2JJKA

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate -1- phosphohydrolase) (e.c.3.1.3.11) complexed with a dual binding amp site inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Fbpase Inhibitors Gain 10(5) Times in Potency When Simultaneously Binding Two Neighboring AMP Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
total genus 101
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2jjkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2jjkA02
1LBVA 3KBZA 3FBPA 1FBCA 2FHYA 1G0IA 2PCRA 1BK4A 3IFCA 4IR8A 4GX4A 1NV5A 4MJOA 3RPLB 4I3YA 5IZ3A 2VT5A 4N81A 3KC0A 1NUZA 2WBBA 3KC1A 2QVRA 2R8TA 3A29A 1KA1A 3RYDA 1YZ0A 3LV0A 1KZ8A 1DCUA 4I3EA 1VDWA 2Y5KA 1IMBA 2QVVA 5FBPA 2FIEA 2P3NA 2QVUA 1NUYA 1NI9A 4GWYA 4H46A 1LBZA 2CZKA 2Q74A 5J16A 1FBHA 4HXVA 1QGXA 1NV6A 1FPFA 1FRPA 1KA0A 1LBXA 1IMFA 5EQAA 1AWBA 3RPLA 1NV2A 2CZHA 2HHMA 1EYKA 2GQ1A 1K9ZA 1FBFA 1NUWA 2FBPA 4GWZA 1IMDA 5ET7A 5LDZA 4O7IA 1FPIA 1Q9DA 5IZ3B 4QXDA 5EQ8A 5EYGA 1FBPA 4GBWA 1FPGA 2CZIA 5EQ7A 3D1RA 5EYHA 1FPJA 1EYJA 2FVZA 4GX6A 1FTAA 1RDZA 1IMAA 5ESYA 1NV4A 4GBVA 1FSAA 1FJ6A 4GX3A 1G0HA 1FPKA 1D9QA 1EYIA 4FBPA 1NV7A 5T3JA 5IZ1A 5A5LA 1NV1A 1IMCA 4GWWA 1NV0A 4AS4A 4KXPA 1YYZA 5ET5A 1LBWA 3BIHA 5EQ9A 1FPBA 2OX3A 1FBEA 2WEFA 2P3VA 3BIGA 4GWXA 4HE2A 5ET6A 3LUZA 4GWUA 3ROJA 5F24A 1DBZA 4PTKA 1LEVA 1NV3A 1YXIA 1K9YA 2BJIA 5DW8A 3IFAA 1IMEA 1RDXA 2F3BA 5ET8A 1FPLA 4G61A 1FBGA 2OWZA 2QFLA 4GWSA 1FJ9A 1FPEA 3B8BA 1INPA 5I3SA 2WBDA 4H45A 4HE0A 1FPDA 1SPIA 1JP4A 1NUXA 1XI6A 1RDYA 1LBYA 4HE1A 4I40A 3T0JA 1DK4A 2DDKA 1FBDA 2Q8MA 4AS5A 2Y5LA 2JJKA 3QMFA 2FIXA 2F3DA 1CNQA
chains in the Genus database with same CATH superfamily
4IO2A 1FBCA 3GBBA 3F11A 1N0TA 3IOUA 4EF2A 2D5WA 1ZBMA 3TMGA 1DTZA 3A3CA 1ZMGA 4U4SA 1ATGA 2QL3A 5H8HA 1UQWA 4OERA 2FA7A 2VPNA 3C34A 4BDMA 1FRPA 3MPKA 4N07A 4L17A 4AQ4A 2DWJA 4PDDA 4PFBA 2DOJA 3JYRA 4ZEDA 1NH7A 5K2YA 1H3DA 5I58B 1FTAA 4N8YA 4GVOA 4F1UA 4GXSB 2QS3A 1N7WA 2ZZVA 3O9PA 2QSXA 1Y3PA 5L9MA 4F1VA 1B3EA 4GWWA 1NV0A 1N84A 1YYZA 3M3FA 3CSBA 4Z7EA 3VXBA 2R9JA 3S9NC 2XHDA 3V83A 1ZLQA 2OPEA 2VGQA 1IIWA 2XWKA 2Z8DA 3JZJA 4OZ9A 1FBGA 3OO7A 1FPEA 4THIA 3RPWA 3ZKKA 2PBWA 1NMUA 2RC9A 4RJZA 1Y1MA 4PBHA 1YPNA 3EN3A 3KN7A 4X48A 4AS5A 3RGYA 3QMFA 1I69A 1SI1A 2XXPA 3GYYA 1P1WA 4LATA 1PB7A 3SESA 5B70A 2PCRA 3T22A 4OESA 1UTBA 1NH8A 2GHBA 4I1DA 1I6AA 2VT5A 4OQOA 3KC0A 1UIVA 3QUFA 1LAHE 2HXWA 4HCWA 3A29A 3O6GA 3IR1A 3RTWB 1KZ8A 1LCTA 2Z23A 3DP8A 1S50A 4JXIA 3ZS6A 4GWYA 2KR0A 2I3VA 2ZNSA 1M5DA 1US4A 2CZHA 3DP4A 1EYKA 3PD8A 2CMOA 3FUZA 3MJNA 3KSXA 4PETA 3W9WA 3D1RA 5ELVA 1MH3A 1NNTA 2REGA 3HO7A 5CMMA 2B65A 4GX3A 4GFRA 3FD3A 5A5XA 1IMCA 3TFLA 2ZXTA 3RTFB 3TTKA 3UN6A 2KLFA 3H4ZA 1NNKA 4ZEIA 4OFOA 3H6VA 3E13X 3LSFB 1IMEA 1B40A 2GRVA 3K02A 4RNSA 3B8BA 3CR9A 3RY3A 4U1ZA 3R7XA 1FPDA 2Y84A 1JP4A 4BDLA 5AA4A 3B7DA 3EPEA 1DK4A 1MG1A 3FXUA 3OEMA 4OFLA 4PE3A 3IFCA 5J1DA 4BDOA 3RPLB 4E0WA 5I2KA 3K2DA 5I56A 1JVXA 4OWDA 2FNCA 1KA1A 1MXYA 2QVUA 1NUYA 3EHSA 4ZS9A 2UVGA 5J16A 5L8DA 3TCFA 4KYSA 1IZ1A 2O6AA 3SEUA 4X1BA 4N8GA 4OVPA 1YAEA 4GWZA 3ILUB 4POWA 2QS2A 2OZZA 3FVNA 1FPGA 2DWIA 2F8DA 4R6HA 4GX6A 4G4PA 4OYVA 4IO4A 4H65A 3FVKA 1R9QA 4N6DA 4QSDA 2ZNUA 3L6HA 3CSGA 2ONRA 3C36A 3K00A 3PMXA 3QK6A 1FTKA 3BIHA 4X04A 1MQDA 4PFTA 1XOCA 4PP0A 2RINA 4XEQA 5DVFA 3DELB 2OLBA 3H06B 1XC1A 4JBZA 2F7BA 1MDQA 4AB6A 1N7XA 5I3SA 2PMSA 2OBGA 4QSCA 4RK9A 3QUJA 4F22A 1MY3A 2UYFA 3T0JA 1A7LA 3E3KA 1MXUA 2Y5LA 1LAFE 4R6YA 4P1LA 4OMBA 3TTRA 1A99A 2V3UA 2XXRA 4IR8A 4C1TA 1NV5A 4E0XA 3KSJA 3PPQA 4NF4A 1SDXA 1YTVA 1MXWA 2E1SA 4GRKA 4H67A 2I49A 4DLDA 2GHAA 5DEXA 3TQLA 4MX6A 4NF6A 1FPIA 4OEVA 5H8QB 3P7IA 3G3GA 1BTJA 2X26A 2Q88A 4LP2B 1GGGA 3LUYA 4P11A 2Z8FA 3KJ7A 4PF6A 1Y9UA 3DLNA 3PPOA 2P0SA 1PBPA 5IZ1A 1NV1A 5CRYA 3FJMA 3N26A 4AS4A 4X1DA 5ET5A 4QFKA 1B7UA 4NG7A 4GQOA 2PT2A 2P3VA 4KCDA 4JSDA 4GWXA 4NQ8A 4HE2A 3QIMA 4R9FA 3N5LA 5CBRA 5H8NA 4MNPA 4GL0A 4GWSA 4I62A 4NE4A 4DXCA 1RYXA 3E9XA 4N17A 5FTHA 3VV5A 2B4LA 3MWBA 4BDRA 4QSEA 3FXRA 4OANA 2PYYA 4GLIA 1H45A 3KBZA 5HBCA 1URSA 1S9TA 1B4HA 1MXZA 4F3GA 1IEJA 1NUZA 1UIUA 2IA4A 3FJGA 4RK2A 1WVJA 3LR1A 2P3NA 1NI9A 1XVYA 5CC2A 3I6VA 4R73A 1M5FA 1FBHA 2F78A 3CI8A 3SEYA 3W15C 1NV2A 4MBPA 