2JJKA

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate -1- phosphohydrolase) (e.c.3.1.3.11) complexed with a dual binding amp site inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Fbpase Inhibitors Gain 10(5) Times in Potency When Simultaneously Binding Two Neighboring AMP Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
total genus 101
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2jjkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2jjkA02
1IMCA 1FTAA 1QGXA 1YZ0A 1NV2A 5I3SA 1EYIA 1FSAA 4GWSA 3FBPA 5ESYA 5A5LA 3IFCA 3KC1A 5FBPA 1VDWA 1FBCA 1FBEA 1DBZA 1NV1A 1G0IA 1KZ8A 4I3YA 1NUXA 2CZKA 5J16A 2F3BA 1FBDA 5ET5A 4QXDA 2R8TA 4AS4A 4MJOA 2QVVA 4H46A 1IMDA 1FJ9A 4HE1A 2HHMA 4H45A 5IZ3A 1RDYA 4GBWA 2WEFA 1YXIA 5EQ8A 2QFLA 4GWUA 1RDXA 1NUZA 2Q8MA 2BJIA 4G61A 1IMBA 4GWXA 5LDZA 1FBGA 1IMFA 1NUWA 4GWZA 2FBPA 1EYJA 5F24A 1Q9DA 1JP4A 1LBWA 2FVZA 1LBXA 1NUYA 5IZ1A 3RPLA 1K9ZA 3RYDA 2DDKA 3BIHA 1NV5A 1FRPA 5IZ3B 2WBDA 1FPDA 2CZHA 1FPIA 1FPGA 3KC0A 3LV0A 4GWWA 1FPBA 2FHYA 3LUZA 4N81A 5ET7A 2FIEA 4GX3A 1EYKA 1FPEA 1FPJA 4I3EA 5EQ9A 4I40A 5EYGA 1LBVA 1NV6A 4O7IA 5ET6A 2Q74A 4GWYA 1INPA 5DW8A 2OWZA 5ET8A 5T3JA 1DK4A 1G0HA 4KXPA 1KA0A 1D9QA 2PCRA 3ROJA 1LBYA 2P3NA 4GX4A 1NI9A 2QVRA 4HXVA 2Y5LA 1NV7A 4IR8A 1FPKA 2QVUA 1FPFA 5EYHA 1LEVA 3T0JA 1CNQA 2P3VA 4GX6A 5EQ7A 1SPIA 2VT5A 4GBVA 1AWBA 2F3DA 4HE0A 3BIGA 4AS5A 1DCUA 3B8BA 1NV0A 1IMEA 1IMAA 1FBPA 1FPLA 1BK4A 1FBHA 1YYZA 3IFAA 3KBZA 4HE2A 2CZIA 1LBZA 2JJKA 4PTKA 1KA1A 2OX3A 3A29A 1K9YA 2FIXA 1XI6A 5EQAA 1RDZA 4FBPA 2GQ1A 2WBBA 1FBFA 3D1RA 3RPLB 1NV3A 1FJ6A 1NV4A 3QMFA 2Y5KA
chains in the Genus database with same CATH superfamily
3G3FA 3T9UA 2RCAA 1FTOA 1UTBA 2X7PA 4DCXA 1LGBC 4NGUA 3SKPA 3PD9A 3UK4A 1R9LA 2RC9A 1NUXA 4QXDA 4N4UA 1M5FA 1IXHA 1B5JA 1IMDA 4PQJA 1RDYA 2ZNSA 1GR2A 1LBBA 5L9SA 3FJ7A 1NUZA 3ISPA 4NAPA 4IO6A 4NHBA 1POY1 5B70A 4IO7A 4DXCA 1Q9DA 1JP4A 3RPLA 3A3CA 3FVNA 4XKNA 3O66A 3HFUA 5I7IA 3HO7A 2WBDA 1D9YA 3PPPA 1N3WA 3OSQA 2O1MA 4MNIA 4N07A 4EUOA 3UA8A 1B4ZA 3OEMA 1EYKA 3HSTA 2XXHA 2D3IA 1UTHB 1H76A 3JZJA 1A7LA 1TFDA 1UTBB 3KZGA 4JWOA 3OO8A 2PX1A 1AMFA 3PPNA 5I56A 3K4UA 2QVRA 3F11A 4MNCA 2F35A 3QIMA 2F36A 3FXRA 4U22A 1N0TA 3S9MC 4GBVA 4UA8A 4MIJA 4F39A 3MPKA 1OQGA 2DOJA 4ZECA 4YMAA 5DEXA 1SW5A 2F97A 3LSLA 3KN3A 2QSXA 4MNPA 5EQAA 3PUXE 1IXGA 5IGAA 3R26A 3QK6A 2XXYA 1LAXA 3B6QA 2Z8FA 4POWA 1B3LA 5I3SA 4GWSA 3DLNA 1NKXA 3T22A 3VFJA 4P3LA 1FTKA 1FBEA 4F29A 3TELA 2Y84A 2B3FA 3FV2A 2FA7A 3TTKA 1FTJA 4KYDA 3C33A 2QVVA 2OCUA 1FJ9A 4KQPA 3TZAA 1VSOA 1S7YA 3L6GA 4JVDA 3E9XA 1ZTYA 4N15A 2XXTA 1RYXA 3O6HA 2UVGA 1N84A 4I8CA 5F7VA 1US4A 5M2VA 1B1HA 3W9WA 1NUYA 1ZMGA 3RYDA 3BFUA 3PGFA 1XHYA 2VP1A 1FTLA 4PAFA 1OLAA 1B9JA 4LZ5A 4GXSB 1MXYA 4OVRA 4G68C 2FHYA 3H7MA 4YKJA 4I3EA 2UYEA 3IO4A 4DCYA 4LA9A 3T66A 3MWBA 1KA0A 4NF5A 3V8XB 2ONSA 2YJPA 1JW1A 4NQ8A 2QVUA 1IXCA 3TEPA 5EQ7A 4QSDA 2QRYA 1WVJA 3RGYA 4H6DA 2Z8DA 2FYIA 2I4BA 1YYZA 4F19A 1LBZA 2NXOA 1SDXA 4H5FA 1QUJA 3T9VA 4HCWA 1S9TA 3QMFA 4RYAA 1FQAA 1QGXA 1CE2A 3IJXB 5CBRA 3T9HB 3ZSFA 1LFHA 1MPBA 1A55A 3KFMA 4OVTA 3O6GA 1B51A 1FQEA 3MVWA 1R1NA 5FHOA 4PFRA 4G8HA 4PFYA 2WEFA 5CC2A 4P1LA 4N91A 4GWUA 4U1ZA 4U4XA 2XX8A 2E1SA 3G3KA 2BJIA 1I6QA 4OESA 3EHSA 1EZ9A 5LTCA 3Q29A 4KPTA 1ANFA 3D4CA 4NE4A 4IO5A 5KDTB 2Z23A 2VD3A 4R73A 4IGTA 5IZ1A 2FVZA 1VR5A 5TP9A 5AA2D 2RKMA 2QMXA 3C4MA 2CZHA 2O68A 2Q2AA 5KCJB 2OBGA 5I59B 4X9TA 3IX1A 4DI3D 3MBPA 3OO7A 2ZZXA 1H43A 2XWVA 3N6UA 3VE1B 2ANJA 4TLMB 3VXCA 1D9QA 2NVUB 4DI4B 3C36A 3E13X 4POXA 3E78A 4F22A 4P8BA 4LQ5A 3DP4A 3FJGA 3RNNA 2F78A 2VGQA 4PBHA 1B5HA 3BIGA 3OO9A 4WEDA 3OMBA 5A5XA 4ECFA 4R6YA 4KYSA 2DWAA 1POTA 3C34A 1P99A 1D9VA 1SW2A 1FSAA 1MPDA 4WEPA 4R2FA 2GHAA 1USYH 4XKRA 4YKPA 4IO3A 4RY1A 5BWJA 2DWJA 5FTIA 3R7XA 3U1OA 2PT2A 3C32A 4NG7A 4BDQA 1QUKA 2WYKA 4LATA 2LAOA 5CMCA 1Y1MA 1NUWA 2G29A 3VLWA 2FBPA 3FVKA 4DZ1A 4DE8A 2QS3A 5I58B 4Q0CA 4LQ2A 2Y7KA 3QSLA 4X1BA 4BDNA 1TFAA 4ZE8A 3HPIA 5TPAA 3KSXA 4GWWA 4ELRA 3TCGA 4PCDA 3TTRA 2FIEA 4LVQA 5AE4A 1MY3A 5ET6A 2OWZA 4PBQA 4PFTA 1LFGA 4PF6A 3H03A 1B40A 3TDJA 4OYVA 4UABA 2ONRA 4XIGQ 3MC2A 4NF0A 2P3VA 4MAGA 3DELB 3FUZA 1I69A 1YPNA 4GQOA 4X04A 2QPQA 1US5A 5DEXB 3UORA 1A8EA 