2JJKA

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate -1- phosphohydrolase) (e.c.3.1.3.11) complexed with a dual binding amp site inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
319
Chain Sequence
b'DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Allosteric Fbpase Inhibitors Gain 10(5) Times in Potency When Simultaneously Binding Two Neighboring AMP Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2jjkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2jjkA02
1KZ8A 1NV5A 4G61A 2PCRA 1DCUA 3A29A 1NV3A 4O7IA 4GWUA 1Q9DA 3BIHA 4AS4A 1RDXA 2QFLA 4HE1A 1LEVA 1K9ZA 1NV7A 2QVUA 4HE0A 1IMBA 1D9QA 4FBPA 2R8TA 1NV2A 1LBXA 1QGXA 4IR8A 4HXVA 3IFCA 5ESYA 5DW8A 1IMCA 1FSAA 4GX3A 1IMFA 5ET7A 4MJOA 1RDYA 4N81A 5F24A 5T3JA 1AWBA 2WEFA 3KBZA 1NUYA 2FIXA 5EQ7A 5IZ3A 4H45A 1LBVA 2CZHA 1EYJA 3RPLA 2QVRA 3QMFA 4I40A 5IZ1A 1EYKA 1LBZA 2CZIA 1G0IA 1XI6A 1IMEA 5ET5A 2OX3A 5LDZA 5EQ8A 3RYDA 1VDWA 2P3NA 2VT5A 2P3VA 5ET8A 4PTKA 3BIGA 2BJIA 1KA1A 5J16A 4GWSA 5FBPA 2Q74A 2JJKA 1YZ0A 1INPA 3KC0A 2HHMA 1FPIA 2CZKA 4GWWA 2Y5LA 2GQ1A 1FBEA 2F3DA 2F3BA 4GX6A 1DBZA 1FPFA 3FBPA 5IZ3B 1FBDA 2FIEA 2WBBA 1NUWA 3LV0A 1LBYA 2FHYA 1FPKA 1FBPA 4GWZA 3RPLB 1NV6A 1FPBA 1FPLA 3D1RA 1BK4A 1K9YA 1FBCA 2WBDA 5EQAA 1NV0A 3B8BA 1FPEA 1FJ6A 3T0JA 1FPGA 1FBHA 1NV1A 4GX4A 4GWYA 1YXIA 1NUXA 4GBWA 4HE2A 1DK4A 1YYZA 4AS5A 1FBGA 1NUZA 2FBPA 1SPIA 1IMDA 1FJ9A 1FPDA 3LUZA 5EQ9A 5A5LA 2FVZA 1IMAA 4GBVA 1EYIA 1LBWA 1RDZA 1NI9A 2Y5KA 3ROJA 1FBFA 2DDKA 2Q8MA 1CNQA 3IFAA 1FPJA 1FTAA 4I3YA 4I3EA 4GWXA 3KC1A 2QVVA 5EYHA 4KXPA 1KA0A 1FRPA 1NV4A 4H46A 5ET6A 4QXDA 5I3SA 1G0HA 5EYGA 2OWZA 1JP4A
