5EQAA

Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) with intermolecular cross-link between lys158 and cys245
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
265
structure length
253
Chain Sequence
QLNHFSDVANKAANAAGDVIRKYFRKSPVTIADQSAEEAMVSVILDNFPSHAVYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGPLFGTLIALLQNGTPILGIIDQPVLKERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRVRDKVKIPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASPLSIATSFNVVAAGDKQIHQQALDSLQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Structural Studies of Medicago truncatula Histidinol Phosphate Phosphatase from Inositol Monophosphatase Superfamily Reveal Details of Penultimate Step of Histidine Biosynthesis in Plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Biosynthetic protein
total genus 87
structure length 253
sequence length 265
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eqaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eqaA02
3LUZA 1VDWA 1IMCA 2Y5LA 1LEVA 1FPBA 1FBPA 1EYIA 1INPA 4QXDA 2FHYA 1FJ6A 2HHMA 1EYJA 1NV7A 4MJOA 1NI9A 3D1RA 1AWBA 1FPGA 1G0IA 2FIXA 4HE2A 1IMFA 4GWXA 2PCRA 1FBDA 3RPLB 4GX6A 4GBWA 3T0JA 4H45A 1FPKA 3B8BA 1NV5A 2FIEA 1DCUA 4FBPA 3ROJA 2OWZA 3BIHA 5ET5A 5DW8A 5IZ1A 1D9QA 4GWWA 1NUXA 1NV2A 1IMEA 1XI6A 1NUZA 5T3JA 2GQ1A 2R8TA 1NUYA 1FBFA 1FJ9A 5EQ9A 2P3NA 5LDZA 5ET8A 2FVZA 4I3EA 4G61A 4HXVA 4O7IA 5EQ7A 2QVRA 5EQAA 2QVVA 1NUWA 3IFCA 5J16A 1DBZA 1FRPA 4GWUA 1LBXA 4I3YA 2VT5A 2CZHA 1FBHA 2CZIA 3KC0A 1K9ZA 1FBEA 2Q8MA 1LBVA 1IMDA 1FPJA 2OX3A 1YXIA 4IR8A 2Q74A 2WEFA 1LBYA 3BIGA 1FBGA 2P3VA 4HE0A 3A29A 1QGXA 2JJKA 3RYDA 1NV6A 2QVUA 4N81A 1RDZA 1RDYA 2DDKA 5I3SA 5ESYA 2QFLA 5EYHA 4GBVA 1K9YA 1NV4A 5A5LA 4GWSA 2F3DA 4KXPA 5ET6A 5F24A 1FPFA 1FPEA 5IZ3A 1FBCA 2WBDA 1FPLA 1DK4A 4AS5A 1RDXA 4GX4A 1FPIA 2F3BA 1LBZA 1G0HA 5FBPA 3LV0A 1IMAA 4AS4A 1YZ0A 1EYKA 4GWYA 4GX3A 1IMBA 5EYGA 1SPIA 2BJIA 3KC1A 3IFAA 4I40A 4GWZA 3RPLA 1JP4A 1YYZA 2CZKA 1NV3A 1NV1A 3FBPA 1LBWA 1BK4A 1CNQA 1FPDA 2WBBA 1Q9DA 4PTKA 5ET7A 3KBZA 1KZ8A 4H46A 5EQ8A 2Y5KA 1FTAA 1KA0A 1KA1A 4HE1A 1FSAA 3QMFA 1NV0A 5IZ3B 2FBPA
chains in the Genus database with same CATH superfamily
4OVPA 4JBZA 4I62A 2XWKA 4F19A 5L9MA 1ANFA 3O6IA 3KEIA 1IMFA 1GGGA 2GFEA 2DQVA 4FE8A 3L6HA 4YB5A 1NV2A 3MPKA 3G3JA 1LAGE 3WAEA 5IKBA 4QSDA 1P1QA 4ZDMA 5LDZA 3PD8A 1MY1A 4O7IA 3O28A 2OCUA 4EF2A 2Y7RA 1WVJA 4ZE9A 1MQIA 4F3BA 4I3YA 4ZS9A 3TYHA 1L5TA 4XKRA 5DVJA 3KC0A 2O1MA 4BDMA 2ZYMA 3MAMA 4IB2A 2KQZA 2WEFA 2O7IA 4QFLA 4MLVA 3KJTA 3IJOB 1FBGA 3KFMA 4HE0A 3TTKA 3BKIB 3TUSA 3HO7A 5HBCA 3CG1A 5TU0A 5EYHA 3IAZA 2I4BA 1N04A 3S9NC 2WBDA 4AS5A 4PP0A 4GX4A 5CBSA 3FV2A 1IXCA 1PEBA 3IL1B 4MCOA 3ZKLA 1QW0A 4LQ2A 4JXIA 4JWYA 2ONSA 4EQ7A 4QSEA 4N8GA 1BK4A 2I0CA 2ZYOA 2RC9A 1FTAA 4P1EA 3O2AA 1Z7ME 4ZE8A 2QPQA 3QIMA 3V8XB 1SYHA 5HM4B 2Z8EA 4XEQA 1EYJA 4ESXA 1BLFA 2A5TB 2PYYA 1A40A 3H4ZA 1UIUA 2OK2A 2YLNA 3BIHA 3FVOA 4NAPA 2HZLA 3C4MA 5KDTA 4EDPA 2XXYA 4QBAA 4QFOA 3K01A 4MNCA 3SETA 4PETA 5ET8A 3PUYE 2QVRA 3IJXB 1FQEA 2DWIA 4YICA 2Q8JA 2VOZA 2XXWA 4UA8A 3VVDA 2VT5A 2NUVA 3U72A 5LTCA 1IMDA 1PBQA 5M2VA 4BDOA 3LUYA 3EPEA 2XXPA 3M3LA 3MWBA 3EQ1A 3TZAA 2RCAA 1XS5A 3KZGA 1K9YA 1B4HA 5A5LA 2F6PA 1FPFA 1A55A 1SI1A 1IUDA 1EU8A 1NNFA 1D9YA 5H8NB 1R9LA 1VSOA 2L5VA 2A5TA 4WEDA 1IMBA 1DTGA 4YB6A 1H76A 2R9JA 3H6TA 4RNSA 2CZKA 3RN8A 2UVIA 3UK4A 4H67A 4G8MA 3TTRA 1YPNA 4GFRA 1I6QA 3TQWA 1GR2A 3E13X 1MDP1 4Q0CA 3TODA 4M4GA 4R2FA 5L8DA 1US4A 4OWDA 1USYH 1TXFA 2O1LA 3B8BA 5B70A 5CMBA 4F3PA 5IZ1A 4KCDA 1O7TA 1P1OA 2HFBA 3BFUA 3OEKA 2AYSA 2VD3A 4YMBA 3DP8A 2REGA 4ZEDA 1FQAA 3PMVA 2QJEA 1JW1A 3TMGA 1YCJA 3ZSFA 3EF7A 2QSXA 3SEUA 1FQDA 4GLIA 3MYUA 2R6GE 2AL5A 3PUZE 5H8NA 3ZS6A 1ZBMA 5CRYA 2DXRA 1SW1A 1MY3A 2QS1A 1B3GA 3RGYA 3TAJA 5H8FB 4NF8B 4GIZA 1N0TA 4LA9A 3K1PA 3T9XB 4PBHA 3FJGA 4DCXA 4PFYA 2F8DA 1DK4A 5DTBA 4OVTA 1FTKA 3KSJA 5KCJB 3JV9A 1BKAA 2ZNUA 2E1SA 3OENA 1F9BA 1Q35A 3U8QA 1FPDA 4P0IA 2UYFA 4BDRA 3B50A 1ZU0A 1IMCA 4MH5A 3GZGA 4OETA 2F6GA 1INPA 1LAHE 3HPIA 1DMBA 2OJTA 2FHYA 1FJ6A 2OBGA 1BTJA 1UQWA 2F7BA 1LGBC 4FATA 1B5JA 2H99A 4N91A 4XFEA 3K1NA 1DTZA 1VR5A 1FPKA 3RUMA 2FIEA 4MHFA 3JYRA 3GLBA 3LSXA 1Z7NE 2I49A 1N3XA 5DVIA 4H65A 1Y3QA 4PF8A 4YB7A 3C35A 1LLSA 4ELPA 1XVYA 5FTIA 