5EQAA

Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) with intermolecular cross-link between lys158 and cys245
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
265
structure length
253
Chain Sequence
b'QLNHFSDVANKAANAAGDVIRKYFRKSPVTIADQSAEEAMVSVILDNFPSHAVYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGPLFGTLIALLQNGTPILGIIDQPVLKERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRVRDKVKIPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASPLSIATSFNVVAAGDKQIHQQALDSLQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Structural Studies of Medicago truncatula Histidinol Phosphate Phosphatase from Inositol Monophosphatase Superfamily Reveal Details of Penultimate Step of Histidine Biosynthesis in Plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Biosynthetic protein
total genus 87
structure length 253
sequence length 265
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eqaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eqaA02
1LBWA 5ET5A 3IFAA 1K9YA 1FBPA 1DCUA 1YYZA 1JP4A 2WBDA 2GQ1A 3LUZA 1RDYA 2P3VA 4QXDA 1FPLA 2Q8MA 1G0HA 2CZKA 1NV1A 2F3DA 3QMFA 5EQ7A 5ET6A 1NI9A 4I3YA 3KBZA 1KZ8A 1YXIA 1INPA 1FPKA 1NV3A 2Q74A 5DW8A 2Y5LA 1RDXA 1FTAA 1NV6A 4AS4A 4FBPA 5A5LA 2VT5A 2CZIA 1LBVA 2FVZA 5EYHA 1IMCA 1EYJA 5IZ3B 1NV0A 1AWBA 4GBWA 5T3JA 2R8TA 4G61A 1QGXA 1FJ9A 2FBPA 4I3EA 4HXVA 4IR8A 3D1RA 3ROJA 5F24A 2CZHA 1G0IA 5IZ1A 2OWZA 1IMAA 4KXPA 3RPLA 5ET8A 1IMDA 1D9QA 1LEVA 3FBPA 4GWZA 1KA1A 1LBXA 4O7IA 1DBZA 1FPBA 1FBCA 4H45A 4GX4A 1FSAA 2BJIA 2QVRA 1IMBA 4HE1A 4GWUA 2FHYA 1FRPA 1FBFA 1RDZA 4H46A 2DDKA 4PTKA 1FPFA 1NUXA 3RYDA 2PCRA 4GX6A 5FBPA 1IMFA 1CNQA 3B8BA 5ET7A 1YZ0A 1VDWA 5EQ8A 1NV4A 4GWWA 4GWXA 5IZ3A 4I40A 1IMEA 4GWYA 1FBHA 5ESYA 1FPGA 1XI6A 3KC0A 4GX3A 5J16A 5EQ9A 1EYIA 5EQAA 3BIHA 1EYKA 2WEFA 1NV5A 1NUWA 1FPDA 4HE2A 1LBZA 2F3BA 2JJKA 3A29A 3BIGA 1Q9DA 1KA0A 1SPIA 4GBVA 1NV2A 1FBEA 1K9ZA 2FIEA 2QFLA 2OX3A 3T0JA 1FPEA 5LDZA 1FPJA 3IFCA 2P3NA 3LV0A 4N81A 2Y5KA 1DK4A 1FBGA 1NUZA 1NV7A 4HE0A 4MJOA 1FPIA 5I3SA 1LBYA 2WBBA 1FBDA 1FJ6A 2FIXA 2QVVA 5EYGA 1BK4A 4GWSA 1NUYA 3KC1A 2HHMA 4AS5A 2QVUA 3RPLB
chains in the Genus database with same CATH superfamily
2Z22A 1FBPA 4OEVA 4EUOA 1NV1A 4XKQA 4HTGA 4YKPA 4NAPA 3T9XB 2BJJX 4MEVA 2ZZVA 3TTRA 4G4PA 1FJ9A 4G8HA 1A7LA 3IX1A 4IO2A 1GTKA 2B3FA 3QAXA 1IMDA 3G3JA 3C35A 2YLNA 1LBXA 4MMPA 2QVRA 1DPEA 4RK9A 1LCTA 1GGGA 3H6UA 1FPFA 3RYDA 4ZEFA 4PFIA 4OA4A 1YZ0A 1FW0A 4R6HA 1Y1MA 3O9PA 4G8NA 5I58B 3SEXA 2P2AA 4O3AA 2DWJA 2F78A 3H3GA 2Y7WA 4C1TA 5EQAA 1MXYA 2F6PA 4I8CA 3IK6B 3K00A 5LTCA 3K6VA 1VFDA 1Q1KA 3OOAA 3EKIA 4NF4A 1NMUA 3FVKA 1LAGE 3ILTB 4GXAA 1FPEA 2E0SA 5LDZA 3KSXA 4TOZA 1B32A 1OMPA 1FPJA 1DSNA 4N81A 4PBQA 1FBGA 3H6TA 1VE4A 3MVWA 3B6TA 3K1NA 3LSXA 4R75A 4NWCA 5ET5A 2OK2A 1FTOA 5A5XA 2GQ1A 4OVSA 3IJOB 3PPRA 4HCWA 1NNTA 1UIVA 3IO4A 3OEKA 4PC9A 1NKXA 1INPA 3LC8A 2Q74A 4ZE9A 1FTAA 3C34A 4U2RA 4FBPA 1LB8A 2ZNUA 5I5PA 1SYIA 1PDAA 3O29A 3IOVA 4I3EA 4UABA 1H44A 4OENA 2E1SA 3PMWA 3ZSFA 2F35A 5CRYA 1A55A 3Q29A 4R9GA 1R9LA 3TTLA 3VFJA 3TTNA 4H6DA 4PQJA 4PETA 4GX4A 3UORA 2BJIA 2QMXA 3K02A 3FV2A 3LBSA 4XTCQ 4FIMA 3HPIA 2OLBA 3MVXA 4PFWA 4R2FA 1GR2A 1A54A 2OWSA 5ICQA 4XIGQ 2ONRA 5L9OA 2REGA 2OCUA 2UYFA 5TPAB 4DXBA 1B52A 2AYSA 4MNCA 4DLDA 1IXHA 1FBEA 3T0JA 4XXUA 2Y7KA 5H8SA 2DSFA 1JVXA 1N0TA 3LR1A 2HFBA 1MY2A 1SW1A 3K1PA 1TFAA 3IJXB 3FJMA 3S9MC 4XKRA 4HE0A 2Q89A 1MXWA 2I6EA 3UIFA 2THIA 2WBBA 2FIXA 2QVVA 3WAEA 1DCUA 2DYXA 1R6ZA 3MC2A 4I1DA 4K3FA 2ZYOA 3U93A 4MBPA 4F2QA 1LSTA 2DOJA 2O69A 4M4GA 2FVZA 2A5SA 5I58A 4N17A 4G8MA 2R8TA 1ZKBA 2F97A 4JWOA 3MPLA 1IIWA 3MYUA 2P0SA 4O3BA 2REJA 1XT8A 4XKPA 4DXUA 4EF2A 4GRKA 1FBCA 1OVBA 2I49A 3FD3A 1SBPA 3A3CA 3HFUA 4X1BA 2PT1A 4KYEA 1FTJA 3S4UA 2PCRA 2Z8DA 4MAGA 5FBPA 4F3SA 1Q35A 3B8BA 5CM6A 3T22A 1ZIUA 2F7AA 2A5TB 2Q2AA 2Y7PA 1B3EA 4F2OA 4RPOA 1IMEA 3ZS6A 1MQJA 4H65A 3T96B 2VPNA 3CR9A 4GWOA 4IGTA 3BIHA 4G77A 4PDHA 4NHBA 5DYHA 4KYSA 1NNPA 4YB6A 2NXOA 4OWDA 3ECRA 4RXLA 4LUBA 2FIEA 1OIBA 2DVCA 1YPNA 3T93B 2FNCA 2P1SA 3TMGA 2Q8JA 1DK4A 4LQ5A 3VXBA 1M5FA 5B7DA 3GLBA 1FJ6A 4GXSB 4UA8A 2HHMA 4DIGA 4LN5A 3RPLB 4ONYA 1B7ZA 5AA4B 1II5A 1QULA 1S50A 2QS3A 4F1UA 2F36A 1MDQA 4ZS9A 1US5A 3LSWA 3PD9A 3T9HB 1S7YA 3N26A 1FQDA 5ELVA 3B50A 3DLNA 