5EQ9A

Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
265
structure length
254
Chain Sequence
QLNHFSDVANKAANAAGDVIRKYFRKSPVTIADQSAEEAMVSVILDNFPSHAVYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGKPLFGTLIALLQNGTPILGIIDQPVLKERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRVRDKVKIPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASPLSIATSFNVVAAGDKQIHQQALDSLQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Medicago truncatula Histidinol Phosphate Phosphatase from Inositol Monophosphatase Superfamily Reveal Details of Penultimate Step of Histidine Biosynthesis in Plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Biosynthetic protein
molecule keywords Inositol monophosphatase
total genus 83
structure length 254
sequence length 265
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eq9A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eq9A02
1LBZA 1LBXA 2Q8MA 1NV2A 2R8TA 1NV6A 1YXIA 1FPJA 3A29A 1FBPA 1K9YA 1NV4A 2BJIA 2Y5KA 4AS5A 4HE0A 1FPIA 5LDZA 4IR8A 2Y5LA 5IZ1A 2QVUA 1CNQA 2P3NA 1FTAA 3IFAA 1NV1A 4GBWA 4MJOA 1FPGA 2WBBA 5ET8A 1IMFA 1RDXA 5FBPA 5IZ3A 3KBZA 1FBHA 1FPLA 1FPKA 2FIEA 1LBYA 4O7IA 5J16A 4GWUA 3BIHA 1K9ZA 1NV7A 2F3DA 4GWZA 1SPIA 2QFLA 4I40A 1EYJA 4I3YA 1FBFA 5ET5A 2CZKA 4GWWA 5EYHA 5T3JA 1NV5A 3RPLA 1FBEA 4QXDA 2OWZA 4G61A 4H46A 3KC1A 1XI6A 3D1RA 2WEFA 1EYKA 4GBVA 4GWXA 4HE2A 2VT5A 1FJ6A 1JP4A 3KC0A 4N81A 1QGXA 1FSAA 2FHYA 1FJ9A 5EQ7A 3B8BA 5EQ9A 1G0IA 1EYIA 1IMDA 2OX3A 1DCUA 1NV3A 1LBVA 3RPLB 1FBGA 1LBWA 3RYDA 1G0HA 2WBDA 1IMEA 5ESYA 4GX6A 5F24A 1DK4A 1INPA 4HXVA 2QVVA 5I3SA 1FBCA 1KA1A 4GX4A 2CZIA 1NUYA 1IMBA 2P3VA 3QMFA 3LV0A 1BK4A 1IMAA 1NUWA 1FPBA 1NV0A 2PCRA 2FBPA 1NUXA 1NI9A 2DDKA 4PTKA 3FBPA 5ET6A 5IZ3B 1FPEA 4HE1A 1RDYA 1YZ0A 2F3BA 3BIGA 5EQAA 1FPDA 2CZHA 1FBDA 5A5LA 1FRPA 4KXPA 1D9QA 5ET7A 3ROJA 1DBZA 5EYGA 4H45A 2HHMA 4I3EA 2JJKA 3T0JA 5DW8A 1Q9DA 5EQ8A 2QVRA 1KZ8A 3LUZA 1IMCA 4GWYA 1NUZA 4AS4A 1YYZA 4GX3A 3IFCA 2GQ1A 2FIXA 1KA0A 1VDWA 2FVZA 2Q74A 1AWBA 1FPFA 1LEVA 4FBPA 4GWSA 1RDZA
chains in the Genus database with same CATH superfamily
2R8TA 2I4BA 1SYHA 2ONRA 4LQ5A 1R1NA 4LA9A 2ONSA 4MJOA 1VFEA 3RUMA 3O2AA 1GTKA 2Z22A 1NV7A 3MVYA 3QUFA 2O69A 3OO6A 4I9DA 1FTJA 5I7IA 4FEDA 3P7IA 4OVPA 4K3FA 5H8FA 1D9VA 3K1MA 2DXYA 2Q89A 2W7YA 3L6HA 4OVJA 2AIXA 1LGBC 1UTBA 2V25A 4PFRA 4YKIA 1B1HA 4I1DA 2R9JA 2F78A 1SW4A 2YLNA 3FXRA 2B3FA 4JVCA 1PB9A 2Z8FA 1G0IA 2CEYA 3FJMA 3VXBA 1URSA 2VP1A 3TQLA 2DE4A 4F39A 4N8YA 4GX4A 2X7PA 1BKAA 5ELVA 1JETA 4F22A 5KCJA 4NF4B 2D5WA 2DDKA 1WDNA 5I2NA 4H6DA 4F3PA 3ONMA 1MXWA 2PVUA 2RCAA 1OQHA 4PAKA 4I3EA 1LFGA 4JWYA 4Q30B 3T96B 2DXRA 4NF5A 3VV5A 1ZKBA 1N7XA 5ICQA 2REGA 5AA2D 2GRVA 2FVZA 3RNNA 2F7AA 3FV1A 1WODA 3IOVA 5AA4B 1MPDA 1K9YA 4ELQA 1NH8A 4G8NA 3UORA 4P1LA 2DP8A 4POXA 1LBYA 4O3CA 5L9MA 4GLIA 4YB6A 2OJTA 4PFWA 2ZYMA 3C32A 1K9ZA 2CMOA 1A54A 1RKMA 3V83A 1JNFA 4R9GA 2F35A 4PQJA 1EYJA 4O8MA 5I57B 3B6TA 4XF5A 5H8NA 4PC9A 4OETA 1D9YA 2PMSA 4IB2A 1IXGA 4GWXA 1Z7ME 4GWOA 4QSEA 4R9FA 3HPIA 3HCQA 3LC8A 1MQGA 1FJ9A 4O3AA 2YPNA 3KJTA 4JBZA 2OX3A 1DCUA 5I5PA 4GFRA 2O1MA 3O6HA 1P1OA 1M5BA 2E1SA 3IOTA 4LN5A 3QMFA 4BDNA 2OPDA 5CMBA 4THIA 3IK6B 5H8HA 1B4ZA 2V84A 4F3BA 4QHQA 2F3BA 1MQHA 4NF6A 4HW8A 3WAEA 2QMXA 4X04A 3PGFA 3USDA 1MY0A 1O7TA 3H6TA 2OWSA 3T93B 1MDQA 1GVCA 2NUVA 1FQFA 1AWBA 4ELPA 4PFIA 1IITA 3U92A 1NV4A 1AIVA 2XA5A 4M4GA 1QKBA 4ZZEA 4XXUA 3CI8A 4RY1A 3E4RA 2RCBA 4MNCA 3M3KA 4NF4A 2UYEA 4LQ2A 2I6EA 4EF1A 2QFLA 4P56A 3IJOB 1SI1A 4P9KA 5CI5A 3A09A 4G61A 2YJPA 3D1RA 2GHAA 2ALUA 4JWOA 4N8GA 2HXRA 4R2FA 4QRZA 5I2KB 4R2BA 1I69A 3KSJA 3DELB 3C34A 1EYIA 3AXFA 3FXQA 4QFKA 3DP8A 5I56A 4HCYA 5JTYB 2XWOA 4AB6A 2FA7A 2OZZA 3FJ7A 2PBWA 3KFMA 1B1XA 1IMAA 1QW0A 3SESA 5ET6A 1NI9A 4MIJA 2PFZA 2ESNA 1CB6A 2R6GE 1FPDA 1UTHB 3TPAA 2Y7WA 4EXKA 2O7UA 3T9UA 4H45A 4MH5A 3PPRA 2XXPA 1IMCA 4RPNA 3SEUA 2A5TA 3HN0A 3H7MA 1VDWA 1I6AA 4GQOA 5LTCA 3K1PA 4GXAA 4LONB 3OMBA 1LCTA 4JSDA 1Y4TA 1Y9UA 2HQ0A 1UIVA 3H6VA 5CMMA 5TP9A 3MPKA 1Y1MA 4OFOA 3I6VA 3U1OA 1O63A 1US4A 3ECRA 1H44A 1DTGA 1P1QA 3QYTA 3QSLA 4OVSA 4U21A 4ZDMA 3L6GA 2B4LA 4EQ9A 5DVJA 2QS4A 3JV9A 3MAMA 1POY1 3MC2A 4PCDA 4U2RA 1B7UA 5DVIA 1AH5A 4R6HA 1HSLA 3RPLA 5LOMA 3Q28A 5DEXA 1PC3A 1IEJA 4IY5A 2IEEA 1A8FA 