2ZYKA 3QXMA 1IXHA 5I5PA 1OLAA 4PFIA 5H8FA 4NF8A 4G8HA 4PCDA 3ZKKA 3U93A 4F1YA 5CMKA 3T9UA 1A8EA 1PB7A 1FBEA 2Q8MA 3V83A 2OX3A 4NTLA 3BIGA 5KCJA 4QSCA 3ILUB 4KHZE 2ZXTA 4NMYA 4GF8A 4O94A 1H43A 1RYOA 1J1NA 2XXIA 4RPOA 5ESYA 1H44A 1FTMA 3Q27A 3F11A 1I69A 4KXPA 2V4CA 5F24A 4PFRA 1B0LA 3BFTA 4OFOA 2E0SA 4UACA 2KR0A 1LCFA 4EUOA 5JK4A 3S9EA 1SDXA 3Q26A 1BIYA 3EHTA 4OA4A 1MXVA 1LB8A 3H6VA 3K02A 4QHQA 1LBWA 2PVUA 3S9LC 1D9VA 1KZ8A 4DLDA 1B3LA 4FECA 4F22A 4MLQA 2FBPA 2PFZA 1VDWA 2Y5LA 2I4CA 4C1TA 4N6DA 4I9DA 1B1XA 4F39A 1MY0A 2ANJA 1B5IA 2XX7A 1JNFA 2PFYA 4OFLA 4XF5A 3O6HA 2B4LA 3U65A 3FV1A 3TPAA 5DW8A 4F1UA 4NWDA 1S50A 1NUXA 2QMXA 4IY5A 4OEVA 4KR5A 2GQ1A 1CB6A 3W9WA 4OVJA 5EQ9A 3FXQA 2P3NA 3IB2A 1MY2A 4JB7A 3KG2A 1XOCA 4GWUA 1EZPA 3CSBA 4PE5B 3RTWB 2O84X 3R7XA 2F78A 2Y7KA 3DELB 2RF1A 5AA2B 3A29A 1R9QA 1TT1A 2QVUA 4N81A 3MVYA 4OMBA 4YU0A 4RJZA 3K00A 4ONYA 2F7CA 4ND9A 5I57B 3H6UA 3KOTA 5KZTA 1AH5A 1LBZA 5DT6A 3N6UA 3SEXA 4KD5A 2Q2AA 2I6EA 1B4ZA 1LB9A 3FVGA 2B3FA 3LSLA 1NH7A 1B46A 4OHNA 4QFKA 3DP6A 4U21A 3G3IA 3T96B 3CIJA 4POWA 1MXZA 2F36A 4NEDA 4OENA 4ISUA 3THIA 2CEXA 2FIXA 1VE4A 4GX6A 4H45A 4F18A 4X9TA 3VLVA 4NG7A 4JSOA 4Q8RA 4MIJA 4BLAA 1QKBA 3P7IA 3M8UA 1I6BA 3Q28A 2YPNA 1NUYA 3IOUA 1OLCA 5H8SA 4P8BA 3MJNA 2FVZA 4MEVA 1SI0A 2Q88A 3MP8A 1UIVA 1B5HA 5I57A 2ABHA 2VPNA 3G7WA 2DWHA 3HN0A 4ZZAA 4Z7EA 3UGWA 4MNIA 1UTBB 2NOOA 3B6TA 2HAUA 2V25A 3QYTA 1CE2A 3PPPA 2XD3A 4IO2A 1EZOA 1NV4A 4GWSA 4G68B 3PUXE 1ZTYA 2OWSA 1B3FA 1DPPA 1OQGA 4EQBA 1ELJA 1P99A 4KFQA 2QS4A 3ECRA 1JETA 1USYE 4OVQA 3T66A 2BJIA 3G3FA 3IFAA 4U1OA 4I40A 1KWHA 4L17A 3MP6A 2RC8A 3IORA 1CNQA 3UORA 4XIGQ 2QL3A 1LFGA 5AE4A 3DM0A 1KA1A 3QMFA 2O51A 5EHMA 3A3CA 4RK9A 1EYIA 3MC2A 4F1VA 5ICTA 4HCYA 4Z0IA 3IB0A 4O3CA 3VFJA 1NNTA 5HPQA 3OSQA 3TKDA 2QS2A 1UTBA 3PU5A 1OVTA 1JEVA 3G3KA 5EQ7A 1URSA 4DE8A 2CEYA 4RXLA 3ILTB 1OMPA 1EH3A 3L6GA 1MXWA 1LBXA 5AA1A 4FEDA 3PGFA 2CZHA 2WX9A 3CFZA 2MKZA 2G29A 1POY1 2DXYA 3I5OA 5IGAA 1MQDA 4FJPA 1AOVA 3RNNA 1A54A 4ELRA 3CSGA 4POXA 4RA1A 4GL8A 4GBVA 3EN3A 1B3EA 2F3DA 3B6QA 1GVCA 3ISPA 4XKPA 2QS3A 1FPEA 1N7WA 3MP1A 2X7PA 5EYGA 5I7IA 3LC8A 3PV0E 3FUZA 3OO8A 3O29A 1JW5A 3O6GA 1FSAA 3H03A 4ELOA 1LAXA 4E0WA 1LEVA 4OTEA 2W7YA 2D21A 4NF5B 4M1VA 3VLWA 2QMWA 1N7XA 1IXIA 5H8HB 4DXCA 1SD3A 1B52A 1IZ1A 2A5SA 4H5GA 2PBWA 3TCHA 1N84A 3IOWA 1MH4A 4UABA 1Y9UA 3HSTA 3O66A 1NUZA 4ESWA 2ONRA 2IEEA 5I84A 3FJ7A 3T9VA 3FXUA 1MY4A 4MNPA 4IO3A 4HXVA 5EQAA 2CZLA 5DEXB 5TP9B 4LQ5A 2Y7WA 1FBHA 1FPJA 4R73A 1Q1KA 2OPDA 1FTLA 1QUJA 4OANA 5FTHA 3RTFB 3TELA 3S2VA 1Y3PA 3S9MC 3PUVE 2V3TA 4GWOA 1QJMA 3HCQA 4HS7A 2H98A 2WYKA 1DPEA 4G2ZA 1NL5A 4NF0A 2IA4A 3FVKA 3PPRA 4NF5A 3M3FA 1FTOA 2XXHA 1MXUA 4AS4A 1HSJA 5I59B 1IQ7A 2XWVA 5H8HA 2XWOA 1JP4A 3RT6B 3VVFA 4U4SA 4P9KA 1H3DA 3KBZA 4NX1A 1OQHA 2H9BA 3M3KA 2AIXA 1B32A 4O8MA 3TCFA 5DYHA 4QRZA 1TFDA 2B65A 1PC3A 5DEXA 2XXRA 2V3UA 2ONKE 5AA2D 1M5FA 1DCUA 2Q2CA 4PQJA 1M5BA 3HHFA 2REJA 1NFTA 2Z22A 3C9HA 3FJMA 5I2KB 1EZ9A 1II5A 1MPDA 4PDDA 1MPBA 4AB6A 4N6KA 3D4CA 4GXSB 4RK2A 1IXGA 3CHGA 4E0XA 4U4XA 2D3IA 1BP5A 1ZLQA 4OXVA 3IOVA 1POTA 1K9ZA 1MXXA 1OVBA 2WKYA 4GVOA 5J1DA 1VFDA 4N4UA 4O3AA 1MS7A 3MPLA 5CBRA 1LBYA 1MXYA 2P3VA 5I59A 3IOTA 3JZJA 5JTYB 2NVUB 4N8YA 1NV6A 3N5LA 2Q9TA 2X26A 4OVSA 3N6TA 3MZ9A 3CFLA 4YKJA 2UYEA 3QUJA 4ZEIA 1FQFA 1NMUA 4YMAA 3LSWA 2I0BA 4DCYA 5L9SA 3KJ7A 4R6HA 1MM7A 5FBPA 1Y1MA 3OO9A 4PC9A 3TTMA 4GX3A 2RINA 3CG3A 3LBSA 1PB8A 5TPAB 1RKMA 3OMBA 2XXKA 4IO4A 3MW0A 4R74A 4P11A 1KA0A 2VHAA 2NWJA 1H45A 3SERA 3B6WA 5I2KA 1FBPA 3E3KA 4P0GA 4IO6A 4O7MA 1XT8A 4C0RA 4NE4A 4HE2A 3PUWE 5BWJA 4OERA 2DYXA 4R6YA 4FIMA 1AIVA 3ROJA 3SDFA 4PFUA 3DLNA 4IY6A 2OLBA 2XXVA 3K6VA 5A5XB 4H8IA 3E79A 5EYFA 2XXTA 1B2HA 5JTYA 2ZZVA 4KYDA 4IGRA 3O97A 2XA5A 3T93B 5IZZA 3A09A 1DBZA 1FRPA 4PBQA 1Y4TA 4JSDA 4DXBA 2VP1A 1ZKBA 2LAOA 3MUQA 1MQJA 3VLUA 1ATGA 3U92A 1SW4A 3OOAA 1URGA 4LUBA 1B7HA 1WDNA 5TPAA 4P1LA 1LFHA 3S4UA 1SVXB 3IO4A 4HTGA 4F29A 3Q25A 4NWCA 5AA4B 2M8CA 1R6ZA 3KSXA 1O63A 3LV0A 1IMAA 2GHBA 1EYKA 5I2NB 1N76A 3GXAA 1M5DA 1Q9DA 3OD7A 5FHMA 2H5YA 1YAEA 4H46A 2Y5KA 4OVRA 1XVXA 1DSNA 1XI6A 1NV0A 4ZEBA 2DE3A 1MQHA 1FPBA 4ZZEA 2V93A 1MDQA 5F7VA 1UTHB 1AWBA 2KLFA 1QUKA 4R6KA 4NGUA 4PF6A 1IITA 1Y1ZA 4RYAA 4PAKA 4O3BA 2PT1A 3FIRA 4N13A 4GWWA 4QFPA 3U94A 3CI8A 