1YXIA 2Y5LA 3TAJA 1P99A 1B0LA 3S9NC 1I6BA 4MFIA 3C36A 4YKJA 5H8HA 4OVJA 2I0CA 1Y3QA 5EYHA 3DP8A 2HCAA 4FECA 2HQ0A 3TDJA 4BDNA 3V8XB 5AE4A 1WDNA 1PBQA 1USYE 2X26A 3CSBA 1IXGA 1UIUA 3FIRA 2I48A 3E9XA 5DVIA 1JEUA 2I4BA 4O7IA 1JEVA 4ZDMA 3PV0E 2V93A 3MP8A 1AH5A 3JV9A 4BLAA 1IMFA 1TWYA 5JEIA 1LLSA 1MPCA 3SDFA 2V3QA 4KQPA 3OO8A 3S2VA 1OLCA 4ZEDA 4PDDA 2QS2A 3EHUA 3TELA 4JSOA 3IAZA 2HZKA 3HV1A 1MY1A 4DDDA 1DMBA 3G3GA 1B3LA 2QJEA 3LSFB 2HEUA 5IAIA 4EQBA 3G3KA 2H99A 2D5WA 1RYXA 4EXKA 2VOZA 3HN0A 4LZ7A 4X48A 5ISUA 4ZZAA 3FATA 3OSQA 1B3FA 1N7WA 2R71A 5I84A 4R74A 3U94A 1PB7A 2CZKA 1UTBA 3K6XA 2OWTA 4GOTA 5H8FA 4P11A 1Y4TA 2H98A 5A5LA 2A5TA 1YCJA 2F7CA 2KLFA 2F8DA 2QSXA 4YKIA 4HXVA 4OQOA 1B9JA 2HXRA 1N76A 4QRZA 4F31B 3CG3A 2HZLA 1M5CA 2B65A 4TLMB 3FBPA 4NF4B 1Y3PA 3KBRA 4QSEA 5IKBA 1O63A 1LAHE 1ZU0A 4EDPA 4GWUA 3SEYA 1GV8A 3KN3A 1RDZA 2DE3A 4N91A 1ZJLA 2XXXA 4XEQA 1QUIA 3ZKKA 3H7MA 1WODA 4JXIA 4QFPA 3PPQA 1FTLA 2PX1A 3C33A 3FXRA 4FEBA 4KFQA 4FAJA 4ELQA 2HXWA 1EYKA 4H5GA 3O97A 5A5XB 1FPDA 2HPGA 2KQZA 2PMSA 4F19A 1SPIA 4OVPA 4JB7A 1US4A 3MBPA 1A8FA 4ISUA 4MLVA 3MZBA 1IZ1A 2Q2CA 2D21A 4ESXA 5CMKA 3RN8A 3E13X 4DZ1A 2Z8FA 3K6UA 3CSGA 1CB6A 4C0RA 3IFAA 3OSRA 4OFJA 4PFRA 3LUZA 3B7DA 4EXLA 2Q8MA 4RPNA 5K2YA 3QXMA 2VHAA 5DW8A 5AA2B 3FXQA 3TTKA 4AS4A 4PE3A 3TODA 1PEBA 4M1VA 1MPDA 4OZ9A 4QFOA 3S9EA 1P1UA 4U4SA 1FQBA 5IGAA 2ALUA 4ZEBA 3H6WA 2ZZXA 2QPQA 5FTIA 1O7TA 4DCYA 3Q26A 1QUJA 3TUSA 5LOMA 5ET8A 1N7XA 2VPOA 4EQ7A 3PD8A 3FJ7A 4PFTA 3PUVE 3U8QA 3FGSA 1FQFA 3C31A 4IGRA 2B4MA 2HAUA 4F3BA 3M3FA 2UVGA 3SEVA 1A40A 4GWXA 2OPEA 1AMFA 1MH3A 2VD3A 3MWBA 3G3HA 4ZEKA 3VVDA 4PFYA 2XXVA 4F3PA 2QS1A 4QFLA 2WEFA 2NOOA 1O64A 2YPNA 2XXTA 4PGPA 5FHNA 3K01A 4GBVA 1SI1A 2ZMBA 4LP2B 3LUYA 1MXUA 3LV0A 3IB2A 2Y5KA 3MSTA 1R9QA 1Y20A 2XXRA 4H67A 4XKNA 2UXAA 1ZBMA 1FBDA 4GIZA 2PYYA 1N84A 2UVJA 4P1EA 2L5VA 1NUYA 1LBBA 4AS5A 4BDLA 4JVIA 4YB7A 4TQUQ 4IO4A 2WBDA 2NWJA 1BLFA 1EU8A 4OESA 5ET6A 1USYH 3UP9A 3PPOA 2VD2A 2RINA 2RC9A 2XXKA 3IL1B 5B70A 1ZLQA 4F22A 1EZOA 2Q88A 4N6PA 1TT1A 3VVFA 3HSTA 1QGXA 1VR5A 2I4CA 3D1RA 2DWIA 3L6HA 1DTGA 2XWKA 4XF5A 4YMAA 4P47A 3KEIA 1M5BA 1KA1A 4U22A 3RTWB 3D4CA 2I0BA 3Q25A 3CI8A 1IMBA 4PFUA 1A8EA 2DDKA 2PFZA 1LAFE 1FQEA 2RC7A 3V5AA 3DM0A 4NF5A 5FTHA 4I40A 1FBHA 1BKAA 4H0WA 3KC0A 3HHFA 5M2VA 4N6DA 1MXXA 5KCJA 3QK6A 3E78A 3O6IA 3O66A 3C32A 4R6YA 2X7QA 4I62A 1P1WA 4P8BA 5AA2A 1IITA 2Z8EA 5DVJA 5DT6A 2UVIA 2MKZA 4LZ5A 5H8HB 1VSOA 3BKIB 2XWIA 2P3NA 1SW2A 2ZNSA 4Q30B 1B40A 3MVYA 1LFGA 3WAFA 3MVZA 4MX6A 3MAMA 4X9TA 1OLAA 4R73A 3G3IA 2ANJA 1CE2A 1FPLA 2DXYA 3OMBA 1PB8A 3SERA 2X7PA 2XXWA 1AIVA 3KBZA 3Q28A 1N3WA 1ANFA 4THIA 3G7WA 1SQYA 2YJPA 1BTJA 2Z23A 4JVCA 1LGBC 3KJTA 3N5LA 1IXCA 1B05A 4YB5A 1MH4A 3PTYA 3U92A 5JK4A 4DXCA 5TU0A 1LEVA 4F18A 5F7VA 4GWZA 1XHYA 4L17A 1H45A 3OO9A 4QF9A 2V3TA 4NF6B 1Z7NE 4UACA 4JWXA 1XVYA 1BIYA 4QFKA 4Z0IA 3OENA 3I3VA 3N6UA 2G93A 2F5XA 3CG1A 3K1MA 4NGUA 4PF6A 1FPGA 3SEUA 5EQ9A 3FXUA 4KI0E 2R6GE 2RCBA 4LZ8A 1JW5A 1QKAA 1UTBB 5H8NB 4O7MA 2H25A 5H8FB 2V25A 3G3FA 4LATA 3TKDA 4U1OA 3OELA 3FZVA 4MF3A 1T0KA 5J1DA 4MLQA 1SVXB 2OZZA 3GBBA 1EH3A 3PUXE 2I3WA 4YKKA 3HHGA 4NF8B 3H06B 3ZKLA 3OD7A 4FATA 4JBZA 3FVGA 3W9WA 1KZ8A 3R6UA 1FPKA 1B5HA 1MY3A 3DELB 1NV6A 5I57A 1XOCA 3PPPA 3TQWA 4H5FA 1NH7A 2F6GA 1EYJA 2B4LA 1NV0A 2XWVA 3PGFA 4G61A 5ICTA 1OVTA 1MQGA 1B3HA 2G29A 4AB5A 2B3BA 2R9JA 3RUMA 2O1MA 4AQ4A 2ABHA 1H3DA 4OMBA 2ZZWA 4LA9A 2PFYA 1PBPA 4AB6A 4Q0CA 1VFEA 3RY3A 1I6QA 1URGA 3QYTA 1HSLA 3W15C 5IZ3A 2Y7IA 4NEDA 4TLLB 1NL5A 1RYOA 3OO6A 1MY0A 4BDQA 3TCHA 2ESNA 4XFEA 3PU5A 1QJMA 4G68B 1URDA 2LAOA 2WX9A 1Q9DA 4RA1A 2DE4A 1B1XA 5I2NA 4PBHA 5HBCA 3BFUA 2I58A 4BDOA 2HAVA 4MH5A 1NV7A 2XXQA 2F34A 5HM4B 1UQWA 3B6QA 4GD5A 3USDA 1AL3A 3FUZA 4LONB 1FTMA 4R72A 4H8IA 1OQGA 1XVXA 3EHTA 4NF6A 1RDYA 2GHBA 4OVQA 2F3DA 1P1NA 3DP4A 3RT8A 5I59A 4X04A 1B58A 2FA7A 4H8JA 2O51A 3O6GA 4F29A 2FBPA 4IR8A 1B1HA 3U72A 2XD2A 4N8GA 2CZHA 4FEDA 4MNIA 4N6KA 1NNKA 4NF0A 1MXZA 5H8NA 4NWDA 4P1LA 4OVRA 4NE4A 3IB1A 1DBZA 4H45A 3RNNA 1FTKA 4PAIA 1DOTA 2OBGA 4H46A 2FYIA 4WEPA 1LBCA 4KCCA 3OEMA 1P1QA 2H9BA 3TQLA 3LSLA 1JW1A 4NF8A 1EYIA 1HSEA 3V89B 4OETA 4NMYA 4HE2A 5BWJA 2F3BA 2O68A 1FQCA 4N07A 1PB9A 1ZMGA 1KA0A 3KOTA 2AL4A 4QFNA 5L8DA 4LVQA 4RY1A 3IOUA 2XXYA 1MG1A 4O8MA 