chains in the Genus database with same CATH superfamily
2Y7WA 2QJEA 1R9LA 1ZJLA 1AH5A 2Q8JA 4L17A 4H8JA 4X1DA 4R6HA 4YB5A 3E9XA 3CI8A 1XVXA 4HXVA 5IM2A 1SDXA 4MLVA 1DTGA 5ET7A 4N81A 2PT2A 3DLNA 4R9GA 4RK2A 3TQWA 5L9SA 4KCDA 2BJJX 3BFUA 5EQ8A 1B1XA 2XWIA 5ET8A 4HCYA 1PDAA 3VV5A 3IR1A 3TFLA 1MPDA 4M4GA 2YJPA 3KGCA 3A3CA 1B58A 3FGSA 3R7XA 4JVDA 5H8SA 1SVXB 4JWYA 4I62A 1B1HA 3ZS6A 3CG1A 1A99A 3RNNA 4GL8A 2XXRA 2ZNUA 1PC3A 4FATA 1ZU0A 5B7DA 3T93B 1USYE 4O3BA 3KBRA 5L8DA 4AQ4A 2I4BA 3PPOA 1OVTA 1XVYA 1POTA 3O28A 2YPNA 1FBFA 2ZYOA 1CNQA 3HV1A 5IKBA 5IGAA 4ZEKA 2V3QA 2Z8EA 1OIBA 3FVKA 1MY3A 2DVZA 2VD3A 4EF2A 1PB8A 3HCQA 1IZ1A 1M5CA 1QW0A 3MP8A 2R6GE 3ISPA 4G61A 3I6VA 3PPNA 4NF8A 1NV3A 4H8IA 3SDFA 1N7XA 3K6XA 5EHMA 4RXLA 2X7PA 4F19A 2WKYA 4UA8A 2H99A 2ZXTA 3G3GA 3TCHA 4ECFA 4IR8A 4XKQA 4PE3A 1N0TA 2CEYA 3T1BA 1AWBA 1WODA 3QK6A 4MH5A 3VVEA 3TTMA 4RPOA 3FD3A 3UIFA 2AL4A 3KSJA 1QUKA 4DI4B 2CMOA 4U23A 4DLDA 2Q9TA 1ZLQA 1I6QA 1I6BA 3HFUA 5FBPA 2JJKA 4LZ5A 3JYRA 4MLQA 1HSJA 4OEUA 4Z7EA 4PCDA 3GZGA 5J1DA 3D1RA 1JW5A 1IXIA 4ELRA 3T66A 4KQPA 3DELB 1MH4A 1XOCA 1NMUA 1CE2A 4ZDMA 3T0JA 1QJMA 4DIGA 5A5XB 3OEMA 4PGPA 4PF8A 2CEXA 4X1BA 4I3YA 3OO9A 4O7MA 4ELOA 3Q29A 4R73A 2DWHA 3Q28A 1A54A 5F7VA 1LGBC 4GF8A 5KCJA 4HE1A 1SBPA 2PVUA 5LOMA 1NNTA 5DEXB 3A09A 2QS2A 1AL3A 2F35A 4R6YA 1QUJA 4EXLA 2XXKA 1FSAA 3IJOB 2WEFA 1B5JA 4RA1A 5EQ7A 5I2KA 3H7MA 4NGUA 5CBRA 1P99A 3TEPA 3HN0A 3QMFA 5ICQA 3CIJA 1EYKA 3C32A 2I3VA 3MVXA 4H67A 5HPQA 1IMEA 1NNFA 4R2BA 4IO3A 3C33A 4Q0CA 3S9MC 3B6TA 4G2ZA 4ZS9A 2Q74A 3CFZA 4F31B 2Q89A 1NUWA 3LSLA 3TAJA 2P0SA 4AB6A 2H4IA 3PUYE 2YLNA 1FQFA 4F2QA 1NV0A 3FVNA 5M2VA 4GWYA 4NQ8A 1P1WA 3MJNA 4ZZAA 2XXYA 2V25A 