2NXOA 2VD2A 4N6PA 3CRBA 4H5FA 1ZJLA 3H6WA 3OSRA 2GH9A 2DOJA 1XC1A 2B3BA 4WEPA 3MSTA 3MVZA 5AA4A 4MMPA 3G3GA 5AA2A 2DVZA 4DDDA 1US5A 3TQLA 4K3FA 1VFEA 1QVSA 4PDHA 3SESA 1RDYA 2GRVA 3I6VA 1S9TA 3GYYA 3H06B 1JVXA 2BJJX 3K0VA 3RPWA 2Z8FA 1LAFE 1B3HA 3CFXA 4TLMB 3UIFA 1FPIA 4I8CA 2F3BA 4ZEFA 4LZ5A 2ESNA 3K6WA 1UTHA 1SPIA 3V89B 4TLLB 3B7DA 1IEJA 3FBPA 4FEBA 5CMCA 2XXXA 4DIGA 4EXLA 2ZYNA 5ITPA 2GHAA 3UP9A 4MF3A 1P1WA 1B51A 3Q29A 4QXDA 2HHMA 1MRPA 4ELQA 3EHSA 4PE3A 2I48A 2O68A 2CMOA 1NI9A 3D1RA 1FBDA 4PFBA 4LN5A 4GBWA 4BDQA 4FBPA 5ELVA 5IM2A 4QF9A 4FORA 4G8NA 2XD2A 2F7AA 4QFNA 4JVDA 1D9QA 4JDFA 5KDTB 3E4RA 1M5EA 1SW2A 4JVIA 5CC2A 5T3JA 3SEVA 3KBRA 2ZMBA 3C36A 2V84A 1FTJA 4LZ8A 1FJ9A 3SEYA 4XKNA 3ODBA 1NUWA 3BBRA 1HSEA 3K2DA 1URDA 1ZMGA 1JQFA 1YXIA 4X1BA 3KOSA 1OIBA 1FQBA 4PFTA 4N15A 2Y7IA 2Z8DA 2I3VA 1RDZA 4THIA 5FHNA 2DDKA 4KI0E 2ZNTA 4LZ7A 3QAXA 4DXUA 4G68A 3PMWA 4P56A 3OO7A 4MAGA 1RDXA 3TFLA 4JWXA 2QRYA 2XHDA 3RT8A 4YKPA 3FXBA 3RLFE 3KN7A 1YYZA 1LCTA 5FHOA 3MVXA 4PAIA 4PTKA 5ET7A 3MZBA 5AA3A 4NF6B 3PMXA 4G4PA 3LUZA 2F35A 1A99A 3LSFB 1Y4CA 1A7LA 2Z23A 3O9PA 4GOTA 3MZ1A 3H3GA 5CI5A 1D3KA 4Q30B 5ITOA 3K6XA 4GWXA 2PCRA 1JEUA 4P3LA 3SEWA 3DP4A 1NV5A 2XXUA 4GQOA 2OWZA 1LSTA 2HAVA 4BDNA 4XTCQ 4TQUQ 1TWYA 3CVGA 4HCWA 1D4NA 2F5XA 1FBFA 2OPEA 4G61A 4LP2B 2P2AA 4DI3D 4YZZA 3R26A 2XX8A 4FAJA 4F3GA 4JWOA 2DVCA 2CZIA 3OELA 5JEIA 4R9FA 4TOZA 2HCAA 2Q74A 4H1XA 1SQYA 1B6HA 4KYSA 3W15C 3N26A 4H0WA 1AL3A 2FA7A 5I56B 4RY1A 1QUIA 3FATA 4HW8A 3V5AA 3C32A 3SZPA 3VE1B 5I58B 2PT2A 3PD9A 2AL4A 4NF6A 3OO6A 4YAHX 1B40A 4LVQA 4IO5A 4NHBA 1PB9A 4GWYA 3HV1A 1Y3NA 3RQTA 4GWZA 4I1DA 4IGTA 4X04A 4F3SA 3IR1A 1A8FA 4NF4B 4NN3A 1RYXA 2QVVA 1B7ZA 4U22A 3C33A 3KGCA 4PFWA 4MJOA 1JW4A 3AXFA 4DZ1A 3C34A 1FQCA 4PAFA 5ET5A 2I3WA 4R75A 3VXCA 5BUUA 4KYEA 3UN6A 1T0KA 2R8TA 3WAFA 4I3EA 5CMMA 4C1UA 5I56A 5J16A 5TP9A 5I58A 2B4MA 1QKAA 3U1OA 4KPTA 3PTYA 2VGQA 2P0SA 5H8QB 4GXAA 2F34A 3H7MA 3FGSA 1MQGA 4ECFA 1SW5A 4Q5TA 1LFIA 1XHYA 2XXQA 3TTLA 3A3UA 1GTKA 2Y7PA 5L9OA 2QFLA 3FZVA 5LOMA 1Y20A 3R6UA 3MVWA 5ET6A 4R9GA 4NF4A 3EKIA 5K2XA 2RCBA 2DS9A 1P1UA 2H4IA 4F2QA 2HEUA 1M5CA 3TDJA 2DE4A 1YZ0A 4WKMA 4MBPA 3KC1A 4YKKA 1NNPA 2DE2A 1NV3A 1NV1A 4OYVA 2HZKA 4R72A 3PPQA 4XKQA 5DVFA 3FXRA 5EQ8A 4HE1A 4MX6A 2PMSA 2OZZA 3FD3A 4H6DA 3I3VA 3FASA 4U23A 2VPOA 1FPGA 1G0IA 4WXJA 1HSLA 1PBPA 1B58A 2PX1A 3IO6A 1DOTA 4BDLA 4OZ9A 1ZIUA 2UVJA 3RY3A 4OQOA 1GV8A 5H8QA 1SYIA 3N94A 4R2BA 3T1BA 3CR9A 1IMEA 2FYIA 3IX1A 3TCGA 4OFJA 1TFAA 2DSFA 1B1HA 3HFUA 3T9HB 2UVHA 4N07A 4ZECA 3VV5A 3LR1A 5EHSA 3IK6B 1SBPA 4F2OA 1R1NA 4F31B 4H8JA 3QK6A 1JVYA 4GRKA 4GL0A 1QGXA 3W9VA 4MFIA 4LONB 5I3SA 1IIWA 5ISUA 3SKPA 1WODA 3GBBA 4XXUA 3VDFA 4G77A 1B9JA 1N3WA 1O64A 1FBCA 3UA8A 2ZZWA 1B05A 2O69A 3QUFA 2Q89A 1B7UA 4PGNA 3K4UA 1G0HA 4U1ZA 2ZNSA 2ZZXA 2RKMA 2OWTA 1MPCA 5IAIA 4ZEKA 1FW0A 2H25A 1NNKA 3NOHA 2WBBA 1MH3A 4X1DA 1S7YA 4EQ9A 1B0HA 5IZ3B 1NH8A 4G68C 5CM6A 2I58A 1LBCA 5ICQA 3IB1A 3E9XA 2Y84A 3KN8A 2G93A 5B7DA 2HQ0A 1NV7A 4AB5A 3EHUA 4RPNA 2DWJA 4OEUA 2THIA 2V3QA 3RPLB 3T0JA 2XX9A 3KN3A 3HHGA 3TEPA 4YKIA 3D4GA 2P1SA 3VXBA 4EF1A 3MBPA 2ALUA 5A5XA 3USDA 1MG1A 4KQPA 2F97A 2YJPA 3E78A 3K6UA 2HXRA 2R71A 2X7QA 1FCKA 2D5WA 3IFCA 3T22A 4DI4B 1YTVA 1LBVA 2DP8A 4LATA 4IR8A 3QSLA 2UVGA 3TTNA 2JJKA 3FVNA 3RYDA 4JVCA 4NQ8A 1NKXA 3VVEA 3PPNA 3OXNA 4PGPA 2DWAA 4X48A 4U2RA 4X8RA 4GD5A 4P47A 1LBBA 1PDAA 3C31A 4IO7A 5IZ3A 4N17A 1FPLA 2XWIA 1P1NA 2WYPA 2HXWA 2HPGA 4KCCA 3GBAA 3K1MA 2UXAA 3PPOA 1I6AA 1AMFA 2O7UA 5F1QA 5I2NA 3ONMA 1QULA 4EXKA 3G3HA 3MQ9A 4AQ4A 3RPLA 2FNCA 2O6AA 1MM6A 5K2YA 3OEMA 2RC7A 4OESA
chains in the Genus database with same CATH topology