3S9LC 4OETA 5TP9B 2V4CA 3N6TA 3PU5A 2W7YA 4OHNA 1FTMA 3G3KA 2CZIA 3PUYE 1B3LA 3RN8A 5EYHA 4C0RA 1VE4A 3FVGA 1NL5A 3C9HA 1EYIA 3BBRA 1B1XA 2G93A 4IGTA 3TDJA 1VR5A 4WXJA 4GIZA 2H9BA 1PB9A 1FTOA 2XX9A 2I6EA 4FIMA 3K6WA 4G68C 4HTGA 3RNNA 2ALUA 3PUZE 2DS9A 5I59A 1AOVA 3B50A 4X8RA 3VDFA 4ZECA 4ZEKA 2REJA 4DI3D 2O84X 3TUSA 4G61A 2OWZA 1INPA 1PEBA 1EZ9A 3CFLA 4H45A 3N6UA 3EKIA 4JDFA 4UABA 1QUIA 2PFZA 1M5CA 1AIVA 1FBDA 3O6IA 2JJKA 3MZ9A 1SW1A 3MP8A 1I6BA 1A54A 3VE1B 4PQJA 1FQAA 3KEIA 4FE8A 2V84A 3ONMA 4ZZEA 1EZPA 3LV0A 1NNFA 1A8EA 1AL3A 4K3FA 5ISUA 3L6GA 2V3TA 2LAOA 1URDA 1JW4A 5M2VA 1B58A 4OVTA 1SYIA 5KDTB 1OVBA 2P2AA 3RPLA 4JB7A 4ZZAA 1AH5A 5LOMA 5FTIA 2R71A 3OELA 2RKMA 4JWOA 5K2XA 3QYTA 5ICTA 1XVXA 4MMPA 3OSQA 4IB2A 4MCOA 1FSAA 4H5FA 2Q2AA 3QAXA 2QMXA 1DPPA 1LAGE 4U2RA 3GZGA 1B3FA 5H8FB 1D4NA 2OWTA 5I2KB 1Z7ME 4JWYA 1BP5A 1TFAA 3MC2A 3PMWA 4XTCQ 3C4MA 3O29A 1H43A 1MPCA 3UGWA 5TP9A 1NV3A 1K9YA 4NMYA 4JVIA 1RDXA 1USYH 3H6UA 2QFLA 4ZDMA 2P1SA 2DP8A 3HFUA 3K1PA 2XXKA 4WEPA 4P8BA 2WBDA 4P1EA 4PGPA 2DVZA 5FHMA 3B6TA 1XI6A 1XS5A 3SKPA 2RC7A 1LSTA 3VLVA 2RC8A 4MLVA 2ONSA 3ILTB 5DT6A 1EU8A 3IK6B 1PDAA 3K1MA 3E4RA 2R8TA 1DMBA 3UIFA 1YZ0A 2AL4A 1IMBA 2YLNA 3IAZA 1B5IA 4KD5A 1HSEA 2CZKA 1QGXA 2DVCA 4C1UA 1KA0A 3T9VA 1AWBA 1VFDA 1Y3NA 1O7TA 1IXGA 1OVTA 3KN8A 4YKKA 5AE4A 3H7MA 1LCFA 4OVRA 3U94A 4PFWA 5ESYA 2DE3A 3IOVA 2THIA 3MZBA 5H8SA 1OLCA 3CFXA 3WAFA 2F7AA 2OK2A 3ISPA 5A5LA 4O3CA 5I59B 3IO4A 5JTYA 5IAIA 3TZAA 1N04A 3S4UA 1FPBA 4O3AA 3SDFA 3TCHA 2XXHA 1EZOA 5DEXB 2NOOA 3EF7A 2O68A 1F9BA 3LBSA 2F36A 4QFNA 1MRPA 4YMBA 1UTHA 2I0BA 3GLBA 5TPAA 5IZZA 3K6UA 1SPIA 3U1OA 2I3WA 3Q27A 4KQPA 2BJJX 4H6DA 1URGA 3FZVA 3U93A 3FATA 2PX1A 3GBAA 2FYIA 4FEBA 4IO5A 2QS1A 1MPBA 3MYUA 1POY1 3IO6A 2O1MA 2QVRA 2RCBA 4ZEFA 2ZMBA 3KGCA 4FATA 1UTHB 1LGBC 4N6KA 4LONB 1US5A 1P1NA 3MVWA 2NWJA 5EHSA 3OD7A 3FASA 3DM0A 3OO9A 4QXDA 1O63A 5ITOA 3O2AA 3VLWA 1Y4CA 3KBRA 2NVUB 5AA3A 2HCAA 2XXWA 2UVIA 1B2HA 3C33A 1FW0A 1ZU0A 2WYPA 2A5SA 3C31A 4YU0A 3UA8A 3RUMA 2WEFA 4TLMB 3K01A 4G8HA 4Q30B 4KR5A 1MQIA 1H76A 4O94A 1VSOA 3O66A 3M3LA 3E78A 2OWSA 1ZTYA 1SVXB 5F7VA 1TT1A 1B0LA 4FORA 1UTBB 1YCJA 3Q28A 4YKJA 1LBYA 4OVJA 4ECFA 2DDKA 1R6ZA 1LFGA 3VVEA 2F3DA 3U92A 4YZZA 4KYEA 1G0IA 3PPNA 4TLLB 4H0WA 4NF5B 2A5TA 4OXVA 2VD2A 3G3IA 5AA4B 2GH9A 2H25A 1XT8A 5BWJA 3FIRA 3OOAA 3DP6A 1DCUA 4I9DA 2X7PA 2HQ0A 2NUVA 4H46A 3T9UA 1MH4A 2HFBA 2ZYMA 1T0KA 4XKQA 1JVYA 2HZLA 4PFRA 3QSLA 1Z7NE 4ELOA 2Y7RA 3ZSFA 4IO7A 4DXUA 2B3BA 3OSRA 2VP1A 4LZ5A 5I5PA 2VHAA 5EYGA 3EHUA 4NN3A 4KI0E 1BKAA 3USDA 3HCQA 2XXYA 1FPJA 4PF8A 3LSXA 4O7MA 3O97A 2H99A 5L9OA 4GBVA 3T9HB 4F3PA 1O64A 2Z22A 2XXQA 1OIBA 3CFZA 3GXAA 1PB8A 4GD5A 1PC3A 4MF3A 2HZKA 3EHTA 5ITPA 5DVJA 2AL5A 4OTEA 5ICQA 5H8NB 4P56A 1MY0A 3A09A 3CIJA 3MBPA 3O28A 5I2NB 2M8CA 5TU0A 2E0SA 3TODA 4DIGA 4DZ1A 1D3KA 3TTMA 4P47A 3IB0A 1B32A 2MKZA 4GWOA 4G8MA 1ELJA 3U65A 1JQFA 3FXQA 2ZNTA 5I2NA 4I40A 4LZ8A 3D4CA 2Z8EA 4P3LA 3KZGA 2ZYKA 2H5YA 4U23A 4MH5A 1QKAA 4OA4A 1SQYA 1BK4A 2RCAA 4PAKA 4DCXA 4QFPA 3TCGA 4AB5A 1USYE 4KYDA 4NF6B 1FQFA 1H44A 2CZLA 4I3EA 2UVHA 1QJMA 3T9XB 4NWCA 1LBZA 1B3HA 3KFMA 4PAIA 4HXVA 4EQBA 4PE5B 4OFJA 2XWOA 3OEKA 4HCYA 1OQGA 4G77A 1FCKA 4KPTA 2I48A 5ET7A 2UVJA 4MNCA 4ZEBA 4ZE9A 3U8QA 1M5EA 5FHOA 3UORA 4RYAA 3E79A 3H6WA 5EYFA 1MXXA 1NV7A 2Y7KA 2B3FA 4NF0A 1B46A 4YKPA 2A5TB 1QUKA 4GF8A 1GTKA 4LQ2A 4FEDA 1LBWA 3IL1B 1QW0A 3CG1A 5I57B 3UP9A 4YB7A 1FQBA 4F1YA 1FTLA 1LB8A 3M8UA 3TYHA 4F31B 3IJOB 5F1QA 4H8IA 3FGSA 5ET8A 3H6TA 4N4UA 4N91A 4MNIA 2F5XA 1IXHA 2XXTA 1IXCA 1VFEA 4BLAA 2O7UA 4P9KA 1ANFA 2Q8MA 4NTLA 2XWVA 1IXIA 1MM7A 1BLFA 1LBVA 2V25A 3MUQA 1HSJA 4I3YA 5FHNA 2ZYOA 2WBBA 1SW2A 3IOTA 4LUBA 1SI0A 2D21A 3OENA 2FIEA 4MHFA 5HPQA 2I4BA 1KWHA 3V89B 4HS7A 2Q74A 1FPFA 2Y7PA 1LBCA 5EQAA 4R9GA 4EQ7A 3HPIA 3TAJA 5AA2A 1B51A 3HV1A 3LSLA 1TWYA 3KOTA 2FBPA 1MQHA 3MW0A 4EF1A 4ZE8A 2ANJA 3TTLA 4U1OA 4GBWA 5CBSA 4JVDA 2G29A 2VOZA 1EYJA 4RY1A 4ONYA 1MY2A 3HHFA 1G0HA 5H8FA 3BKIB 3VFJA 5KCJB 4F18A 1MY4A 5AA1A 4R72A 4ELQA 2YPNA 1S7YA 3T1BA 1QVSA 4NHBA 3PTYA 4BDQA 5JK4A 1SW4A 1EH3A 1LEVA 5I84A 1B9JA 4NWDA 2BJIA 5DW8A 2HAUA 2O51A 3W9VA 4N15A 4XXUA 4G68B 4I8CA 3R6UA 1FJ9A 1J1NA 1B5JA 3WAEA 4MFIA 4NX1A 1NUXA 