4HE2A 3OOAA 1IUDA 5IZZA 2F7AA 2L5VA 2ZYNA 4YMBA 4RJZA 1N3WA 5I57A 4LUBA 4ND9A 1FPJA 4AB5A 4I3EA 4YKJA 5I59B 4GWXA 5EHSA 4OTEA 1SW5A 1LSTA 1KZ8A 1IQ7A 1I6AA 4F2OA 3KFMA 4FEDA 3O66A 4AS4A 1RYOA 3ECRA 1IITA 3NOHA 4UABA 3N6TA 4NX1A 4OFOA 4NTLA 3RTWB 5AA4A 3CSGA 2THIA 5TU0A 4Z0IA 2ONKE 4PC9A 3DP8A 3M3KA 2QPQA 1N76A 2GFEA 3L6HA 4MCOA 2DP8A 2Q2AA 2CZIA 5TPAA 1EZOA 2VT5A 4R75A 4BDQA 3PUZE 2KLFA 3IJXB 1H45A 3QAXA 3RT8A 4ZE8A 2R71A 4HTGA 2Y5LA 3B6WA 4IO2A 4GXAA 2UVHA 4GWOA 3VLWA 4BDRA 3FV2A 3MW0A 4O8MA 1FTLA 1FBCA 4DXCA 5FTHA 4U4XA 4U1OA 3GBAA 3K6UA 3O6GA 2GH9A 3PPRA 1BKAA 1FTJA 5H8FA 4PFRA 3CSBA 3FZVA 1NH7A 2QSXA 1LFIA 3VXBA 1MPCA 1B52A 2HAVA 1B3LA 4KXPA 1DSNA 1Q1KA 3QXMA 2O51A 1JEVA 4P1LA 4X8RA 4KD5A 1N7WA 1XC1A 1QVSA 4LZ7A 4FAJA 1B3GA 4FECA 3CFLA 4C1TA 2PMSA 4QFOA 3H6UA 3OELA 4N4UA 5F24A 1MDP1 4OETA 4RPNA 2O6AA 3EHSA 5IZ3A 3EHUA 1UTHA 2A5TB 5ISUA 5AA2D 1MH3A 3PMVA 5IZ1A 3ILUB 4QHQA 4JVIA 5I2NA 3TDJA 1B7ZA 1SD3A 5TPAB 1SW4A 5FTIA 1VDWA 2P3VA 1PB7A 4XTCQ 4WKMA 1PB9A 1B3HA 5IAIA 3O2AA 2HHMA 5TP9A 1NKXA 3MVYA 4F3BA 1XT8A 2FIEA 3K0VA 4PFIA 2HZLA 3THIA 4JB7A 4IO5A 3A3UA 1K9YA 3N26A 3IB1A 4NF5A 3USDA 2PFYA 2LAOA 4OVQA 2E0SA 4EDPA 3SEWA 4F29A 1Y20A 4U2RA 4N07A 3V83A 3N94A 4OVRA 4LATA 3PGFA 4NE4A 2NOOA 3ROJA 4KYEA 3IFAA 4XKNA 1HSEA 1R1NA 1P1OA 3D4CA 2ZNTA 3KN7A 4YU0A 4JXIA 2ZZVA 1D9QA 4IO7A 4QFNA 3A29A 3KEIA 1SQYA 3RY3A 4WEDA 1B51A 3TTKA 2KR0A 1DMBA 5DVIA 4YKKA 4OMBA 4NN3A 4K3FA 4C1UA 3U65A 1BP5A 3F11A 2F7BA 2GRVA 3MBPA 1FQDA 1YAEA 2XX9A 2DSFA 4N6KA 4MNIA 4DE8A 1Y4CA 4XEQA 3H4ZA 1MY1A 3W15C 1R9QA 4P0GA 1FQCA 4QSEA 3IORA 3TPAA 5I2NB 3KG2A 5AA2A 4PTKA 3BIGA 4PAFA 3PUWE 2QMWA 3MZ9A 5H8QA 2I6EA 3FVOA 