5BUUA 4GBVA 4EUOA 4ZECA 2UVGA 2R71A 3S4UA 2Z8EA 4F19A 1NKXA 4EDPA 2FHYA 4KYEA 4M1VA 3RYDA 1B52A 3OELA 5AA3A 1R6ZA 4GX6A 1DPPA 3VE1B 3MBPA 1B0HA 2VHAA 4F18A 2XWIA 3OSQA 3TCHA 1N3XA 4ELRA 1N0TA 1RDYA 4H65A 1EH3A 1YZ0A 3KZGA 4F29A 2CZHA 1M5FA 1XHYA 1D9QA 5FHMA 3K6XA 1O64A 1B3EA 1S7YA 4GRKA 3UN6A 3RGYA 1FTKA 2VPOA 1L5TA 4ZEKA 1EU8A 4BDQA 4MFIA 1PEBA 1WVJA 4UA8A 1LBCA 4NE4A 4F2OA 3A29A 2Y5KA 4AS5A 1FPIA 3OEKA 1CNQA 4GL0A 4MHFA 5I57A 1FPGA 1RDXA 4JWXA 4NG7A 4YB7A 4U4SA 4DDDA 1GGGA 1AL3A 3A3UA 3CG3A 1OVTA 4G68A 4GWZA 4KCCA 4PAFA 4OYVA 3QIMA 1FBFA 1HSEA 3CFLA 1MPBA 5T3JA 2H98A 1IUDA 1BIYA 1TXFA 2WEFA 2XXVA 3MP1A 4XKPA 1EYKA 2I49A 1UQWA 3D4CA 3TAJA 1B2HA 2VOZA 5EQ7A 2FNCA 3CIJA 1Y4CA 1LBWA 3F11A 2XXQA 4DXUA 2GHBA 1ZLQA 3C31A 3EF7A 4G8MA 5IZZA 3IB2A 5ISUA 2XWVA 4IO4A 5CMCA 3PU5A 3PD9A 3O28A 2VD2A 3KOTA 4NTLA 2QRYA 4TLMB 3O97A 3C4MA 3G7WA 2XXTA 1DSNA 2WKYA 4OVQA 4MCOA 3VLVA 5A5XA 3N6UA 4NX1A 3LBSA 4N13A 3M3LA 2O7IA 1SDXA 4EXLA 1N76A 1YYZA 4GX3A 1IXCA 2GQ1A 3KJ7A 2I0BA 3PUVE 4OEUA 1ZIUA 3SEVA 1DTZA 2XXXA 1YAEA 4KYDA 5IZ1A 4PBHA 2Y7RA 5TU0A 1FTAA 5ET8A 1MY2A 3R7XA 4OESA 1B7ZA 5ICTA 4FIMA 4GD5A 4PAIA 4P11A 4NF8A 4RA1A 4RNSA 3C33A 1N04A 2V4CA 4OFJA 4P47A 2DWJA 3MJNA 3KG2A 3ZKKA 4FORA 4QBAA 3OO9A 1JW5A 4L17A 3RTWB 4PFBA 2OLBA 3DLNA 3S9EA 1S9TA 3DP6A 2Y7KA 3TELA 3B6WA 4YICA 4KHZE 3GZGA 2DVZA 2XD2A 1INPA 5I2KA 3PD8A 1TFAA 3KOSA 1B5JA 1FQEA 1B05A 5EQAA 2ZNSA 4GVOA 3CG1A 4GL8A 3T0JA 1Q9DA 5KDTA 2OBGA 4AS4A 4FE8A 4XFEA 1KA0A 1NH7A 2UVIA 4TOZA 3K4UA 1FPFA 1XVYA 4F1UA 1JEVA 1Y3NA 5AA2A 2XXKA 2QPQA 1PB7A 1JW4A 2A5TB 2ZYKA 3DM0A 3FVOA 5L9SA 2Q88A 2ABHA 3VXCA 1FPKA 5AE4A 3GBBA 3CRBA 3PMVA 4YMAA 1Y3PA 3O9PA 4N6PA 2RC8A 1SI0A 3KGCA 4GWWA 4QFOA 4OWDA 1MXUA 2ONKE 3Q29A 3VDFA 4HE2A 5AA2B 3TYHA 4R6YA 3I5OA 5JTYA 5I58A 1POTA 1LAFE 1SYIA 1IXHA 4PFTA 1FSAA 2V93A 3TCGA 1NV3A 5ITPA 5TPAB 4ZEFA 2I3WA 3MSTA 3TTKA 2ZYOA 1ZMGA 4HXVA 3ZS6A 2QVVA 1KA1A 3MW0A 4F3GA 2WYKA 4NWCA 1MH3A 3T9XB 2NWJA 4NMYA 1BK4A 1US5A 3QAXA 1NV0A 2PCRA 2O68A 4PTKA 3VVDA 3RTFB 4HE1A 4OMBA 3EKIA 1FTLA 3C36A 4BDMA 4BDOA 1IZ1A 5JK4A 1MY3A 2HAUA 5FTIA 5DVFA 1MY1A 1MXYA 2OWTA 4TLLB 4I8CA 2HCAA 1KWHA 5EYFA 5H8QB 2HPGA 2ZYNA 4FAJA 4N17A 4FATA 4RK2A 1GV8A 1PBPA 3V89B 1EZPA 2V3TA 3A3CA 2DYXA 2Q8MA 1YXIA 3PMWA 5HBCA 5I59B 1T0KA 1DMBA 3O29A 5IZ3A 5HM4B 1YTVA 3O66A 4P0IA 4JXIA 4MNPA 1QULA 5I84A 2F3DA 4NEDA 1B40A 4I40A 5L8DA 2I0CA 2GH9A 1MQIA 2XWKA 4XEQA 1XC1A 3G3JA 2RC7A 5EHMA 1N7WA 2X26A 3THIA 3OO8A 4OANA 4H5FA 5AA1A 1QGXA 3N26A 2Y84A 2QS1A 5CM6A 3PUXE 4OHNA 4MMPA 3K01A 2WBDA 2F5XA 4EQBA 2OPEA 4O3BA 3D4GA 3GXAA 5A5XB 2CZIA 3H6WA 3MYUA 1EZ9A 3HSTA 2G29A 1LCFA 4BLAA 1B0LA 4HS7A 1FPBA 1MM7A 2L5VA 1NUXA 1B5IA 4DCYA 5J1DA 3EPEA 3MZ9A 3TCFA 4F1VA 3G3FA 1FBDA 4KYSA 4DI4B 3UP9A 4PE3A 1OMPA 3LUZA 4GWYA 1GR2A 3PPOA 1BTJA 5IM2A 2H9BA 4IGRA 2OK2A 1H43A 4G68C 4XKNA 1PDAA 3FV2A 2Y5LA 4H5GA 4PF8A 2O51A 2QL3A 1QUKA 2XXRA 2F36A 3IJXB 1IMFA 4XTCQ 3UGWA 2Q2AA 4MX6A 4YB5A 4DXCA 4ZEDA 4OQOA 2GFEA 1CE2A 1QUJA 4JVDA 5IAIA 2VD3A 1ZU0A 1B46A 4MNIA 4FEBA 4OEVA 4HTGA 5TPAA 1XT8A 5B70A 5KCJB 5FHOA 3TTNA 3KC1A 5JEIA 1URGA 4MBPA 4R74A 2V3QA 3QUJA 3UA8A 5I58B 1FQBA 2DWAA 1N84A 3HHFA 2QS3A 1B58A 2OCUA 5F7VA 2AYSA 4YKJA 1G0HA 1IMEA 2Z8DA 3QK6A 5F24A 3EQ1A 4KFQA 2HZLA 4DI3D 4RK9A 4PBQA 5KDTB 1SW2A 3TTMA 5B7DA 1RYXA 4R6KA 4DIGA 3W9VA 1NNKA 5H8HB 4HCWA 4OVRA 3ROJA 2F34A 2XXWA 2I3VA 4KI0E 2UXAA 4ZS9A 4H8IA 2XXUA 5DYHA 3Q27A 4QFNA 2KQZA 4FJPA 1A40A 1JVYA 2B65A 4TQUQ 3IB0A 5LDZA 4HE0A 1QVSA 4PDHA 4IGTA 3H3GA 2WBBA 1D4NA 1A99A 4BDLA 2F8DA 4O7IA 5J16A 1M5EA 2ZZXA 3PPQA 3E3KA 2D21A 4N15A 3FD3A 1I6QA 1H3DA 3IOUA 3WAFA 3PMXA 4NN3A 3K6UA 2B4MA 3LSXA 3LR1A 4RPOA 4Q8RA 4IO7A 4WKMA 4ELOA 1F9BA 4U1OA 4LVQA 1XI6A 3IX1A 2ZNUA 1YCJA 3CHGA 1FJ6A 4KR5A 5H8SA 4N91A 3RY3A 4PETA 2KLFA 1LAHE 4AQ4A 1MPCA 4U22A 4PGNA 3MZ1A 2MKZA 4PGPA 1NFTA 1RYOA 2XX8A 3T9VA 3R26A 3FXBA 1MRPA 3K0VA 4N6DA 3SEXA 1VSOA 4C1TA 2WX9A 3QXMA 1OLCA 4IY6A 5ET7A 3K1NA 4OFLA 2JJKA 3PV0E 3GBAA 3RN8A 2QVRA 3ISPA 4RYAA 3SKPA 1ZJLA 3S2VA 2FIXA 2F97A 4XKQA 3FIRA 4U4XA 2RKMA 2E0SA 5EHSA 2QMWA 5HPQA 4ZE8A 2B3BA 2F6GA 4EF2A 3BFUA 4ZEIA 4WEPA 4F31B 1NV2A 4R73A 2UVJA 2Q2CA 3IFAA 2M8CA 4GBWA 2Q9TA 3OENA 3E79A 5FBPA 3B50A 1MH4A 1FPLA 4WXJA 4DCXA 4GIZA 4U23A 3MPLA 3DP4A 1MXXA 1JVXA 1QJMA 