3QXMA 2HEUA 1MY1A 2I4CA 4DCYA 5IGAA 2F35A 3IOWA 3A3UA 2QPQA 4RXLA 4G8NA 1M5BA 1JEUA 2DXYA 3FBPA 3PUXE 2PVUA 2HAVA 4MJOA 1SW5A 1I6QA 4F2QA 4UACA 3B6QA 4KFQA 4JWXA 5H8HB 1VDWA 5I57A 2XXVA 2ZYNA 3Q26A 1SYHA 4IY6A 2ONKE 4EUOA 1CE2A 4X9TA 1GR2A 1QKBA 2KQZA 1TFDA 1B7ZA 1MXVA 1A55A 1NKXA 1LBBA 4PFYA 3TEPA 2F7CA 2Y7IA 5AA2D 4PDHA 4NEDA 2H4IA 1MM6A 2XX7A 3FV2A 3ODBA 1RDZA 3TKDA 2V3QA 2NXOA 4FBPA 5DTBA 3VXCA 2XXXA 4LVQA 2DYXA 2F6PA 5KZTA 1A8FA 3KJTA 2OCUA 1ZIUA 1PBQA 4FECA 3ZKLA 3MAMA 5DYHA 5EQ9A 2OX3A 5L9SA 4GOTA 1P99A 3OO8A 3S2VA 5CM6A 2XD3A 2DE4A 4Q0CA 1Q1KA 4OVSA 2RF1A 3TTNA 2ZZWA 2PFYA 4POXA 3LSWA 4F3BA 2IEEA 2XX8A 4GXAA 3C35A 1B1HA 5HM4B 4HE1A 4R6KA 5I56B 4DI4B 1DOTA 1B0HA 3G3FA 4JVCA 4RPNA 1XHYA 2YJPA 4IO6A 4QFOA 4XIGQ 2WX9A 2VD3A 3T96B 3PPPA 4QF9A 1LFHA 1MS7A 3FJ7A 4ELRA 2Y5KA 3HHGA 3M3KA 3SZPA 2Q8JA 5CI5A 1B3GA 3K1NA 2DSFA 4U21A 1OMPA 1GVCA 1NV6A 4XKPA 1LBXA 4M1VA 4ELPA 3SETA 2DE2A 4LN5A 2F34A 3H3GA 3MP6A 3OXNA 4NGUA 4IGRA 3BFTA 4OEUA 1N3WA 4OENA 3FVOA 2WKYA 5B7DA 3FV1A 1R1NA 3PD9A 2ZZXA 1FPKA 4EXLA 4YMAA 4G68A 3S9MC 2Q2CA 2Y7WA 4FAJA 1IUDA 1AMFA 3HSTA 3MSTA 4GWUA 4KHZE 4RA1A 3IFAA 3MVZA 2F3BA 4JSOA 4H1XA 5CMBA 3SERA 1Y1ZA 1P1OA 4R2FA 3UK4A 4HE0A 1CB6A 4F29A 3S9EA 4TOZA 2OPDA 1FQDA 4P0GA 2XA5A 3PUWE 3SEWA 1A40A 3MVXA 5H8QA 3PV0E 5IZ3A 3KG2A 5JTYB 2ABHA 2R6GE 3KC1A 1IITA 3T66A 1MPDA 1MQGA 3IB2A 1Y4TA 3C32A 4O8MA 3MPLA 1P1UA 4H8JA 4YAHX 4O3BA 4U22A 4IY5A 2XXIA 1N3XA 1IMFA 4ESWA 3CRBA 1FTJA 1II5A 4NF4B 3PPRA 1DPEA 1K9ZA 2XWIA 3IB1A 4LQ5A 1Q9DA 1D9YA 4LZ7A 5AA2B 5EQ7A 4R2BA 4OVQA 3RLFE 2FVZA 4PGNA 3Q29A 1IMAA 2O69A 4QRZA 1QULA 2Q89A 1LLSA 4H5GA 3SEXA 5CMCA 1JW1A 5I58A 4M4GA 1LAXA 2QJEA 4EXKA 5JEIA 4PFIA 3EQ1A 4QBAA 5IM2A 4EQ9A 4GL8A 4P0IA 2HXRA 3BIGA 5ET6A 1L5TA 3VLUA 5F24A 5CMKA 3PMVA 4YICA 1YXIA 1B5HA 4Q5TA 2Q9TA 3N94A 2CEYA 4PAFA 2B4MA 3TQWA 1P1QA 2H98A 1FQEA 5I7IA 5LTCA 3D4GA 3KN3A 3CG3A 2I58A 2UXAA 3VVDA 3K4UA 3IORA 2FIXA 4U4XA 3MZ1A 1IQ7A 2I0CA 2HPGA 5TPAB 4NF8A 1OQHA 1JW5A 4XF5A 4R74A 4YKIA 4IO3A 3Q25A 5BUUA 3O6HA 2QVVA 3OMBA 1B52A 3KOSA 3B6WA 4QHQA 1SBPA 1B05A 3PGFA 3I3VA 1NUWA 1WODA 3G7WA 1LFIA 4F3SA 4O7IA 3NOHA 1NFTA 5EQ8A 1QUJA 3IJXB 4NF8B 1B7HA 2V93A 5EHMA 3U72A 5KDTA 4YB5A 4N13A 3RT8A 1NV4A 3BFUA 4ISUA 4QFLA 3TELA 5DVIA 4UA8A 4EDPA 3MQ9A 2O1LA 4KXPA 2XD2A 2QRYA 4PFUA 1SD3A 2PT1A 3I5OA 2CEXA 1FBEA 4MEVA 3LUZA 3ROJA 1DBZA 4PTKA 1MQJA 2O7IA 4XKRA 3CHGA 4TQUQ 2WYKA 3IX1A 2GFEA 1B4ZA 2D3IA 3R26A 5IKBA 2OJTA 3K6XA 1Y3QA 1DTGA 1ZKBA 3ECRA 4DE8A 2XXUA 1FQCA 5A5XB 1NNPA 4YB6A 1Y20A 3V8XB 1GV8A 4R75A 1LB9A 1ZJLA 3HN0A 1FBPA 1POTA 1B6HA 1CNQA 2F97A 1D9VA 4XKNA 2AIXA 2FHYA 4MLQA 4GX4A 4WKMA 4N81A 2VPOA 4LA9A 3VVFA 3RYDA 1JETA 3G3JA 4NAPA 3MVYA 2DWHA 5FBPA 1TXFA 1OLAA 4XFEA 4PCDA 1RYOA 4Z0IA 3LC8A 4DXBA 1JEVA 2HHMA 2GQ1A 2AYSA 1FBFA 1IMDA 5LDZA 4DDDA 1MDP1 5IZ3B 3CVGA 4ESXA 4KCCA 2DWAA 4WEDA 3SEVA 4BDNA 4F2OA 3FXBA 1R9LA 4ND9A 4PC9A 4Q8RA 4RPOA 5KCJA 1FJ6A 1D9QA 3AXFA 1WDNA 4F39A 5T3JA 1JNFA 3RT6B 4F19A 4MAGA 4NF5A 3RQTA 3K6VA 4FJPA 4PBQA 3K0VA 1BIYA 3OO6A 3T93B 2ESNA 2DQVA 2QMWA 3JV9A 1HSLA 3PUVE 4HW8A 4G2ZA 3TPAA 1FPLA 2X7QA 2F6GA 3H03A 1RKMA 4MIJA 3THIA 1DSNA 1RDYA 2L5VA 2QS4A 3G3HA 2DXRA 3MP1A 1N76A 3V5AA 1Q35A 2UYEA 4N6PA
chains in the Genus database with same CATH topology
4OA4A 1LBVA 4PE3A 3KBZA 3FBPA 1FBCA 2FHYA 1G0IA 2PCRA 1BK4A 3IFCA 4IR8A 4GX4A 2HPGA 4JVCA 1NV5A 5J1DA 4MJOA 4PAKA 4XF5A 3RPLB 4I3YA 5IZ3A 2VT5A 2WX9A 4N81A 3MYUA 3KC0A 2VPOA 1NUZA 2WBBA 3KC1A 2QVRA 2R8TA 4HCWA 3A29A 1KA1A 3RYDA 1YZ0A 3LV0A 1KZ8A 1DCUA 4NAPA 4I3EA 1VDWA 2Y5KA 4O8MA 1IMBA 2QVVA 5FBPA 2FIEA 2P3NA 2QVUA 1NUYA 4MHFA 1NI9A 3SZPA 4GWYA 4H46A 2KR0A 1LBZA 2VPNA 4XFEA 4PAIA 2CZKA 2Q74A 5J16A 1FBHA 4HXVA 4PCDA 1QGXA 1NV6A 4OVTA 1FPFA 1FRPA 1KA0A 4N6KA 1LBXA 1IMFA 5EQAA 1AWBA 3RPLA 1NV2A 2HZLA 2XWOA 4M1VA 2CZHA 4MX6A 2HHMA 4PFRA 2DE2A 2V4CA 4HCYA 1EYKA 4N8GA 4LN5A 4OVPA 2GQ1A 1K9ZA 1FBFA 1NUWA 2FBPA 4GWZA 2KQZA 2XWIA 4X9TA 1IMDA 5ET7A 4MNCA 5I5PA 5LDZA 4NGUA 4O7IA 1FPIA 1Q9DA 5IZ3B 3NOHA 4QXDA 5EQ8A 5EYGA 4PETA 4PDDA 1FBPA 4PFBA 4GBWA 1FPGA 4JVDA 3W9WA 2CZIA 5EQ7A 4NN3A 4OVQA 4PDHA 3D1RA 4OVRA 5EYHA 1FPJA 4PF8A 1EYJA 4MMPA 2FVZA 3FXBA 4PGNA 4GX6A 4O7MA 4PC9A 1FTAA 1RDZA 1IMAA 5ESYA 