5H8QB 5KDTA 3T1BA 4GWSA 3BFTA 3PPNA 3KC1A 4Z7EA 3IORA 3MP1A 1EZPA 1MXVA 4KCDA 2GRVA 3KN8A 3MZ1A 3EF7A 4QBAA 4E0XA 3QMFA 4I3YA 2I3VA 1LFIA 2O84X 4YU0A 4I9DA 3EHSA 1RDXA 4G68C 3UGWA 2CZIA 4RJZA 4NF5B 1IMCA 3RQTA 4C1UA 5L9MA 4BDRA 2UYEA 3SKPA 3TEPA 4DI3D 4GL0A 3ROJA 5AA3A 4G68A 4NTLA 1MM6A 4U23A 3THIA 5KCJB 4F3GA 4KR5A 1JW4A 3KZGA 1FSAA 2FHYA 5I2KA 4MCOA 3E3KA 2DP8A 4GX6A 4R9FA 4PGNA 1CNQA 4F1VA 1MPBA 1J1NA 2QMWA 5L9SA 5JTYA 1YTVA 1XI6A 4X8RA 4GX3A 5J16A 4NQ8A 2DWHA 3TTMA 4GVOA 1QW0A 1ZTYA 3VLWA 2CMOA 4QHQA 4U4XA 1LBZA 2JJKA 3KG2A 3AXFA 3T66A 3MQ9A 3RLFE 2GH9A 4KD5A 4P0GA 3TYHA 2D3IA 4IO6A 2VP1A 4GLIA 2QS4A 3MUQA 4FORA 4GL8A 5EYGA 1FQAA 4PFBA 1HSJA 4YICA 1K9YA 1YYZA 4U21A 3UA8A 2DS9A 2NUVA 2ZXTA 4PAFA 3R26A 1SDXA 2ONKE 4F1YA 2IEEA 4OEUA 4R6KA 5CBRA 4ECFA 2KR0A 2H4IA 1UTHA 4ELOA 4YMBA 2IA4A 3TZAA 3GZGA 1BP5A 4KPTA 3BBRA 2XHDA 3SETA 3ONMA 3MP6A 2XWOA 4E0WA 5FHMA 2O7IA 4JSDA 1WVJA 5KZTA 5I56A 4IO7A 3GBAA 4IO3A 3RPWA 4EQ9A 3A09A 4WXJA 2CEXA 3TPAA 5H8QA 1NV4A 1DPPA 4H1XA 1LB9A 3PMXA 3W9VA 1AOVA 4QSCA 3DP6A 4DE8A 3RGYA 4IY5A 4RYAA 3C4MA 4OTEA 3NOHA 3U65A 2QRYA 4IO5A 3E4RA 4N8YA 1FCKA 3O28A 5DVFA 4P56A 2OX3A 3T9UA 1NNFA 2NVUB 5I57B 2DVZA 3KN7A 2CEYA 5BUUA 5TP9A 3TCGA 3E79A 4MNPA 1NUZA 3FXBA 2ZYKA 1M5DA 1FPIA 3PMVA 1B5JA 1M5EA 3F11A 1SD3A 1SI0A 3UN6A 2QVUA 2CZLA 1IQ7A 4NX1A 3VDFA 2UVHA 2DWAA 2O1LA 1LFHA 3IOTA 4KYDA 4Q5TA 2Q9TA 3C9HA 1MQDA 1B2HA 2RC8A 2PT2A 1IEJA 1SW5A 1LBVA 3FV1A 1KWHA 5IZ3B 5T3JA 4MIJA 3KJ7A 1QKBA 4JWYA 1G0IA 4OERA 5IZ1A 1IMAA 4GQOA 2RKMA 4O94A 5CBSA 1D9QA 3OO7A 5ITOA 1ATGA 1FRPA 4ZECA 5I2NB 1H43A 3KSJA 1B6HA 3L6GA 3VVEA 3ODBA 3HO7A 3VLUA 1LAXA 3O6HA 3GXAA 3QSLA 3OXNA 2O7UA 2O6AA 3CFLA 1IXIA 2F7BA 1MRPA 4HW8A 3K2DA 3JYRA 3N6TA 4OHNA 3QIMA 3Q27A 3UK4A 4JVDA 1MDP1 3PUZE 1D4NA 4ZEIA 3U1OA 2Y84A 1N3XA 5I59B 4OFOA 2GFEA 4RNSA 3SEWA 3IFCA 1YAEA 2VGQA 4FE8A 3I5OA 5I3SA 4N4UA 4Q8RA 1Y1ZA 3CFXA 1QVSA 1P1OA 1LBWA 3H03A 3A3UA 2RF1A 1JP4A 1H76A 1B4HA 3EPEA 1POY1 1B4ZA 2DXRA 5EQ7A 2XX8A 1GVCA 2WYKA 4NG7A 2VT5A 1B3GA 3V83A 3B6WA 1QUKA 2AIXA 4PP0A 2M8CA 1MQIA 4ZE8A 4IB2A 1Y3NA 3FJGA 1I6AA 4KXPA 5DEXB 4OYVA 3K6WA 4OFLA 1PC3A 3M3LA 1IUDA 4OXVA 4GF8A 3FASA 1NUXA 3CIJA 5ITPA 5K2XA 2XXUA 2DQVA 3VV5A 3H4ZA 4GWYA 1JVYA 1Y4CA 5KDTB 4MHFA 1MS7A 5EHMA 3ILUB 4QSDA 1Y9UA 3BIGA 4P3LA 3MPKA 3K4UA 1NV2A 1K9ZA 1N04A 2QFLA 4GFRA 4WKMA 2PVUA 3IB0A 1RKMA 4FJPA 4ESWA 3IO6A 2V84A 4ELRA 3CVGA 1B7HA 3IR1A 5CI5A 4MJOA 1NH8A 4YAHX 1B51A 3MJNA 1D3KA 2WYPA 3MZ9A 4ND9A 2RCAA 3FVNA 3MW0A 5F1QA 1G0HA 1B7UA 3PUYE 4PCDA 1NI9A 5I2KB 5TPAA 2XX9A 2ZYNA 2W7YA 3S9LC 4G2ZA 4WEDA 3SESA 3D4GA 1B0HA 3HCQA 3P7IA 2ONSA 5JTYB 4NN3A 1AWBA 4GBWA 1D9YA 5CMCA 5AA2D 5F24A 4HS7A 3FVOA 3KOSA 5CMMA 5CMBA 2OWZA 4JDFA 3ISPA 5IM2A 1XC1A 3KFMA 3VE1B 2AL5A 3PUWE 1FPBA 1S9TA 4HE1A 4OANA 1FBFA 4PF8A 2PBWA 1URSA 4PTKA 3CHGA 4P0IA 3EN3A 1TXFA 4X1DA 5ET7A 4RK2A 1OQHA 3I6VA 4N15A 5EQ8A 4PE5B 4DCXA 3M3KA 1Z7ME 1B46A 2QL3A 5CC2A 1JNFA 3QUJA 2H5YA 1L5TA 5DTBA 3SZPA 4EF1A 2OPDA 4R2BA 3QUFA 4BDMA 2V3UA 1B5IA 1NV5A 1NUWA 1NFTA 3EQ1A 1EZ9A 3T9VA 2XX7A 3R7XA 5AA1A 3M8UA 5FHOA 4ZZEA 1UTHB 2XA5A 4ELPA 3JZJA 4HCYA 2ZNTA 1DTZA 3TCFA 4PAKA 5DEXA 3RT6B 2V4CA 4LQ2A 1F9BA 4U1ZA 3IOWA 2XXPA 1JETA 2DE2A 2P3VA 4QXDA 1A99A 1JQFA 5I56B 4POWA 1NV3A 3RTFB 3CFZA 1MY4A 5EHSA 3N94A 2OJTA 1POTA 3TFLA 3H6VA 5I7IA 4YZZA 5IZZA 5EYFA 1TFDA 4POXA 2XXIA 3VLVA 4OVTA 3RPLA 1SW4A 5HPQA 5AA4A 4O3CA 4N13A 1R1NA 3O2AA 3K0VA 2Y7RA 5TP9B 2XD3A 1VDWA 1D9VA 4F39A 4GWWA 1MQHA 4P9KA 5ESYA 4DI4B 3VXCA 2ZYMA 2GHAA 1LCFA 3KGCA 3A29A 2WKYA 1I69A 3GYYA 1ELJA 1MM7A 3CRBA 2XXHA 4IY6A 4KHZE 1LBYA 1BK4A 1XS5A 1SYHA
chains in the Genus database with same CATH topology