1Y3QA 1SPIA 2H25A 4LP2B 2DE3A 2CZKA 3JZJA 4Z0IA 4H46A 4MEVA 3FZVA 3UK4A 4Z7EA 5CMKA 3HHGA 4H8JA 4R72A 3RQTA 1FCKA 3SDFA 3B8BA 2Y7PA 1B3GA 3OSRA 1NL5A 4P1EA 2UVHA 1IIWA 1M5CA 2QJEA 1MM6A 3EHSA 3VLUA 4G68B 5CBRA 3TEPA 4C0RA 3KSXA 1FQCA 3IOWA 3LUYA 1NUWA 1NNFA 1FTMA 2HFBA 1UIUA 4ZEBA 4WEDA 1LSTA 4YKPA 4NGUA 1MQDA 1QUIA 4PP0A 4KXPA 4H1XA 5I56B 3IL1B 3N5LA 4NF8B 1Z7NE 3BFTA 1XS5A 3ZSFA 3IFCA 2QSXA 4KPTA 5IGAA 4MF3A 3B7DA 4NWDA 3FVKA 1JW1A 1PB8A 5EYGA 1LBZA 2PYYA 3IO6A 1JEUA 1Y20A 2I58A 3IORA 4DZ1A 2P3NA 2NXOA 4PFYA 2RF1A 2O1LA 2PFYA 4RJZA 1MS7A 1IQ7A 2DVCA 1NNPA 1XVXA 1DPEA 3K02A 4ESXA 2H5YA 3Q25A 3FUZA 3TKDA 2F6PA 4LUBA 4POWA 1LBBA 3EHUA 4YKKA 2DE2A 2THIA 4KD5A 4QSDA 4F2QA 2VT5A 3V5AA 1TWYA 3KC0A 3CVGA 3ODBA 2XXHA 3IO4A 1LLSA 5EQ9A 3K6VA 3NOHA 3T9HB 3RPLB 4X8RA 3IB1A 4G4PA 1II5A 3EHTA 1MDP1 4OERA 3MUQA 3MWBA 3N6TA 4DE8A 3E78A 3HO7A 2IA4A 3LSLA 3TDJA 1URDA 1NMUA 5KZTA 3HV1A 1SW1A 5ITOA 3G3GA 4LZ7A 4XKRA 3M8UA 3PUZE 3PUWE 2DSFA 1B3HA 4X1BA 5CRYA 2Q74A 4O94A 3K2DA 1LEVA 5IKBA 2AL5A 1SW5A 4ZZAA 4H0WA 1FPJA 4IR8A 3KBRA 2WYPA 1QKAA 3FVGA 1P99A 3MP8A 4P8BA 3RPWA 3SETA 4ESWA 1NNTA 3T66A 4NHBA 2XXIA 2RINA 1D3KA 1B51A 3SEYA 1ZBMA 2ZXTA 4ZE9A 3G3IA 5F1QA 4IO3A 1ELJA 1OVBA 4I3YA 1VR5A 4RXLA 3U93A 1SD3A 4NAPA 5ET5A 1LAXA 3K00A 3TMGA 4QXDA 5AA4A 3LSFB 3N94A 3PPPA 4QSCA 3VVEA 2Z23A 3VVFA 3OEMA 5M2VA 4ND9A 3FJGA 3BKIB 1SVXB 2HXWA 3I3VA 3IR1A 4IO2A 3V8XB 1FBGA 2NVUB 1SBPA 5ESYA 3SEWA 2NOOA 3KN8A 3C9HA 5I3SA 3SZPA 3R6UA 3MVXA 1J1NA 4YMBA 3O6GA 1Q35A 5I2NB 1B5HA 4MLVA 5DEXB 3OO7A 4JVIA 3O6IA 1B9JA 3CFXA 1JQFA 1LFHA 3EN3A 4JDFA 3U72A 4NF6B 4N4UA 3Q26A 1ANFA 4F1YA 3S9LC 2F7CA 2HHMA 3TQWA 4Q5TA 1BLFA 5EQ8A 1VFDA 1KZ8A 1NUZA 4MAGA 1N3WA 4JSOA 3IAZA 4X1DA 4PE5B 5FHNA 4FBPA 1UTBB 1FTOA 1B3FA 1ZTYA 1B6HA 2RC9A 1A8EA 4OA4A 4C1UA 4OVTA 2Y7IA 2Q8JA 3VLWA 1MY4A 1OIBA 3KN7A 4I62A 4EQ7A 2ZMBA 3S9MC 3FGSA 3ILUB 3B6QA 3KN3A 1TFDA 2OWZA 4AB5A 4G8HA 4F3SA 2H99A 3TODA 1B4HA 1JP4A 4LZ8A 3ILTB 4UACA 1LB9A 5FTHA 1LBVA 4IO5A 2A5SA 1USYE 1BP5A 4GOTA 3H03A 1DK4A 3OD7A 1FQAA 3M3FA 4ECFA 1IMBA 4ONYA 2ZNTA 4X48A 1VE4A 1A55A 4E0XA 2BJJX 3FATA 1FW0A 5A5LA 3MVZA 1MXZA 2PX1A 3K6WA 2I4CA 4YZZA 2PT2A 3SERA 2PT1A 4UABA 1LFIA 4QFPA 1B32A 3H06B 2XX7A 1FQDA 3BBRA 3VFJA 3CSGA 1OQGA 2ZZWA 1LBXA 1YPNA 4OZ9A 1EZOA 4OXVA 2QVUA 1B3LA 2XXYA 3E13X 2ZZVA 3H6UA 3KBZA 1H76A 2REJA 1FBHA 2FIEA 2XHDA 4GWUA 1PBQA 3CR9A 3GYYA 4YAHX 2P1SA 3TFLA 3U8QA 3MQ9A 3ZKLA 5I59A 5CC2A 1AOVA 5EYHA 1NV5A 1FBEA 4PF6A 3W15C 1S50A 3OXNA 4LATA 4NQ8A 1R9LA 2XX9A 3PTYA 3TTRA 3JYRA 5H8QA 1IMDA 3PUYE 2DQVA 1AMFA 1DOTA 3G3HA 4E0WA 2HAVA 2LAOA 1P1NA 5H8FB 2HZKA 4LZ5A 4P3LA 3GLBA 4QFLA 4Q0CA 1LB8A 1FBCA 3UIFA 1NUYA 1P1UA 3PPNA 2QS2A 1B7HA 1SQYA 2P0SA 2P3VA 5DT6A 3LV0A 4DLDA 2FYIA 3CSBA 4PFUA 4H67A 5H8NB 3FBPA 1MG1A 1I6BA 2X7QA 3MP6A 2HEUA 1USYH 2CEXA 1DBZA 3H4ZA 1XOCA 1Q1KA 3T1BA 2AL4A 2I48A 4FECA 3KEIA 4NF0A 3OOAA 4GWSA 1RDZA 2O6AA 3E9XA 1NV6A 4IO6A 1FBPA 4OENA 1HSJA 2BJIA 4X9TA 1MQJA 2DOJA 5BWJA 1NV1A 3TZAA 1LAGE 2DWIA 4NF5B 4BDRA 3HFUA 5K2YA 2KR0A 3U94A 3BIHA 2G93A 1OLAA 4G2ZA 4N6KA 3MZBA 2XD3A 3FASA 1Y1ZA 4JB7A 2H4IA 3FVNA 2CZLA 4N07A 3U65A 4O7MA 4U1ZA 3FXUA 5TP9B 2O84X 4PDDA 3S9NC 4ISUA 4N81A 5K2XA 1TT1A 4GXSB 1A7LA 2P2AA 4MLQA 5CBSA 2UYFA 3TTLA 1ATGA 3W9WA 3RLFE 3T22A 1MXVA 2V3UA 3LSWA 1H45A 4P0GA 2F7BA 4YU0A 2VPNA 1UTHA 2FBPA 5DTBA 4GF8A 5IZ3B 1FPEA 3BIGA 4R75A 3C35A 3MVWA 4KQPA 4XIGQ 1P1WA 3TUSA 1FRPA 2ANJA 5L9OA 1R9QA 4KCDA 2D3IA 3CFZA 5DW8A 1M5DA 2VGQA 2DWHA 3RT6B 3RT8A 2DS9A 4DXBA 4OTEA 4G77A 4QF9A 1IXIA 3G3KA
chains in the Genus database with same CATH topology
2XXKA 2QPQA 1LBZA 2ZZWA 1LBXA 2Q8MA 1NV2A 2R8TA 4PFIA 1NV6A 1YXIA 1FPJA 3A29A 1FBPA 1K9YA 1NV4A 2BJIA 2Y5KA 4AS5A 4HE0A 1FPIA 5LDZA 4IR8A 4PDHA 2Y5LA 5IZ1A 2XA5A 2QVUA 2WYPA 4P1EA 1CNQA 2P3NA 4PBHA 1FTAA 3IFAA 4P1LA 1NV1A 2ZZVA 4MHFA 4OA4A 4PF8A 4GBWA 4MJOA 1FPGA 2WBBA 5ET8A 1IMFA 2Q9TA 4P8BA 1RDXA 2PFYA 3E79A 5FBPA 5IZ3A 3B50A 3KBZA 4NG7A 4MX6A 1FBHA 1FPLA 1FPKA 2FIEA 4OVTA 1LBYA 4O7IA 3HFUA 5J16A 4NHBA 2KR0A 2ZZXA 4GWUA 4OVSA 3BIHA 4PAIA 4MNCA 4MNPA 4N6KA 4JVDA 1K9ZA 2B4LA 3GYYA 1NV7A 4N15A 2F3DA 4GWZA 4PAFA 1SPIA 2QFLA 2V4CA 4MNIA 4I40A 4PCDA 1EYJA 4I3YA 4NN3A 4O8MA 5I7IA 4OVPA 1FBFA 2B4MA 4P56A 4P47A 4NAPA 2DE3A 5ET5A 2XWKA 2CZKA 