4MCOA 4N8YA 1NV4A 3E79A 2ZZXA 2DE3A 4GBVA 1FSAA 1FJ6A 4GX3A 1G0HA 1FPKA 2V3QA 4P1LA 4PF6A 1D9QA 1EYIA 4FBPA 4F1UA 1NV7A 4F18A 4N6DA 5T3JA 5IZ1A 3ISPA 4NF0A 2ZZVA 5A5LA 1NV1A 4F1VA 4F19A 1IMCA 4MAGA 3T1BA 4GWWA 1NV0A 4AS4A 2WYPA 4KXPA 1YYZA 5ET5A 2HZKA 4PFIA 4QBAA 1LBWA 4NHBA 3PTYA 3BIHA 5EQ9A 5IM2A 1FPBA 2OX3A 2CEXA 4NG7A 1FBEA 2WEFA 4PBQA 4X04A 4P56A 2P3VA 2HXRA 3BIGA 4GWXA 4HE2A 5ET6A 3MSTA 4MEVA 3LUZA 4NQ8A 4GWUA 3ROJA 5F24A 1DBZA 4PTKA 2XWKA 5JK4A 1LEVA 4XEQA 3CHGA 1NV3A 1YXIA 1K9YA 4O94A 2DE4A 4YICA 2WYKA 5CM6A 2BJIA 5DW8A 3B50A 4OVSA 4X8RA 3W9VA 4N15A 3IFAA 4JVIA 3E78A 1IMEA 1RDXA 2Q9TA 2ZZWA 4DI3D 2F3BA 2CEYA 5ET8A 1FPLA 2PFYA 4N4UA 4G61A 1FBGA 4MNPA 4N91A 4MNIA 4P47A 4PAFA 2OWZA 2QFLA 2B4MA 4GWSA 1FJ9A 1FPEA 3B8BA 2XXKA 3HFUA 1INPA 2MKZA 4P8BA 5I3SA 2WBDA 4MIJA 4H45A 4HE0A 2F5XA 4P1EA 3U65A 1FPDA 3EKIA 5IZZA 4PGPA 4NX1A 1SPIA 1JP4A 2DVZA 1NUXA 4UABA 4PBHA 1XI6A 4N17A 1RDYA 1LBYA 4HE1A 2L5VA 4I40A 2PFZA 5IGAA 5I7IA 3T0JA 5LTCA 1DK4A 4P9KA 2DDKA 1FBDA 2B4LA 4DI4B 2Q8MA 4AS5A 2Y5LA 2JJKA 3QMFA 2XWVA 4P3LA 2XA5A 2FIXA 2QPQA 4OANA 3GYYA 2F3DA 4YZZA 1CNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBV A;  3KBZ A;  3FBP A;  1FBC A;  2FHY A;  1G0I A;  2PCR A;  1BK4 A;  3IFC A;  4IR8 A;  4GX4 A;  1NV5 A;  4MJO A;  3RPL B;  4I3Y A;  5IZ3 A;  2VT5 A;  4N81 A;  3KC0 A;  1NUZ A;  2WBB A;  3KC1 A;  2QVR A;  2R8T A;  3A29 A;  1KA1 A;  3RYD A;  1YZ0 A;  3LV0 A;  1KZ8 A;  1DCU A;  4I3E A;  1VDW A;  2Y5K A;  1IMB A;  2QVV A;  5FBP A;  2FIE A;  2P3N A;  2QVU A;  1NUY A;  1NI9 A;  4GWY A;  4H46 A;  1LBZ A;  2CZK A;  2Q74 A;  5J16 A;  1FBH A;  4HXV A;  1QGX A;  1NV6 A;  1FPF A;  1FRP A;  1KA0 A;  1LBX A;  1IMF A;  5EQA A;  1AWB A;  3RPL A;  1NV2 A;  2CZH A;  2HHM A;  1EYK A;  2GQ1 A;  1K9Z A;  1FBF A;  1NUW A;  2FBP A;  4GWZ A;  1IMD A;  5ET7 A;  5LDZ A;  4O7I A;  1FPI A;  1Q9D A;  5IZ3 B;  4QXD A;  5EQ8 A;  5EYG A;  1FBP A;  4GBW A;  1FPG A;  2CZI A;  5EQ7 A;  3D1R A;  5EYH A;  1FPJ A;  1EYJ A;  2FVZ A;  4GX6 A;  1FTA A;  1RDZ A;  1IMA A;  5ESY A;  1NV4 A;  4GBV A;  1FSA A;  1FJ6 A;  4GX3 A;  1G0H A;  1FPK A;  1D9Q A;  1EYI A;  4FBP A;  1NV7 A;  5T3J A;  5IZ1 A;  5A5L A;  1NV1 A;  1IMC A;  4GWW A;  1NV0 A;  4AS4 A;  4KXP A;  1YYZ A;  5ET5 A;  1LBW A;  3BIH A;  5EQ9 A;  1FPB A;  2OX3 A;  1FBE A;  2WEF A;  2P3V A;  3BIG A;  4GWX A;  4HE2 A;  5ET6 A;  3LUZ A;  4GWU A;  3ROJ A;  5F24 A;  1DBZ A;  4PTK A;  1LEV A;  1NV3 A;  1YXI A;  1K9Y A;  2BJI A;  5DW8 A;  3IFA A;  1IME A;  1RDX A;  2F3B A;  5ET8 A;  1FPL A;  4G61 A;  1FBG A;  2OWZ A;  2QFL A;  4GWS A;  1FJ9 A;  1FPE A;  3B8B A;  1INP A;  5I3S A;  2WBD A;  4H45 A;  4HE0 A;  1FPD A;  1SPI A;  1JP4 A;  1NUX A;  1XI6 A;  1RDY A;  1LBY A;  4HE1 A;  4I40 A;  3T0J A;  1DK4 A;  2DDK A;  1FBD A;  2Q8M A;  4AS5 A;  2Y5L A;  2JJK A;  3QMF A;  2FIX A;  2F3D A;  1CNQ A; 
#chains in the Genus database with same CATH topology
 4IO2 A;  1FBC A;  3GBB A;  3F11 A;  1N0T A;  3IOU A;  4EF2 A;  2D5W A;  1ZBM A;  3TMG A;  1DTZ A;  3A3C A;  1ZMG A;  4U4S A;  1ATG A;  2QL3 A;  5H8H A;  1UQW A;  4OER A;  2FA7 A;  2VPN A;  3C34 A;  4BDM A;  1FRP A;  3MPK A;  4N07 A;  4L17 A;  4AQ4 A;  2DWJ A;  4PDD A;  4PFB A;  2DOJ A;  3JYR A;  4ZED A;  1NH7 A;  5K2Y A;  1H3D A;  5I58 B;  1FTA A;  4N8Y A;  4GVO A;  4F1U A;  4GXS B;  2QS3 A;  1N7W A;  2ZZV A;  3O9P A;  2QSX A;  1Y3P A;  5L9M A;  4F1V A;  1B3E A;  4GWW A;  1NV0 A;  1N84 A;  1YYZ A;  3M3F A;  3CSB A;  4Z7E A;  3VXB A;  2R9J A;  3S9N C;  2XHD A;  3V83 A;  1ZLQ A;  2OPE A;  2VGQ A;  1IIW A;  2XWK A;  2Z8D A;  3JZJ A;  4OZ9 A;  1FBG A;  3OO7 A;  1FPE A;  4THI A;  3RPW A;  3ZKK A;  2PBW A;  1NMU A;  2RC9 A;  4RJZ A;  1Y1M A;  4PBH A;  1YPN A;  3EN3 A;  3KN7 A;  4X48 A;  4AS5 A;  3RGY A;  3QMF A;  1I69 A;  1SI1 A;  2XXP A;  3GYY A;  1P1W A;  4LAT A;  1PB7 A;  3SES A;  5B70 A;  2PCR A;  3T22 A;  4OES A;  1UTB A;  1NH8 A;  2GHB A;  4I1D A;  1I6A A;  2VT5 A;  4OQO A;  3KC0 A;  1UIV A;  3QUF A;  1LAH E;  2HXW A;  4HCW A;  3A29 A;  3O6G A;  3IR1 A;  3RTW B;  1KZ8 A;  1LCT A;  2Z23 A;  3DP8 A;  1S50 A;  4JXI A;  3ZS6 A;  4GWY A;  2KR0 A;  2I3V A;  2ZNS A;  1M5D A;  1US4 A;  2CZH A;  3DP4 A;  1EYK A;  