2PFZA 4OVPA 3LUZA 1VDWA 2Y5LA 4O8MA 4N6DA 2XWKA 4F19A 1IMFA 4GWXA 2PCRA 4P3LA 2PFYA 4XF5A 2B4LA 1NV5A 1DCUA 3U65A 2OWZA 5DW8A 4F1UA 1NUXA 1NV2A 4HCWA 2GQ1A 2F5XA 3W9WA 1FBFA 4PDDA 5EQ9A 2P3NA 5LDZA 4N6KA 4G61A 4O7IA 3CHGA 4DI3D 4YZZA 4GWUA 4I3YA 2CZIA 3KC0A 1K9ZA 5J1DA 4N4UA 2Q74A 2KQZA 2WEFA 1LBYA 1FBGA 2P3VA 4HE0A 3A29A 4N8YA 1NV6A 2QVUA 4N81A 2Q9TA 4OVSA 5EYHA 3SZPA 2WBDA 4AS5A 4GX4A 1LBZA 4NHBA 5FBPA 4PC9A 4MCOA 4GWYA 4GX3A 4GWZA 4N8GA 4X04A 1BK4A 2XXKA 1FTAA 4NN3A 4P1EA 1KA0A 2QVVA 2QPQA 1FBPA 4XEQA 1EYJA 4O7MA 4MJOA 2CEXA 2FIXA 4HE2A 4GX6A 4H45A 4F18A 4PAFA 3ROJA 4X9TA 3BIHA 4NG7A 5ET5A 4NAPA 2HZLA 4MIJA 4QBAA 3E79A 4MNCA 2R8TA 1NUYA 2ZZVA 4PETA 4P8BA 5ET8A 2FVZA 4I3EA 4MEVA 2QVRA 2XA5A 4YICA 5IZZA 5J16A 1DBZA 1FRPA 2B4MA 4PBQA 2VT5A 5LTCA 2VPNA 1IMDA 3PTYA 4MNIA 4P1LA 2QFLA 1K9YA 1NV4A 5A5LA 4GWSA 5ET6A 1FPFA 3EKIA 3LV0A 1IMAA 2L5VA 2DE4A 1YZ0A 1EYKA 1IMBA 4OVQA 2BJIA 3KC1A 3IFAA 4I40A 2DE2A 2CZKA 1NV3A 1NV1A 1CNQA 2HZKA 1Q9DA 4H46A 5EQ8A 2Y5KA 4OVRA 4HE1A 1KA1A 3QMFA 1XI6A 1NV0A 4MX6A 2DE3A 1FPBA 1EYIA 4F1VA 4HCYA 1AWBA 1FPGA 1G0IA 2VPOA 4NGUA 4PF6A 3B8BA 4PAKA 5IZ1A 4GWWA 3T1BA 1IMEA 5EQ7A 2CEYA 3HFUA 1LBXA 3MYUA 2CZHA 3MSTA 2WX9A 4MMPA 2MKZA 2DVZA 5IGAA 1QGXA 4PDHA 3W9VA 1RDYA 5I3SA 4GBVA 3GYYA 4PBHA 2F3DA 3ISPA 1FPEA 1FBCA 2ZZWA 1DK4A 4OVTA 1FPIA 4PGNA 2F3BA 1G0HA 2ZZXA 5EYGA 5I7IA 1SPIA 3FBPA 3NOHA 1FPDA 2WBBA 1FSAA 3B50A 5IZ3B 5CM6A 1IMCA 1LEVA 1INPA 4M1VA 4QXDA 2FHYA 1FJ6A 2HHMA 1NV7A 4PE3A 4N91A 1NI9A 3D1RA 4XFEA 2V3QA 1FBDA 4PFBA 3RPLB 4LN5A 4GBWA 3T0JA 1FPKA 2FIEA 4FBPA 4MHFA 5IM2A 4JVDA 1D9QA 4UABA 4PF8A 4JVIA 1NUZA 5T3JA 1FJ9A 5I5PA 4MNPA 3E78A 2HXRA 4PFIA 4HXVA 5EQAA 1NUWA 3IFCA 4DI4B 4PCDA 1FBHA 1FBEA 2Q8MA 1LBVA 1FPJA 2OX3A 1YXIA 4IR8A 3BIGA 4N15A 4OANA 2JJKA 3RYDA 4JVCA 4NQ8A 4O94A 1RDZA 2DDKA 5ESYA 4PGPA 2WYKA 4KXPA 2V4CA 4X8RA 5F24A 4PFRA 4P47A 4P56A 5IZ3A 2KR0A 4N17A 1FPLA 5JK4A 2XWIA 4MAGA 4NF0A 1RDXA 2WYPA 2HPGA 4AS4A 4OA4A 3FXBA 2XWVA 2XWOA 3RPLA 1JP4A 1YYZA 1LBWA 4P9KA 4PAIA 4PTKA 5ET7A 3KBZA 4NX1A 1KZ8A 2FBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUZ A;  1VDW A;  1IMC A;  2Y5L A;  1LEV A;  1FPB A;  1FBP A;  1EYI A;  1INP A;  4QXD A;  2FHY A;  1FJ6 A;  2HHM A;  1EYJ A;  1NV7 A;  4MJO A;  1NI9 A;  3D1R A;  1AWB A;  1FPG A;  1G0I A;  2FIX A;  4HE2 A;  1IMF A;  4GWX A;  2PCR A;  1FBD A;  3RPL B;  4GX6 A;  4GBW A;  3T0J A;  4H45 A;  1FPK A;  3B8B A;  1NV5 A;  2FIE A;  1DCU A;  4FBP A;  3ROJ A;  2OWZ A;  3BIH A;  5ET5 A;  5DW8 A;  5IZ1 A;  1D9Q A;  4GWW A;  1NUX A;  1NV2 A;  1IME A;  1XI6 A;  1NUZ A;  5T3J A;  2GQ1 A;  2R8T A;  1NUY A;  1FBF A;  1FJ9 A;  5EQ9 A;  2P3N A;  5LDZ A;  5ET8 A;  2FVZ A;  4I3E A;  4G61 A;  4HXV A;  4O7I A;  5EQ7 A;  2QVR A;  5EQA A;  2QVV A;  1NUW A;  3IFC A;  5J16 A;  1DBZ A;  1FRP A;  4GWU A;  1LBX A;  4I3Y A;  2VT5 A;  2CZH A;  1FBH A;  2CZI A;  3KC0 A;  1K9Z A;  1FBE A;  2Q8M A;  1LBV A;  1IMD A;  1FPJ A;  2OX3 A;  1YXI A;  4IR8 A;  2Q74 A;  2WEF A;  1LBY A;  3BIG A;  1FBG A;  2P3V A;  4HE0 A;  3A29 A;  1QGX A;  2JJK A;  3RYD A;  1NV6 A;  2QVU A;  4N81 A;  1RDZ A;  1RDY A;  2DDK A;  5I3S A;  5ESY A;  2QFL A;  5EYH A;  4GBV A;  1K9Y A;  1NV4 A;  5A5L A;  4GWS A;  2F3D A;  4KXP A;  5ET6 A;  5F24 A;  1FPF A;  1FPE A;  5IZ3 A;  1FBC A;  2WBD A;  1FPL A;  1DK4 A;  4AS5 A;  1RDX A;  4GX4 A;  1FPI A;  2F3B A;  1LBZ A;  1G0H A;  5FBP A;  3LV0 A;  1IMA A;  4AS4 A;  1YZ0 A;  1EYK A;  4GWY A;  4GX3 A;  1IMB A;  5EYG A;  1SPI A;  2BJI A;  3KC1 A;  3IFA A;  4I40 A;  4GWZ A;  3RPL A;  1JP4 A;  1YYZ A;  2CZK A;  1NV3 A;  1NV1 A;  3FBP A;  1LBW A;  1BK4 A;  1CNQ A;  1FPD A;  2WBB A;  1Q9D A;  4PTK A;  5ET7 A;  3KBZ A;  1KZ8 A;  4H46 A;  5EQ8 A;  2Y5K A;  1FTA A;  1KA0 A;  1KA1 A;  4HE1 A;  1FSA A;  3QMF A;  1NV0 A;  5IZ3 B;  2FBP A; 
#chains in the Genus database with same CATH topology
 4OVP A;  4JBZ A;  4I62 A;  2XWK A;  4F19 A;  5L9M A;  1ANF A;  3O6I A;  3KEI A;  1IMF A;  1GGG A;  2GFE A;  2DQV A;  4FE8 A;  3L6H A;  4YB5 A;  1NV2 A;  3MPK A;  3G3J A;  1LAG E;  3WAE A;  5IKB A;  4QSD A;  1P1Q A;  4ZDM A;  5LDZ A;  3PD8 A;  1MY1 A;  4O7I A;  3O28 A;  2OCU A;  4EF2 A;  2Y7R A;  1WVJ A;  4ZE9 A;  1MQI A;  4F3B A;  4I3Y A;  4ZS9 A;  3TYH A;  1L5T A;  4XKR A;  5DVJ A;  3KC0 A;  2O1M A;  4BDM A;  2ZYM A;  3MAM A;  4IB2 A;  2KQZ A;  2WEF A;  2O7I A;  4QFL A;  4MLV A;  3KJT A;  3IJO B;  1FBG A;  3KFM A;  4HE0 A;  3TTK A;  3BKI B;  3TUS A;  3HO7 A;  5HBC A;  3CG1 A;  5TU0 A;  5EYH A;  3IAZ A;  2I4B A;  1N04 A;  3S9N C;  2WBD A;  4AS5 A;  4PP0 A;  4GX4 A;  5CBS A;  3FV2 A;  1IXC A;  1PEB A;  3IL1 B;  4MCO A;  3ZKL A;  1QW0 A;  4LQ2 A;  4JXI A;  4JWY A;  2ONS A;  4EQ7 A;  4QSE A;  4N8G A;  1BK4 A;  2I0C A;  2ZYO A;  2RC9 A;  1FTA A;  4P1E A;  3O2A A;  1Z7M E;  4ZE8 A;  2QPQ A;  3QIM A;  3V8X B;  1SYH A;  5HM4 B;  2Z8E A;  4XEQ A;  1EYJ A;  4ESX A;  1BLF