4NX1A 1FBPA 2CZKA 1NV1A 3W9WA 2Q9TA 1KZ8A 1FPKA 1NV6A 5A5LA 4NAPA 1LBVA 1EYJA 5IZ3B 2B4LA 1NV0A 2XWVA 5T3JA 4MEVA 4MIJA 2ZZVA 4G61A 1FJ9A 4HXVA 2HXRA 1G0IA 5IZ1A 1IMAA 4O94A 2HZLA 1IMDA 1D9QA 3FBPA 1LBXA 4MMPA 2ZZWA 2QVRA 2PFYA 4GWUA 1FRPA 1RDZA 2DE3A 1FPFA 4N91A 3RYDA 4PFIA 4OA4A 4XEQA 1YZ0A 5IZ3A 4XFEA 5EQAA 1EYKA 5LTCA 1FPDA 2WX9A 2HPGA 3EKIA 2KQZA 4JVDA 4F19A 1Q9DA 1SPIA 4OVPA 2DE4A 1FPEA 5LDZA 1FPJA 4PBHA 3IFCA 4N81A 4PBQA 1FBGA 1NV7A 5I3SA 4N4UA 1LBWA 5ET5A 3IFAA 4PFRA 1JP4A 3LUZA 2GQ1A 4OVSA 1RDYA 4OVQA 2Q8MA 2F3DA 5EQ7A 4HCWA 4PC9A 1INPA 2Q74A 5DW8A 2WYKA 1FTAA 4AS4A 4FBPA 4NG7A 4PE3A 2VT5A 4X04A 4M1VA 5I5PA 5IGAA 2FBPA 4I3EA 4UABA 4IR8A 2ZZXA 2QPQA 4N8GA 2CZHA 4MNIA 4N6KA 4NF0A 4KXPA 5ET8A 2VPOA 4P1LA 4OVRA 4PETA 1DBZA 4H45A 4GX4A 2BJIA 4PAIA 4H46A 1NUXA 2B4MA 4GWXA 4GWYA 4MHFA 1EYIA 2WEFA 4HE2A 2F3BA 3BIGA 4P3LA 4MNCA 4PGPA 1KA0A 4GBVA 1NV2A 1FBEA 1K9ZA 3T0JA 2QFLA 3LV0A 2Y5KA 3MSTA 4HE0A 4MJOA 4O8MA 2WBBA 1FBDA 2FIXA 2QVVA 3T1BA 4P1EA 2L5VA 4GWSA 1NUYA 3KC1A 4AS5A 4JVIA 1DCUA 2WYPA 2WBDA 1G0HA 4QBAA 3QMFA 4PCDA 5ET6A 1NI9A 4I3YA 2XXKA 1RDXA 2CZIA 2FVZA 4NN3A 1IMCA 4N17A 1AWBA 4GBWA 2R8TA 1QGXA 4DI3D 3D1RA 3ROJA 5F24A 3MYUA 2OWZA 2XWKA 3ISPA 5IM2A 4XF5A 4P47A 1KA1A 1FPBA 1FBCA 1FSAA 1IMBA 4HE1A 2FHYA 4OANA 1FBFA 3HFUA 4MCOA 4PF8A 2DDKA 4PTKA 3CHGA 2PCRA 4MAGA 4GX6A 4PGNA 5FBPA 2PFZA 1CNQA 3B8BA 5CM6A 4F1VA 5ET7A 4N15A 5EQ8A 4I40A 1IMEA 1FBHA 1XI6A 3KC0A 2VPNA 4X8RA 4GX3A 5J16A 4NQ8A 4N6DA 3SZPA 3BIHA 4PDHA 4NHBA 3E78A 1NV5A 1NUWA 1LBZA 2JJKA 4P8BA 2FIEA 2MKZA 2XWIA 2XA5A 2P3NA 1DK4A 4HCYA 4PAKA 1FJ6A 5EYGA 4MX6A 2HHMA 2V4CA 4LN5A 3RPLB 4PFBA 4YICA 1K9YA 1YYZA 4X9TA 4F1UA 2DE2A 2P3VA 4QXDA 1FPLA 4PAFA 3B50A 3KBZA 1YXIA 1NV3A 2Y5LA 2KR0A 5EYHA 4JVCA 5I7IA 4YZZA 5IZZA 3PTYA 2XWOA 4OVTA 5JK4A 3RPLA 1LEVA 4F18A 4GWZA 4O7IA 2CEXA 1IMFA 1VDWA 2V3QA 1NV4A 2F5XA 4GWWA 4NGUA 4PDDA 4P9KA 4PF6A 5ESYA 1FPGA 3W9VA 4DI4B 5EQ9A 2HZKA 3NOHA 3A29A 3U65A 4O7MA 4N8YA 4P56A 2OX3A 2DVZA 3GYYA 2CEYA 3E79A 4MNPA 1NUZA 3FXBA 1FPIA 1LBYA 5J1DA 1BK4A 2QVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBW A;  5ET5 A;  3IFA A;  1K9Y A;  1FBP A;  1DCU A;  1YYZ A;  1JP4 A;  2WBD A;  2GQ1 A;  3LUZ A;  1RDY A;  2P3V A;  4QXD A;  1FPL A;  2Q8M A;  1G0H A;  2CZK A;  1NV1 A;  2F3D A;  3QMF A;  5EQ7 A;  5ET6 A;  1NI9 A;  4I3Y A;  3KBZ A;  1KZ8 A;  1YXI A;  1INP A;  1FPK A;  1NV3 A;  2Q74 A;  5DW8 A;  2Y5L A;  1RDX A;  1FTA A;  1NV6 A;  4AS4 A;  4FBP A;  5A5L A;  2VT5 A;  2CZI A;  1LBV A;  2FVZ A;  5EYH A;  1IMC A;  1EYJ A;  5IZ3 B;  1NV0 A;  1AWB A;  4GBW A;  5T3J A;  2R8T A;  4G61 A;  1QGX A;  1FJ9 A;  2FBP A;  4I3E A;  4HXV A;  4IR8 A;  3D1R A;  3ROJ A;  5F24 A;  2CZH A;  1G0I A;  5IZ1 A;  2OWZ A;  1IMA A;  4KXP A;  3RPL A;  5ET8 A;  1IMD A;  1D9Q A;  1LEV A;  3FBP A;  4GWZ A;  1KA1 A;  1LBX A;  4O7I A;  1DBZ A;  1FPB A;  1FBC A;  4H45 A;  4GX4 A;  1FSA A;  2BJI A;  2QVR A;  1IMB A;  4HE1 A;  4GWU A;  2FHY A;  1FRP A;  1FBF A;  1RDZ A;  4H46 A;  2DDK A;  4PTK A;  1FPF A;  1NUX A;  3RYD A;  2PCR A;  4GX6 A;  5FBP A;  1IMF A;  1CNQ A;  3B8B A;  5ET7 A;  1YZ0 A;  1VDW A;  5EQ8 A;  1NV4 A;  4GWW A;  4GWX A;  5IZ3 A;  4I40 A;  1IME A;  4GWY A;  1FBH A;  5ESY A;  1FPG A;  1XI6 A;  3KC0 A;  4GX3 A;  5J16 A;  5EQ9 A;  1EYI A;  5EQA A;  3BIH A;  1EYK A;  2WEF A;  1NV5 A;  1NUW A;  1FPD A;  4HE2 A;  1LBZ A;  2F3B A;  2JJK A;  3A29 A;  3BIG A;  1Q9D A;  1KA0 A;  1SPI A;  4GBV A;  1NV2 A;  1FBE A;  1K9Z A;  2FIE A;  2QFL A;  2OX3 A;  3T0J A;  1FPE A;  5LDZ A;  1FPJ A;  3IFC A;  2P3N A;  3LV0 A;  4N81 A;  2Y5K A;  1DK4 A;  1FBG A;  1NUZ A;  1NV7 A;  4HE0 A;  4MJO A;  1FPI A;  5I3S A;  1LBY A;  2WBB A;  1FBD A;  1FJ6 A;  2FIX A;  2QVV A;  5EYG A;  1BK4 A;  4GWS A;  1NUY A;  3KC1 A;  2HHM A;  4AS5 A;  2QVU A;  3RPL B; 
#chains in the Genus database with same CATH topology
 2Z22 A;  1FBP A;  4OEV A;  4EUO A;  1NV1 A;  4XKQ A;  4HTG A;  4YKP A;  4NAP A;  3T9X B;  2BJJ X;  4MEV A;  2ZZV A;  3TTR A;  4G4P A;  1FJ9 A;  4G8H A;  1A7L A;  3IX1 A;  4IO2 A;  1GTK A;  2B3F A;  3QAX A;  1IMD A;  3G3J A;  3C35 A;  2YLN A;  1LBX A;  4MMP A;  2QVR A;  1DPE A;  4RK9 A;  1LCT A;  1GGG A;  3H6U A;  1FPF A;  3RYD A;  4ZEF A;  4PFI A;  4OA4 A;  1YZ0 A;  1FW0 A;  4R6H A;  1Y1M A;  3O9P A;  4G8N A;  5I58 B;  3SEX A;  2P2A A;  4O3A A;  2DWJ A;  2F78 A;  3H3G A;  2Y7W A;  4C1T A;  5EQA A;  1MXY A;  2F6P A;  4I8C A;  3IK6 B;  3K00 A;  5LTC A;  3K6V A;  1VFD A;  1Q1K A;  3OOA A;  3EKI A;  4NF4 A;  1NMU A;  3FVK A;  1LAG E;  3ILT B;  4GXA A;  1FPE A;  2E0S A;  5LDZ A;  3KSX A;  4TOZ A;  1B32 A;  1OMP A;  1FPJ A;  1DSN A;  4N81 A;  4PBQ A;  1FBG A;  3H6T A;  1VE4 A;  3MVW A;  3B6T A;  3K1N A;  3LSX A;  4R75 A;  4NWC A;  5ET5 A;  2OK2 A;  1FTO A;  5A5X A;  2GQ1 A;  4OVS A;  3IJO B;  3PPR A;  4HCW A;  1NNT A;  1UIV A;  3IO4 A;  3OEK A;  4PC9 A;  1NKX A;  