3PD8 A;  2CMO A;  3FUZ A;  3MJN A;  3KSX A;  4PET A;  3W9W A;  3D1R A;  5ELV A;  1MH3 A;  1NNT A;  2REG A;  3HO7 A;  5CMM A;  2B65 A;  4GX3 A;  4GFR A;  3FD3 A;  5A5X A;  1IMC A;  3TFL A;  2ZXT A;  3RTF B;  3TTK A;  3UN6 A;  2KLF A;  3H4Z A;  1NNK A;  4ZEI A;  4OFO A;  3H6V A;  3E13 X;  3LSF B;  1IME A;  1B40 A;  2GRV A;  3K02 A;  4RNS A;  3B8B A;  3CR9 A;  3RY3 A;  4U1Z A;  3R7X A;  1FPD A;  2Y84 A;  1JP4 A;  4BDL A;  5AA4 A;  3B7D A;  3EPE A;  1DK4 A;  1MG1 A;  3FXU A;  3OEM A;  4OFL A;  4PE3 A;  3IFC A;  5J1D A;  4BDO A;  3RPL B;  4E0W A;  5I2K A;  3K2D A;  5I56 A;  1JVX A;  4OWD A;  2FNC A;  1KA1 A;  1MXY A;  2QVU A;  1NUY A;  3EHS A;  4ZS9 A;  2UVG A;  5J16 A;  5L8D A;  3TCF A;  4KYS A;  1IZ1 A;  2O6A A;  3SEU A;  4X1B A;  4N8G A;  4OVP A;  1YAE A;  4GWZ A;  3ILU B;  4POW A;  2QS2 A;  2OZZ A;  3FVN A;  1FPG A;  2DWI A;  2F8D A;  4R6H A;  4GX6 A;  4G4P A;  4OYV A;  4IO4 A;  4H65 A;  3FVK A;  1R9Q A;  4N6D A;  4QSD A;  2ZNU A;  3L6H A;  3CSG A;  2ONR A;  3C36 A;  3K00 A;  3PMX A;  3QK6 A;  1FTK A;  3BIH A;  4X04 A;  1MQD A;  4PFT A;  1XOC A;  4PP0 A;  2RIN A;  4XEQ A;  5DVF A;  3DEL B;  2OLB A;  3H06 B;  1XC1 A;  4JBZ A;  2F7B A;  1MDQ A;  4AB6 A;  1N7X A;  5I3S A;  2PMS A;  2OBG A;  4QSC A;  4RK9 A;  3QUJ A;  4F22 A;  1MY3 A;  2UYF A;  3T0J A;  1A7L A;  3E3K A;  1MXU A;  2Y5L A;  1LAF E;  4R6Y A;  4P1L A;  4OMB A;  3TTR A;  1A99 A;  2V3U A;  2XXR A;  4IR8 A;  4C1T A;  1NV5 A;  4E0X A;  3KSJ A;  3PPQ A;  4NF4 A;  1SDX A;  1YTV A;  1MXW A;  2E1S A;  4GRK A;  4H67 A;  2I49 A;  4DLD A;  2GHA A;  5DEX A;  3TQL A;  4MX6 A;  4NF6 A;  1FPI A;  4OEV A;  5H8Q B;  3P7I A;  3G3G A;  1BTJ A;  2X26 A;  2Q88 A;  4LP2 B;  1GGG A;  3LUY A;  4P11 A;  2Z8F A;  3KJ7 A;  4PF6 A;  1Y9U A;  3DLN A;  3PPO A;  2P0S A;  1PBP A;  5IZ1 A;  1NV1 A;  5CRY A;  3FJM A;  3N26 A;  4AS4 A;  4X1D A;  5ET5 A;  4QFK A;  1B7U A;  4NG7 A;  4GQO A;  2PT2 A;  2P3V A;  4KCD A;  4JSD A;  4GWX A;  4NQ8 A;  4HE2 A;  3QIM A;  4R9F A;  3N5L A;  5CBR A;  5H8N A;  4MNP A;  4GL0 A;  4GWS A;  4I62 A;  4NE4 A;  4DXC A;  1RYX A;  3E9X A;  4N17 A;  5FTH A;  3VV5 A;  2B4L A;  3MWB A;  4BDR A;  4QSE A;  3FXR A;  4OAN A;  2PYY A;  4GLI A;  1H45 A;  3KBZ A;  5HBC A;  1URS A;  1S9T A;  1B4H A;  1MXZ A;  4F3G A;  1IEJ A;  1NUZ A;  1UIU A;  2IA4 A;  3FJG A;  4RK2 A;  1WVJ A;  3LR1 A;  2P3N A;  1NI9 A;  1XVY A;  5CC2 A;  3I6V A;  4R73 A;  1M5F A;  1FBH A;  2F78 A;  3CI8 A;  3SEY A;  3W15 C;  1NV2 A;  4MBP A;  3S9L C;  4OET A;  5TP9 B;  2V4C A;  3N6T A;  3PU5 A;  2W7Y A;  4OHN A;  1FTM A;  3G3K A;  2CZI A;  3PUY E;  1B3L A;  3RN8 A;  5EYH A;  4C0R A;  1VE4 A;  3FVG A;  1NL5 A;  3C9H A;  1EYI A;  3BBR A;  1B1X A;  2G93 A;  4IGT A;  3TDJ A;  1VR5 A;  4WXJ A;  4GIZ A;  2H9B A;  1PB9 A;  1FTO A;  2XX9 A;  2I6E A;  4FIM A;  3K6W A;  4G68 C;  4HTG A;  3RNN A;  2ALU A;  3PUZ E;  2DS9 A;  5I59 A;  1AOV A;  3B50 A;  4X8R A;  3VDF A;  4ZEC A;  4ZEK A;  2REJ A;  4DI3 D;  2O84 X;  3TUS A;  4G61 A;  2OWZ A;  1INP A;  1PEB A;  1EZ9 A;  3CFL A;  4H45 A;  3N6U A;  3EKI A;  4JDF A;  4UAB A;  1QUI A;  2PFZ A;  1M5C A;  1AIV A;  1FBD A;  3O6I A;  2JJK A;  3MZ9 A;  1SW1 A;  3MP8 A;  1I6B A;  1A54 A;  3VE1 B;  4PQJ A;  1FQA A;  3KEI A;  4FE8 A;  2V84 A;  3ONM A;  4ZZE A;  1EZP A;  3LV0 A;  1NNF A;  1A8E A;  1AL3 A;  4K3F A;  5ISU A;  3L6G A;  2V3T A;  2LAO A;  1URD A;  1JW4 A;  5M2V A;  1B58 A;  4OVT A;  1SYI A;  5KDT B;  1OVB A;  2P2A A;  3RPL A;  4JB7 A;  4ZZA A;  1AH5 A;  5LOM A;  5FTI A;  2R71 A;  3OEL A;  2RKM A;  4JWO A;  5K2X A;  3QYT A;  5ICT A;  1XVX A;  4MMP A;  3OSQ A;  4IB2 A;  4MCO A;  1FSA A;  4H5F A;  2Q2A A;  3QAX A;  2QMX A;  1DPP A;  1LAG E;  4U2R A;  3GZG A;  1B3F A;  5H8F B;  1D4N A;  2OWT A;  5I2K B;  1Z7M E;  4JWY A;  1BP5 A;  1TFA A;  3MC2 A;  3PMW A;  4XTC Q;  3C4M A;  3O29 A;  1H43 A;  1MPC A;  3UGW A;  5TP9 A;  1NV3 A;  1K9Y A;  4NMY A;  4JVI A;  1RDX A;  1USY H;  3H6U A;  2QFL A;  4ZDM A;  2P1S A;  2DP8 A;  3HFU A;  3K1P A;  2XXK A;  4WEP A;  4P8B A;  2WBD A;  4P1E A;  4PGP A;  2DVZ A;  5FHM A;  3B6T A;  1XI6 A;  1XS5 A;  3SKP A;  2RC7 A;  1LST A;  3VLV A;  2RC8 A;  4MLV A;  2ONS A;  3ILT B;  5DT6 A;  1EU8 A;  