A;  2A5T B;  2PYY A;  1A40 A;  3H4Z A;  1UIU A;  2OK2 A;  2YLN A;  3BIH A;  3FVO A;  4NAP A;  2HZL A;  3C4M A;  5KDT A;  4EDP A;  2XXY A;  4QBA A;  4QFO A;  3K01 A;  4MNC A;  3SET A;  4PET A;  5ET8 A;  3PUY E;  2QVR A;  3IJX B;  1FQE A;  2DWI A;  4YIC A;  2Q8J A;  2VOZ A;  2XXW A;  4UA8 A;  3VVD A;  2VT5 A;  2NUV A;  3U72 A;  5LTC A;  1IMD A;  1PBQ A;  5M2V A;  4BDO A;  3LUY A;  3EPE A;  2XXP A;  3M3L A;  3MWB A;  3EQ1 A;  3TZA A;  2RCA A;  1XS5 A;  3KZG A;  1K9Y A;  1B4H A;  5A5L A;  2F6P A;  1FPF A;  1A55 A;  1SI1 A;  1IUD A;  1EU8 A;  1NNF A;  1D9Y A;  5H8N B;  1R9L A;  1VSO A;  2L5V A;  2A5T A;  4WED A;  1IMB A;  1DTG A;  4YB6 A;  1H76 A;  2R9J A;  3H6T A;  4RNS A;  2CZK A;  3RN8 A;  2UVI A;  3UK4 A;  4H67 A;  4G8M A;  3TTR A;  1YPN A;  4GFR A;  1I6Q A;  3TQW A;  1GR2 A;  3E13 X;  1MDP 1;  4Q0C A;  3TOD A;  4M4G A;  4R2F A;  5L8D A;  1US4 A;  4OWD A;  1USY H;  1TXF A;  2O1L A;  3B8B A;  5B70 A;  5CMB A;  4F3P A;  5IZ1 A;  4KCD A;  1O7T A;  1P1O A;  2HFB A;  3BFU A;  3OEK A;  2AYS A;  2VD3 A;  4YMB A;  3DP8 A;  2REG A;  4ZED A;  1FQA A;  3PMV A;  2QJE A;  1JW1 A;  3TMG A;  1YCJ A;  3ZSF A;  3EF7 A;  2QSX A;  3SEU A;  1FQD A;  4GLI A;  3MYU A;  2R6G E;  2AL5 A;  3PUZ E;  5H8N A;  3ZS6 A;  1ZBM A;  5CRY A;  2DXR A;  1SW1 A;  1MY3 A;  2QS1 A;  1B3G A;  3RGY A;  3TAJ A;  5H8F B;  4NF8 B;  4GIZ A;  1N0T A;  4LA9 A;  3K1P A;  3T9X B;  4PBH A;  3FJG A;  4DCX A;  4PFY A;  2F8D A;  1DK4 A;  5DTB A;  4OVT A;  1FTK A;  3KSJ A;  5KCJ B;  3JV9 A;  1BKA A;  2ZNU A;  2E1S A;  3OEN A;  1F9B A;  1Q35 A;  3U8Q A;  1FPD A;  4P0I A;  2UYF A;  4BDR A;  3B50 A;  1ZU0 A;  1IMC A;  4MH5 A;  3GZG A;  4OET A;  2F6G A;  1INP A;  1LAH E;  3HPI A;  1DMB A;  2OJT A;  2FHY A;  1FJ6 A;  2OBG A;  1BTJ A;  1UQW A;  2F7B A;  1LGB C;  4FAT A;  1B5J A;  2H99 A;  4N91 A;  4XFE A;  3K1N A;  1DTZ A;  1VR5 A;  1FPK A;  3RUM A;  2FIE A;  4MHF A;  3JYR A;  3GLB A;  3LSX A;  1Z7N E;  2I49 A;  1N3X A;  5DVI A;  4H65 A;  1Y3Q A;  4PF8 A;  4YB7 A;  3C35 A;  1LLS A;  4ELP A;  1XVY A;  5FTI A;  2ZYK A;  3QXM A;  1IXH A;  5I5P A;  1OLA A;  4PFI A;  5H8F A;  4NF8 A;  4G8H A;  4PCD A;  3ZKK A;  3U93 A;  4F1Y A;  5CMK A;  3T9U A;  1A8E A;  1PB7 A;  1FBE A;  2Q8M A;  3V83 A;  2OX3 A;  4NTL A;  3BIG A;  5KCJ A;  4QSC A;  3ILU B;  4KHZ E;  2ZXT A;  4NMY A;  4GF8 A;  4O94 A;  1H43 A;  1RYO A;  1J1N A;  2XXI A;  4RPO A;  5ESY A;  1H44 A;  1FTM A;  3Q27 A;  3F11 A;  1I69 A;  4KXP A;  2V4C A;  5F24 A;  4PFR A;  1B0L A;  3BFT A;  4OFO A;  2E0S A;  4UAC A;  2KR0 A;  1LCF A;  4EUO A;  5JK4 A;  3S9E A;  1SDX A;  3Q26 A;  1BIY A;  3EHT A;  4OA4 A;  1MXV A;  1LB8 A;  3H6V A;  3K02 A;  4QHQ A;  1LBW A;  2PVU A;  3S9L C;  1D9V A;  1KZ8 A;  4DLD A;  1B3L A;  4FEC A;  4F22 A;  4MLQ A;  2FBP A;  2PFZ A;  1VDW A;  2Y5L A;  2I4C A;  4C1T A;  4N6D A;  4I9D A;  1B1X A;  4F39 A;  1MY0 A;  2ANJ A;  1B5I A;  2XX7 A;  1JNF A;  2PFY A;  4OFL A;  4XF5 A;  3O6H A;  2B4L A;  3U65 A;  3FV1 A;  3TPA A;  5DW8 A;  4F1U A;  4NWD A;  1S50 A;  1NUX A;  2QMX A;  4IY5 A;  4OEV A;  4KR5 A;  2GQ1 A;  1CB6 A;  3W9W A;  4OVJ A;  5EQ9 A;  3FXQ A;  2P3N A;  3IB2 A;  1MY2 A;  4JB7 A;  3KG2 A;  1XOC A;  4GWU A;  1EZP A;  3CSB A;  4PE5 B;  3RTW B;  2O84 X;  3R7X A;  2F78 A;  2Y7K A;  3DEL B;  2RF1 A;  5AA2 B;  3A29 A;  1R9Q A;  1TT1 A;  2QVU A;  4N81 A;  3MVY A;  4OMB A;  4YU0 A;  4RJZ A;  3K00 A;  4ONY A;  2F7C A;  4ND9 A;  5I57 B;  3H6U A;  3KOT A;  5KZT A;  1AH5 A;  1LBZ A;  5DT6 A;  3N6U A;  3SEX A;  4KD5 A;  2Q2A A;  2I6E A;  1B4Z A;  1LB9 A;  3FVG A;  2B3F A;  3LSL A;  1NH7 A;  1B46 A;  4OHN A;  4QFK A;  3DP6 A;  4U21 A;  3G3I A;  3T96 B;  3CIJ A;  4POW A;  1MXZ A;  2F36 A;  4NED A;  4OEN A;  4ISU A;  3THI A;  2CEX A;  2FIX A;  1VE4 A;  4GX6 A;  4H45 A;  4F18 A;  4X9T A;  3VLV A;  4NG7 A;  4JSO A;  4Q8R A;  4MIJ A;  4BLA A;  1QKB A;  3P7I A;  3M8U A;  1I6B A;  3Q28 A;  2YPN A;  1NUY A;  3IOU A;  1OLC A;  5H8S A;  4P8B A;  3MJN A;  2FVZ A;  4MEV A;  1SI0 A;  2Q88 A;  3MP8 A;  1UIV A;  1B5H A;  5I57 A;  2ABH A;  2VPN A;  3G7W A;  2DWH A;  3HN0 A;  4ZZA A;  4Z7E A;  3UGW A;  4MNI A;  1UTB B;  2NOO A;  3B6T A;  2HAU A;  2V25 A;  3QYT A;  1CE2 A;  3PPP A;  2XD3 A;  4IO2 A;  1EZO A;  1NV4 A;  4GWS A;  4G68 B;  