  5A5L A;  2L5V A;  4PGP A;  3T0J A;  2BJI A;  4JVC A;  2OWZ A;  5F24 A;  2Q9T A;  1FPF A;  4P1L A;  3ROJ A;  5EYG A;  4UAB A;  5IZ1 A;  4NN3 A;  2JJK A;  4PAK A;  3T1B A;  5IGA A;  2CEY A;  4HE1 A;  3E78 A;  4GWU A;  2WEF A;  1DK4 A;  2WBD A;  1LEV A;  4GBV A;  1FPL A;  4HCY A;  1SPI A;  1RDZ A;  4PFI A;  1NI9 A;  4I3Y A;  2V3Q A;  3EKI A;  5EYH A;  4QBA A;  1LBW A;  1FBC A;  5T3J A;  4HCW A;  2XXK A;  4DI3 D;  5JK4 A;  1IMD A;  4P56 A;  1NV1 A;  1G0H A;  4AS4 A;  4N91 A;  2VPN A;  2VT5 A;  4N8G A;  2HPG A;  4G61 A;  4X04 A;  4NAP A;  5IZ3 B;  5J16 A;  1VDW A;  4NX1 A;  1BK4 A;  5EQ7 A;  1FPG A;  1IMB A;  3KBZ A;  2F5X A;  3NOH A;  1YZ0 A;  4JVD A;  4H45 A;  4F1V A;  4NF0 A;  2PFZ A;  5LDZ A;  2CEX A;  3BIH A;  1FPJ A;  4I3E A;  1FBG A;  4MHF A;  4YIC A;  1NV0 A;  2F3D A;  1INP A;  2HXR A;  2Q8M A;  1NV7 A;  4HE2 A;  3PTY A;  5CM6 A;  1LBZ A;  2WX9 A;  4N8Y A;  2FHY A;  5I3S A;  4AS5 A;  1DBZ A;  2WBB A;  2CZH A;  1LBX A;  1K9Y A;  4N6K A;  4NHB A;  1NUZ A;  1AWB A;  2XWI A;  4PAF A;  1JP4 A;  1DCU A;  3HFU A;  4PFR A;  1IME A;  4H46 A;  1NV5 A;  5EQA A;  3MST A;  4P8B A;  1LBY A;  4PBQ A;  1EYI A;  4OA4 A;  4OVP A;  4HE0 A;  2Y5K A;  3KC0 A;  2F3B A;  4N81 A;  4MIJ A;  3BIG A;  5EQ8 A;  3RPL A;  3LV0 A;  4PFB A;  3IFA A;  4XEQ A;  4M1V A;  2QVR A;  4PET A;  1FPB A;  2FIE A;  4YZZ A;  4P47 A;  4PCD A;  5ET7 A;  3B8B A;  4GBW A;  4PBH A;  2OX3 A;  4PTK A;  2XWV A;  4N17 A;  5ET5 A;  2QVU A;  4GWW A;  4KXP A;  4LN5 A;  2MKZ A;  4X9T A;  2DDK A;  4PGN A;  2Y5L A;  2Q74 A;  4I40 A;  3D1R A;  1FBF A;  4XF5 A;  4MNI A;  4HXV A;  1NV3 A;  4P3L A;  2P3V A;  2VPO A;  1NUW A;  2DE4 A;  4MX6 A;  2KR0 A;  2HHM A;  2XWO A;  3GYY A;  2QFL A;  4FBP A;  4O7I A;  5FBP A;  1FSA A;  2PFY A;  2V4C A;  3MYU A;  4GX6 A;  3CHG A;  3KC1 A;  1IMA A;  2P3N A;  3QMF A;  1FPD A;  4F19 A;  2DE2 A;  4F18 A;  2DVZ A;  5J1D A;  5IZ3 A;  4F1U A;  4PDH A;  4P9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...