2R6GE 3BFTA 1FCKA 1XC1A 2REJA 4BDLA 3NOHA 4NWDA 3MJNA 2I4CA 1FJ6A 4MLVA 3PPQA 3LSFB 3C31A 2DSFA 3QAXA 4YKIA 4GL8A 3SEYA 3KC1A 3KJTA 2OLBA 4YU0A 1ZJLA 1NV1A 2I58A 3T9XB 1UTHA 4DXBA 2F3BA 2R71A 3BBRA 1I6BA 3FZVA 3LBSA 4H8JA 1Y3QA 4EQBA 3AXFA 4GBWA 4PFBA 1QW0A 3U72A 4GD5A 4IY6A 1ZBMA 3G7WA 3SETA 3MVYA 1OVTA 4ZEFA 3B7DA 3QXMA 2F7CA 1LB8A 3K1NA 2DDKA 4P0GA 1Z7ME 1FW0A 3ZKLA 5I5PA 2CEYA 3H6TA 3KN8A 2I0CA 2ZXTA 2WYPA 1N7WA 1MDQA 4E0XA 3S9EA 4XF5A 2E0SA 3TCHA 1INPA 5JEIA 3O28A 4MF3A 4NF4A 4JVIA 2P3NA 3MW0A 3B6WA 4ZE9A 4FEBA 2HZLA 4ZEBA 2F8DA 2QS2A 3FIRA 3MPLA 4QBAA 2DXRA 1ZU0A 4JSOA 2CMOA 2VHAA 4N6PA 2HZKA 5K2XA 2DWIA 4MEVA 3IB0A 4R9FA 2B4LA 3IR1A 1MXWA 2QS4A 3G3HA 2O69A 2JJKA 1YTVA 4NX1A 2IEEA 2RC8A 2XA5A 1Y9UA 4FBPA 1GTKA 4QRZA 4OHNA 2Q8JA 1LSTA 1Y3NA 1JVXA 3DP6A 4L17A 3K01A 4EDPA 1SQYA 3I6VA 4O3BA 2PVUA 1B0HA 2XWKA 1LAFE 4I3YA 3GLBA 1SBPA 4XKPA 4NF5B 3E3KA 1M5EA 1M5BA 2HAUA 4YAHX 1R6ZA 2XD2A 2Q8MA 4PGPA 5LDZA 2V93A 3U92A 2QL3A 1EYJA 3QUFA 1EU8A 4ESWA 3H6WA 2BJJX 4LP2B 4ZDMA 1MY0A 1FPIA 3CG3A 2XXIA 2GRVA 2OWSA 4WXJA 4F31B 4N81A 1PB8A 3PV0E 4GF8A 3TQWA 4MFIA 3SESA 4F1UA 5AA2B 3PU5A 4K3FA 4NF8B 3RUMA 3O97A 5FHMA 3ZKKA 2P2AA 4RJZA 3MZ9A 5H8FA 3FXBA 3RY3A 3U94A 1JETA 1WODA 3EKIA 4LN5A 4QSCA 1IITA 1B7UA 3M3FA 4P1EA 1B1XA 2PFZA 2FIXA 3UGWA 1UIVA 3FJMA 2R9JA 1NV3A 3LR1A 2V84A 1FTAA 3GYYA 4F1YA 4H8IA 5CMBA 3N26A 4U4SA 2DQVA 1T0KA 1MY2A 4TLLB 5EHMA 4H65A 2UVJA 4P47A 3IOWA 4EXLA 3IOUA 4GLIA 2P0SA 2HPGA 1MXZA 4R9GA 5ITOA 3TTLA 4H45A 3IB2A 3VVDA 2H98A 2Z22A 1NNFA 3S4UA 1YAEA 2D5WA 5CBSA 4HCYA 2DVZA 4R74A 1LBXA 2G93A 3GZGA 4NTLA 3E79A 5I2NB 3HHGA 4N6DA 2AL4A 3CSGA 2HFBA 4OWDA 5H8SA 1XVYA 2B4MA 3KJ7A 2P1SA 3LUZA 5AA4B 4FECA 3KEIA 1B58A 3EHTA 5IAIA 1PEBA 1N7XA 4GOTA 3JYRA 4IO2A 4I9DA 2Q74A 2DS9A 5T3JA 4QFPA 4F2QA 1B7ZA 4PDDA 1FPKA 5H8HB 2XHDA 4M4GA 4GX6A 1PC3A 4YMBA 3MVXA 2XX9A 3SZPA 4OVJA 5DTBA 3MZBA 1B4HA 1IQ7A 2XXWA 4JB7A 4LONB 4OXVA 3TKDA 2GQ1A 4RPNA 2ZYMA 1NV4A 2H9BA 4IGRA 4PDHA 5CM6A 3PMXA 4F3SA 1NH7A 3QYTA 2GFEA 3M3KA 5CI5A 1OIBA 3SEUA 1G0IA 1NNPA 4YB6A 4RPOA 5AA1A 1FBDA 1XOCA 3CI8A 2ALUA 2Q88A 2L5VA 4HE1A 5IZ3A 3MZ1A 4AB5A 3TPAA 4OENA 2XXRA 4JVCA 2Y7PA 3OEKA 2RC7A 4GFRA 3K6UA 4YB5A 4OFOA 3CG1A 4JXIA 4H67A 3Q25A 3BIHA 4MH5A 1B5IA 1MY1A 4Q8RA 3GXAA 1OLCA 4JWXA 1MQJA 5ET8A 1SD3A 4GIZA 3LSXA 4GX4A 5H8NB 2ZYKA 1JW4A 2ONKE 4IR8A 1GGGA 2XXKA 4BDMA 4NEDA 1DPEA 4N17A 3PD8A 4X1DA 4ELOA 1MPCA 4FE8A 1FTMA 2WKYA 1B0LA 4N6KA 5JK4A 1BK4A 1FBHA 2CZIA 3ZS6A 3W9VA 3TQLA 2KQZA 3D1RA 3RPLB 4F18A 2WX9A 5DVIA 5AA4A 3BKIB 1EYIA 1Q35A 2XXPA 4EXKA 5ICQA 3U8QA 1WDNA 3LSWA 1LB9A 3TYHA 4F3PA 3SEXA 4F2OA 4OA4A 3B6TA 2CZKA 2XWIA 2DXYA 2R8TA 4R72A 2Q2CA 1MQIA 1DTZA 4RA1A 5EQ8A 2I3VA 4G61A 3IB1A 3CHGA 2VD2A 4C1UA 4N8GA 1IEJA 1DTGA 3IOVA 4HTGA 5HM4B 4N8YA 1FRPA 5I84A 3VVFA 2FNCA 4MMPA 4Q5TA 4UACA 3ILTB 5ET7A 5EHSA 1DSNA 2XXUA 3DM0A 2OPEA 3RT8A 3VLVA 3SEWA 2PMSA 4FORA 1GV8A 1LBYA 2H5YA 4GL0A 4AB6A 3EQ1A 3MQ9A 1TT1A 3S9LC 4R6HA 1LEVA 1URGA 1ZKBA 3U93A 4BDOA 1D4NA 2OZZA 4I1DA 2VT5A 3M3LA 1MXXA 4G8MA 4AS5A 5H8FB 3B8BA 5JTYB 4MCOA 3UN6A 3RTFB 2NOOA 2MKZA 1Y20A 4GWOA 1JW5A 4H0WA 3O9PA 1A40A 1USYE 1B2HA 1Y1ZA 3A3UA 3EPEA 4JSDA 2XD3A 4XEQA 4OETA 3FV1A 3DP8A 1UIUA 4EQ9A 4R2BA 4OVPA 4QFKA 4H46A 1AL3A 1H3DA 3JV9A 1YXIA 1LCFA 1MM7A 5I57B 5TU0A 3IOTA 4U2RA 1XT8A 1FBGA 5FHNA 3VXBA 4MHFA 3SEVA 3O2AA 4ZZEA 4FEDA 3Q27A 5IZ3B 1I6AA 1RYOA 5F1QA 2F6GA 3LV0A 5LOMA 4G77A 1B05A 4Z0IA 3GBBA 4IB2A 4H1XA 2O1LA 3WAEA 5EQ9A 3E4RA 1NV6A 2PFYA 4O7IA 1RKMA 3IL1B 4OEUA 5DW8A 1G0HA 3EN3A 3OXNA 3ILUB 1P1WA 3UIFA 3OO6A 2O84X 4ZZAA 2V3QA 3TMGA 4GVOA 4O94A 3D4GA 2PYYA 4IY5A 3EHUA 4NF6A 4XKQA 1VE4A 2XXQA 1FQFA 3TODA 1FPLA 3IFAA 2O7UA 4JWYA 3M8UA 4R6KA 3OOAA 5H8HA 3HHFA 3K00A 4ZEKA 4KCCA 4KYEA 4PFWA 4ELPA 2AYSA 4FATA 5L9MA 3CFXA 5KZTA 4AQ4A 2F34A 1SYIA 4KD5A 5ESYA 5A5LA 2ESNA 3KGCA 4G68B 2F7BA 5ELVA 2RINA 3MYUA 3B50A 2I49A 4E0WA 4C0RA 1JNFA 3TCFA 1O64A 2H4IA 5I2NA 4PGNA 4U23A 3T1BA 3CFLA 1RDXA 3G3IA 5L8DA 1O7TA 3MP6A 5B7DA 1UQWA 2DE2A 2UYFA 5DT6A 4HW8A 2O7IA 1MQGA 3T96B 2HQ0A 5JTYA 4IO4A 4XFEA 1QULA 3L6HA 1N3XA 4XTCQ 1FPBA 3K6WA 1Q1KA 2GHBA 1Y3PA 2F6PA 2H99A 4U1OA 5KCJA 3OD7A 1FPJA 4QFOA 4I40A 2UXAA 1NNKA 4JDFA 2XWOA 3Q28A 3N5LA 2ZYNA 4QSEA 