3PUX E;  1ZTY A;  2OWS A;  1B3F A;  1DPP A;  1OQG A;  4EQB A;  1ELJ A;  1P99 A;  4KFQ A;  2QS4 A;  3ECR A;  1JET A;  1USY E;  4OVQ A;  3T66 A;  2BJI A;  3G3F A;  3IFA A;  4U1O A;  4I40 A;  1KWH A;  4L17 A;  3MP6 A;  2RC8 A;  3IOR A;  1CNQ A;  3UOR A;  4XIG Q;  2QL3 A;  1LFG A;  5AE4 A;  3DM0 A;  1KA1 A;  3QMF A;  2O51 A;  5EHM A;  3A3C A;  4RK9 A;  1EYI A;  3MC2 A;  4F1V A;  5ICT A;  4HCY A;  4Z0I A;  3IB0 A;  4O3C A;  3VFJ A;  1NNT A;  5HPQ A;  3OSQ A;  3TKD A;  2QS2 A;  1UTB A;  3PU5 A;  1OVT A;  1JEV A;  3G3K A;  5EQ7 A;  1URS A;  4DE8 A;  2CEY A;  4RXL A;  3ILT B;  1OMP A;  1EH3 A;  3L6G A;  1MXW A;  1LBX A;  5AA1 A;  4FED A;  3PGF A;  2CZH A;  2WX9 A;  3CFZ A;  2MKZ A;  2G29 A;  1POY 1;  2DXY A;  3I5O A;  5IGA A;  1MQD A;  4FJP A;  1AOV A;  3RNN A;  1A54 A;  4ELR A;  3CSG A;  4POX A;  4RA1 A;  4GL8 A;  4GBV A;  3EN3 A;  1B3E A;  2F3D A;  3B6Q A;  1GVC A;  3ISP A;  4XKP A;  2QS3 A;  1FPE A;  1N7W A;  3MP1 A;  2X7P A;  5EYG A;  5I7I A;  3LC8 A;  3PV0 E;  3FUZ A;  3OO8 A;  3O29 A;  1JW5 A;  3O6G A;  1FSA A;  3H03 A;  4ELO A;  1LAX A;  4E0W A;  1LEV A;  4OTE A;  2W7Y A;  2D21 A;  4NF5 B;  4M1V A;  3VLW A;  2QMW A;  1N7X A;  1IXI A;  5H8H B;  4DXC A;  1SD3 A;  1B52 A;  1IZ1 A;  2A5S A;  4H5G A;  2PBW A;  3TCH A;  1N84 A;  3IOW A;  1MH4 A;  4UAB A;  1Y9U A;  3HST A;  3O66 A;  1NUZ A;  4ESW A;  2ONR A;  2IEE A;  5I84 A;  3FJ7 A;  3T9V A;  3FXU A;  1MY4 A;  4MNP A;  4IO3 A;  4HXV A;  5EQA A;  2CZL A;  5DEX B;  5TP9 B;  4LQ5 A;  2Y7W A;  1FBH A;  1FPJ A;  4R73 A;  1Q1K A;  2OPD A;  1FTL A;  1QUJ A;  4OAN A;  5FTH A;  3RTF B;  3TEL A;  3S2V A;  1Y3P A;  3S9M C;  3PUV E;  2V3T A;  4GWO A;  1QJM A;  3HCQ A;  4HS7 A;  2H98 A;  2WYK A;  1DPE A;  4G2Z A;  1NL5 A;  4NF0 A;  2IA4 A;  3FVK A;  3PPR A;  4NF5 A;  3M3F A;  1FTO A;  2XXH A;  1MXU A;  4AS4 A;  1HSJ A;  5I59 B;  1IQ7 A;  2XWV A;  5H8H A;  2XWO A;  1JP4 A;  3RT6 B;  3VVF A;  4U4S A;  4P9K A;  1H3D A;  3KBZ A;  4NX1 A;  1OQH A;  2H9B A;  3M3K A;  2AIX A;  1B32 A;  4O8M A;  3TCF A;  5DYH A;  4QRZ A;  1TFD A;  2B65 A;  1PC3 A;  5DEX A;  2XXR A;  2V3U A;  2ONK E;  5AA2 D;  1M5F A;  1DCU A;  2Q2C A;  4PQJ A;  1M5B A;  3HHF A;  2REJ A;  1NFT A;  2Z22 A;  3C9H A;  3FJM A;  5I2K B;  1EZ9 A;  1II5 A;  1MPD A;  4PDD A;  1MPB A;  4AB6 A;  4N6K A;  3D4C A;  4GXS B;  4RK2 A;  1IXG A;  3CHG A;  4E0X A;  4U4X A;  2D3I A;  1BP5 A;  1ZLQ A;  4OXV A;  3IOV A;  1POT A;  1K9Z A;  1MXX A;  1OVB A;  2WKY A;  4GVO A;  5J1D A;  1VFD A;  4N4U A;  4O3A A;  1MS7 A;  3MPL A;  5CBR A;  1LBY A;  1MXY A;  2P3V A;  5I59 A;  3IOT A;  3JZJ A;  5JTY B;  2NVU B;  4N8Y A;  1NV6 A;  3N5L A;  2Q9T A;  2X26 A;  4OVS A;  3N6T A;  3MZ9 A;  3CFL A;  4YKJ A;  2UYE A;  3QUJ A;  4ZEI A;  1FQF A;  1NMU A;  4YMA A;  3LSW A;  2I0B A;  4DCY A;  5L9S A;  3KJ7 A;  4R6H A;  1MM7 A;  5FBP A;  1Y1M A;  3OO9 A;  4PC9 A;  3TTM A;  4GX3 A;  2RIN A;  3CG3 A;  3LBS A;  1PB8 A;  5TPA B;  1RKM A;  3OMB A;  2XXK A;  4IO4 A;  3MW0 A;  4R74 A;  4P11 A;  1KA0 A;  2VHA A;  2NWJ A;  1H45 A;  3SER A;  3B6W A;  5I2K A;  1FBP A;  3E3K A;  4P0G A;  4IO6 A;  4O7M A;  1XT8 A;  4C0R A;  4NE4 A;  4HE2 A;  3PUW E;  5BWJ A;  4OER A;  2DYX A;  4R6Y A;  4FIM A;  1AIV A;  3ROJ A;  3SDF A;  4PFU A;  3DLN A;  4IY6 A;  2OLB A;  2XXV A;  3K6V A;  5A5X B;  4H8I A;  3E79 A;  5EYF A;  2XXT A;  1B2H A;  5JTY A;  2ZZV A;  4KYD A;  4IGR A;  3O97 A;  2XA5 A;  3T93 B;  5IZZ A;  3A09 A;  1DBZ A;  1FRP A;  4PBQ A;  1Y4T A;  4JSD A;  4DXB A;  2VP1 A;  1ZKB A;  2LAO A;  3MUQ A;  1MQJ A;  3VLU A;  1ATG A;  3U92 A;  1SW4 A;  3OOA A;  1URG A;  4LUB A;  1B7H A;  1WDN A;  5TPA A;  4P1L A;  1LFH A;  3S4U A;  1SVX B;  3IO4 A;  4HTG A;  4F29 A;  3Q25 A;  4NWC A;  5AA4 B;  2M8C A;  1R6Z A;  3KSX A;  1O63 A;  3LV0 A;  1IMA A;  2GHB A;  1EYK A;  5I2N B;  1N76 A;  3GXA A;  1M5D A;  1Q9D A;  3OD7 A;  5FHM A;  2H5Y A;  1YAE A;  4H46 A;  2Y5K A;  4OVR A;  1XVX A;  1DSN A;  1XI6 A;  1NV0 A;  4ZEB A;  2DE3 A;  1MQH A;  1FPB A;  4ZZE A;  2V93 A;  1MDQ A;  5F7V A;  1UTH B;  1AWB A;  2KLF A;  1QUK A;  4R6K A;  4NGU A;  4PF6 A;  1IIT A;  1Y1Z A;  4RYA A;  4PAK A;  4O3B A;  2PT1 A;  3FIR A;  4N13 A;  4GWW A;  4QFP A;  3U94 A;  3CI8 A;  2NXO A;  2VD2 A;  4N6P A;  3CRB A;  4H5F A;  1ZJL A;  