1INP A;  3LC8 A;  2Q74 A;  4ZE9 A;  1FTA A;  3C34 A;  4U2R A;  4FBP A;  1LB8 A;  2ZNU A;  5I5P A;  1SYI A;  1PDA A;  3O29 A;  3IOV A;  4I3E A;  4UAB A;  1H44 A;  4OEN A;  2E1S A;  3PMW A;  3ZSF A;  2F35 A;  5CRY A;  1A55 A;  3Q29 A;  4R9G A;  1R9L A;  3TTL A;  3VFJ A;  3TTN A;  4H6D A;  4PQJ A;  4PET A;  4GX4 A;  3UOR A;  2BJI A;  2QMX A;  3K02 A;  3FV2 A;  3LBS A;  4XTC Q;  4FIM A;  3HPI A;  2OLB A;  3MVX A;  4PFW A;  4R2F A;  1GR2 A;  1A54 A;  2OWS A;  5ICQ A;  4XIG Q;  2ONR A;  5L9O A;  2REG A;  2OCU A;  2UYF A;  5TPA B;  4DXB A;  1B52 A;  2AYS A;  4MNC A;  4DLD A;  1IXH A;  1FBE A;  3T0J A;  4XXU A;  2Y7K A;  5H8S A;  2DSF A;  1JVX A;  1N0T A;  3LR1 A;  2HFB A;  1MY2 A;  1SW1 A;  3K1P A;  1TFA A;  3IJX B;  3FJM A;  3S9M C;  4XKR A;  4HE0 A;  2Q89 A;  1MXW A;  2I6E A;  3UIF A;  2THI A;  2WBB A;  2FIX A;  2QVV A;  3WAE A;  1DCU A;  2DYX A;  1R6Z A;  3MC2 A;  4I1D A;  4K3F A;  2ZYO A;  3U93 A;  4MBP A;  4F2Q A;  1LST A;  2DOJ A;  2O69 A;  4M4G A;  2FVZ A;  2A5S A;  5I58 A;  4N17 A;  4G8M A;  2R8T A;  1ZKB A;  2F97 A;  4JWO A;  3MPL A;  1IIW A;  3MYU A;  2P0S A;  4O3B A;  2REJ A;  1XT8 A;  4XKP A;  4DXU A;  4EF2 A;  4GRK A;  1FBC A;  1OVB A;  2I49 A;  3FD3 A;  1SBP A;  3A3C A;  3HFU A;  4X1B A;  2PT1 A;  4KYE A;  1FTJ A;  3S4U A;  2PCR A;  2Z8D A;  4MAG A;  5FBP A;  4F3S A;  1Q35 A;  3B8B A;  5CM6 A;  3T22 A;  1ZIU A;  2F7A A;  2A5T B;  2Q2A A;  2Y7P A;  1B3E A;  4F2O A;  4RPO A;  1IME A;  3ZS6 A;  1MQJ A;  4H65 A;  3T96 B;  2VPN A;  3CR9 A;  4GWO A;  4IGT A;  3BIH A;  4G77 A;  4PDH A;  4NHB A;  5DYH A;  4KYS A;  1NNP A;  4YB6 A;  2NXO A;  4OWD A;  3ECR A;  4RXL A;  4LUB A;  2FIE A;  1OIB A;  2DVC A;  1YPN A;  3T93 B;  2FNC A;  2P1S A;  3TMG A;  2Q8J A;  1DK4 A;  4LQ5 A;  3VXB A;  1M5F A;  5B7D A;  3GLB A;  1FJ6 A;  4GXS B;  4UA8 A;  2HHM A;  4DIG A;  4LN5 A;  3RPL B;  4ONY A;  1B7Z A;  5AA4 B;  1II5 A;  1QUL A;  1S50 A;  2QS3 A;  4F1U A;  2F36 A;  1MDQ A;  4ZS9 A;  1US5 A;  3LSW A;  3PD9 A;  3T9H B;  1S7Y A;  3N26 A;  1FQD A;  5ELV A;  3B50 A;  3DLN A;  1YXI A;  2Y5L A;  3TAJ A;  1P99 A;  1B0L A;  3S9N C;  1I6B A;  4MFI A;  3C36 A;  4YKJ A;  5H8H A;  4OVJ A;  2I0C A;  1Y3Q A;  5EYH A;  3DP8 A;  2HCA A;  4FEC A;  2HQ0 A;  3TDJ A;  4BDN A;  3V8X B;  5AE4 A;  1WDN A;  1PBQ A;  1USY E;  2X26 A;  3CSB A;  1IXG A;  1UIU A;  3FIR A;  2I48 A;  3E9X A;  5DVI A;  1JEU A;  2I4B A;  4O7I A;  1JEV A;  4ZDM A;  3PV0 E;  2V93 A;  3MP8 A;  1AH5 A;  3JV9 A;  4BLA A;  1IMF A;  1TWY A;  5JEI A;  1LLS A;  1MPC A;  3SDF A;  2V3Q A;  4KQP A;  3OO8 A;  3S2V A;  1OLC A;  4ZED A;  4PDD A;  2QS2 A;  3EHU A;  3TEL A;  4JSO A;  3IAZ A;  2HZK A;  3HV1 A;  1MY1 A;  4DDD A;  1DMB A;  3G3G A;  1B3L A;  2QJE A;  3LSF B;  2HEU A;  5IAI A;  4EQB A;  3G3K A;  2H99 A;  2D5W A;  1RYX A;  4EXK A;  2VOZ A;  3HN0 A;  4LZ7 A;  4X48 A;  5ISU A;  4ZZA A;  3FAT A;  3OSQ A;  1B3F A;  1N7W A;  2R71 A;  5I84 A;  4R74 A;  3U94 A;  1PB7 A;  2CZK A;  1UTB A;  3K6X A;  2OWT A;  4GOT A;  5H8F A;  4P11 A;  1Y4T A;  2H98 A;  5A5L A;  2A5T A;  1YCJ A;  2F7C A;  2KLF A;  2F8D A;  2QSX A;  4YKI A;  4HXV A;  4OQO A;  1B9J A;  2HXR A;  1N76 A;  4QRZ A;  4F31 B;  3CG3 A;  2HZL A;  1M5C A;  2B65 A;  4TLM B;  3FBP A;  4NF4 B;  1Y3P A;  3KBR A;  4QSE A;  5IKB A;  1O63 A;  1LAH E;  1ZU0 A;  4EDP A;  4GWU A;  3SEY A;  1GV8 A;  3KN3 A;  1RDZ A;  2DE3 A;  4N91 A;  1ZJL A;  2XXX A;  4XEQ A;  1QUI A;  3ZKK A;  3H7M A;  1WOD A;  4JXI A;  4QFP A;  3PPQ A;  1FTL A;  2PX1 A;  3C33 A;  3FXR A;  4FEB A;  4KFQ A;  4FAJ A;  4ELQ A;  2HXW A;  1EYK A;  4H5G A;  3O97 A;  5A5X B;  1FPD A;  2HPG A;  2KQZ A;  2PMS A;  4F19 A;  1SPI A;  4OVP A;  4JB7 A;  1US4 A;  3MBP A;  1A8F A;  4ISU A;  4MLV A;  3MZB A;  1IZ1 A;  2Q2C A;  2D21 A;  4ESX A;  5CMK A;  3RN8 A;  3E13 X;  4DZ1 A;  2Z8F A;  3K6U A;  3CSG A;  1CB6 A;  4C0R A;  3IFA A;  3OSR A;  4OFJ A;  4PFR A;  3LUZ A;  3B7D A;  4EXL A;  2Q8M A;  4RPN A;  5K2Y A;  3QXM A;  2VHA A;  5DW8 A;  5AA2 B;  3FXQ A;  3TTK A;  4AS4 A;  4PE3 A;  3TOD A;  1PEB A;  4M1V A;  1MPD A;  4OZ9 A;  4QFO A;  3S9E A;  1P1U A;  4U4S A;  1FQB A;  5IGA A;  2ALU A;  4ZEB A;  3H6W A;  2ZZX A;  2QPQ A;  5FTI A;  1O7T A;  4DCY A;  3Q26 A;  1QUJ A;  3TUS A;  5LOM A;  5ET8 A;  1N7X A;  