3S9EA 3FJGA 1B5HA 5TP9B 3K6WA 3G3IA 3MUQA 4O3CA 2IEEA 4U22A 1B6HA 3E79A 1FPKA 3IO4A 3WAEA 3RPLB 5JTYB 4OVPA 1Y1MA 1MXWA 4N8YA 3GXAA 3O97A 2OCUA 4GX4A 1NV1A 1I69A 1ZBMA 4PE5B 2RC9A 4FORA 4XXUA 3U92A 1FJ9A 5CRYA 3Q27A 5EQ9A 3TTLA 4JWOA 5H8NA 4GOTA 1XHYA 4NEDA 1FTAA 1H3DA 3VDFA 5H8HA 2QMXA 2B3FA 3IK6B 2QVVA 4P9KA 1KA0A 5I3SA 3U93A 3TUSA 2XWVA 3WAFA 1FQBA 1UIUA 4YKIA 3U1OA 2D5WA 2XA5A 2Y7RA 4MAGA 4ZE9A 4HE0A 4N8GA 3GLBA 3K4UA 1QGXA 1II5A 3G3JA 3IB2A 3IOWA 1JVYA 3KSXA 5AA3A 4MNCA 2ALUA 1JVXA 3H03A 1MY4A 3VLUA 2VGQA 3IO6A 2O1MA 4F39A 3SZPA 4PQJA 4KYDA 2H5YA 3H6WA 1EYJA 3ZKKA 4U21A 4GQOA 1NH8A 1AOVA 3RYDA 4F1YA 1GR2A 2FNCA 3RLFE 3EHTA 3AXFA 1LFGA 1ZTYA 1UTBA 2CZKA 4GWWA 4O3AA 2QS3A 4G8NA 4OQOA 2HAUA 3QIMA 4TOZA 4BLAA 4GWZA 4EUOA 1TT1A 2F34A 3EKIA 1BK4A 3FXRA 4R6KA 2AL5A 4OFLA 2VP1A 2B3BA 3K1PA 2AYSA 4DCXA 1NUXA 4NF6A 1WVJA 4RNSA 4N6DA 5I56A 2F8DA 4PDHA 4EQ7A 2FVZA 4P56A 1DPPA 2DE4A 3K6VA 2Q8MA 2Z8FA 5DTBA 3OEKA 3CVGA 2ZYKA 4F3PA 4BDNA 2XXHA 2DE3A 1B3EA 2XHDA 1SYIA 4R2FA 3C34A 4GFRA 4C0RA 2QFLA 1QUIA 5AA1A 1RYXA 1QULA 1J1NA 2RC7A 2Z23A 1IMBA 4FBPA 2R8TA 3O29A 1F9BA 4ZEBA 5CMKA 1IMCA 4MJOA 2V4CA 4F3GA 3IL1B 1DTZA 1GV8A 3VFJA 4NF8B 4NWDA 2OK2A 5ELVA 2QVRA 3R26A 4PP0A 3S2VA 3MP1A 1YPNA 4F1UA 2RCBA 4RK9A 3GBBA 3HHGA 3TCGA 2OBGA 2BJIA 2ZZWA 1SW1A 1US5A 1INPA 5HM4B 1FPIA 2OJTA 3PUXE 4YICA 3ZSFA 2PX1A 4QFLA 1UIVA 4X48A 3E13X 2O1LA 3HSTA 2UYFA 4XKPA 4DXBA 4RYAA 1FPLA 2WBDA 3RPWA 2F36A 1LAGE 1MY2A 5CC2A 2DE2A 3N5LA 4XIGQ 1VSOA 4OVSA 1EH3A 1IMDA 1B4HA 5JEIA 1MXUA 5I56B 5ITOA 3Q25A 4KCCA 3I3VA 1TFAA 1LBWA 3TODA 4GXSB 4LP2B 3U8QA 3KJTA 4H5FA 4OYVA 1MQJA 2HFBA 4IO4A 3SEXA 2E1SA 5EYGA 3RN8A 1IIWA 