4GWWA 4P9KA 4XF5A 5EYHA 5T3JA 4XEQA 1NV5A 3RPLA 1FBEA 4PC9A 4QBAA 4QXDA 3U65A 2OWZA 4O7MA 4G61A 4H46A 4PF6A 4MEVA 3KC1A 1XI6A 3D1RA 4PFBA 2WEFA 2DE2A 4PFRA 1EYKA 4PDDA 4N8GA 4GBVA 4GWXA 4HE2A 2HXRA 2V3QA 4NQ8A 2VT5A 3CHGA 3PTYA 1FJ6A 1JP4A 3KC0A 4N81A 4OANA 4F19A 1QGXA 4N91A 4JVCA 1FSAA 2FHYA 1FJ9A 5EQ7A 3B8BA 4PETA 5EQ9A 3NOHA 1G0IA 1EYIA 1IMDA 2OX3A 2CEYA 1DCUA 5CM6A 1NV3A 1LBVA 3RPLB 5I5PA 1FBGA 4PGNA 4M1VA 1LBWA 3RYDA 4HCYA 4X8RA 4YICA 2XWOA 1G0HA 4MMPA 2WBDA 1IMEA 2F5XA 2DE4A 2HZKA 5ESYA 2MKZA 3MSTA 4PGPA 3W9WA 2DVZA 4P3LA 5IZZA 4GX6A 5F24A 1DK4A 1INPA 4HXVA 2QVVA 5I3SA 1FBCA 1KA1A 4GX4A 2HZLA 2XWVA 3FXBA 2CZIA 2WYKA 4N8YA 3SZPA 4DI3D 1NUYA 3MYUA 4LN5A 4F18A 4N6DA 4PBQA 1IMBA 2XWIA 2P3VA 3E78A 3QMFA 3LV0A 1BK4A 1IMAA 4X9TA 2VPNA 4JVIA 1NUWA 1FPBA 1NV0A 2PCRA 2L5VA 2FBPA 1NUXA 1NI9A 2DDKA 4PTKA 3FBPA 5ET6A 2PFZA 5IZ3B 4MIJA 1FPEA 5J1DA 4HE1A 3W9VA 3EKIA 1RDYA 4F1VA 1YZ0A 2F3BA 4N4UA 3BIGA 5EQAA 4NGUA 1FPDA 2CEXA 2WX9A 2CZHA 4OVQA 1FBDA 4HCWA 5A5LA 4MCOA 4DI4B 1FRPA 4KXPA 1D9QA 5ET7A 3ROJA 4OVRA 5JK4A 4PAKA 1DBZA 5EYGA 4X04A 4PE3A 4H45A 4NX1A 2HHMA 4I3EA 2JJKA 3T0JA 2HPGA 5DW8A 3T1BA 1Q9DA 5EQ8A 2QVRA 1KZ8A 4N17A 4YZZA 3LUZA 1IMCA 4GWYA 1NUZA 4AS4A 1YYZA 4GX3A 3IFCA 2GQ1A 3ISPA 4MAGA 5IM2A 2FIXA 4UABA 5IGAA 2VPOA 4XFEA 1KA0A 1VDWA 2FVZA 2Q74A 4NF0A 4O94A 1AWBA 1FPFA 1LEVA 2KQZA 4FBPA 4F1UA 5LTCA 4GWSA 1RDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBZ A;  1LBX A;  2Q8M A;  1NV2 A;  2R8T A;  1NV6 A;  1YXI A;  1FPJ A;  3A29 A;  1FBP A;  1K9Y A;  1NV4 A;  2BJI A;  2Y5K A;  4AS5 A;  4HE0 A;  1FPI A;  5LDZ A;  4IR8 A;  2Y5L A;  5IZ1 A;  2QVU A;  1CNQ A;  2P3N A;  1FTA A;  3IFA A;  1NV1 A;  4GBW A;  4MJO A;  1FPG A;  2WBB A;  5ET8 A;  1IMF A;  1RDX A;  5FBP A;  5IZ3 A;  3KBZ A;  1FBH A;  1FPL A;  1FPK A;  2FIE A;  1LBY A;  4O7I A;  5J16 A;  4GWU A;  3BIH A;  1K9Z A;  1NV7 A;  2F3D A;  4GWZ A;  1SPI A;  2QFL A;  4I40 A;  1EYJ A;  4I3Y A;  1FBF A;  5ET5 A;  2CZK A;  4GWW A;  5EYH A;  5T3J A;  1NV5 A;  3RPL A;  1FBE A;  4QXD A;  2OWZ A;  4G61 A;  4H46 A;  3KC1 A;  1XI6 A;  3D1R A;  2WEF A;  1EYK A;  4GBV A;  4GWX A;  4HE2 A;  2VT5 A;  1FJ6 A;  1JP4 A;  3KC0 A;  4N81 A;  1QGX A;  1FSA A;  2FHY A;  1FJ9 A;  5EQ7 A;  3B8B A;  5EQ9 A;  1G0I A;  1EYI A;  1IMD A;  2OX3 A;  1DCU A;  1NV3 A;  1LBV A;  3RPL B;  1FBG A;  1LBW A;  3RYD A;  1G0H A;  2WBD A;  1IME A;  5ESY A;  4GX6 A;  5F24 A;  1DK4 A;  1INP A;  4HXV A;  2QVV A;  5I3S A;  1FBC A;  1KA1 A;  4GX4 A;  2CZI A;  1NUY A;  1IMB A;  2P3V A;  3QMF A;  3LV0 A;  1BK4 A;  1IMA A;  1NUW A;  1FPB A;  1NV0 A;  2PCR A;  2FBP A;  1NUX A;  1NI9 A;  2DDK A;  4PTK A;  3FBP A;  5ET6 A;  5IZ3 B;  1FPE A;  4HE1 A;  1RDY A;  1YZ0 A;  2F3B A;  3BIG A;  5EQA A;  1FPD A;  2CZH A;  1FBD A;  5A5L A;  1FRP A;  4KXP A;  1D9Q A;  5ET7 A;  3ROJ A;  1DBZ A;  5EYG A;  4H45 A;  2HHM A;  4I3E A;  2JJK A;  3T0J A;  5DW8 A;  1Q9D A;  5EQ8 A;  2QVR A;  1KZ8 A;  3LUZ A;  1IMC A;  4GWY A;  1NUZ A;  4AS4 A;  1YYZ A;  4GX3 A;  3IFC A;  2GQ1 A;  2FIX A;  1KA0 A;  1VDW A;  2FVZ A;  2Q74 A;  1AWB A;  1FPF A;  1LEV A;  4FBP A;  4GWS A;  1RDZ A; 
#chains in the Genus database with same CATH topology
 2R8T A;  2I4B A;  1SYH A;  2ONR A;  4LQ5 A;  1R1N A;  4LA9 A;  2ONS A;  4MJO A;  1VFE A;  3RUM A;  3O2A A;  1GTK A;  2Z22 A;  1NV7 A;  3MVY A;  3QUF A;  2O69 A;  3OO6 A;  4I9D A;  1FTJ A;  5I7I A;  4FED A;  3P7I A;  4OVP A;  4K3F A;  5H8F A;  1D9V A;  3K1M A;  2DXY A;  2Q89 A;  2W7Y A;  3L6H A;  4OVJ A;  2AIX A;  1LGB C;  1UTB A;  2V25 A;  4PFR A;  4YKI A;  1B1H A;  4I1D A;  2R9J A;  2F78 A;  1SW4 A;  2YLN A;  3FXR A;  2B3F A;  4JVC A;  1PB9 A;  2Z8F A;  1G0I A;  2CEY A;  3FJM A;  3VXB A;  1URS A;  2VP1 A;  3TQL A;  2DE4 A;  4F39 A;  4N8Y A;  4GX4 A;  2X7P A;  1BKA A;  5ELV A;  1JET A;  4F22 A;  5KCJ A;  4NF4 B;  2D5W A;  2DDK A;  1WDN A;  5I2N A;  4H6D A;  4F3P A;  3ONM A;  1MXW A;  2PVU A;  2RCA A;  1OQH A;  4PAK A;  4I3E A;  1LFG A;  4JWY A;  4Q30 B;  3T96 B;  2DXR A;  4NF5 A;  3VV5 A;  1ZKB A;  1N7X A;  5ICQ A;  2REG A;  5AA2 D;  2GRV A;  2FVZ A;  3RNN A;  2F7A A;  3FV1 A;  1WOD A;  3IOV A;  5AA4 B;  1MPD A;  1K9Y A;  4ELQ A;  1NH8 A;  4G8N A;  3UOR A;  4P1L A;  2DP8 A;  4POX A;  1LBY A;  4O3C A;  5L9M