1XVXA 1NI9A 3PPOA 2V4CA 5H8QB 5KDTA 2ABHA 4F3BA 1HSLA 3FVGA 3V5AA 1AIVA 2NWJA 3SERA 4MLQA 1IZ1A 2ZNTA 4PF8A 4PETA 3N6TA 1NV0A 1IMEA 4PE3A 4PAIA 3K2DA 4PTKA 1MXUA 3CRBA 2OX3A 1TXFA 1JEUA 1K9YA 1MH4A 4OFJA 3IK6B 1LCTA 2V3TA 4H5GA 1FQBA 1TWYA 2B65A 5TPAB 1QKAA 3IO6A 3K0VA 3IFCA 5EYFA 4P56A 2Z8EA 4OZ9A 1J1NA 1JEVA 4O8MA 4TOZA 2CEXA 1MH3A 2Q9TA 4O3AA 4THIA 3GBAA 4BDRA 3PTYA 4AS4A 2QJEA 3RPWA 2VOZA 3WAFA 3V83A 1H44A 4F1VA 3MUQA 2W7YA 5I2KA 2DP8A 1IMFA 4QF9A 3A09A 1B6HA 1B52A 1LBWA 4NMYA 1EZPA 2OPDA 1P1QA 1F9BA 4KR5A 5I57A 4BLAA 1QJMA 1NMUA 1LFIA 1P1UA 4ND9A 2Y7IA 4Q30B 4MBPA 1FPEA 1Z7NE 5H8NA 3FASA 3PUVE 3SDFA 4PFUA 1LBVA 1GVCA 1MRPA 3PUZE 1NL5A 1M5CA 4LZ7A 2NUVA 2ZZWA 4HXVA 4DXUA 3W15C 3LUYA 4RNSA 1SYHA 3U65A 2GH9A 3V89B 4HS7A 1N04A 3O6IA 3UP9A 1FBPA 4G4PA 4O3CA 3PMWA 3USDA 5ICTA 1EH3A 3K6VA 1RDZA 1VFEA 1SI1A 2I48A 3R6UA 2O6AA 4EF1A 1LAGE 5DYHA 3RQTA 4OEVA 2DYXA 5FBPA 1HSEA 3Q26A 3PUYE 3H6VA 4PP0A 3KSJA 1AOVA 1A54A 5H8QA 3S2VA 5ET5A 4QHQA 3O29A 4MJOA 3VDFA 3VVEA 2ZNUA 1PB9A 2HCAA 4LUBA 4GWXA 1R9QA 3QUJA 1JQFA 4ONYA 3K02A 1MS7A 5ISUA 5HBCA 4OMBA 4KI0E 3CFZA 1MXVA 5CMKA 4DLDA 1OQHA 3I3VA 3MP8A 4G8NA 1IIWA 1QUIA 1D3KA 3CSBA 1SI0A 4RK2A 2ZMBA 3RN8A 4C1TA 5BUUA 1PB7A 2REGA 4EF2A 5EYGA 4FAJA 1CB6A 4GWYA 4ZEDA 4F3GA 2THIA 1DK4A 1FQCA 1N76A 2PCRA 3KOTA 4Z7EA 1OVBA 2X7QA 1A8FA 2Y5LA 1M5DA 4KFQA 1IXIA 1DOTA 4OVSA 4X8RA 1FPFA 4G68A 2OJTA 2IA4A 1B3HA 2F7AA 4WKMA 1DCUA 3C35A 1HSJA 5K2YA 1H45A 2I3WA 4PC9A 5FTHA 3HCQA 1ZIUA 1KA1A 1B3GA 3FXUA 3FGSA 1MDP1 5IM2A 5CRYA 3KG2A 2DVCA 1LAHE 2XXVA 4GWZA 3S9NC 1IMCA 3OELA 2OK2A 4NF6B 3FBPA 3TUSA 5I2KB 5DVJA 1IUDA 1VFDA 1VDWA 5AA3A 1FBCA 4OERA 1KZ8A 1BP5A 4OFLA 5J1DA 3G3GA 3MP1A 2HXWA 3H06B 1LLSA 2XXXA 3TTMA 3K6XA 1MQDA 1ATGA 3KOSA 4FJPA 1B46A 4PFIA 1BIYA 1B3FA 5HPQA 1K9ZA 3RLFE 4OVQA 3K1PA 1NV5A 4R75A 1FPDA 4P9KA 2YPNA 3IJOB 1FPGA 4I62A 4DDDA 4GX3A 1A99A 1ELJA 2V3UA 2PBWA 4XXUA 1DMBA 4NF8A 3TFLA 4KXPA 3VLUA 1BKAA 1BTJA 3KN7A 1URSA 2DE3A 1AH5A 2UVHA 4GRKA 4JBZA 4U21A 1S50A 1LBCA 5EYHA 1OMPA 5L9OA 1B32A 4TQUQ 5A5XB 2RCBA 2Q89A 4YB7A 4HE0A 2A5TA 4MX6A 5CMMA 3THIA 2RF1A 4HE2A 1B3EA 5I56B 2I0BA 3A29A 1NH8A 2HEUA 3K1MA 2D21A 3N94A 3H4ZA 3H3GA 2O51A 3HV1A 1PBPA 1MG1A 4P0IA 2DWHA 4NWCA 3MSTA 2I6EA 4ESXA 5J16A 4PAKA 1SW4A 2HHMA 1B7HA 2QFLA 3CR9A 2H25A 2B3BA 5TP9B 3OSRA 4DIGA 1IMBA 4ZS9A 5ITPA 2XX7A 3MAMA 5F24A 4ELQA 2KR0A 4LZ8A 3RTWB 4ZEIA 2M8CA 3CIJA 1ZLQA 1O63A 4YICA 4N13A 2KLFA 1PDAA 3T93B 2HAVA 4NF4B 3IAZA 4KHZE 2VPNA 1QVSA 3IORA 3TAJA 2A5SA 3C9HA 4M1VA 1NV7A 3G3JA 3ECRA 1SPIA 3LC8A 4EQ7A 1AWBA 5I58A 2F3DA 3KBRA 1NFTA 3MVZA 3ONMA 3VV5A 3PPRA 1L5TA 1DPPA 4G2ZA 5IKBA 5IZZA 2Y5KA 1YZ0A 2PT1A 4QFLA 1NV2A 1EZOA 4O7MA 2YLNA 3TTNA 2CZLA 3RT6B 1DBZA 2X26A 5AA2A 1II5A 2V25A 1MQHA 4OANA 2UVIA 1P1OA 2A5TB 2AL5A 1YCJA 1URDA 3I5OA 1FQDA 2ZZVA 1MY4A 1XS5A 1PBQA 4RK9A 4QFNA 4X48A 1KWHA 4FIMA 3FXQA 1SVXB 4YZZA 3FVOA 3OENA 3KC0A 4ISUA 3PMVA 2Y7WA 4KCDA 4P11A 3ODBA 3HN0A 2QS1A 5I59A 5DVFA 3ROJA 1JVYA 2AIXA 3EF7A 2VPOA 2OWTA 4OQOA 2F5XA 2Y7RA 3H6UA 1NNTA 2QMWA 4OTEA 2ZYOA 3FATA 3FD3A 3T0JA 1CNQA 3PUWE 1QKBA 1Y4TA 1MM6A 1P1NA 1IMAA 1BLFA 4YKKA 1SW1A 3KBZA 3P7IA 1Y4CA 4RXLA 4PE5B 4NN3A 1XI6A 2HXRA 3CVGA 2DE4A 2WBBA 1FBFA 4GXAA
chains in the Genus database with same CATH topology
1IMCA 1FTAA 1QGXA 1YZ0A 3GYYA 4PDHA 5CM6A 1NV2A 4XEQA 5I3SA 1EYIA 1FSAA 4GWSA 3FBPA 4O7MA 5ESYA 5A5LA 3IFCA 3KC1A 5FBPA 3MSTA 4P3LA 4P1EA 4NGUA 4P56A 1VDWA 1FBCA 1FBEA 3MYUA 1DBZA 1NV1A 4O8MA 4OVTA 2CEXA 1G0IA 2Q9TA 1KZ8A 2XWKA 4I3YA 3B50A 4OA4A 1NUXA 4P47A 2CZKA 5J16A 2F3BA 1FBDA 2XWIA 4OANA 5J1DA 5ET5A 4PAKA 4OVPA 3PTYA 4QXDA 2R8TA 4AS4A 4N4UA 4MJOA 2QVVA 4PFRA 4H46A 2HPGA 1IMDA 1FJ9A 2L5VA 4HE1A 2HHMA 4NG7A 4H45A 5IZ3A 1RDYA 4GBWA 2WEFA 4JVDA 4F1VA 1YXIA 4PFBA 4PGNA 5EQ8A 2QFLA 4GWUA 4N15A 4N91A 4P1LA 1RDXA 2ZZVA 1NUZA 3T1BA 2Q8MA 4JVCA 2BJIA 4G61A 1IMBA 4GWXA 3ISPA 4PGPA 5LTCA 2WYKA 4NAPA 5LDZA 4PFIA 3CHGA 1FBGA 1IMFA 4N8GA 1NUWA 4GWZA 2DE2A 4NHBA 2FBPA 1EYJA 4HCYA 4MHFA 2DVZA 5F24A 1Q9DA 1JP4A 1LBWA 2FVZA 1LBXA 1NUYA 5IZ1A 3RPLA 2KR0A 3W9WA 1K9ZA 3E79A 3HFUA 5I7IA 3RYDA 2DDKA 4N8YA 3BIHA 4OVQA 4XFEA 1NV5A 1FRPA 5IZ3B 2WBDA 4N6DA 4PAFA 4YZZA 1FPDA 4P9KA 5I5PA 2CZHA 4OVRA 1FPIA 1FPGA 