4YB7A 4H6DA 1B46A 3U72A 1URDA 4LQ2A 3EPEA 4BDOA 1B5IA 3H6TA 4IB2A 2F78A 3M3FA 2W7YA 4HCWA 2F5XA 5ESYA 2XXTA 1IMFA 1RDYA 2O84X 4OFJA 3PD8A 1O63A 1Y1ZA 4OVJA 1B40A 1O64A 2ZNSA 2GHAA 1FW0A 3IOTA 5KCJB 3JV9A 1LFHA 5CM6A 5KDTA 2X26A 1XS5A 2H98A 5AE4A 3PPQA 3K02A 3MPLA 3LUYA 4PBHA 3TMGA 2XXUA 3CRBA 4E0WA 3ILTB 2QS1A 4GX6A 5I2KB 4WXJA 1FPBA 4N13A 4Q5TA 3HO7A 3VLVA 2I48A 4XF5A 4G68A 4IGRA 3MZBA 4KI0E 4AS5A 2QS4A 4OVTA 1OLCA 4ZEDA 3MAMA 3DP4A 3BBRA 3LUZA 2F6PA 3OXNA 5EYFA 1B2HA 3PMWA 4OA4A 4G68C 4JVCA 4QRZA 1G0HA 1QKBA 2UYEA 2R9JA 4E0XA 1DCUA 1ATGA 4O7IA 4ZEIA 3DP6A 4LONB 1POY1 1O7TA 4I9DA 3TCFA 1S7YA 2Y7PA 3MQ9A 3C35A 5I57B 4U1ZA 2HXWA 3SEVA 4MX6A 1EZ9A 4FE8A 4LZ8A 2ZMBA 2XXPA 3SESA 3E4RA 2CZLA 1A8FA 3C9HA 3K2DA 5LTCA 1VFDA 2ONRA 4ISUA 2I3WA 3MP6A 5FHNA 1MQHA 2OPEA 4I40A 5I58A 1LBZA 4R74A 2Q2CA 3KZGA 5LDZA 4THIA 1D9VA 4DCYA 1M5EA 5KZTA 2B4LA 1URGA 2D21A 4NAPA 3LSFB 4NF4A 4PAIA 5AA4B 1A7LA 2F3BA 1B7UA 4PGNA 1Y4TA 2DOJA 2O69A 2UVIA 4YAHX 4UACA 5F1QA 3K1MA 2G93A 3S4UA 3MYUA 1D9YA 3H6VA 3FJ7A 4OENA 3W9WA 4H0WA 4ESWA 3SERA 1YXIA 4P47A 2QL3A 1LB9A 1YYZA 2RINA 3S9LC 2FBPA 1SPIA 3KOSA 1Z7ME 1GVCA 1LAHE 1CB6A 4TLLB 3KN3A 3B6QA 4I1DA 3PTYA 4YZZA 3T96B 4G77A 4LA9A 2F6GA 4QXDA 1MPBA 4JSDA 3UORA 2PCRA 4LVQA 4M1VA 1MM6A 2PYYA 1NNKA 5H8FB 5K2YA 1OQHA 1NL5A 1NV7A 3MVZA 3VVDA 2I4CA 3BKIB 5FHMA 4MNPA 2V93A 4GL0A 3G3HA 4GD5A 4OZ9A 3V8XB 3M3LA 5DW8A 5CMMA 1NUYA 4OWDA 1ELJA 1ZIUA 4PBQA 4EF1A 2VOZA 4F1VA 2OX3A 1MG1A 5I5PA 2PT1A 4YB6A 2XD3A 1Y3QA 2OLBA 3T9UA 5L9MA 2FA7A 1JNFA 4MF3A 3VE1B 3K00A 2XWOA 1N3XA 1DBZA 5IZ3B 1B7HA 1FBDA 3QYTA 3QUJA 3FUZA 2AIXA 1UTHB 2XXWA 4HS7A 4OERA 4I8CA 1LCFA 5HBCA 4YMAA 4HW8A 1Y3NA 