A;  4GLI A;  4YB6 A;  2OJT A;  4PFW A;  2ZYM A;  3C32 A;  1K9Z A;  2CMO A;  1A54 A;  1RKM A;  3V83 A;  1JNF A;  4R9G A;  2F35 A;  4PQJ A;  1EYJ A;  4O8M A;  5I57 B;  3B6T A;  4XF5 A;  5H8N A;  4PC9 A;  4OET A;  1D9Y A;  2PMS A;  4IB2 A;  1IXG A;  4GWX A;  1Z7M E;  4GWO A;  4QSE A;  4R9F A;  3HPI A;  3HCQ A;  3LC8 A;  1MQG A;  1FJ9 A;  4O3A A;  2YPN A;  3KJT A;  4JBZ A;  2OX3 A;  1DCU A;  5I5P A;  4GFR A;  2O1M A;  3O6H A;  1P1O A;  1M5B A;  2E1S A;  3IOT A;  4LN5 A;  3QMF A;  4BDN A;  2OPD A;  5CMB A;  4THI A;  3IK6 B;  5H8H A;  1B4Z A;  2V84 A;  4F3B A;  4QHQ A;  2F3B A;  1MQH A;  4NF6 A;  4HW8 A;  3WAE A;  2QMX A;  4X04 A;  3PGF A;  3USD A;  1MY0 A;  1O7T A;  3H6T A;  2OWS A;  3T93 B;  1MDQ A;  1GVC A;  2NUV A;  1FQF A;  1AWB A;  4ELP A;  4PFI A;  1IIT A;  3U92 A;  1NV4 A;  1AIV A;  2XA5 A;  4M4G A;  1QKB A;  4ZZE A;  4XXU A;  3CI8 A;  4RY1 A;  3E4R A;  2RCB A;  4MNC A;  3M3K A;  4NF4 A;  2UYE A;  4LQ2 A;  2I6E A;  4EF1 A;  2QFL A;  4P56 A;  3IJO B;  1SI1 A;  4P9K A;  5CI5 A;  3A09 A;  4G61 A;  2YJP A;  3D1R A;  2GHA A;  2ALU A;  4JWO A;  4N8G A;  2HXR A;  4R2F A;  4QRZ A;  5I2K B;  4R2B A;  1I69 A;  3KSJ A;  3DEL B;  3C34 A;  1EYI A;  3AXF A;  3FXQ A;  4QFK A;  3DP8 A;  5I56 A;  4HCY A;  5JTY B;  2XWO A;  4AB6 A;  2FA7 A;  2OZZ A;  3FJ7 A;  2PBW A;  3KFM A;  1B1X A;  1IMA A;  1QW0 A;  3SES A;  5ET6 A;  1NI9 A;  4MIJ A;  2PFZ A;  2ESN A;  1CB6 A;  2R6G E;  1FPD A;  1UTH B;  3TPA A;  2Y7W A;  4EXK A;  2O7U A;  3T9U A;  4H45 A;  4MH5 A;  3PPR A;  2XXP A;  1IMC A;  4RPN A;  3SEU A;  2A5T A;  3HN0 A;  3H7M A;  1VDW A;  1I6A A;  4GQO A;  5LTC A;  3K1P A;  4GXA A;  4LON B;  3OMB A;  1LCT A;  4JSD A;  1Y4T A;  1Y9U A;  2HQ0 A;  1UIV A;  3H6V A;  5CMM A;  5TP9 A;  3MPK A;  1Y1M A;  4OFO A;  3I6V A;  3U1O A;  1O63 A;  1US4 A;  3ECR A;  1H44 A;  1DTG A;  1P1Q A;  3QYT A;  3QSL A;  4OVS A;  4U21 A;  4ZDM A;  3L6G A;  2B4L A;  4EQ9 A;  5DVJ A;  2QS4 A;  3JV9 A;  3MAM A;  1POY 1;  3MC2 A;  4PCD A;  4U2R A;  1B7U A;  5DVI A;  1AH5 A;  4R6H A;  1HSL A;  3RPL A;  5LOM A;  3Q28 A;  5DEX A;  1PC3 A;  1IEJ A;  4IY5 A;  2IEE A;  1A8F A;  5BUU A;  4GBV A;  4EUO A;  4ZEC A;  2UVG A;  2R71 A;  3S4U A;  2Z8E A;  4F19 A;  1NKX A;  4EDP A;  2FHY A;  4KYE A;  4M1V A;  3RYD A;  1B52 A;  3OEL A;  5AA3 A;  1R6Z A;  4GX6 A;  1DPP A;  3VE1 B;  3MBP A;  1B0H A;  2VHA A;  4F18 A;  2XWI A;  3OSQ A;  3TCH A;  1N3X A;  4ELR A;  1N0T A;  1RDY A;  4H65 A;  1EH3 A;  1YZ0 A;  3KZG A;  4F29 A;  2CZH A;  1M5F A;  1XHY A;  1D9Q A;  5FHM A;  3K6X A;  1O64 A;  1B3E A;  1S7Y A;  4GRK A;  3UN6 A;  3RGY A;  1FTK A;  2VPO A;  1L5T A;  4ZEK A;  1EU8 A;  4BDQ A;  4MFI A;  1PEB A;  1WVJ A;  4UA8 A;  1LBC A;  4NE4 A;  4F2O A;  3A29 A;  2Y5K A;  4AS5 A;  1FPI A;  3OEK A;  1CNQ A;  4GL0 A;  4MHF A;  5I57 A;  1FPG A;  1RDX A;  4JWX A;  4NG7 A;  4YB7 A;  4U4S A;  4DDD A;  1GGG A;  1AL3 A;  3A3U A;  3CG3 A;  1OVT A;  4G68 A;  4GWZ A;  4KCC A;  4PAF A;  4OYV A;  3QIM A;  1FBF A;  1HSE A;  3CFL A;  1MPB A;  5T3J A;  2H98 A;  1IUD A;  1BIY A;  1TXF A;  2WEF A;  2XXV A;  3MP1 A;  4XKP A;  1EYK A;  2I49 A;  1UQW A;  3D4C A;  3TAJ A;  1B2H A;  2VOZ A;  5EQ7 A;  2FNC A;  3CIJ A;  1Y4C A;  1LBW A;  3F11 A;  2XXQ A;  4DXU A;  2GHB A;  1ZLQ A;  3C31 A;  3EF7 A;  4G8M A;  5IZZ A;  3IB2 A;  5ISU A;  2XWV A;  4IO4 A;  5CMC A;  3PU5 A;  3PD9 A;  3O28 A;  2VD2 A;  3KOT A;  4NTL A;  2QRY A;  4TLM B;  3O97 A;  3C4M A;  3G7W A;  2XXT A;  1DSN A;  2WKY A;  4OVQ A;  4MCO A;  3VLV A;  5A5X A;  3N6U A;  4NX1 A;  3LBS A;  4N13 A;  3M3L A;  2O7I A;  1SDX A;  4EXL A;  1N76 A;  1YYZ A;  4GX3 A;  1IXC A;  2GQ1 A;  3KJ7 A;  2I0B A;  3PUV E;  4OEU A;  1ZIU A;  3SEV A;  1DTZ A;  2XXX A;  1YAE A;  4KYD A;  5IZ1 A;  4PBH A;  2Y7R A;  5TU0 A;  1FTA A;  5ET8 A;  1MY2 A;  3R7X A;  4OES A;  1B7Z A;  5ICT A;  4FIM A;  4GD5 A;  4PAI A;  4P11 A;  4NF8 A;  4RA1 A;  4RNS A;  3C33 A;  1N04 A;  2V4C A;  4OFJ A;  4P47 A;  2DWJ A;  3MJN A;  3KG2 A;  3ZKK A;  4FOR A;  4QBA A;  3OO9 A;  1JW5 A;  4L17 A;  3RTW B;  4PFB A;  2OLB A;  3DLN A;  3S9E A;  1S9T A;  3DP6 A;  2Y7K A;  3TEL A;  3B6W A;  4YIC A;  4KHZ E;  3GZG A;  2DVZ A;  2XD2 A;  1INP A;  5I2K A;  3PD8 A;  1TFA A;  3KOS A;  1B5J A;  1FQE A;  1B05 A;  