3IK6 B;  1PDA A;  3K1M A;  3E4R A;  2R8T A;  1DMB A;  3UIF A;  1YZ0 A;  2AL4 A;  1IMB A;  2YLN A;  3IAZ A;  1B5I A;  4KD5 A;  1HSE A;  2CZK A;  1QGX A;  2DVC A;  4C1U A;  1KA0 A;  3T9V A;  1AWB A;  1VFD A;  1Y3N A;  1O7T A;  1IXG A;  1OVT A;  3KN8 A;  4YKK A;  5AE4 A;  3H7M A;  1LCF A;  4OVR A;  3U94 A;  4PFW A;  5ESY A;  2DE3 A;  3IOV A;  2THI A;  3MZB A;  5H8S A;  1OLC A;  3CFX A;  3WAF A;  2F7A A;  2OK2 A;  3ISP A;  5A5L A;  4O3C A;  5I59 B;  3IO4 A;  5JTY A;  5IAI A;  3TZA A;  1N04 A;  3S4U A;  1FPB A;  4O3A A;  3SDF A;  3TCH A;  2XXH A;  1EZO A;  5DEX B;  2NOO A;  3EF7 A;  2O68 A;  1F9B A;  3LBS A;  2F36 A;  4QFN A;  1MRP A;  4YMB A;  1UTH A;  2I0B A;  3GLB A;  5TPA A;  5IZZ A;  3K6U A;  1SPI A;  3U1O A;  2I3W A;  3Q27 A;  4KQP A;  2BJJ X;  4H6D A;  1URG A;  3FZV A;  3U93 A;  3FAT A;  2PX1 A;  3GBA A;  2FYI A;  4FEB A;  4IO5 A;  2QS1 A;  1MPB A;  3MYU A;  1POY 1;  3IO6 A;  2O1M A;  2QVR A;  2RCB A;  4ZEF A;  2ZMB A;  3KGC A;  4FAT A;  1UTH B;  1LGB C;  4N6K A;  4LON B;  1US5 A;  1P1N A;  3MVW A;  2NWJ A;  5EHS A;  3OD7 A;  3FAS A;  3DM0 A;  3OO9 A;  4QXD A;  1O63 A;  5ITO A;  3O2A A;  3VLW A;  1Y4C A;  3KBR A;  2NVU B;  5AA3 A;  2HCA A;  2XXW A;  2UVI A;  1B2H A;  3C33 A;  1FW0 A;  1ZU0 A;  2WYP A;  2A5S A;  3C31 A;  4YU0 A;  3UA8 A;  3RUM A;  2WEF A;  4TLM B;  3K01 A;  4G8H A;  4Q30 B;  4KR5 A;  1MQI A;  1H76 A;  4O94 A;  1VSO A;  3O66 A;  3M3L A;  3E78 A;  2OWS A;  1ZTY A;  1SVX B;  5F7V A;  1TT1 A;  1B0L A;  4FOR A;  1UTB B;  1YCJ A;  3Q28 A;  4YKJ A;  1LBY A;  4OVJ A;  4ECF A;  2DDK A;  1R6Z A;  1LFG A;  3VVE A;  2F3D A;  3U92 A;  4YZZ A;  4KYE A;  1G0I A;  3PPN A;  4TLL B;  4H0W A;  4NF5 B;  2A5T A;  4OXV A;  2VD2 A;  3G3I A;  5AA4 B;  2GH9 A;  2H25 A;  1XT8 A;  5BWJ A;  3FIR A;  3OOA A;  3DP6 A;  1DCU A;  4I9D A;  2X7P A;  2HQ0 A;  2NUV A;  4H46 A;  3T9U A;  1MH4 A;  2HFB A;  2ZYM A;  1T0K A;  4XKQ A;  1JVY A;  2HZL A;  4PFR A;  3QSL A;  1Z7N E;  4ELO A;  2Y7R A;  3ZSF A;  4IO7 A;  4DXU A;  2B3B A;  3OSR A;  2VP1 A;  4LZ5 A;  5I5P A;  2VHA A;  5EYG A;  3EHU A;  4NN3 A;  4KI0 E;  1BKA A;  3USD A;  3HCQ A;  2XXY A;  1FPJ A;  4PF8 A;  3LSX A;  4O7M A;  3O97 A;  2H99 A;  5L9O A;  4GBV A;  3T9H B;  4F3P A;  1O64 A;  2Z22 A;  2XXQ A;  1OIB A;  3CFZ A;  3GXA A;  1PB8 A;  4GD5 A;  1PC3 A;  4MF3 A;  2HZK A;  3EHT A;  5ITP A;  5DVJ A;  2AL5 A;  4OTE A;  5ICQ A;  5H8N B;  4P56 A;  1MY0 A;  3A09 A;  3CIJ A;  3MBP A;  3O28 A;  5I2N B;  2M8C A;  5TU0 A;  2E0S A;  3TOD A;  4DIG A;  4DZ1 A;  1D3K A;  3TTM A;  4P47 A;  3IB0 A;  1B32 A;  2MKZ A;  4GWO A;  4G8M A;  1ELJ A;  3U65 A;  1JQF A;  3FXQ A;  2ZNT A;  5I2N A;  4I40 A;  4LZ8 A;  3D4C A;  2Z8E A;  4P3L A;  3KZG A;  2ZYK A;  2H5Y A;  4U23 A;  4MH5 A;  1QKA A;  4OA4 A;  1SQY A;  1BK4 A;  2RCA A;  4PAK A;  4DCX A;  4QFP A;  3TCG A;  4AB5 A;  1USY E;  4KYD A;  4NF6 B;  1FQF A;  1H44 A;  2CZL A;  4I3E A;  2UVH A;  1QJM A;  3T9X B;  4NWC A;  1LBZ A;  1B3H A;  3KFM A;  4PAI A;  4HXV A;  4EQB A;  4PE5 B;  4OFJ A;  2XWO A;  3OEK A;  4HCY A;  1OQG A;  4G77 A;  1FCK A;  4KPT A;  2I48 A;  5ET7 A;  2UVJ A;  4MNC A;  4ZEB A;  4ZE9 A;  3U8Q A;  1M5E A;  5FHO A;  3UOR A;  4RYA A;  3E79 A;  3H6W A;  5EYF A;  1MXX A;  1NV7 A;  2Y7K A;  2B3F A;  4NF0 A;  1B46 A;  4YKP A;  2A5T B;  1QUK A;  4GF8 A;  1GTK A;  4LQ2 A;  4FED A;  1LBW A;  3IL1 B;  1QW0 A;  3CG1 A;  5I57 B;  3UP9 A;  4YB7 A;  1FQB A;  4F1Y A;  1FTL A;  1LB8 A;  3M8U A;  3TYH A;  4F31 B;  3IJO B;  5F1Q A;  4H8I A;  3FGS A;  5ET8 A;  3H6T A;  4N4U A;  4N91 A;  4MNI A;  2F5X A;  1IXH A;  2XXT A;  1IXC A;  1VFE A;  4BLA A;  2O7U A;  4P9K A;  1ANF A;  2Q8M A;  4NTL A;  2XWV A;  1IXI A;  1MM7 A;  1BLF A;  1LBV A;  2V25 A;  3MUQ A;  1HSJ A;  4I3Y A;  5FHN A;  2ZYO A;  2WBB A;  1SW2 A;  3IOT A;  4LUB A;  1SI0 A;  2D21 A;  3OEN A;  2FIE A;  4MHF A;  5HPQ A;  2I4B A;  1KWH A;  3V89 B;  4HS7 A;  2Q74 A;  1FPF A;  2Y7P A;  1LBC A;  5EQA A;  4R9G A;  4EQ7 A;  3HPI A;  3TAJ A;  5AA2 A;  1B51 A;  3HV1 A;  3LSL A;  1TWY A;  3KOT A;  2FBP A;  1MQH A;  3MW0 A;  4EF1 A;  4ZE8 A;  2ANJ A;  3TTL A;  4U1O A;  4GBW A;  5CBS A;  4JVD A;  2G29 A;  2VOZ A;  1EYJ A;  4RY1 A;  4ONY A;  1MY2 A;  