3KC0A 3LV0A 4MMPA 2CEYA 4MNIA 4GWWA 1FPBA 2B4MA 4YICA 2FHYA 3LUZA 4PCDA 4N81A 5ET7A 2FIEA 4GX3A 4X9TA 4DI3D 2WYPA 1EYKA 1FPEA 1FPJA 4I3EA 5EQ9A 4I40A 4XF5A 5EYGA 1LBVA 2ZZXA 1NV6A 4F1UA 2PFYA 4O7IA 5ET6A 2Q74A 2XWOA 4GWYA 1INPA 5DW8A 2OWZA 5ET8A 5T3JA 2XWVA 4PBQA 1DK4A 1G0HA 2VPNA 4KXPA 1KA0A 1D9QA 2PCRA 4DI4B 3ROJA 1LBYA 3E78A 4JVIA 2P3NA 2ZZWA 2DE3A 4PF6A 4GX4A 1NI9A 2QVRA 4HXVA 2V4CA 2Y5LA 4M1VA 4P8BA 4MNCA 2VPOA 2F5XA 4PDDA 1NV7A 4IR8A 4NQ8A 1FPKA 2V3QA 2QVUA 3FXBA 4OVSA 2XXKA 4UABA 4X8RA 2HZLA 3U65A 1FPFA 5EYHA 4NF0A 1LEVA 3T0JA 4O94A 4QBAA 1CNQA 2P3VA 4GX6A 5EQ7A 4N17A 1SPIA 2VT5A 4PBHA 4GBVA 1AWBA 3EKIA 4MIJA 4PF8A 4LN5A 2F3DA 4HE0A 3BIGA 2HZKA 4AS5A 4MAGA 1DCUA 3B8BA 4PETA 1NV0A 1IMEA 4PE3A 4MEVA 4PAIA 1IMAA 1FBPA 4MCOA 4MX6A 2B4LA 2QPQA 4N6KA 4PC9A 4X04A 3SZPA 1FPLA 5JK4A 1BK4A 1FBHA 1YYZA 3IFAA 3KBZA 4HE2A 2CZIA 1LBZA 2JJKA 4PTKA 2MKZA 4NX1A 1KA1A 2PFZA 2OX3A 4MNPA 3A29A 1K9YA 2FIXA 1XI6A 2HXRA 4NN3A 2XA5A 3W9VA 5EQAA 1RDZA 5IM2A 2KQZA 4FBPA 3NOHA 2GQ1A 2DE4A 2WBBA 1FBFA 3D1RA 3RPLB 4F19A 4F18A 1NV3A 2WX9A 1FJ6A 4HCWA 5IGAA 1NV4A 3QMFA 5IZZA 2Y5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMC A;  1FTA A;  1QGX A;  1YZ0 A;  1NV2 A;  5I3S A;  1EYI A;  1FSA A;  4GWS A;  3FBP A;  5ESY A;  5A5L A;  3IFC A;  3KC1 A;  5FBP A;  1VDW A;  1FBC A;  1FBE A;  1DBZ A;  1NV1 A;  1G0I A;  1KZ8 A;  4I3Y A;  1NUX A;  2CZK A;  5J16 A;  2F3B A;  1FBD A;  5ET5 A;  4QXD A;  2R8T A;  4AS4 A;  4MJO A;  2QVV A;  4H46 A;  1IMD A;  1FJ9 A;  4HE1 A;  2HHM A;  4H45 A;  5IZ3 A;  1RDY A;  4GBW A;  2WEF A;  1YXI A;  5EQ8 A;  2QFL A;  4GWU A;  1RDX A;  1NUZ A;  2Q8M A;  2BJI A;  4G61 A;  1IMB A;  4GWX A;  5LDZ A;  1FBG A;  1IMF A;  1NUW A;  4GWZ A;  2FBP A;  1EYJ A;  5F24 A;  1Q9D A;  1JP4 A;  1LBW A;  2FVZ A;  1LBX A;  1NUY A;  5IZ1 A;  3RPL A;  1K9Z A;  3RYD A;  2DDK A;  3BIH A;  1NV5 A;  1FRP A;  5IZ3 B;  2WBD A;  1FPD A;  2CZH A;  1FPI A;  1FPG A;  3KC0 A;  3LV0 A;  4GWW A;  1FPB A;  2FHY A;  3LUZ A;  4N81 A;  5ET7 A;  2FIE A;  4GX3 A;  1EYK A;  1FPE A;  1FPJ A;  4I3E A;  5EQ9 A;  4I40 A;  5EYG A;  1LBV A;  1NV6 A;  4O7I A;  5ET6 A;  2Q74 A;  4GWY A;  1INP A;  5DW8 A;  2OWZ A;  5ET8 A;  5T3J A;  1DK4 A;  1G0H A;  4KXP A;  1KA0 A;  1D9Q A;  2PCR A;  3ROJ A;  1LBY A;  2P3N A;  4GX4 A;  1NI9 A;  2QVR A;  4HXV A;  2Y5L A;  1NV7 A;  4IR8 A;  1FPK A;  2QVU A;  1FPF A;  5EYH A;  1LEV A;  3T0J A;  1CNQ A;  2P3V A;  4GX6 A;  5EQ7 A;  1SPI A;  2VT5 A;  4GBV A;  1AWB A;  2F3D A;  4HE0 A;  3BIG A;  4AS5 A;  1DCU A;  3B8B A;  1NV0 A;  1IME A;  1IMA A;  1FBP A;  1FPL A;  1BK4 A;  1FBH A;  1YYZ A;  3IFA A;  3KBZ A;  4HE2 A;  2CZI A;  1LBZ A;  2JJK A;  4PTK A;  1KA1 A;  2OX3 A;  3A29 A;  1K9Y A;  2FIX A;  1XI6 A;  5EQA A;  1RDZ A;  4FBP A;  2GQ1 A;  2WBB A;  1FBF A;  3D1R A;  3RPL B;  1NV3 A;  1FJ6 A;  1NV4 A;  3QMF A;  2Y5K A; 
#chains in the Genus database with same CATH topology
 3G3F A;  3T9U A;  2RCA A;  1FTO A;  1UTB A;  2X7P A;  4DCX A;  1LGB C;  4NGU A;  3SKP A;  3PD9 A;  3UK4 A;  1R9L A;  2RC9 A;  1NUX A;  4QXD A;  4N4U A;  1M5F A;  1IXH A;  1B5J A;  1IMD A;  4PQJ A;  1RDY A;  2ZNS A;  1GR2 A;  1LBB A;  5L9S A;  3FJ7 A;  1NUZ A;  3ISP A;  4NAP A;  4IO6 A;  4NHB A;  1POY 1;  5B70 A;  4IO7 A;  4DXC A;  1Q9D A;  1JP4 A;  3RPL A;  3A3C A;  3FVN A;  4XKN A;  3O66 A;  3HFU A;  5I7I A;  3HO7 A;  2WBD A;  1D9Y A;  3PPP A;  1N3W A;  3OSQ A;  2O1M A;  4MNI A;  4N07 A;  4EUO A;  3UA8 A;  1B4Z A;  3OEM A;  1EYK A;  3HST A;  2XXH A;  2D3I A;  1UTH B;  1H76 A;  3JZJ A;  1A7L A;  1TFD A;  1UTB B;  3KZG A;  4JWO A;  3OO8 A;  2PX1 A;  1AMF A;  3PPN A;  5I56 A;  3K4U A;  2QVR A;  3F11 A;  4MNC A;  2F35 A;  3QIM A;  2F36 A;  3FXR A;  4U22 A;  1N0T A;  3S9M C;  4GBV A;  4UA8 A;  4MIJ A;  4F39 A;  3MPK A;  1OQG A;  2DOJ A;  4ZEC A;  4YMA A;  5DEX A;  1SW5 A;  2F97 A;  3LSL A;  3KN3 A;  2QSX A;  4MNP A;  5EQA A;  3PUX E;  1IXG A;  5IGA A;  3R26 A;  3QK6 A;  2XXY A;  1LAX A;  3B6Q A;  2Z8F A;  4POW A;  1B3L A;  5I3S A;  4GWS A;  3DLN A;  1NKX A;  3T22 A;  3VFJ A;  4P3L A;  1FTK A;  1FBE A;  4F29 A;  3TEL A;  2Y84 A;  2B3F A;  3FV2 A;  2FA7 A;  3TTK A;  1FTJ A;  4KYD A;  3C33 A;  2QVV A;  2OCU A;  