5EQA A;  2ZNS A;  4GVO A;  3CG1 A;  4GL8 A;  3T0J A;  1Q9D A;  5KDT A;  2OBG A;  4AS4 A;  4FE8 A;  4XFE A;  1KA0 A;  1NH7 A;  2UVI A;  4TOZ A;  3K4U A;  1FPF A;  1XVY A;  4F1U A;  1JEV A;  1Y3N A;  5AA2 A;  2XXK A;  2QPQ A;  1PB7 A;  1JW4 A;  2A5T B;  2ZYK A;  3DM0 A;  3FVO A;  5L9S A;  2Q88 A;  2ABH A;  3VXC A;  1FPK A;  5AE4 A;  3GBB A;  3CRB A;  3PMV A;  4YMA A;  1Y3P A;  3O9P A;  4N6P A;  2RC8 A;  1SI0 A;  3KGC A;  4GWW A;  4QFO A;  4OWD A;  1MXU A;  2ONK E;  3Q29 A;  3VDF A;  4HE2 A;  5AA2 B;  3TYH A;  4R6Y A;  3I5O A;  5JTY A;  5I58 A;  1POT A;  1LAF E;  1SYI A;  1IXH A;  4PFT A;  1FSA A;  2V93 A;  3TCG A;  1NV3 A;  5ITP A;  5TPA B;  4ZEF A;  2I3W A;  3MST A;  3TTK A;  2ZYO A;  1ZMG A;  4HXV A;  3ZS6 A;  2QVV A;  1KA1 A;  3MW0 A;  4F3G A;  2WYK A;  4NWC A;  1MH3 A;  3T9X B;  2NWJ A;  4NMY A;  1BK4 A;  1US5 A;  3QAX A;  1NV0 A;  2PCR A;  2O68 A;  4PTK A;  3VVD A;  3RTF B;  4HE1 A;  4OMB A;  3EKI A;  1FTL A;  3C36 A;  4BDM A;  4BDO A;  1IZ1 A;  5JK4 A;  1MY3 A;  2HAU A;  5FTI A;  5DVF A;  1MY1 A;  1MXY A;  2OWT A;  4TLL B;  4I8C A;  2HCA A;  1KWH A;  5EYF A;  5H8Q B;  2HPG A;  2ZYN A;  4FAJ A;  4N17 A;  4FAT A;  4RK2 A;  1GV8 A;  1PBP A;  3V89 B;  1EZP A;  2V3T A;  3A3C A;  2DYX A;  2Q8M A;  1YXI A;  3PMW A;  5HBC A;  5I59 B;  1T0K A;  1DMB A;  3O29 A;  5IZ3 A;  5HM4 B;  1YTV A;  3O66 A;  4P0I A;  4JXI A;  4MNP A;  1QUL A;  5I84 A;  2F3D A;  4NED A;  1B40 A;  4I40 A;  5L8D A;  2I0C A;  2GH9 A;  1MQI A;  2XWK A;  4XEQ A;  1XC1 A;  3G3J A;  2RC7 A;  5EHM A;  1N7W A;  2X26 A;  3THI A;  3OO8 A;  4OAN A;  4H5F A;  5AA1 A;  1QGX A;  3N26 A;  2Y84 A;  2QS1 A;  5CM6 A;  3PUX E;  4OHN A;  4MMP A;  3K01 A;  2WBD A;  2F5X A;  4EQB A;  2OPE A;  4O3B A;  3D4G A;  3GXA A;  5A5X B;  2CZI A;  3H6W A;  3MYU A;  1EZ9 A;  3HST A;  2G29 A;  1LCF A;  4BLA A;  1B0L A;  4HS7 A;  1FPB A;  1MM7 A;  2L5V A;  1NUX A;  1B5I A;  4DCY A;  5J1D A;  3EPE A;  3MZ9 A;  3TCF A;  4F1V A;  3G3F A;  1FBD A;  4KYS A;  4DI4 B;  3UP9 A;  4PE3 A;  1OMP A;  3LUZ A;  4GWY A;  1GR2 A;  3PPO A;  1BTJ A;  5IM2 A;  2H9B A;  4IGR A;  2OK2 A;  1H43 A;  4G68 C;  4XKN A;  1PDA A;  3FV2 A;  2Y5L A;  4H5G A;  4PF8 A;  2O51 A;  2QL3 A;  1QUK A;  2XXR A;  2F36 A;  3IJX B;  1IMF A;  4XTC Q;  3UGW A;  2Q2A A;  4MX6 A;  4YB5 A;  4DXC A;  4ZED A;  4OQO A;  2GFE A;  1CE2 A;  1QUJ A;  4JVD A;  5IAI A;  2VD3 A;  1ZU0 A;  1B46 A;  4MNI A;  4FEB A;  4OEV A;  4HTG A;  5TPA A;  1XT8 A;  5B70 A;  5KCJ B;  5FHO A;  3TTN A;  3KC1 A;  5JEI A;  1URG A;  4MBP A;  4R74 A;  2V3Q A;  3QUJ A;  3UA8 A;  5I58 B;  1FQB A;  2DWA A;  1N84 A;  3HHF A;  2QS3 A;  1B58 A;  2OCU A;  5F7V A;  2AYS A;  4YKJ A;  1G0H A;  1IME A;  2Z8D A;  3QK6 A;  5F24 A;  3EQ1 A;  4KFQ A;  2HZL A;  4DI3 D;  4RK9 A;  4PBQ A;  5KDT B;  1SW2 A;  3TTM A;  5B7D A;  1RYX A;  4R6K A;  4DIG A;  3W9V A;  1NNK A;  5H8H B;  4HCW A;  4OVR A;  3ROJ A;  2F34 A;  2XXW A;  2I3V A;  4KI0 E;  2UXA A;  4ZS9 A;  4H8I A;  2XXU A;  5DYH A;  3Q27 A;  4QFN A;  2KQZ A;  4FJP A;  1A40 A;  1JVY A;  2B65 A;  4TQU Q;  3IB0 A;  5LDZ A;  4HE0 A;  1QVS A;  4PDH A;  4IGT A;  3H3G A;  2WBB A;  1D4N A;  1A99 A;  4BDL A;  2F8D A;  4O7I A;  5J16 A;  1M5E A;  2ZZX A;  3PPQ A;  3E3K A;  2D21 A;  4N15 A;  3FD3 A;  1I6Q A;  1H3D A;  3IOU A;  3WAF A;  3PMX A;  4NN3 A;  3K6U A;  2B4M A;  3LSX A;  3LR1 A;  4RPO A;  4Q8R A;  4IO7 A;  4WKM A;  4ELO A;  1F9B A;  4U1O A;  4LVQ A;  1XI6 A;  3IX1 A;  2ZNU A;  1YCJ A;  3CHG A;  1FJ6 A;  4KR5 A;  5H8S A;  4N91 A;  3RY3 A;  4PET A;  2KLF A;  1LAH E;  4AQ4 A;  1MPC A;  4U22 A;  4PGN A;  3MZ1 A;  2MKZ A;  4PGP A;  1NFT A;  1RYO A;  2XX8 A;  3T9V A;  3R26 A;  3FXB A;  1MRP A;  3K0V A;  4N6D A;  3SEX A;  1VSO A;  4C1T A;  2WX9 A;  3QXM A;  1OLC A;  4IY6 A;  5ET7 A;  3K1N A;  4OFL A;  2JJK A;  3PV0 E;  3GBA A;  3RN8 A;  2QVR A;  3ISP A;  4RYA A;  3SKP A;  1ZJL A;  3S2V A;  2FIX A;  2F97 A;  4XKQ A;  3FIR A;  4U4X A;  2RKM A;  2E0S A;  5EHS A;  2QMW A;  5HPQ A;  4ZE8 A;  2B3B A;  2F6G A;  4EF2 A;  3BFU A;  4ZEI A;  4WEP A;  4F31 B;  1NV2 A;  4R73 A;  2UVJ A;  2Q2C A;  3IFA A;  2M8C A;  4GBW A;  2Q9T A;  3OEN A;  3E79 A;  5FBP A;  3B50 A;  1MH4 A;  1FPL A;  4WXJ A;  4DCX A;  4GIZ A;  4U23 A;  3MPL A;  3DP4 A;  1MXX