2VPO A;  4EQ7 A;  3PD8 A;  3FJ7 A;  4PFT A;  3PUV E;  3U8Q A;  3FGS A;  1FQF A;  3C31 A;  4IGR A;  2B4M A;  2HAU A;  4F3B A;  3M3F A;  2UVG A;  3SEV A;  1A40 A;  4GWX A;  2OPE A;  1AMF A;  1MH3 A;  2VD3 A;  3MWB A;  3G3H A;  4ZEK A;  3VVD A;  4PFY A;  2XXV A;  4F3P A;  2QS1 A;  4QFL A;  2WEF A;  2NOO A;  1O64 A;  2YPN A;  2XXT A;  4PGP A;  5FHN A;  3K01 A;  4GBV A;  1SI1 A;  2ZMB A;  4LP2 B;  3LUY A;  1MXU A;  3LV0 A;  3IB2 A;  2Y5K A;  3MST A;  1R9Q A;  1Y20 A;  2XXR A;  4H67 A;  4XKN A;  2UXA A;  1ZBM A;  1FBD A;  4GIZ A;  2PYY A;  1N84 A;  2UVJ A;  4P1E A;  2L5V A;  1NUY A;  1LBB A;  4AS5 A;  4BDL A;  4JVI A;  4YB7 A;  4TQU Q;  4IO4 A;  2WBD A;  2NWJ A;  1BLF A;  1EU8 A;  4OES A;  5ET6 A;  1USY H;  3UP9 A;  3PPO A;  2VD2 A;  2RIN A;  2RC9 A;  2XXK A;  3IL1 B;  5B70 A;  1ZLQ A;  4F22 A;  1EZO A;  2Q88 A;  4N6P A;  1TT1 A;  3VVF A;  3HST A;  1QGX A;  1VR5 A;  2I4C A;  3D1R A;  2DWI A;  3L6H A;  1DTG A;  2XWK A;  4XF5 A;  4YMA A;  4P47 A;  3KEI A;  1M5B A;  1KA1 A;  4U22 A;  3RTW B;  3D4C A;  2I0B A;  3Q25 A;  3CI8 A;  1IMB A;  4PFU A;  1A8E A;  2DDK A;  2PFZ A;  1LAF E;  1FQE A;  2RC7 A;  3V5A A;  3DM0 A;  4NF5 A;  5FTH A;  4I40 A;  1FBH A;  1BKA A;  4H0W A;  3KC0 A;  3HHF A;  5M2V A;  4N6D A;  1MXX A;  5KCJ A;  3QK6 A;  3E78 A;  3O6I A;  3O66 A;  3C32 A;  4R6Y A;  2X7Q A;  4I62 A;  1P1W A;  4P8B A;  5AA2 A;  1IIT A;  2Z8E A;  5DVJ A;  5DT6 A;  2UVI A;  2MKZ A;  4LZ5 A;  5H8H B;  1VSO A;  3BKI B;  2XWI A;  2P3N A;  1SW2 A;  2ZNS A;  4Q30 B;  1B40 A;  3MVY A;  1LFG A;  3WAF A;  3MVZ A;  4MX6 A;  3MAM A;  4X9T A;  1OLA A;  4R73 A;  3G3I A;  2ANJ A;  1CE2 A;  1FPL A;  2DXY A;  3OMB A;  1PB8 A;  3SER A;  2X7P A;  2XXW A;  1AIV A;  3KBZ A;  3Q28 A;  1N3W A;  1ANF A;  4THI A;  3G7W A;  1SQY A;  2YJP A;  1BTJ A;  2Z23 A;  4JVC A;  1LGB C;  3KJT A;  3N5L A;  1IXC A;  1B05 A;  4YB5 A;  1MH4 A;  3PTY A;  3U92 A;  5JK4 A;  4DXC A;  5TU0 A;  1LEV A;  4F18 A;  5F7V A;  4GWZ A;  1XHY A;  4L17 A;  1H45 A;  3OO9 A;  4QF9 A;  2V3T A;  4NF6 B;  1Z7N E;  4UAC A;  4JWX A;  1XVY A;  1BIY A;  4QFK A;  4Z0I A;  3OEN A;  3I3V A;  3N6U A;  2G93 A;  2F5X A;  3CG1 A;  3K1M A;  4NGU A;  4PF6 A;  1FPG A;  3SEU A;  5EQ9 A;  3FXU A;  4KI0 E;  2R6G E;  2RCB A;  4LZ8 A;  1JW5 A;  1QKA A;  1UTB B;  5H8N B;  4O7M A;  2H25 A;  5H8F B;  2V25 A;  3G3F A;  4LAT A;  3TKD A;  4U1O A;  3OEL A;  3FZV A;  4MF3 A;  1T0K A;  5J1D A;  4MLQ A;  1SVX B;  2OZZ A;  3GBB A;  1EH3 A;  3PUX E;  2I3W A;  4YKK A;  3HHG A;  4NF8 B;  3H06 B;  3ZKL A;  3OD7 A;  4FAT A;  4JBZ A;  3FVG A;  3W9W A;  1KZ8 A;  3R6U A;  1FPK A;  1B5H A;  1MY3 A;  3DEL B;  1NV6 A;  5I57 A;  1XOC A;  3PPP A;  3TQW A;  4H5F A;  1NH7 A;  2F6G A;  1EYJ A;  2B4L A;  1NV0 A;  2XWV A;  3PGF A;  4G61 A;  5ICT A;  1OVT A;  1MQG A;  1B3H A;  2G29 A;  4AB5 A;  2B3B A;  2R9J A;  3RUM A;  2O1M A;  4AQ4 A;  2ABH A;  1H3D A;  4OMB A;  2ZZW A;  4LA9 A;  2PFY A;  1PBP A;  4AB6 A;  4Q0C A;  1VFE A;  3RY3 A;  1I6Q A;  1URG A;  3QYT A;  1HSL A;  3W15 C;  5IZ3 A;  2Y7I A;  4NED A;  4TLL B;  1NL5 A;  1RYO A;  3OO6 A;  1MY0 A;  4BDQ A;  3TCH A;  2ESN A;  4XFE A;  3PU5 A;  1QJM A;  4G68 B;  1URD A;  2LAO A;  2WX9 A;  1Q9D A;  4RA1 A;  2DE4 A;  1B1X A;  5I2N A;  4PBH A;  5HBC A;  3BFU A;  2I58 A;  4BDO A;  2HAV A;  4MH5 A;  1NV7 A;  2XXQ A;  2F34 A;  5HM4 B;  1UQW A;  3B6Q A;  4GD5 A;  3USD A;  1AL3 A;  3FUZ A;  4LON B;  1FTM A;  4R72 A;  4H8I A;  1OQG A;  1XVX A;  3EHT A;  4NF6 A;  1RDY A;  2GHB A;  4OVQ A;  2F3D A;  1P1N A;  3DP4 A;  3RT8 A;  5I59 A;  4X04 A;  1B58 A;  2FA7 A;  4H8J A;  2O51 A;  3O6G A;  4F29 A;  2FBP A;  4IR8 A;  1B1H A;  3U72 A;  2XD2 A;  4N8G A;  2CZH A;  4FED A;  4MNI A;  4N6K A;  1NNK A;  4NF0 A;  1MXZ A;  5H8N A;  4NWD A;  4P1L A;  4OVR A;  4NE4 A;  3IB1 A;  1DBZ A;  4H45 A;  3RNN A;  1FTK A;  4PAI A;  1DOT A;  2OBG A;  4H46 A;  2FYI A;  4WEP A;  1LBC A;  4KCC A;  3OEM A;  1P1Q A;  2H9B A;  3TQL A;  3LSL A;  1JW1 A;  4NF8 A;  1EYI A;  1HSE A;  3V89 B;  4OET A;  4NMY A;  4HE2 A;  5BWJ A;  2F3B A;  2O68 A;  1FQC A;  4N07 A;  1PB9 A;  1ZMG A;  1KA0 A;  3KOT A;  2AL4 A;  4QFN A;  5L8D A;  4LVQ A;  4RY1 A;  3IOU A;  2XXY A;  1MG1 A;  4O8M A;  5H8Q B;  5KDT A;  3T1B A;  4GWS A;  3BFT A;  3PPN A;  3KC1 A;  