1FJ9 A;  4KQP A;  3TZA A;  1VSO A;  1S7Y A;  3L6G A;  4JVD A;  3E9X A;  1ZTY A;  4N15 A;  2XXT A;  1RYX A;  3O6H A;  2UVG A;  1N84 A;  4I8C A;  5F7V A;  1US4 A;  5M2V A;  1B1H A;  3W9W A;  1NUY A;  1ZMG A;  3RYD A;  3BFU A;  3PGF A;  1XHY A;  2VP1 A;  1FTL A;  4PAF A;  1OLA A;  1B9J A;  4LZ5 A;  4GXS B;  1MXY A;  4OVR A;  4G68 C;  2FHY A;  3H7M A;  4YKJ A;  4I3E A;  2UYE A;  3IO4 A;  4DCY A;  4LA9 A;  3T66 A;  3MWB A;  1KA0 A;  4NF5 A;  3V8X B;  2ONS A;  2YJP A;  1JW1 A;  4NQ8 A;  2QVU A;  1IXC A;  3TEP A;  5EQ7 A;  4QSD A;  2QRY A;  1WVJ A;  3RGY A;  4H6D A;  2Z8D A;  2FYI A;  2I4B A;  1YYZ A;  4F19 A;  1LBZ A;  2NXO A;  1SDX A;  4H5F A;  1QUJ A;  3T9V A;  4HCW A;  1S9T A;  3QMF A;  4RYA A;  1FQA A;  1QGX A;  1CE2 A;  3IJX B;  5CBR A;  3T9H B;  3ZSF A;  1LFH A;  1MPB A;  1A55 A;  3KFM A;  4OVT A;  3O6G A;  1B51 A;  1FQE A;  3MVW A;  1R1N A;  5FHO A;  4PFR A;  4G8H A;  4PFY A;  2WEF A;  5CC2 A;  4P1L A;  4N91 A;  4GWU A;  4U1Z A;  4U4X A;  2XX8 A;  2E1S A;  3G3K A;  2BJI A;  1I6Q A;  4OES A;  3EHS A;  1EZ9 A;  5LTC A;  3Q29 A;  4KPT A;  1ANF A;  3D4C A;  4NE4 A;  4IO5 A;  5KDT B;  2Z23 A;  2VD3 A;  4R73 A;  4IGT A;  5IZ1 A;  2FVZ A;  1VR5 A;  5TP9 A;  5AA2 D;  2RKM A;  2QMX A;  3C4M A;  2CZH A;  2O68 A;  2Q2A A;  5KCJ B;  2OBG A;  5I59 B;  4X9T A;  3IX1 A;  4DI3 D;  3MBP A;  3OO7 A;  2ZZX A;  1H43 A;  2XWV A;  3N6U A;  3VE1 B;  2ANJ A;  4TLM B;  3VXC A;  1D9Q A;  2NVU B;  4DI4 B;  3C36 A;  3E13 X;  4POX A;  3E78 A;  4F22 A;  4P8B A;  4LQ5 A;  3DP4 A;  3FJG A;  3RNN A;  2F78 A;  2VGQ A;  4PBH A;  1B5H A;  3BIG A;  3OO9 A;  4WED A;  3OMB A;  5A5X A;  4ECF A;  4R6Y A;  4KYS A;  2DWA A;  1POT A;  3C34 A;  1P99 A;  1D9V A;  1SW2 A;  1FSA A;  1MPD A;  4WEP A;  4R2F A;  2GHA A;  1USY H;  4XKR A;  4YKP A;  4IO3 A;  4RY1 A;  5BWJ A;  2DWJ A;  5FTI A;  3R7X A;  3U1O A;  2PT2 A;  3C32 A;  4NG7 A;  4BDQ A;  1QUK A;  2WYK A;  4LAT A;  2LAO A;  5CMC A;  1Y1M A;  1NUW A;  2G29 A;  3VLW A;  2FBP A;  3FVK A;  4DZ1 A;  4DE8 A;  2QS3 A;  5I58 B;  4Q0C A;  4LQ2 A;  2Y7K A;  3QSL A;  4X1B A;  4BDN A;  1TFA A;  4ZE8 A;  3HPI A;  5TPA A;  3KSX A;  4GWW A;  4ELR A;  3TCG A;  4PCD A;  3TTR A;  2FIE A;  4LVQ A;  5AE4 A;  1MY3 A;  5ET6 A;  2OWZ A;  4PBQ A;  4PFT A;  1LFG A;  4PF6 A;  3H03 A;  1B40 A;  3TDJ A;  4OYV A;  4UAB A;  2ONR A;  4XIG Q;  3MC2 A;  4NF0 A;  2P3V A;  4MAG A;  3DEL B;  3FUZ A;  1I69 A;  1YPN A;  4GQO A;  4X04 A;  2QPQ A;  1US5 A;  5DEX B;  3UOR A;  1A8E A;  2R6G E;  3BFT A;  1FCK A;  1XC1 A;  2REJ A;  4BDL A;  3NOH A;  4NWD A;  3MJN A;  2I4C A;  1FJ6 A;  4MLV A;  3PPQ A;  3LSF B;  3C31 A;  2DSF A;  3QAX A;  4YKI A;  4GL8 A;  3SEY A;  3KC1 A;  3KJT A;  2OLB A;  4YU0 A;  1ZJL A;  1NV1 A;  2I58 A;  3T9X B;  1UTH A;  4DXB A;  2F3B A;  2R71 A;  3BBR A;  1I6B A;  3FZV A;  3LBS A;  4H8J A;  1Y3Q A;  4EQB A;  3AXF A;  4GBW A;  4PFB A;  1QW0 A;  3U72 A;  4GD5 A;  4IY6 A;  1ZBM A;  3G7W A;  3SET A;  3MVY A;  1OVT A;  4ZEF A;  3B7D A;  3QXM A;  2F7C A;  1LB8 A;  3K1N A;  2DDK A;  4P0G A;  1Z7M E;  1FW0 A;  3ZKL A;  5I5P A;  2CEY A;  3H6T A;  3KN8 A;  2I0C A;  2ZXT A;  2WYP A;  1N7W A;  1MDQ A;  4E0X A;  3S9E A;  4XF5 A;  2E0S A;  3TCH A;  1INP A;  5JEI A;  3O28 A;  4MF3 A;  4NF4 A;  4JVI A;  2P3N A;  3MW0 A;  3B6W A;  4ZE9 A;  4FEB A;  2HZL A;  4ZEB A;  2F8D A;  2QS2 A;  3FIR A;  3MPL A;  4QBA A;  2DXR A;  1ZU0 A;  4JSO A;  2CMO A;  2VHA A;  4N6P A;  2HZK A;  5K2X A;  2DWI A;  4MEV A;  3IB0 A;  4R9F A;  2B4L A;  3IR1 A;  1MXW A;  2QS4 A;  3G3H A;  2O69 A;  2JJK A;  1YTV A;  4NX1 A;  2IEE A;  2RC8 A;  2XA5 A;  1Y9U A;  4FBP A;  1GTK A;  4QRZ A;  4OHN A;  2Q8J A;  1LST A;  1Y3N A;  1JVX A;  3DP6 A;  4L17 A;  3K01 A;  4EDP A;  1SQY A;  3I6V A;  4O3B A;  2PVU A;  1B0H A;  2XWK A;  1LAF E;  4I3Y A;  3GLB A;  1SBP A;  4XKP A;  4NF5 B;  3E3K A;  1M5E A;  1M5B A;  2HAU A;  4YAH X;  1R6Z A;  2XD2 A;  2Q8M A;  4PGP A;  5LDZ A;  2V93 A;  3U92 A;  2QL3 A;  1EYJ A;  3QUF A;  1EU8 A;  4ESW A;  3H6W A;  2BJJ X;  4LP2 B;  4ZDM A;  1MY0 A;  1FPI A;  3CG3 A;  2XXI A;  2GRV A;  2OWS A;  4WXJ A;  4F31 B;  4N81 A;  1PB8 A;  3PV0 E;  4GF8 A;  3TQW A;  4MFI A;  3SES A;  4F1U A;  5AA2 B;  3PU5 A;  