3HHF A;  1G0H A;  5H8F A;  3BKI B;  3VFJ A;  5KCJ B;  4F18 A;  1MY4 A;  5AA1 A;  4R72 A;  4ELQ A;  2YPN A;  1S7Y A;  3T1B A;  1QVS A;  4NHB A;  3PTY A;  4BDQ A;  5JK4 A;  1SW4 A;  1EH3 A;  1LEV A;  5I84 A;  1B9J A;  4NWD A;  2BJI A;  5DW8 A;  2HAU A;  2O51 A;  3W9V A;  4N15 A;  4XXU A;  4G68 B;  4I8C A;  3R6U A;  1FJ9 A;  1J1N A;  1B5J A;  3WAE A;  4MFI A;  4NX1 A;  1NUX A;  3QXM A;  2HEU A;  1MY1 A;  2I4C A;  4DCY A;  5IGA A;  2F35 A;  3IOW A;  3A3U A;  2QPQ A;  4RXL A;  4G8N A;  1M5B A;  1JEU A;  2DXY A;  3FBP A;  3PUX E;  2PVU A;  2HAV A;  4MJO A;  1SW5 A;  1I6Q A;  4F2Q A;  4UAC A;  3B6Q A;  4KFQ A;  4JWX A;  5H8H B;  1VDW A;  5I57 A;  2XXV A;  2ZYN A;  3Q26 A;  1SYH A;  4IY6 A;  2ONK E;  4EUO A;  1CE2 A;  4X9T A;  1GR2 A;  1QKB A;  2KQZ A;  1TFD A;  1B7Z A;  1MXV A;  1A55 A;  1NKX A;  1LBB A;  4PFY A;  3TEP A;  2F7C A;  2Y7I A;  5AA2 D;  4PDH A;  4NED A;  2H4I A;  1MM6 A;  2XX7 A;  3FV2 A;  3ODB A;  1RDZ A;  3TKD A;  2V3Q A;  2NXO A;  4FBP A;  5DTB A;  3VXC A;  2XXX A;  4LVQ A;  2DYX A;  2F6P A;  5KZT A;  1A8F A;  3KJT A;  2OCU A;  1ZIU A;  1PBQ A;  4FEC A;  3ZKL A;  3MAM A;  5DYH A;  5EQ9 A;  2OX3 A;  5L9S A;  4GOT A;  1P99 A;  3OO8 A;  3S2V A;  5CM6 A;  2XD3 A;  2DE4 A;  4Q0C A;  1Q1K A;  4OVS A;  2RF1 A;  3TTN A;  2ZZW A;  2PFY A;  4POX A;  3LSW A;  4F3B A;  2IEE A;  2XX8 A;  4GXA A;  3C35 A;  1B1H A;  5HM4 B;  4HE1 A;  4R6K A;  5I56 B;  4DI4 B;  1DOT A;  1B0H A;  3G3F A;  4JVC A;  4RPN A;  1XHY A;  2YJP A;  4IO6 A;  4QFO A;  4XIG Q;  2WX9 A;  2VD3 A;  3T96 B;  3PPP A;  4QF9 A;  1LFH A;  1MS7 A;  3FJ7 A;  4ELR A;  2Y5K A;  3HHG A;  3M3K A;  3SZP A;  2Q8J A;  5CI5 A;  1B3G A;  3K1N A;  2DSF A;  4U21 A;  1OMP A;  1GVC A;  1NV6 A;  4XKP A;  1LBX A;  4M1V A;  4ELP A;  3SET A;  2DE2 A;  4LN5 A;  2F34 A;  3H3G A;  3MP6 A;  3OXN A;  4NGU A;  4IGR A;  3BFT A;  4OEU A;  1N3W A;  4OEN A;  3FVO A;  2WKY A;  5B7D A;  3FV1 A;  1R1N A;  3PD9 A;  2ZZX A;  1FPK A;  4EXL A;  4YMA A;  4G68 A;  3S9M C;  2Q2C A;  2Y7W A;  4FAJ A;  1IUD A;  1AMF A;  3HST A;  3MST A;  4GWU A;  4KHZ E;  4RA1 A;  3IFA A;  3MVZ A;  2F3B A;  4JSO A;  4H1X A;  5CMB A;  3SER A;  1Y1Z A;  1P1O A;  4R2F A;  3UK4 A;  4HE0 A;  1CB6 A;  4F29 A;  3S9E A;  4TOZ A;  2OPD A;  1FQD A;  4P0G A;  2XA5 A;  3PUW E;  3SEW A;  1A40 A;  3MVX A;  5H8Q A;  3PV0 E;  5IZ3 A;  3KG2 A;  5JTY B;  2ABH A;  2R6G E;  3KC1 A;  1IIT A;  3T66 A;  1MPD A;  1MQG A;  3IB2 A;  1Y4T A;  3C32 A;  4O8M A;  3MPL A;  1P1U A;  4H8J A;  4YAH X;  4O3B A;  4U22 A;  4IY5 A;  2XXI A;  1N3X A;  1IMF A;  4ESW A;  3CRB A;  1FTJ A;  1II5 A;  4NF4 B;  3PPR A;  1DPE A;  1K9Z A;  2XWI A;  3IB1 A;  4LQ5 A;  1Q9D A;  1D9Y A;  4LZ7 A;  5AA2 B;  5EQ7 A;  4R2B A;  4OVQ A;  3RLF E;  2FVZ A;  4PGN A;  3Q29 A;  1IMA A;  2O69 A;  4QRZ A;  1QUL A;  2Q89 A;  1LLS A;  4H5G A;  3SEX A;  5CMC A;  1JW1 A;  5I58 A;  4M4G A;  1LAX A;  2QJE A;  4EXK A;  5JEI A;  4PFI A;  3EQ1 A;  4QBA A;  5IM2 A;  4EQ9 A;  4GL8 A;  4P0I A;  2HXR A;  3BIG A;  5ET6 A;  1L5T A;  3VLU A;  5F24 A;  5CMK A;  3PMV A;  4YIC A;  1YXI A;  1B5H A;  4Q5T A;  2Q9T A;  3N94 A;  2CEY A;  4PAF A;  2B4M A;  3TQW A;  1P1Q A;  2H98 A;  1FQE A;  5I7I A;  5LTC A;  3D4G A;  3KN3 A;  3CG3 A;  2I58 A;  2UXA A;  3VVD A;  3K4U A;  3IOR A;  2FIX A;  4U4X A;  3MZ1 A;  1IQ7 A;  2I0C A;  2HPG A;  5TPA B;  4NF8 A;  1OQH A;  1JW5 A;  4XF5 A;  4R74 A;  4YKI A;  4IO3 A;  3Q25 A;  5BUU A;  3O6H A;  2QVV A;  3OMB A;  1B52 A;  3KOS A;  3B6W A;  4QHQ A;  1SBP A;  1B05 A;  3PGF A;  3I3V A;  1NUW A;  1WOD A;  3G7W A;  1LFI A;  4F3S A;  4O7I A;  3NOH A;  1NFT A;  5EQ8 A;  1QUJ A;  3IJX B;  4NF8 B;  1B7H A;  2V93 A;  5EHM A;  3U72 A;  5KDT A;  4YB5 A;  4N13 A;  3RT8 A;  1NV4 A;  3BFU A;  4ISU A;  4QFL A;  3TEL A;  5DVI A;  4UA8 A;  4EDP A;  3MQ9 A;  2O1L A;  4KXP A;  2XD2 A;  2QRY A;  4PFU A;  1SD3 A;  2PT1 A;  3I5O A;  2CEX A;  1FBE A;  4MEV A;  3LUZ A;  3ROJ A;  1DBZ A;  4PTK A;  1MQJ A;  2O7I A;  4XKR A;  3CHG A;  4TQU Q;  2WYK A;  3IX1 A;  2GFE A;  1B4Z A;  2D3I A;  3R26 A;  5IKB A;  2OJT A;  3K6X A;  1Y3Q A;  1DTG A;  1ZKB A;  3ECR A;  4DE8 A;  2XXU A;  1FQC A;  5A5X B;  1NNP A;  4YB6 A;  1Y20 A;  3V8X B;  1GV8 