4Z7E A;  3IOR A;  3MP1 A;  1EZP A;  1MXV A;  4KCD A;  2GRV A;  3KN8 A;  3MZ1 A;  3EF7 A;  4QBA A;  4E0X A;  3QMF A;  4I3Y A;  2I3V A;  1LFI A;  2O84 X;  4YU0 A;  4I9D A;  3EHS A;  1RDX A;  4G68 C;  3UGW A;  2CZI A;  4RJZ A;  4NF5 B;  1IMC A;  3RQT A;  4C1U A;  5L9M A;  4BDR A;  2UYE A;  3SKP A;  3TEP A;  4DI3 D;  4GL0 A;  3ROJ A;  5AA3 A;  4G68 A;  4NTL A;  1MM6 A;  4U23 A;  3THI A;  5KCJ B;  4F3G A;  4KR5 A;  1JW4 A;  3KZG A;  1FSA A;  2FHY A;  5I2K A;  4MCO A;  3E3K A;  2DP8 A;  4GX6 A;  4R9F A;  4PGN A;  1CNQ A;  4F1V A;  1MPB A;  1J1N A;  2QMW A;  5L9S A;  5JTY A;  1YTV A;  1XI6 A;  4X8R A;  4GX3 A;  5J16 A;  4NQ8 A;  2DWH A;  3TTM A;  4GVO A;  1QW0 A;  1ZTY A;  3VLW A;  2CMO A;  4QHQ A;  4U4X A;  1LBZ A;  2JJK A;  3KG2 A;  3AXF A;  3T66 A;  3MQ9 A;  3RLF E;  2GH9 A;  4KD5 A;  4P0G A;  3TYH A;  2D3I A;  4IO6 A;  2VP1 A;  4GLI A;  2QS4 A;  3MUQ A;  4FOR A;  4GL8 A;  5EYG A;  1FQA A;  4PFB A;  1HSJ A;  4YIC A;  1K9Y A;  1YYZ A;  4U21 A;  3UA8 A;  2DS9 A;  2NUV A;  2ZXT A;  4PAF A;  3R26 A;  1SDX A;  2ONK E;  4F1Y A;  2IEE A;  4OEU A;  4R6K A;  5CBR A;  4ECF A;  2KR0 A;  2H4I A;  1UTH A;  4ELO A;  4YMB A;  2IA4 A;  3TZA A;  3GZG A;  1BP5 A;  4KPT A;  3BBR A;  2XHD A;  3SET A;  3ONM A;  3MP6 A;  2XWO A;  4E0W A;  5FHM A;  2O7I A;  4JSD A;  1WVJ A;  5KZT A;  5I56 A;  4IO7 A;  3GBA A;  4IO3 A;  3RPW A;  4EQ9 A;  3A09 A;  4WXJ A;  2CEX A;  3TPA A;  5H8Q A;  1NV4 A;  1DPP A;  4H1X A;  1LB9 A;  3PMX A;  3W9V A;  1AOV A;  4QSC A;  3DP6 A;  4DE8 A;  3RGY A;  4IY5 A;  4RYA A;  3C4M A;  4OTE A;  3NOH A;  3U65 A;  2QRY A;  4IO5 A;  3E4R A;  4N8Y A;  1FCK A;  3O28 A;  5DVF A;  4P56 A;  2OX3 A;  3T9U A;  1NNF A;  2NVU B;  5I57 B;  2DVZ A;  3KN7 A;  2CEY A;  5BUU A;  5TP9 A;  3TCG A;  3E79 A;  4MNP A;  1NUZ A;  3FXB A;  2ZYK A;  1M5D A;  1FPI A;  3PMV A;  1B5J A;  1M5E A;  3F11 A;  1SD3 A;  1SI0 A;  3UN6 A;  2QVU A;  2CZL A;  1IQ7 A;  4NX1 A;  3VDF A;  2UVH A;  2DWA A;  2O1L A;  1LFH A;  3IOT A;  4KYD A;  4Q5T A;  2Q9T A;  3C9H A;  1MQD A;  1B2H A;  2RC8 A;  2PT2 A;  1IEJ A;  1SW5 A;  1LBV A;  3FV1 A;  1KWH A;  5IZ3 B;  5T3J A;  4MIJ A;  3KJ7 A;  1QKB A;  4JWY A;  1G0I A;  4OER A;  5IZ1 A;  1IMA A;  4GQO A;  2RKM A;  4O94 A;  5CBS A;  1D9Q A;  3OO7 A;  5ITO A;  1ATG A;  1FRP A;  4ZEC A;  5I2N B;  1H43 A;  3KSJ A;  1B6H A;  3L6G A;  3VVE A;  3ODB A;  3HO7 A;  3VLU A;  1LAX A;  3O6H A;  3GXA A;  3QSL A;  3OXN A;  2O7U A;  2O6A A;  3CFL A;  1IXI A;  2F7B A;  1MRP A;  4HW8 A;  3K2D A;  3JYR A;  3N6T A;  4OHN A;  3QIM A;  3Q27 A;  3UK4 A;  4JVD A;  1MDP 1;  3PUZ E;  1D4N A;  4ZEI A;  3U1O A;  2Y84 A;  1N3X A;  5I59 B;  4OFO A;  2GFE A;  4RNS A;  3SEW A;  3IFC A;  1YAE A;  2VGQ A;  4FE8 A;  3I5O A;  5I3S A;  4N4U A;  4Q8R A;  1Y1Z A;  3CFX A;  1QVS A;  1P1O A;  1LBW A;  3H03 A;  3A3U A;  2RF1 A;  1JP4 A;  1H76 A;  1B4H A;  3EPE A;  1POY 1;  1B4Z A;  2DXR A;  5EQ7 A;  2XX8 A;  1GVC A;  2WYK A;  4NG7 A;  2VT5 A;  1B3G A;  3V83 A;  3B6W A;  1QUK A;  2AIX A;  4PP0 A;  2M8C A;  1MQI A;  4ZE8 A;  4IB2 A;  1Y3N A;  3FJG A;  1I6A A;  4KXP A;  5DEX B;  4OYV A;  3K6W A;  4OFL A;  1PC3 A;  3M3L A;  1IUD A;  4OXV A;  4GF8 A;  3FAS A;  1NUX A;  3CIJ A;  5ITP A;  5K2X A;  2XXU A;  2DQV A;  3VV5 A;  3H4Z A;  4GWY A;  1JVY A;  1Y4C A;  5KDT B;  4MHF A;  1MS7 A;  5EHM A;  3ILU B;  4QSD A;  1Y9U A;  3BIG A;  4P3L A;  3MPK A;  3K4U A;  1NV2 A;  1K9Z A;  1N04 A;  2QFL A;  4GFR A;  4WKM A;  2PVU A;  3IB0 A;  1RKM A;  4FJP A;  4ESW A;  3IO6 A;  2V84 A;  4ELR A;  3CVG A;  1B7H A;  3IR1 A;  5CI5 A;  4MJO A;  1NH8 A;  4YAH X;  1B51 A;  3MJN A;  1D3K A;  2WYP A;  3MZ9 A;  4ND9 A;  2RCA A;  3FVN A;  3MW0 A;  5F1Q A;  1G0H A;  1B7U A;  3PUY E;  4PCD A;  1NI9 A;  5I2K B;  5TPA A;  2XX9 A;  2ZYN A;  2W7Y A;  3S9L C;  4G2Z A;  4WED A;  3SES A;  3D4G A;  1B0H A;  3HCQ A;  3P7I A;  2ONS A;  5JTY B;  4NN3 A;  1AWB A;  4GBW A;  1D9Y A;  5CMC A;  5AA2 D;  5F24 A;  4HS7 A;  3FVO A;  3KOS A;  5CMM A;  5CMB A;  2OWZ A;  4JDF A;  3ISP A;  5IM2 A;  1XC1 A;  3KFM A;  3VE1 B;  2AL5 A;  3PUW E;  1FPB A;  1S9T A;  4HE1 A;  4OAN A;  1FBF A;  4PF8 A;  2PBW A;  1URS A;  4PTK A;  3CHG A;  4P0I A;  3EN3 A;  1TXF A;  4X1D A;  5ET7 A;  4RK2 A;  1OQH A;  3I6V A;  4N15 A;  5EQ8 A;  4PE5 B;  