4K3F A;  4NF8 B;  3RUM A;  3O97 A;  5FHM A;  3ZKK A;  2P2A A;  4RJZ A;  3MZ9 A;  5H8F A;  3FXB A;  3RY3 A;  3U94 A;  1JET A;  1WOD A;  3EKI A;  4LN5 A;  4QSC A;  1IIT A;  1B7U A;  3M3F A;  4P1E A;  1B1X A;  2PFZ A;  2FIX A;  3UGW A;  1UIV A;  3FJM A;  2R9J A;  1NV3 A;  3LR1 A;  2V84 A;  1FTA A;  3GYY A;  4F1Y A;  4H8I A;  5CMB A;  3N26 A;  4U4S A;  2DQV A;  1T0K A;  1MY2 A;  4TLL B;  5EHM A;  4H65 A;  2UVJ A;  4P47 A;  3IOW A;  4EXL A;  3IOU A;  4GLI A;  2P0S A;  2HPG A;  1MXZ A;  4R9G A;  5ITO A;  3TTL A;  4H45 A;  3IB2 A;  3VVD A;  2H98 A;  2Z22 A;  1NNF A;  3S4U A;  1YAE A;  2D5W A;  5CBS A;  4HCY A;  2DVZ A;  4R74 A;  1LBX A;  2G93 A;  3GZG A;  4NTL A;  3E79 A;  5I2N B;  3HHG A;  4N6D A;  2AL4 A;  3CSG A;  2HFB A;  4OWD A;  5H8S A;  1XVY A;  2B4M A;  3KJ7 A;  2P1S A;  3LUZ A;  5AA4 B;  4FEC A;  3KEI A;  1B58 A;  3EHT A;  5IAI A;  1PEB A;  1N7X A;  4GOT A;  3JYR A;  4IO2 A;  4I9D A;  2Q74 A;  2DS9 A;  5T3J A;  4QFP A;  4F2Q A;  1B7Z A;  4PDD A;  1FPK A;  5H8H B;  2XHD A;  4M4G A;  4GX6 A;  1PC3 A;  4YMB A;  3MVX A;  2XX9 A;  3SZP A;  4OVJ A;  5DTB A;  3MZB A;  1B4H A;  1IQ7 A;  2XXW A;  4JB7 A;  4LON B;  4OXV A;  3TKD A;  2GQ1 A;  4RPN A;  2ZYM A;  1NV4 A;  2H9B A;  4IGR A;  4PDH A;  5CM6 A;  3PMX A;  4F3S A;  1NH7 A;  3QYT A;  2GFE A;  3M3K A;  5CI5 A;  1OIB A;  3SEU A;  1G0I A;  1NNP A;  4YB6 A;  4RPO A;  5AA1 A;  1FBD A;  1XOC A;  3CI8 A;  2ALU A;  2Q88 A;  2L5V A;  4HE1 A;  5IZ3 A;  3MZ1 A;  4AB5 A;  3TPA A;  4OEN A;  2XXR A;  4JVC A;  2Y7P A;  3OEK A;  2RC7 A;  4GFR A;  3K6U A;  4YB5 A;  4OFO A;  3CG1 A;  4JXI A;  4H67 A;  3Q25 A;  3BIH A;  4MH5 A;  1B5I A;  1MY1 A;  4Q8R A;  3GXA A;  1OLC A;  4JWX A;  1MQJ A;  5ET8 A;  1SD3 A;  4GIZ A;  3LSX A;  4GX4 A;  5H8N B;  2ZYK A;  1JW4 A;  2ONK E;  4IR8 A;  1GGG A;  2XXK A;  4BDM A;  4NED A;  1DPE A;  4N17 A;  3PD8 A;  4X1D A;  4ELO A;  1MPC A;  4FE8 A;  1FTM A;  2WKY A;  1B0L A;  4N6K A;  5JK4 A;  1BK4 A;  1FBH A;  2CZI A;  3ZS6 A;  3W9V A;  3TQL A;  2KQZ A;  3D1R A;  3RPL B;  4F18 A;  2WX9 A;  5DVI A;  5AA4 A;  3BKI B;  1EYI A;  1Q35 A;  2XXP A;  4EXK A;  5ICQ A;  3U8Q A;  1WDN A;  3LSW A;  1LB9 A;  3TYH A;  4F3P A;  3SEX A;  4F2O A;  4OA4 A;  3B6T A;  2CZK A;  2XWI A;  2DXY A;  2R8T A;  4R72 A;  2Q2C A;  1MQI A;  1DTZ A;  4RA1 A;  5EQ8 A;  2I3V A;  4G61 A;  3IB1 A;  3CHG A;  2VD2 A;  4C1U A;  4N8G A;  1IEJ A;  1DTG A;  3IOV A;  4HTG A;  5HM4 B;  4N8Y A;  1FRP A;  5I84 A;  3VVF A;  2FNC A;  4MMP A;  4Q5T A;  4UAC A;  3ILT B;  5ET7 A;  5EHS A;  1DSN A;  2XXU A;  3DM0 A;  2OPE A;  3RT8 A;  3VLV A;  3SEW A;  2PMS A;  4FOR A;  1GV8 A;  1LBY A;  2H5Y A;  4GL0 A;  4AB6 A;  3EQ1 A;  3MQ9 A;  1TT1 A;  3S9L C;  4R6H A;  1LEV A;  1URG A;  1ZKB A;  3U93 A;  4BDO A;  1D4N A;  2OZZ A;  4I1D A;  2VT5 A;  3M3L A;  1MXX A;  4G8M A;  4AS5 A;  5H8F B;  3B8B A;  5JTY B;  4MCO A;  3UN6 A;  3RTF B;  2NOO A;  2MKZ A;  1Y20 A;  4GWO A;  1JW5 A;  4H0W A;  3O9P A;  1A40 A;  1USY E;  1B2H A;  1Y1Z A;  3A3U A;  3EPE A;  4JSD A;  2XD3 A;  4XEQ A;  4OET A;  3FV1 A;  3DP8 A;  1UIU A;  4EQ9 A;  4R2B A;  4OVP A;  4QFK A;  4H46 A;  1AL3 A;  1H3D A;  3JV9 A;  1YXI A;  1LCF A;  1MM7 A;  5I57 B;  5TU0 A;  3IOT A;  4U2R A;  1XT8 A;  1FBG A;  5FHN A;  3VXB A;  4MHF A;  3SEV A;  3O2A A;  4ZZE A;  4FED A;  3Q27 A;  5IZ3 B;  1I6A A;  1RYO A;  5F1Q A;  2F6G A;  3LV0 A;  5LOM A;  4G77 A;  1B05 A;  4Z0I A;  3GBB A;  4IB2 A;  4H1X A;  2O1L A;  3WAE A;  5EQ9 A;  3E4R A;  1NV6 A;  2PFY A;  4O7I A;  1RKM A;  3IL1 B;  4OEU A;  5DW8 A;  1G0H A;  3EN3 A;  3OXN A;  3ILU B;  1P1W A;  3UIF A;  3OO6 A;  2O84 X;  4ZZA A;  2V3Q A;  3TMG A;  4GVO A;  4O94 A;  3D4G A;  2PYY A;  4IY5 A;  3EHU A;  4NF6 A;  4XKQ A;  1VE4 A;  2XXQ A;  1FQF A;  3TOD A;  1FPL A;  3IFA A;  2O7U A;  4JWY A;  3M8U A;  4R6K A;  3OOA A;  5H8H A;  3HHF A;  3K00 A;  4ZEK A;  4KCC A;  4KYE A;  4PFW A;  4ELP A;  2AYS A;  4FAT A;  5L9M A;  3CFX A;  5KZT A;  4AQ4 A;  2F34 A;  1SYI A;  4KD5 A;  5ESY A;  5A5L A;  2ESN A;  3KGC A;  4G68 B;  2F7B A;  5ELV A;  2RIN A;  3MYU A;  3B50 A;  2I49 A;  4E0W A;  4C0R A;  1JNF A;  3TCF A;  1O64 A;  2H4I A;  5I2N A;  4PGN A;  4U23 A;  3T1B A;  3CFL A;  1RDX A;  