3H6W A;  3OSR A;  2GH9 A;  2DOJ A;  1XC1 A;  2B3B A;  4WEP A;  3MST A;  3MVZ A;  5AA4 A;  4MMP A;  3G3G A;  5AA2 A;  2DVZ A;  4DDD A;  1US5 A;  3TQL A;  4K3F A;  1VFE A;  1QVS A;  4PDH A;  3SES A;  1RDY A;  2GRV A;  3I6V A;  1S9T A;  3GYY A;  3H06 B;  1JVX A;  2BJJ X;  3K0V A;  3RPW A;  2Z8F A;  1LAF E;  1B3H A;  3CFX A;  4TLM B;  3UIF A;  1FPI A;  4I8C A;  2F3B A;  4ZEF A;  4LZ5 A;  2ESN A;  3K6W A;  1UTH A;  1SPI A;  3V89 B;  4TLL B;  3B7D A;  1IEJ A;  3FBP A;  4FEB A;  5CMC A;  2XXX A;  4DIG A;  4EXL A;  2ZYN A;  5ITP A;  2GHA A;  3UP9 A;  4MF3 A;  1P1W A;  1B51 A;  3Q29 A;  4QXD A;  2HHM A;  1MRP A;  4ELQ A;  3EHS A;  4PE3 A;  2I48 A;  2O68 A;  2CMO A;  1NI9 A;  3D1R A;  1FBD A;  4PFB A;  4LN5 A;  4GBW A;  4BDQ A;  4FBP A;  5ELV A;  5IM2 A;  4QF9 A;  4FOR A;  4G8N A;  2XD2 A;  2F7A A;  4QFN A;  4JVD A;  1D9Q A;  4JDF A;  5KDT B;  3E4R A;  1M5E A;  1SW2 A;  4JVI A;  5CC2 A;  5T3J A;  3SEV A;  3KBR A;  2ZMB A;  3C36 A;  2V84 A;  1FTJ A;  4LZ8 A;  1FJ9 A;  3SEY A;  4XKN A;  3ODB A;  1NUW A;  3BBR A;  1HSE A;  3K2D A;  1URD A;  1ZMG A;  1JQF A;  1YXI A;  4X1B A;  3KOS A;  1OIB A;  1FQB A;  4PFT A;  4N15 A;  2Y7I A;  2Z8D A;  2I3V A;  1RDZ A;  4THI A;  5FHN A;  2DDK A;  4KI0 E;  2ZNT A;  4LZ7 A;  3QAX A;  4DXU A;  4G68 A;  3PMW A;  4P56 A;  3OO7 A;  4MAG A;  1RDX A;  3TFL A;  4JWX A;  2QRY A;  2XHD A;  3RT8 A;  4YKP A;  3FXB A;  3RLF E;  3KN7 A;  1YYZ A;  1LCT A;  5FHO A;  3MVX A;  4PAI A;  4PTK A;  5ET7 A;  3MZB A;  5AA3 A;  4NF6 B;  3PMX A;  4G4P A;  3LUZ A;  2F35 A;  1A99 A;  3LSF B;  1Y4C A;  1A7L A;  2Z23 A;  3O9P A;  4GOT A;  3MZ1 A;  3H3G A;  5CI5 A;  1D3K A;  4Q30 B;  5ITO A;  3K6X A;  4GWX A;  2PCR A;  1JEU A;  4P3L A;  3SEW A;  3DP4 A;  1NV5 A;  2XXU A;  4GQO A;  2OWZ A;  1LST A;  2HAV A;  4BDN A;  4XTC Q;  4TQU Q;  1TWY A;  3CVG A;  4HCW A;  1D4N A;  2F5X A;  1FBF A;  2OPE A;  4G61 A;  4LP2 B;  2P2A A;  4DI3 D;  4YZZ A;  3R26 A;  2XX8 A;  4FAJ A;  4F3G A;  4JWO A;  2DVC A;  2CZI A;  3OEL A;  5JEI A;  4R9F A;  4TOZ A;  2HCA A;  2Q74 A;  4H1X A;  1SQY A;  1B6H A;  4KYS A;  3W15 C;  3N26 A;  4H0W A;  1AL3 A;  2FA7 A;  5I56 B;  4RY1 A;  1QUI A;  3FAT A;  4HW8 A;  3V5A A;  3C32 A;  3SZP A;  3VE1 B;  5I58 B;  2PT2 A;  3PD9 A;  2AL4 A;  4NF6 A;  3OO6 A;  4YAH X;  1B40 A;  4LVQ A;  4IO5 A;  4NHB A;  1PB9 A;  4GWY A;  3HV1 A;  1Y3N A;  3RQT A;  4GWZ A;  4I1D A;  4IGT A;  4X04 A;  4F3S A;  3IR1 A;  1A8F A;  4NF4 B;  4NN3 A;  1RYX A;  2QVV A;  1B7Z A;  4U22 A;  3C33 A;  3KGC A;  4PFW A;  4MJO A;  1JW4 A;  3AXF A;  4DZ1 A;  3C34 A;  1FQC A;  4PAF A;  5ET5 A;  2I3W A;  4R75 A;  3VXC A;  5BUU A;  4KYE A;  3UN6 A;  1T0K A;  2R8T A;  3WAF A;  4I3E A;  5CMM A;  4C1U A;  5I56 A;  5J16 A;  5TP9 A;  5I58 A;  2B4M A;  1QKA A;  3U1O A;  4KPT A;  3PTY A;  2VGQ A;  2P0S A;  5H8Q B;  4GXA A;  2F34 A;  3H7M A;  3FGS A;  1MQG A;  4ECF A;  1SW5 A;  4Q5T A;  1LFI A;  1XHY A;  2XXQ A;  3TTL A;  3A3U A;  1GTK A;  2Y7P A;  5L9O A;  2QFL A;  3FZV A;  5LOM A;  1Y20 A;  3R6U A;  3MVW A;  5ET6 A;  4R9G A;  4NF4 A;  3EKI A;  5K2X A;  2RCB A;  2DS9 A;  1P1U A;  2H4I A;  4F2Q A;  2HEU A;  1M5C A;  3TDJ A;  2DE4 A;  1YZ0 A;  4WKM A;  4MBP A;  3KC1 A;  4YKK A;  1NNP A;  2DE2 A;  1NV3 A;  1NV1 A;  4OYV A;  2HZK A;  4R72 A;  3PPQ A;  4XKQ A;  5DVF A;  3FXR A;  5EQ8 A;  4HE1 A;  4MX6 A;  2PMS A;  2OZZ A;  3FD3 A;  4H6D A;  3I3V A;  3FAS A;  4U23 A;  2VPO A;  1FPG A;  1G0I A;  4WXJ A;  1HSL A;  1PBP A;  1B58 A;  2PX1 A;  3IO6 A;  1DOT A;  4BDL A;  4OZ9 A;  1ZIU A;  2UVJ A;  3RY3 A;  4OQO A;  1GV8 A;  5H8Q A;  1SYI A;  3N94 A;  4R2B A;  3T1B A;  3CR9 A;  1IME A;  2FYI A;  3IX1 A;  3TCG A;  4OFJ A;  1TFA A;  2DSF A;  1B1H A;  3HFU A;  3T9H B;  2UVH A;  4N07 A;  4ZEC A;  3VV5 A;  3LR1 A;  5EHS A;  3IK6 B;  1SBP A;  4F2O A;  1R1N A;  4F31 B;  4H8J A;  3QK6 A;  1JVY A;  4GRK A;  4GL0 A;  1QGX A;  3W9V A;  4MFI A;  4LON B;  5I3S A;  1IIW A;  5ISU A;  3SKP A;  1WOD A;  3GBB A;  4XXU A;  3VDF A;  4G77 A;  1B9J A;  1N3W A;  1O64 A;  1FBC A;  3UA8 A;  2ZZW A;  1B05 A;  2O69 A;  3QUF A;  2Q89 A;  1B7U A;  4PGN A;  3K4U A;  1G0H A;  4U1Z A;  2ZNS A;  2ZZX A;  2RKM A;  2OWT A;  1MPC A;  5IAI A;  4ZEK A;  1FW0 A;  2H25 A;  1NNK A;  3NOH A;  2WBB A;  1MH3 A;  4X1D A;  