4NF0A 4LQ5A 1MXYA 1OQGA 4JDFA 4EXKA 1VE4A 3G3FA 4XKRA 4POXA 4RY1A 4OXVA 2OZZA 4NWCA 4P1EA 2H9BA 2V84A 4R9FA 2IA4A 4MFIA 4IO6A 1LBCA 4P8BA 3TTNA 3OENA 3FJMA 4NF5B 1NV5A 3KJ7A 5CI5A 4GVOA 1A40A 3HPIA 1BLFA 4BDMA 3PD9A 2REGA 4EQ9A 1MY0A 3FASA 1YCJA 1D4NA 1LEVA 1K9ZA 1H76A 3K01A 3EF7A 4YKPA 3EQ1A 4MIJA 3O9PA 5ICTA 3IOVA 2HQ0A 2CZHA 1TXFA 1IXCA 3W9VA 2HZKA 1BTJA 4F3SA 4IGTA 4N17A 2DXRA 4PAKA 5CMBA 5CMCA 5A5XA 1FQEA 2HCAA 4P11A 1R6ZA 4DZ1A 1FBEA 4ELQA 2XX7A 3FVGA 4NMYA 2WBBA 3TYHA 1LBYA 2FHYA 1FBPA 2NUVA 4OEVA 2OPDA 2DS9A 5DVJA 2XWKA 5AA2B 3FXQA 4KFQA 2RF1A 2FYIA 5H8QB 1DK4A 3TZAA 1FBGA 1FTOA 1IXHA 3T9XB 4PF6A 4MMPA 5DEXA 1B3FA 3IOUA 1EYIA 5DVFA 3LC8A 4JWXA 3KC1A 4F22A 4DXUA 2HPGA 2MKZA 2VPOA 3IX1A 4G4PA 1UQWA 3FV1A 4KHZE 1MXZA 4DI3D 3BIHA 4PETA 1B4ZA 4PFUA 3I5OA 4H5GA 4MBPA 5H8NB 4GIZA 2P2AA 3RGYA 1HSLA 3PV0E 1Y3PA 1SI0A 1KWHA 1ZMGA 2X7QA 5H8HB 2QRYA 2VPNA 3QSLA 3PPPA 4O94A 4PFYA 4ESXA 1YTVA 1DPEA 4QFKA 4H65A 3ONMA 5CBSA 3P7IA 4ZECA 1SYHA 1XI6A 3RTFB 3JZJA 2V3TA 2P3NA 4QFPA 4Q8RA 4ONYA 2HEUA 1A55A 5J16A 3T9HB 1YZ0A 3KC0A 3E78A 1QKAA 3OO7A 1US4A 2GHBA 1IEJA 3RUMA 1M5DA 3UK4A 2XXQA 2ANJA 4QF9A 5I59A 1JW1A 3B7DA 2DQVA 4IY6A 1VFEA 3T9VA 3LBSA 1B0LA 3B8BA 1PBPA 1PEBA 4FIMA 1FBHA 1H44A 3UGWA 4KYSA 1USYH 4PFBA 1UTBB 4FJPA 1WDNA 1OMPA 1FPDA 1MQIA 4GLIA 3MC2A 3V5AA 1RDZA 2DDKA 2PFZA 5BUUA 2WYKA 2XXXA 2NWJA 2F7CA 2I49A 1B05A 1NFTA 3SKPA 2OWZA 1JP4A 2DVCA 4ELPA 1LAFE 1N84A 4GWUA 3TQLA 4NF6B 2XD2A 4POWA 3ZKLA 3PU5A 3CG3A 2DXYA 3CFXA 3OSRA 1AIVA 4KR5A 4N6PA 3TELA 1LBXA 2RC8A 1S9TA 4JBZA 3IFCA 1T0KA 4QSDA 3DM0A 2WYPA 3KBZA 2FIXA 5DYHA 1VR5A 2UVGA 4X9TA 2OWTA 2DWJA 5ITPA 1FQAA 2Y7KA 3G7WA 4X04A 