3G3I A;  5L8D A;  1O7T A;  3MP6 A;  5B7D A;  1UQW A;  2DE2 A;  2UYF A;  5DT6 A;  4HW8 A;  2O7I A;  1MQG A;  3T96 B;  2HQ0 A;  5JTY A;  4IO4 A;  4XFE A;  1QUL A;  3L6H A;  1N3X A;  4XTC Q;  1FPB A;  3K6W A;  1Q1K A;  2GHB A;  1Y3P A;  2F6P A;  2H99 A;  4U1O A;  5KCJ A;  3OD7 A;  1FPJ A;  4QFO A;  4I40 A;  2UXA A;  1NNK A;  4JDF A;  2XWO A;  3Q28 A;  3N5L A;  2ZYN A;  4QSE A;  1XVX A;  1NI9 A;  3PPO A;  2V4C A;  5H8Q B;  5KDT A;  2ABH A;  4F3B A;  1HSL A;  3FVG A;  3V5A A;  1AIV A;  2NWJ A;  3SER A;  4MLQ A;  1IZ1 A;  2ZNT A;  4PF8 A;  4PET A;  3N6T A;  1NV0 A;  1IME A;  4PE3 A;  4PAI A;  3K2D A;  4PTK A;  1MXU A;  3CRB A;  2OX3 A;  1TXF A;  1JEU A;  1K9Y A;  1MH4 A;  4OFJ A;  3IK6 B;  1LCT A;  2V3T A;  4H5G A;  1FQB A;  1TWY A;  2B65 A;  5TPA B;  1QKA A;  3IO6 A;  3K0V A;  3IFC A;  5EYF A;  4P56 A;  2Z8E A;  4OZ9 A;  1J1N A;  1JEV A;  4O8M A;  4TOZ A;  2CEX A;  1MH3 A;  2Q9T A;  4O3A A;  4THI A;  3GBA A;  4BDR A;  3PTY A;  4AS4 A;  2QJE A;  3RPW A;  2VOZ A;  3WAF A;  3V83 A;  1H44 A;  4F1V A;  3MUQ A;  2W7Y A;  5I2K A;  2DP8 A;  1IMF A;  4QF9 A;  3A09 A;  1B6H A;  1B52 A;  1LBW A;  4NMY A;  1EZP A;  2OPD A;  1P1Q A;  1F9B A;  4KR5 A;  5I57 A;  4BLA A;  1QJM A;  1NMU A;  1LFI A;  1P1U A;  4ND9 A;  2Y7I A;  4Q30 B;  4MBP A;  1FPE A;  1Z7N E;  5H8N A;  3FAS A;  3PUV E;  3SDF A;  4PFU A;  1LBV A;  1GVC A;  1MRP A;  3PUZ E;  1NL5 A;  1M5C A;  4LZ7 A;  2NUV A;  2ZZW A;  4HXV A;  4DXU A;  3W15 C;  3LUY A;  4RNS A;  1SYH A;  3U65 A;  2GH9 A;  3V89 B;  4HS7 A;  1N04 A;  3O6I A;  3UP9 A;  1FBP A;  4G4P A;  4O3C A;  3PMW A;  3USD A;  5ICT A;  1EH3 A;  3K6V A;  1RDZ A;  1VFE A;  1SI1 A;  2I48 A;  3R6U A;  2O6A A;  4EF1 A;  1LAG E;  5DYH A;  3RQT A;  4OEV A;  2DYX A;  5FBP A;  1HSE A;  3Q26 A;  3PUY E;  3H6V A;  4PP0 A;  3KSJ A;  1AOV A;  1A54 A;  5H8Q A;  3S2V A;  5ET5 A;  4QHQ A;  3O29 A;  4MJO A;  3VDF A;  3VVE A;  2ZNU A;  1PB9 A;  2HCA A;  4LUB A;  4GWX A;  1R9Q A;  3QUJ A;  1JQF A;  4ONY A;  3K02 A;  1MS7 A;  5ISU A;  5HBC A;  4OMB A;  4KI0 E;  3CFZ A;  1MXV A;  5CMK A;  4DLD A;  1OQH A;  3I3V A;  3MP8 A;  4G8N A;  1IIW A;  1QUI A;  1D3K A;  3CSB A;  1SI0 A;  4RK2 A;  2ZMB A;  3RN8 A;  4C1T A;  5BUU A;  1PB7 A;  2REG A;  4EF2 A;  5EYG A;  4FAJ A;  1CB6 A;  4GWY A;  4ZED A;  4F3G A;  2THI A;  1DK4 A;  1FQC A;  1N76 A;  2PCR A;  3KOT A;  4Z7E A;  1OVB A;  2X7Q A;  1A8F A;  2Y5L A;  1M5D A;  4KFQ A;  1IXI A;  1DOT A;  4OVS A;  4X8R A;  1FPF A;  4G68 A;  2OJT A;  2IA4 A;  1B3H A;  2F7A A;  4WKM A;  1DCU A;  3C35 A;  1HSJ A;  5K2Y A;  1H45 A;  2I3W A;  4PC9 A;  5FTH A;  3HCQ A;  1ZIU A;  1KA1 A;  1B3G A;  3FXU A;  3FGS A;  1MDP 1;  5IM2 A;  5CRY A;  3KG2 A;  2DVC A;  1LAH E;  2XXV A;  4GWZ A;  3S9N C;  1IMC A;  3OEL A;  2OK2 A;  4NF6 B;  3FBP A;  3TUS A;  5I2K B;  5DVJ A;  1IUD A;  1VFD A;  1VDW A;  5AA3 A;  1FBC A;  4OER A;  1KZ8 A;  1BP5 A;  4OFL A;  5J1D A;  3G3G A;  3MP1 A;  2HXW A;  3H06 B;  1LLS A;  2XXX A;  3TTM A;  3K6X A;  1MQD A;  1ATG A;  3KOS A;  4FJP A;  1B46 A;  4PFI A;  1BIY A;  1B3F A;  5HPQ A;  1K9Z A;  3RLF E;  4OVQ A;  3K1P A;  1NV5 A;  4R75 A;  1FPD A;  4P9K A;  2YPN A;  3IJO B;  1FPG A;  4I62 A;  4DDD A;  4GX3 A;  1A99 A;  1ELJ A;  2V3U A;  2PBW A;  4XXU A;  1DMB A;  4NF8 A;  3TFL A;  4KXP A;  3VLU A;  1BKA A;  1BTJ A;  3KN7 A;  1URS A;  2DE3 A;  1AH5 A;  2UVH A;  4GRK A;  4JBZ A;  4U21 A;  1S50 A;  1LBC A;  5EYH A;  1OMP A;  5L9O A;  1B32 A;  4TQU Q;  5A5X B;  2RCB A;  2Q89 A;  4YB7 A;  4HE0 A;  2A5T A;  4MX6 A;  5CMM A;  3THI A;  2RF1 A;  4HE2 A;  1B3E A;  5I56 B;  2I0B A;  3A29 A;  1NH8 A;  2HEU A;  3K1M A;  2D21 A;  3N94 A;  3H4Z A;  3H3G A;  2O51 A;  3HV1 A;  1PBP A;  1MG1 A;  4P0I A;  2DWH A;  4NWC A;  3MST A;  2I6E A;  4ESX A;  5J16 A;  4PAK A;  1SW4 A;  2HHM A;  1B7H A;  2QFL A;  3CR9 A;  2H25 A;  2B3B A;  5TP9 B;  3OSR A;  4DIG A;  1IMB A;  4ZS9 A;  5ITP A;  2XX7 A;  3MAM A;  5F24 A;  4ELQ A;  2KR0 A;  4LZ8 A;  3RTW B;  4ZEI A;  2M8C A;  3CIJ A;  1ZLQ A;  1O63 A;  4YIC A;  4N13 A;  2KLF A;  1PDA A;  3T93 B;  2HAV A;  4NF4 B;  3IAZ A;  4KHZ E;  2VPN A;  1QVS A;  3IOR A;  3TAJ A;  2A5S A;  3C9H A;  4M1V A;  1NV7 A;  3G3J A;  3ECR A;  1SPI