4DCX A;  3M3K A;  1Z7M E;  1B46 A;  2QL3 A;  5CC2 A;  1JNF A;  3QUJ A;  2H5Y A;  1L5T A;  5DTB A;  3SZP A;  4EF1 A;  2OPD A;  4R2B A;  3QUF A;  4BDM A;  2V3U A;  1B5I A;  1NV5 A;  1NUW A;  1NFT A;  3EQ1 A;  1EZ9 A;  3T9V A;  2XX7 A;  3R7X A;  5AA1 A;  3M8U A;  5FHO A;  4ZZE A;  1UTH B;  2XA5 A;  4ELP A;  3JZJ A;  4HCY A;  2ZNT A;  1DTZ A;  3TCF A;  4PAK A;  5DEX A;  3RT6 B;  2V4C A;  4LQ2 A;  1F9B A;  4U1Z A;  3IOW A;  2XXP A;  1JET A;  2DE2 A;  2P3V A;  4QXD A;  1A99 A;  1JQF A;  5I56 B;  4POW A;  1NV3 A;  3RTF B;  3CFZ A;  1MY4 A;  5EHS A;  3N94 A;  2OJT A;  1POT A;  3TFL A;  3H6V A;  5I7I A;  4YZZ A;  5IZZ A;  5EYF A;  1TFD A;  4POX A;  2XXI A;  3VLV A;  4OVT A;  3RPL A;  1SW4 A;  5HPQ A;  5AA4 A;  4O3C A;  4N13 A;  1R1N A;  3O2A A;  3K0V A;  2Y7R A;  5TP9 B;  2XD3 A;  1VDW A;  1D9V A;  4F39 A;  4GWW A;  1MQH A;  4P9K A;  5ESY A;  4DI4 B;  3VXC A;  2ZYM A;  2GHA A;  1LCF A;  3KGC A;  3A29 A;  2WKY A;  1I69 A;  3GYY A;  1ELJ A;  1MM7 A;  3CRB A;  2XXH A;  4IY6 A;  4KHZ E;  1LBY A;  1BK4 A;  1XS5 A;  1SYH A; 
#chains in the Genus database with same CATH homology
 4NX1 A;  1FBP A;  2CZK A;  1NV1 A;  3W9W A;  2Q9T A;  1KZ8 A;  1FPK A;  1NV6 A;  5A5L A;  4NAP A;  1LBV A;  1EYJ A;  5IZ3 B;  2B4L A;  1NV0 A;  2XWV A;  5T3J A;  4MEV A;  4MIJ A;  2ZZV A;  4G61 A;  1FJ9 A;  4HXV A;  2HXR A;  1G0I A;  5IZ1 A;  1IMA A;  4O94 A;  2HZL A;  1IMD A;  1D9Q A;  3FBP A;  1LBX A;  4MMP A;  2ZZW A;  2QVR A;  2PFY A;  4GWU A;  1FRP A;  1RDZ A;  2DE3 A;  1FPF A;  4N91 A;  3RYD A;  4PFI A;  4OA4 A;  4XEQ A;  1YZ0 A;  5IZ3 A;  4XFE A;  5EQA A;  1EYK A;  5LTC A;  1FPD A;  2WX9 A;  2HPG A;  3EKI A;  2KQZ A;  4JVD A;  4F19 A;  1Q9D A;  1SPI A;  4OVP A;  2DE4 A;  1FPE A;  5LDZ A;  1FPJ A;  4PBH A;  3IFC A;  4N81 A;  4PBQ A;  1FBG A;  1NV7 A;  5I3S A;  4N4U A;  1LBW A;  5ET5 A;  3IFA A;  4PFR A;  1JP4 A;  3LUZ A;  2GQ1 A;  4OVS A;  1RDY A;  4OVQ A;  2Q8M A;  2F3D A;  5EQ7 A;  4HCW A;  4PC9 A;  1INP A;  2Q74 A;  5DW8 A;  2WYK A;  1FTA A;  4AS4 A;  4FBP A;  4NG7 A;  4PE3 A;  2VT5 A;  4X04 A;  4M1V A;  5I5P A;  5IGA A;  2FBP A;  4I3E A;  4UAB A;  4IR8 A;  2ZZX A;  2QPQ A;  4N8G A;  2CZH A;  4MNI A;  4N6K A;  4NF0 A;  4KXP A;  5ET8 A;  2VPO A;  4P1L A;  4OVR A;  4PET A;  1DBZ A;  4H45 A;  4GX4 A;  2BJI A;  4PAI A;  4H46 A;  1NUX A;  2B4M A;  4GWX A;  4GWY A;  4MHF A;  1EYI A;  2WEF A;  4HE2 A;  2F3B A;  3BIG A;  4P3L A;  4MNC A;  4PGP A;  1KA0 A;  4GBV A;  1NV2 A;  1FBE A;  1K9Z A;  3T0J A;  2QFL A;  3LV0 A;  2Y5K A;  3MST A;  4HE0 A;  4MJO A;  4O8M A;  2WBB A;  1FBD A;  2FIX A;  2QVV A;  3T1B A;  4P1E A;  2L5V A;  4GWS A;  1NUY A;  3KC1 A;  4AS5 A;  4JVI A;  1DCU A;  2WYP A;  2WBD A;  1G0H A;  4QBA A;  3QMF A;  4PCD A;  5ET6 A;  1NI9 A;  4I3Y A;  2XXK A;  1RDX A;  2CZI A;  2FVZ A;  4NN3 A;  1IMC A;  4N17 A;  1AWB A;  4GBW A;  2R8T A;  1QGX A;  4DI3 D;  3D1R A;  3ROJ A;  5F24 A;  3MYU A;  2OWZ A;  2XWK A;  3ISP A;  5IM2 A;  4XF5 A;  4P47 A;  1KA1 A;  1FPB A;  1FBC A;  1FSA A;  1IMB A;  4HE1 A;  2FHY A;  4OAN A;  1FBF A;  3HFU A;  4MCO A;  4PF8 A;  2DDK A;  4PTK A;  3CHG A;  2PCR A;  4MAG A;  4GX6 A;  4PGN A;  5FBP A;  2PFZ A;  1CNQ A;  3B8B A;  5CM6 A;  4F1V A;  5ET7 A;  4N15 A;  5EQ8 A;  4I40 A;  1IME A;  1FBH A;  1XI6 A;  3KC0 A;  2VPN A;  4X8R A;  4GX3 A;  5J16 A;  4NQ8 A;  4N6D A;  3SZP A;  3BIH A;  4PDH A;  4NHB A;  3E78 A;  1NV5 A;  1NUW A;  1LBZ A;  2JJK A;  4P8B A;  2FIE A;  2MKZ A;  2XWI A;  2XA5 A;  2P3N A;  1DK4 A;  4HCY A;  4PAK A;  1FJ6 A;  5EYG A;  4MX6 A;  2HHM A;  2V4C A;  4LN5 A;  3RPL B;  4PFB A;  4YIC A;  1K9Y A;  1YYZ A;  4X9T A;  4F1U A;  2DE2 A;  2P3V A;  4QXD A;  1FPL A;  4PAF A;  3B50 A;  3KBZ A;  1YXI A;  1NV3 A;  2Y5L A;  2KR0 A;  5EYH A;  4JVC A;  5I7I A;  4YZZ A;  5IZZ A;  3PTY A;  2XWO A;  4OVT A;  5JK4 A;  3RPL A;  1LEV A;  4F18 A;  4GWZ A;  4O7I A;  2CEX A;  1IMF A;  1VDW A;  2V3Q A;  1NV4 A;  2F5X A;  4GWW A;  4NGU A;  4PDD A;  4P9K A;  4PF6 A;  5ESY A;  1FPG A;  3W9V A;  4DI4 B;  5EQ9 A;  2HZK A;  3NOH A;  3A29 A;  3U65 A;  4O7M A;  4N8Y A;  4P56 A;  2OX3 A;  2DVZ A;  3GYY A;  2CEY A;  3E79 A;  4MNP A;  1NUZ A;  3FXB A;  1FPI A;  1LBY A;  5J1D A;  1BK4 A;  2QVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...