4Q30B 3CR9A 2NXOA 3FXUA 2F97A 2ZYMA 1MDQA 1A8EA 1L5TA 3OO6A 3UP9A 2F3DA 1MRPA 2P1SA 1MQGA 3PMXA 3EN3A 2Y7IA 1EZPA 1B0HA 3D4GA 1FTMA 4GBWA 5L9OA 1OLAA 3OSQA 1BIYA 2ABHA 4H1XA 4BDLA 3G3KA 1TWYA 3E3KA 1FCKA 3KN8A 2B65A 3GYYA 1GGGA 5EYHA 4P3LA 1D3KA 3S9NC 1NV4A 5ET6A 1LCTA 2ESNA 4NG7A 3RT6B 1PBQA 1RKMA 2A5TA 4OHNA 5FHOA 4PFWA 3N6UA 1P1NA 2A5SA 2QVUA 1LBBA 1B9JA 1P1QA 2O68A 3O6IA 1B32A 1IXGA 1NV2A 1URSA 4WEPA 3MWBA 2PBWA 3FIRA 3TKDA 1M5BA 1JQFA 3L6GA 5B70A 2UXAA 1SW2A 4GX3A 5T3JA 2VHAA 4N15A 4G8MA 2M8CA 1OVBA 5K2XA 4H45A 1LBVA 3QUFA 2H25A 4KPTA 2HXRA 1ANFA 1G0IA 4MEVA 3CHGA 3LR1A 1JEUA 3C4MA 1KA1A 3FXBA 4GWSA 3MSTA 3TTRA 3RQTA 3ODBA 1Y9UA 4N91A 5BWJA 1FPFA 1P1UA 1Q35A 2WX9A 3LV0A 3O6HA 2RKMA 1MXXA 1ZKBA 1MS7A 2XXVA 4TQUQ 3B50A 5KDTB 1S50A 1FPEA 3IAZA 2V3UA 2I58A 2UVJA 3BFTA 4U4SA 2REJA 4F18A 3KOTA 3MVWA 5A5LA 2XX8A 4GBVA 1NNPA 1LB8A 4ZEFA 3FATA 4LN5A 3C31A 2Q88A 3C36A 2B4MA 4H46A 3K1NA 1DOTA 2ZZXA 2I0BA 4G68B 5I7IA 3PUVE 4PFTA 1Q9DA 3VXCA 1RDXA 3OO8A 1TFDA 3HHFA 4TLMB 1SI1A 1MM7A 3H3GA 4MHFA 2VD2A 3T22A 3OMBA 2KQZA 2RCAA 1AMFA 1LAXA 4QBAA 2I0CA 2O7IA 3M8UA 3LSWA 5I84A 4IY5A 3RPLA 1MQDA 3IB0A 5JTYA 3SETA 2NVUB 2Y84A 5ET5A 3Q26A 1FTKA 2G29A 3V89B 3OD7A 4QSCA 1GTKA 3H06B 3VVFA 1M5FA 2Z8DA 4XFEA 5JK4A 1LLSA 3SEYA 4NHBA 4OANA 3MPKA 2ONSA 2GQ1A 1Z7NE 3FBPA 3R6UA 1NV6A 4FEBA 3SEUA 5I58B 1MXVA 5EQAA 4DDDA 4P0IA 2DWIA 1FJ6A 1FPGA 4ZZEA 1JETA 3UN6A 3UA8A 2Z22A 1N04A 4OESA 1NUZA 1H43A 4GRKA 4JSOA 4NF4B 4R72A 2D3IA 2DYXA 1IMAA 1NI9A 2Y5KA 1JW4A 5DT6A 3U94A 2OWSA 3MZ1A 3LSXA 2O7UA 4G8HA 1EU8A 1FRPA 4EQBA 2XXIA 4PDDA 2DWAA
chains in the Genus database with same CATH topology