1S7Y A;  4EQ9 A;  1B0H A;  5IZ3 B;  1NH8 A;  4G68 C;  5CM6 A;  2I58 A;  1LBC A;  5ICQ A;  3IB1 A;  3E9X A;  2Y84 A;  3KN8 A;  2G93 A;  5B7D A;  2HQ0 A;  1NV7 A;  4AB5 A;  3EHU A;  4RPN A;  2DWJ A;  4OEU A;  2THI A;  2V3Q A;  3RPL B;  3T0J A;  2XX9 A;  3KN3 A;  3HHG A;  3TEP A;  4YKI A;  3D4G A;  2P1S A;  3VXB A;  4EF1 A;  3MBP A;  2ALU A;  5A5X A;  3USD A;  1MG1 A;  4KQP A;  2F97 A;  2YJP A;  3E78 A;  3K6U A;  2HXR A;  2R71 A;  2X7Q A;  1FCK A;  2D5W A;  3IFC A;  3T22 A;  4DI4 B;  1YTV A;  1LBV A;  2DP8 A;  4LAT A;  4IR8 A;  3QSL A;  2UVG A;  3TTN A;  2JJK A;  3FVN A;  3RYD A;  4JVC A;  4NQ8 A;  1NKX A;  3VVE A;  3PPN A;  3OXN A;  4PGP A;  2DWA A;  4X48 A;  4U2R A;  4X8R A;  4GD5 A;  4P47 A;  1LBB A;  1PDA A;  3C31 A;  4IO7 A;  5IZ3 A;  4N17 A;  1FPL A;  2XWI A;  1P1N A;  2WYP A;  2HXW A;  2HPG A;  4KCC A;  3GBA A;  3K1M A;  2UXA A;  3PPO A;  1I6A A;  1AMF A;  2O7U A;  5F1Q A;  5I2N A;  3ONM A;  1QUL A;  4EXK A;  3G3H A;  3MQ9 A;  4AQ4 A;  3RPL A;  2FNC A;  2O6A A;  1MM6 A;  5K2Y A;  3OEM A;  2RC7 A;  4OES A; 
#chains in the Genus database with same CATH homology
 2PFZ A;  4OVP A;  3LUZ A;  1VDW A;  2Y5L A;  4O8M A;  4N6D A;  2XWK A;  4F19 A;  1IMF A;  4GWX A;  2PCR A;  4P3L A;  2PFY A;  4XF5 A;  2B4L A;  1NV5 A;  1DCU A;  3U65 A;  2OWZ A;  5DW8 A;  4F1U A;  1NUX A;  1NV2 A;  4HCW A;  2GQ1 A;  2F5X A;  3W9W A;  1FBF A;  4PDD A;  5EQ9 A;  2P3N A;  5LDZ A;  4N6K A;  4G61 A;  4O7I A;  3CHG A;  4DI3 D;  4YZZ A;  4GWU A;  4I3Y A;  2CZI A;  3KC0 A;  1K9Z A;  5J1D A;  4N4U A;  2Q74 A;  2KQZ A;  2WEF A;  1LBY A;  1FBG A;  2P3V A;  4HE0 A;  3A29 A;  4N8Y A;  1NV6 A;  2QVU A;  4N81 A;  2Q9T A;  4OVS A;  5EYH A;  3SZP A;  2WBD A;  4AS5 A;  4GX4 A;  1LBZ A;  4NHB A;  5FBP A;  4PC9 A;  4MCO A;  4GWY A;  4GX3 A;  4GWZ A;  4N8G A;  4X04 A;  1BK4 A;  2XXK A;  1FTA A;  4NN3 A;  4P1E A;  1KA0 A;  2QVV A;  2QPQ A;  1FBP A;  4XEQ A;  1EYJ A;  4O7M A;  4MJO A;  2CEX A;  2FIX A;  4HE2 A;  4GX6 A;  4H45 A;  4F18 A;  4PAF A;  3ROJ A;  4X9T A;  3BIH A;  4NG7 A;  5ET5 A;  4NAP A;  2HZL A;  4MIJ A;  4QBA A;  3E79 A;  4MNC A;  2R8T A;  1NUY A;  2ZZV A;  4PET A;  4P8B A;  5ET8 A;  2FVZ A;  4I3E A;  4MEV A;  2QVR A;  2XA5 A;  4YIC A;  5IZZ A;  5J16 A;  1DBZ A;  1FRP A;  2B4M A;  4PBQ A;  2VT5 A;  5LTC A;  2VPN A;  1IMD A;  3PTY A;  4MNI A;  4P1L A;  2QFL A;  1K9Y A;  1NV4 A;  5A5L A;  4GWS A;  5ET6 A;  1FPF A;  3EKI A;  3LV0 A;  1IMA A;  2L5V A;  2DE4 A;  1YZ0 A;  1EYK A;  1IMB A;  4OVQ A;  2BJI A;  3KC1 A;  3IFA A;  4I40 A;  2DE2 A;  2CZK A;  1NV3 A;  1NV1 A;  1CNQ A;  2HZK A;  1Q9D A;  4H46 A;  5EQ8 A;  2Y5K A;  4OVR A;  4HE1 A;  1KA1 A;  3QMF A;  1XI6 A;  1NV0 A;  4MX6 A;  2DE3 A;  1FPB A;  1EYI A;  4F1V A;  4HCY A;  1AWB A;  1FPG A;  1G0I A;  2VPO A;  4NGU A;  4PF6 A;  3B8B A;  4PAK A;  5IZ1 A;  4GWW A;  3T1B A;  1IME A;  5EQ7 A;  2CEY A;  3HFU A;  1LBX A;  3MYU A;  2CZH A;  3MST A;  2WX9 A;  4MMP A;  2MKZ A;  2DVZ A;  5IGA A;  1QGX A;  4PDH A;  3W9V A;  1RDY A;  5I3S A;  4GBV A;  3GYY A;  4PBH A;  2F3D A;  3ISP A;  1FPE A;  1FBC A;  2ZZW A;  1DK4 A;  4OVT A;  1FPI A;  4PGN A;  2F3B A;  1G0H A;  2ZZX A;  5EYG A;  5I7I A;  1SPI A;  3FBP A;  3NOH A;  1FPD A;  2WBB A;  1FSA A;  3B50 A;  5IZ3 B;  5CM6 A;  1IMC A;  1LEV A;  1INP A;  4M1V A;  4QXD A;  2FHY A;  1FJ6 A;  2HHM A;  1NV7 A;  4PE3 A;  4N91 A;  1NI9 A;  3D1R A;  4XFE A;  2V3Q A;  1FBD A;  4PFB A;  3RPL B;  4LN5 A;  4GBW A;  3T0J A;  1FPK A;  2FIE A;  4FBP A;  4MHF A;  5IM2 A;  4JVD A;  1D9Q A;  4UAB A;  4PF8 A;  4JVI A;  1NUZ A;  5T3J A;  1FJ9 A;  5I5P A;  4MNP A;  3E78 A;  2HXR A;  4PFI A;  4HXV A;  5EQA A;  1NUW A;  3IFC A;  4DI4 B;  4PCD A;  1FBH A;  1FBE A;  2Q8M A;  1LBV A;  1FPJ A;  2OX3 A;  1YXI A;  4IR8 A;  3BIG A;  4N15 A;  4OAN A;  2JJK A;  3RYD A;  4JVC A;  4NQ8 A;  4O94 A;  1RDZ A;  2DDK A;  5ESY A;  4PGP A;  2WYK A;  4KXP A;  2V4C A;  4X8R A;  5F24 A;  4PFR A;  4P47 A;  4P56 A;  5IZ3 A;  2KR0 A;  4N17 A;  1FPL A;  5JK4 A;  2XWI A;  4MAG A;  4NF0 A;  1RDX A;  2WYP A;  2HPG A;  4AS4 A;  4OA4 A;  3FXB A;  2XWV A;  2XWO A;  3RPL A;  1JP4 A;  1YYZ A;  1LBW A;  4P9K A;  4PAI A;  4PTK A;  5ET7 A;  3KBZ A;  4NX1 A;  1KZ8 A;  2FBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...