A;  3LC8 A;  4EQ7 A;  1AWB A;  5I58 A;  2F3D A;  3KBR A;  1NFT A;  3MVZ A;  3ONM A;  3VV5 A;  3PPR A;  1L5T A;  1DPP A;  4G2Z A;  5IKB A;  5IZZ A;  2Y5K A;  1YZ0 A;  2PT1 A;  4QFL A;  1NV2 A;  1EZO A;  4O7M A;  2YLN A;  3TTN A;  2CZL A;  3RT6 B;  1DBZ A;  2X26 A;  5AA2 A;  1II5 A;  2V25 A;  1MQH A;  4OAN A;  2UVI A;  1P1O A;  2A5T B;  2AL5 A;  1YCJ A;  1URD A;  3I5O A;  1FQD A;  2ZZV A;  1MY4 A;  1XS5 A;  1PBQ A;  4RK9 A;  4QFN A;  4X48 A;  1KWH A;  4FIM A;  3FXQ A;  1SVX B;  4YZZ A;  3FVO A;  3OEN A;  3KC0 A;  4ISU A;  3PMV A;  2Y7W A;  4KCD A;  4P11 A;  3ODB A;  3HN0 A;  2QS1 A;  5I59 A;  5DVF A;  3ROJ A;  1JVY A;  2AIX A;  3EF7 A;  2VPO A;  2OWT A;  4OQO A;  2F5X A;  2Y7R A;  3H6U A;  1NNT A;  2QMW A;  4OTE A;  2ZYO A;  3FAT A;  3FD3 A;  3T0J A;  1CNQ A;  3PUW E;  1QKB A;  1Y4T A;  1MM6 A;  1P1N A;  1IMA A;  1BLF A;  4YKK A;  1SW1 A;  3KBZ A;  3P7I A;  1Y4C A;  4RXL A;  4PE5 B;  4NN3 A;  1XI6 A;  2HXR A;  3CVG A;  2DE4 A;  2WBB A;  1FBF A;  4GXA A; 
#chains in the Genus database with same CATH homology
 1IMC A;  1FTA A;  1QGX A;  1YZ0 A;  3GYY A;  4PDH A;  5CM6 A;  1NV2 A;  4XEQ A;  5I3S A;  1EYI A;  1FSA A;  4GWS A;  3FBP A;  4O7M A;  5ESY A;  5A5L A;  3IFC A;  3KC1 A;  5FBP A;  3MST A;  4P3L A;  4P1E A;  4NGU A;  4P56 A;  1VDW A;  1FBC A;  1FBE A;  3MYU A;  1DBZ A;  1NV1 A;  4O8M A;  4OVT A;  2CEX A;  1G0I A;  2Q9T A;  1KZ8 A;  2XWK A;  4I3Y A;  3B50 A;  4OA4 A;  1NUX A;  4P47 A;  2CZK A;  5J16 A;  2F3B A;  1FBD A;  2XWI A;  4OAN A;  5J1D A;  5ET5 A;  4PAK A;  4OVP A;  3PTY A;  4QXD A;  2R8T A;  4AS4 A;  4N4U A;  4MJO A;  2QVV A;  4PFR A;  4H46 A;  2HPG A;  1IMD A;  1FJ9 A;  2L5V A;  4HE1 A;  2HHM A;  4NG7 A;  4H45 A;  5IZ3 A;  1RDY A;  4GBW A;  2WEF A;  4JVD A;  4F1V A;  1YXI A;  4PFB A;  4PGN A;  5EQ8 A;  2QFL A;  4GWU A;  4N15 A;  4N91 A;  4P1L A;  1RDX A;  2ZZV A;  1NUZ A;  3T1B A;  2Q8M A;  4JVC A;  2BJI A;  4G61 A;  1IMB A;  4GWX A;  3ISP A;  4PGP A;  5LTC A;  2WYK A;  4NAP A;  5LDZ A;  4PFI A;  3CHG A;  1FBG A;  1IMF A;  4N8G A;  1NUW A;  4GWZ A;  2DE2 A;  4NHB A;  2FBP A;  1EYJ A;  4HCY A;  4MHF A;  2DVZ A;  5F24 A;  1Q9D A;  1JP4 A;  1LBW A;  2FVZ A;  1LBX A;  1NUY A;  5IZ1 A;  3RPL A;  2KR0 A;  3W9W A;  1K9Z A;  3E79 A;  3HFU A;  5I7I A;  3RYD A;  2DDK A;  4N8Y A;  3BIH A;  4OVQ A;  4XFE A;  1NV5 A;  1FRP A;  5IZ3 B;  2WBD A;  4N6D A;  4PAF A;  4YZZ A;  1FPD A;  4P9K A;  5I5P A;  2CZH A;  4OVR A;  1FPI A;  1FPG A;  3KC0 A;  3LV0 A;  4MMP A;  2CEY A;  4MNI A;  4GWW A;  1FPB A;  2B4M A;  4YIC A;  2FHY A;  3LUZ A;  4PCD A;  4N81 A;  5ET7 A;  2FIE A;  4GX3 A;  4X9T A;  4DI3 D;  2WYP A;  1EYK A;  1FPE A;  1FPJ A;  4I3E A;  5EQ9 A;  4I40 A;  4XF5 A;  5EYG A;  1LBV A;  2ZZX A;  1NV6 A;  4F1U A;  2PFY A;  4O7I A;  5ET6 A;  2Q74 A;  2XWO A;  4GWY A;  1INP A;  5DW8 A;  2OWZ A;  5ET8 A;  5T3J A;  2XWV A;  4PBQ A;  1DK4 A;  1G0H A;  2VPN A;  4KXP A;  1KA0 A;  1D9Q A;  2PCR A;  4DI4 B;  3ROJ A;  1LBY A;  3E78 A;  4JVI A;  2P3N A;  2ZZW A;  2DE3 A;  4PF6 A;  4GX4 A;  1NI9 A;  2QVR A;  4HXV A;  2V4C A;  2Y5L A;  4M1V A;  4P8B A;  4MNC A;  2VPO A;  2F5X A;  4PDD A;  1NV7 A;  4IR8 A;  4NQ8 A;  1FPK A;  2V3Q A;  2QVU A;  3FXB A;  4OVS A;  2XXK A;  4UAB A;  4X8R A;  2HZL A;  3U65 A;  1FPF A;  5EYH A;  4NF0 A;  1LEV A;  3T0J A;  4O94 A;  4QBA A;  1CNQ A;  2P3V A;  4GX6 A;  5EQ7 A;  4N17 A;  1SPI A;  2VT5 A;  4PBH A;  4GBV A;  1AWB A;  3EKI A;  4MIJ A;  4PF8 A;  4LN5 A;  2F3D A;  4HE0 A;  3BIG A;  2HZK A;  4AS5 A;  4MAG A;  1DCU A;  3B8B A;  4PET A;  1NV0 A;  1IME A;  4PE3 A;  4MEV A;  4PAI A;  1IMA A;  1FBP A;  4MCO A;  4MX6 A;  2B4L A;  2QPQ A;  4N6K A;  4PC9 A;  4X04 A;  3SZP A;  1FPL A;  5JK4 A;  1BK4 A;  1FBH A;  1YYZ A;  3IFA A;  3KBZ A;  4HE2 A;  2CZI A;  1LBZ A;  2JJK A;  4PTK A;  2MKZ A;  4NX1 A;  1KA1 A;  2PFZ A;  2OX3 A;  4MNP A;  3A29 A;  1K9Y A;  2FIX A;  1XI6 A;  2HXR A;  4NN3 A;  2XA5 A;  3W9V A;  5EQA A;  1RDZ A;  5IM2 A;  2KQZ A;  4FBP A;  3NOH A;  2GQ1 A;  2DE4 A;  2WBB A;  1FBF A;  3D1R A;  3RPL B;  4F19 A;  4F18 A;  1NV3 A;  2WX9 A;  1FJ6 A;  4HCW A;  5IGA A;  1NV4 A;  3QMF A;  5IZZ A;  2Y5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...