A;  4R75 A;  1LB9 A;  1ZJL A;  3HN0 A;  1FBP A;  1POT A;  1B6H A;  1CNQ A;  2F97 A;  1D9V A;  4XKN A;  2AIX A;  2FHY A;  4MLQ A;  4GX4 A;  4WKM A;  4N81 A;  2VPO A;  4LA9 A;  3VVF A;  3RYD A;  1JET A;  3G3J A;  4NAP A;  3MVY A;  2DWH A;  5FBP A;  1TXF A;  1OLA A;  4XFE A;  4PCD A;  1RYO A;  4Z0I A;  3LC8 A;  4DXB A;  1JEV A;  2HHM A;  2GQ1 A;  2AYS A;  1FBF A;  1IMD A;  5LDZ A;  4DDD A;  1MDP 1;  5IZ3 B;  3CVG A;  4ESX A;  4KCC A;  2DWA A;  4WED A;  3SEV A;  4BDN A;  4F2O A;  3FXB A;  1R9L A;  4ND9 A;  4PC9 A;  4Q8R A;  4RPO A;  5KCJ A;  1FJ6 A;  1D9Q A;  3AXF A;  1WDN A;  4F39 A;  5T3J A;  1JNF A;  3RT6 B;  4F19 A;  4MAG A;  4NF5 A;  3RQT A;  3K6V A;  4FJP A;  4PBQ A;  3K0V A;  1BIY A;  3OO6 A;  3T93 B;  2ESN A;  2DQV A;  2QMW A;  3JV9 A;  1HSL A;  3PUV E;  4HW8 A;  4G2Z A;  3TPA A;  1FPL A;  2X7Q A;  2F6G A;  3H03 A;  1RKM A;  4MIJ A;  3THI A;  1DSN A;  1RDY A;  2L5V A;  2QS4 A;  3G3H A;  2DXR A;  3MP1 A;  1N76 A;  3V5A A;  1Q35 A;  2UYE A;  4N6P A; 
#chains in the Genus database with same CATH homology
 4OA4 A;  1LBV A;  4PE3 A;  3KBZ A;  3FBP A;  1FBC A;  2FHY A;  1G0I A;  2PCR A;  1BK4 A;  3IFC A;  4IR8 A;  4GX4 A;  2HPG A;  4JVC A;  1NV5 A;  5J1D A;  4MJO A;  4PAK A;  4XF5 A;  3RPL B;  4I3Y A;  5IZ3 A;  2VT5 A;  2WX9 A;  4N81 A;  3MYU A;  3KC0 A;  2VPO A;  1NUZ A;  2WBB A;  3KC1 A;  2QVR A;  2R8T A;  4HCW A;  3A29 A;  1KA1 A;  3RYD A;  1YZ0 A;  3LV0 A;  1KZ8 A;  1DCU A;  4NAP A;  4I3E A;  1VDW A;  2Y5K A;  4O8M A;  1IMB A;  2QVV A;  5FBP A;  2FIE A;  2P3N A;  2QVU A;  1NUY A;  4MHF A;  1NI9 A;  3SZP A;  4GWY A;  4H46 A;  2KR0 A;  1LBZ A;  2VPN A;  4XFE A;  4PAI A;  2CZK A;  2Q74 A;  5J16 A;  1FBH A;  4HXV A;  4PCD A;  1QGX A;  1NV6 A;  4OVT A;  1FPF A;  1FRP A;  1KA0 A;  4N6K A;  1LBX A;  1IMF A;  5EQA A;  1AWB A;  3RPL A;  1NV2 A;  2HZL A;  2XWO A;  4M1V A;  2CZH A;  4MX6 A;  2HHM A;  4PFR A;  2DE2 A;  2V4C A;  4HCY A;  1EYK A;  4N8G A;  4LN5 A;  4OVP A;  2GQ1 A;  1K9Z A;  1FBF A;  1NUW A;  2FBP A;  4GWZ A;  2KQZ A;  2XWI A;  4X9T A;  1IMD A;  5ET7 A;  4MNC A;  5I5P A;  5LDZ A;  4NGU A;  4O7I A;  1FPI A;  1Q9D A;  5IZ3 B;  3NOH A;  4QXD A;  5EQ8 A;  5EYG A;  4PET A;  4PDD A;  1FBP A;  4PFB A;  4GBW A;  1FPG A;  4JVD A;  3W9W A;  2CZI A;  5EQ7 A;  4NN3 A;  4OVQ A;  4PDH A;  3D1R A;  4OVR A;  5EYH A;  1FPJ A;  4PF8 A;  1EYJ A;  4MMP A;  2FVZ A;  3FXB A;  4PGN A;  4GX6 A;  4O7M A;  4PC9 A;  1FTA A;  1RDZ A;  1IMA A;  5ESY A;  4MCO A;  4N8Y A;  1NV4 A;  3E79 A;  2ZZX A;  2DE3 A;  4GBV A;  1FSA A;  1FJ6 A;  4GX3 A;  1G0H A;  1FPK A;  2V3Q A;  4P1L A;  4PF6 A;  1D9Q A;  1EYI A;  4FBP A;  4F1U A;  1NV7 A;  4F18 A;  4N6D A;  5T3J A;  5IZ1 A;  3ISP A;  4NF0 A;  2ZZV A;  5A5L A;  1NV1 A;  4F1V A;  4F19 A;  1IMC A;  4MAG A;  3T1B A;  4GWW A;  1NV0 A;  4AS4 A;  2WYP A;  4KXP A;  1YYZ A;  5ET5 A;  2HZK A;  4PFI A;  4QBA A;  1LBW A;  4NHB A;  3PTY A;  3BIH A;  5EQ9 A;  5IM2 A;  1FPB A;  2OX3 A;  2CEX A;  4NG7 A;  1FBE A;  2WEF A;  4PBQ A;  4X04 A;  4P56 A;  2P3V A;  2HXR A;  3BIG A;  4GWX A;  4HE2 A;  5ET6 A;  3MST A;  4MEV A;  3LUZ A;  4NQ8 A;  4GWU A;  3ROJ A;  5F24 A;  1DBZ A;  4PTK A;  2XWK A;  5JK4 A;  1LEV A;  4XEQ A;  3CHG A;  1NV3 A;  1YXI A;  1K9Y A;  4O94 A;  2DE4 A;  4YIC A;  2WYK A;  5CM6 A;  2BJI A;  5DW8 A;  3B50 A;  4OVS A;  4X8R A;  3W9V A;  4N15 A;  3IFA A;  4JVI A;  3E78 A;  1IME A;  1RDX A;  2Q9T A;  2ZZW A;  4DI3 D;  2F3B A;  2CEY A;  5ET8 A;  1FPL A;  2PFY A;  4N4U A;  4G61 A;  1FBG A;  4MNP A;  4N91 A;  4MNI A;  4P47 A;  4PAF A;  2OWZ A;  2QFL A;  2B4M A;  4GWS A;  1FJ9 A;  1FPE A;  3B8B A;  2XXK A;  3HFU A;  1INP A;  2MKZ A;  4P8B A;  5I3S A;  2WBD A;  4MIJ A;  4H45 A;  4HE0 A;  2F5X A;  4P1E A;  3U65 A;  1FPD A;  3EKI A;  5IZZ A;  4PGP A;  4NX1 A;  1SPI A;  1JP4 A;  2DVZ A;  1NUX A;  4UAB A;  4PBH A;  1XI6 A;  4N17 A;  1RDY A;  1LBY A;  4HE1 A;  2L5V A;  4I40 A;  2PFZ A;  5IGA A;  5I7I A;  3T0J A;  5LTC A;  1DK4 A;  4P9K A;  2DDK A;  1FBD A;  2B4L A;  4DI4 B;  2Q8M A;  4AS5 A;  2Y5L A;  2JJK A;  3QMF A;  2XWV A;  4P3L A;  2XA5 A;  2FIX A;  2QPQ A;  4OAN A;  3GYY A;  2F3D A;  4YZZ A;  1CNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...