A;  1JVX A;  1QJM A;  1Y3Q A;  1SPI A;  2H25 A;  4LP2 B;  2DE3 A;  2CZK A;  3JZJ A;  4Z0I A;  4H46 A;  4MEV A;  3FZV A;  3UK4 A;  4Z7E A;  5CMK A;  3HHG A;  4H8J A;  4R72 A;  3RQT A;  1FCK A;  3SDF A;  3B8B A;  2Y7P A;  1B3G A;  3OSR A;  1NL5 A;  4P1E A;  2UVH A;  1IIW A;  1M5C A;  2QJE A;  1MM6 A;  3EHS A;  3VLU A;  4G68 B;  5CBR A;  3TEP A;  4C0R A;  3KSX A;  1FQC A;  3IOW A;  3LUY A;  1NUW A;  1NNF A;  1FTM A;  2HFB A;  1UIU A;  4ZEB A;  4WED A;  1LST A;  4YKP A;  4NGU A;  1MQD A;  1QUI A;  4PP0 A;  4KXP A;  4H1X A;  5I56 B;  3IL1 B;  3N5L A;  4NF8 B;  1Z7N E;  3BFT A;  1XS5 A;  3ZSF A;  3IFC A;  2QSX A;  4KPT A;  5IGA A;  4MF3 A;  3B7D A;  4NWD A;  3FVK A;  1JW1 A;  1PB8 A;  5EYG A;  1LBZ A;  2PYY A;  3IO6 A;  1JEU A;  1Y20 A;  2I58 A;  3IOR A;  4DZ1 A;  2P3N A;  2NXO A;  4PFY A;  2RF1 A;  2O1L A;  2PFY A;  4RJZ A;  1MS7 A;  1IQ7 A;  2DVC A;  1NNP A;  1XVX A;  1DPE A;  3K02 A;  4ESX A;  2H5Y A;  3Q25 A;  3FUZ A;  3TKD A;  2F6P A;  4LUB A;  4POW A;  1LBB A;  3EHU A;  4YKK A;  2DE2 A;  2THI A;  4KD5 A;  4QSD A;  4F2Q A;  2VT5 A;  3V5A A;  1TWY A;  3KC0 A;  3CVG A;  3ODB A;  2XXH A;  3IO4 A;  1LLS A;  5EQ9 A;  3K6V A;  3NOH A;  3T9H B;  3RPL B;  4X8R A;  3IB1 A;  4G4P A;  1II5 A;  3EHT A;  1MDP 1;  4OER A;  3MUQ A;  3MWB A;  3N6T A;  4DE8 A;  3E78 A;  3HO7 A;  2IA4 A;  3LSL A;  3TDJ A;  1URD A;  1NMU A;  5KZT A;  3HV1 A;  1SW1 A;  5ITO A;  3G3G A;  4LZ7 A;  4XKR A;  3M8U A;  3PUZ E;  3PUW E;  2DSF A;  1B3H A;  4X1B A;  5CRY A;  2Q74 A;  4O94 A;  3K2D A;  1LEV A;  5IKB A;  2AL5 A;  1SW5 A;  4ZZA A;  4H0W A;  1FPJ A;  4IR8 A;  3KBR A;  2WYP A;  1QKA A;  3FVG A;  1P99 A;  3MP8 A;  4P8B A;  3RPW A;  3SET A;  4ESW A;  1NNT A;  3T66 A;  4NHB A;  2XXI A;  2RIN A;  1D3K A;  1B51 A;  3SEY A;  1ZBM A;  2ZXT A;  4ZE9 A;  3G3I A;  5F1Q A;  4IO3 A;  1ELJ A;  1OVB A;  4I3Y A;  1VR5 A;  4RXL A;  3U93 A;  1SD3 A;  4NAP A;  5ET5 A;  1LAX A;  3K00 A;  3TMG A;  4QXD A;  5AA4 A;  3LSF B;  3N94 A;  3PPP A;  4QSC A;  3VVE A;  2Z23 A;  3VVF A;  3OEM A;  5M2V A;  4ND9 A;  3FJG A;  3BKI B;  1SVX B;  2HXW A;  3I3V A;  3IR1 A;  4IO2 A;  3V8X B;  1FBG A;  2NVU B;  1SBP A;  5ESY A;  3SEW A;  2NOO A;  3KN8 A;  3C9H A;  5I3S A;  3SZP A;  3R6U A;  3MVX A;  1J1N A;  4YMB A;  3O6G A;  1Q35 A;  5I2N B;  1B5H A;  4MLV A;  5DEX B;  3OO7 A;  4JVI A;  3O6I A;  1B9J A;  3CFX A;  1JQF A;  1LFH A;  3EN3 A;  4JDF A;  3U72 A;  4NF6 B;  4N4U A;  3Q26 A;  1ANF A;  4F1Y A;  3S9L C;  2F7C A;  2HHM A;  3TQW A;  4Q5T A;  1BLF A;  5EQ8 A;  1VFD A;  1KZ8 A;  1NUZ A;  4MAG A;  1N3W A;  4JSO A;  3IAZ A;  4X1D A;  4PE5 B;  5FHN A;  4FBP A;  1UTB B;  1FTO A;  1B3F A;  1ZTY A;  1B6H A;  2RC9 A;  1A8E A;  4OA4 A;  4C1U A;  4OVT A;  2Y7I A;  2Q8J A;  3VLW A;  1MY4 A;  1OIB A;  3KN7 A;  4I62 A;  4EQ7 A;  2ZMB A;  3S9M C;  3FGS A;  3ILU B;  3B6Q A;  3KN3 A;  1TFD A;  2OWZ A;  4AB5 A;  4G8H A;  4F3S A;  2H99 A;  3TOD A;  1B4H A;  1JP4 A;  4LZ8 A;  3ILT B;  4UAC A;  1LB9 A;  5FTH A;  1LBV A;  4IO5 A;  2A5S A;  1USY E;  1BP5 A;  4GOT A;  3H03 A;  1DK4 A;  3OD7 A;  1FQA A;  3M3F A;  4ECF A;  1IMB A;  4ONY A;  2ZNT A;  4X48 A;  1VE4 A;  1A55 A;  4E0X A;  2BJJ X;  3FAT A;  1FW0 A;  5A5L A;  3MVZ A;  1MXZ A;  2PX1 A;  3K6W A;  2I4C A;  4YZZ A;  2PT2 A;  3SER A;  2PT1 A;  4UAB A;  1LFI A;  4QFP A;  1B32 A;  3H06 B;  2XX7 A;  1FQD A;  3BBR A;  3VFJ A;  3CSG A;  1OQG A;  2ZZW A;  1LBX A;  1YPN A;  4OZ9 A;  1EZO A;  4OXV A;  2QVU A;  1B3L A;  2XXY A;  3E13 X;  2ZZV A;  3H6U A;  3KBZ A;  1H76 A;  2REJ A;  1FBH A;  2FIE A;  2XHD A;  4GWU A;  1PBQ A;  3CR9 A;  3GYY A;  4YAH X;  2P1S A;  3TFL A;  3U8Q A;  3MQ9 A;  3ZKL A;  5I59 A;  5CC2 A;  1AOV A;  5EYH A;  1NV5 A;  1FBE A;  4PF6 A;  3W15 C;  1S50 A;  3OXN A;  4LAT A;  4NQ8 A;  1R9L A;  2XX9 A;  3PTY A;  3TTR A;  3JYR A;  5H8Q A;  1IMD A;  3PUY E;  2DQV A;  1AMF A;  1DOT A;  3G3H A;  4E0W A;  2HAV A;  2LAO A;  1P1N A;  5H8F B;  2HZK A;  4LZ5 A;  4P3L A;  3GLB A;  4QFL A;  4Q0C A;  1LB8 A;  1FBC A;  3UIF A;  1NUY A;  1P1U A;  3PPN A;  2QS2 A;  1B7H A;  1SQY A;  2P0S A;  2P3V A;  5DT6 A;  3LV0 A;  4DLD A;  2FYI A;  3CSB A;  4PFU A;  4H67 A;  5H8N B;  3FBP A;  1MG1 A;  1I6B A;  2X7Q A;  3MP6 A;  2HEU A;  1USY H;  2CEX A;  1DBZ A;  3H4Z A;  1XOC A;  1Q1K A;  3T1B A;  2AL4 A;  2I48 A;  4FEC A;  3KEI A;  4NF0 A;  3OOA A;  4GWS A;  1RDZ A;  2O6A A;  3E9X A;  1NV6 A;  4IO6 A;  1FBP A;  4OEN A;  1HSJ A;  2BJI A;  4X9T A;  1MQJ A;  2DOJ A;  5BWJ A;  1NV1 A;  3TZA A;  1LAG E;  2DWI A;  4NF5 B;  4BDR A;  3HFU A;  5K2Y A;  2KR0 A;  3U94 A;  3BIH A;  2G93 A;  1OLA A;  4G2Z A;  4N6K A;  3MZB A;  2XD3 A;  3FAS A;  1Y1Z A;  4JB7 A;  2H4I A;  3FVN A;  2CZL A;  4N07 A;  3U65 A;  4O7M A;  4U1Z A;  3FXU A;  5TP9 B;  2O84 X;  4PDD A;  3S9N C;  4ISU A;  4N81 A;  5K2X A;  1TT1 A;  4GXS B;  1A7L A;  2P2A A;  4MLQ A;  5CBS A;  2UYF A;  3TTL A;  1ATG A;  3W9W A;  3RLF E;  3T22 A;  1MXV A;  2V3U A;  3LSW A;  1H45 A;  4P0G A;  2F7B A;  4YU0 A;  2VPN A;  1UTH A;  2FBP A;  5DTB A;  4GF8 A;  5IZ3 B;  1FPE A;  3BIG A;  4R75 A;  3C35 A;  3MVW A;  4KQP A;  4XIG Q;  1P1W A;  3TUS A;  1FRP A;  2ANJ A;  5L9O A;  1R9Q A;  4KCD A;  2D3I A;  3CFZ A;  5DW8 A;  1M5D A;  2VGQ A;  2DWH A;  3RT6 B;  3RT8 A;  2DS9 A;  4DXB A;  4OTE A;  4G77 A;  4QF9 A;  1IXI A;  3G3K A; 
#chains in the Genus database with same CATH homology
 2XXK A;  2QPQ A;  1LBZ A;  2ZZW A;  1LBX A;  2Q8M A;  1NV2 A;  2R8T A;  4PFI A;  1NV6 A;  1YXI A;  1FPJ A;  3A29 A;  1FBP A;  1K9Y A;  1NV4 A;  2BJI A;  2Y5K A;  4AS5 A;  4HE0 A;  1FPI A;  5LDZ A;  4IR8 A;  4PDH A;  2Y5L A;  5IZ1 A;  2XA5 A;  2QVU A;  2WYP A;  4P1E A;  1CNQ A;  2P3N A;  4PBH A;  1FTA A;  3IFA A;  4P1L A;  1NV1 A;  2ZZV A;  4MHF A;  4OA4 A;  4PF8 A;  4GBW A;  4MJO A;  1FPG A;  2WBB A;  5ET8 A;  1IMF A;  2Q9T A;  4P8B A;  1RDX A;  2PFY A;  3E79 A;  5FBP A;  5IZ3 A;  3B50 A;  3KBZ A;  4NG7 A;  4MX6 A;  1FBH A;  1FPL A;  1FPK A;  2FIE A;  4OVT A;  1LBY A;  4O7I A;  3HFU A;  5J16 A;  4NHB A;  2KR0 A;  2ZZX A;  4GWU A;  4OVS A;  3BIH A;  4PAI A;  4MNC A;  4MNP A;  4N6K A;  4JVD A;  1K9Z A;  2B4L A;  3GYY A;  1NV7 A;  4N15 A;  2F3D A;  4GWZ A;  4PAF A;  1SPI A;  2QFL A;  2V4C A;  4MNI A;  4I40 A;  4PCD A;  1EYJ A;  4I3Y A;  4NN3 A;  4O8M A;  5I7I A;  4OVP A;  1FBF A;  2B4M A;  4P56 A;  4P47 A;  4NAP A;  2DE3 A;  5ET5 A;  2XWK A;  2CZK A;  4GWW A;  4P9K A;  4XF5 A;  5EYH A;  5T3J A;  4XEQ A;  1NV5 A;  3RPL A;  1FBE A;  4PC9 A;  4QBA A;  4QXD A;  3U65 A;  2OWZ A;  4O7M A;  4G61 A;  4H46 A;  4PF6 A;  4MEV A;  3KC1 A;  1XI6 A;  3D1R A;  4PFB A;  2WEF A;  2DE2 A;  4PFR A;  1EYK A;  4PDD A;  4N8G A;  4GBV A;  4GWX A;  4HE2 A;  2HXR A;  2V3Q A;  4NQ8 A;  2VT5 A;  3CHG A;  3PTY A;  1FJ6 A;  1JP4 A;  3KC0 A;  4N81 A;  4OAN A;  4F19 A;  1QGX A;  4N91 A;  4JVC A;  1FSA A;  2FHY A;  1FJ9 A;  5EQ7 A;  3B8B A;  4PET A;  5EQ9 A;  3NOH A;  1G0I A;  1EYI A;  1IMD A;  2OX3 A;  2CEY A;  1DCU A;  5CM6 A;  1NV3 A;  1LBV A;  3RPL B;  5I5P A;  1FBG A;  4PGN A;  4M1V A;  1LBW A;  3RYD A;  4HCY A;  4X8R A;  4YIC A;  2XWO A;  1G0H A;  4MMP A;  2WBD A;  1IME A;  2F5X A;  2DE4 A;  2HZK A;  5ESY A;  2MKZ A;  3MST A;  4PGP A;  3W9W A;  2DVZ A;  4P3L A;  5IZZ A;  4GX6 A;  5F24 A;  1DK4 A;  1INP A;  4HXV A;  2QVV A;  5I3S A;  1FBC A;  1KA1 A;  4GX4 A;  2HZL A;  2XWV A;  3FXB A;  2CZI A;  2WYK A;  4N8Y A;  3SZP A;  4DI3 D;  1NUY A;  3MYU A;  4LN5 A;  4F18 A;  4N6D A;  4PBQ A;  1IMB A;  2XWI A;  2P3V A;  3E78 A;  3QMF A;  3LV0 A;  1BK4 A;  1IMA A;  4X9T A;  2VPN A;  4JVI A;  1NUW A;  1FPB A;  1NV0 A;  2PCR A;  2L5V A;  2FBP A;  1NUX A;  1NI9 A;  2DDK A;  4PTK A;  3FBP A;  5ET6 A;  2PFZ A;  5IZ3 B;  4MIJ A;  1FPE A;  5J1D A;  4HE1 A;  3W9V A;  3EKI A;  1RDY A;  4F1V A;  1YZ0 A;  2F3B A;  4N4U A;  3BIG A;  5EQA A;  4NGU A;  1FPD A;  2CEX A;  2WX9 A;  2CZH A;  4OVQ A;  1FBD A;  4HCW A;  5A5L A;  4MCO A;  4DI4 B;  1FRP A;  4KXP A;  1D9Q A;  5ET7 A;  3ROJ A;  4OVR A;  5JK4 A;  4PAK A;  1DBZ A;  5EYG A;  4X04 A;  4PE3 A;  4H45 A;  4NX1 A;  2HHM A;  4I3E A;  2JJK A;  3T0J A;  2HPG A;  5DW8 A;  3T1B A;  1Q9D A;  5EQ8 A;  2QVR A;  1KZ8 A;  4N17 A;  4YZZ A;  3LUZ A;  1IMC A;  4GWY A;  1NUZ A;  4AS4 A;  1YYZ A;  4GX3 A;  3IFC A;  2GQ1 A;  3ISP A;  4MAG A;  5IM2 A;  2FIX A;  4UAB A;  5IGA A;  2VPO A;  4XFE A;  1KA0 A;  1VDW A;  2FVZ A;  2Q74 A;  4NF0 A;  4O94 A;  1AWB A;  1FPF A;  1LEV A;  2KQZ A;  4FBP A;  4F1U A;  5LTC A;  4GWS A;  1RDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...