4P1LA 4DI3D 4X8RA 3BIHA 4PETA 4HCWA 4HXVA 5IM2A 2F5XA 5ESYA 4N4UA 1IMFA 5ET7A 1RDYA 4N81A 5F24A 2VPNA 4O94A 5IZ3A 5IZ1A 1XI6A 5CM6A 4JVIA 5EQ8A 1VDWA 2XWIA 2P3NA 5ET8A 2P3VA 4HCYA 5J16A 4PBHA 1YZ0A 3KC0A 3E78A 2HHMA 4JVDA 4GX6A 2FIEA 4PFIA 2HZLA 1FPBA 1K9YA 3B8BA 4XF5A 1FBHA 2PFYA 4OVQA 4AS5A 4OVTA 4PFBA 4OVRA 1FPDA 3LUZA 1RDZA 3ROJA 1FBFA 2DDKA 2PFZA 2WYKA 1CNQA 4OA4A 3IFAA 5IGAA 2V3QA 4JVCA 2DVZA 1G0HA 3ISPA 2OWZA 2ZZVA 4G61A 1D9QA 1JP4A 1DCUA 3A29A 1NV3A 4O7IA 4GWUA 4F19A 2KR0A 4NN3A 1LBXA 4IR8A 4MX6A 4PE3A 3U65A 3IFCA 2CEYA 2WYPA 3T1BA 1AWBA 5LTCA 4N6KA 3KBZA 2FIXA 4MNIA 4X9TA 4XEQA 4I40A 1LBZA 4DI4B 4X04A 5LDZA 4PTKA 3BIGA 2Q9TA 4PAFA 3HFUA 5FBPA 2B4LA 2JJKA 4NAPA 2F3DA 4PAIA 2F3BA 4PGNA 4PCDA 3E79A 1FPKA 3RPLB 5J1DA 3D1RA 3MYUA 4OVPA 4N8YA 3W9WA 3T0JA 4GX4A 1NV1A 1YXIA 4P47A 4GBWA 1YYZA 2FBPA 1SPIA 4PGPA 1FJ9A 5EQ9A 4PF8A 2CEXA 3GYYA 1FTAA 4I3YA 3PTYA 4YZZA 5EYHA 2QVVA 4P3LA 4P9KA 4O7MA 1KA0A 1NV4A 5I3SA 5ET6A 4QXDA 4NG7A 2XWVA 2PCRA 4M1VA 4HE1A 2XA5A 4MAGA 1NV7A 2QVUA 4HE0A 4N8GA 1NV2A 4MNPA 1QGXA 5DW8A 4MNCA 2XXKA 1FSAA 4GX3A 5T3JA 2WEFA 4N15A 1NUYA 5EQ7A 3SZPA 4NGUA 4H45A 1LBVA 1EYJA 3QMFA 4PBQA 1EYKA 2HXRA 1G0IA 4MEVA 3CHGA 4F1VA 1IMEA 2OX3A 3RYDA 5I5PA 1KA1A 3FXBA 4GWSA 2Q74A 3MSTA 2CZKA 4GWWA 4N91A 2XWOA 1DBZA 1FPFA 5IZ3B 1FBDA 2WX9A 1NUWA 3LV0A 4GWZA 3EKIA 1BK4A 3B50A 4NF0A 1NV0A 1FPEA 4GWYA 4NQ8A 1NUXA 4HE2A 5IZZA 4F18A 4N6DA 4P1EA 2L5VA 4PDHA 5A5LA 2FVZA 4GBVA 4P56A 2DE4A 2Q8MA 1FPJA 4I3EA 4P8BA 4LN5A 4GWXA 2B4MA 4H46A 2ZZXA 1KZ8A 1NV5A 2DE3A 5I7IA 1Q9DA 4AS4A 1RDXA 2QFLA 1LEVA 1K9ZA 1IMBA 4FBPA 2R8TA 3NOHA 4UABA 4NX1A 4MHFA 1IMCA 4MJOA 2KQZA 2V4CA 4MIJA 4QBAA 4PC9A 2CZHA 3RPLA 2QVRA 2QPQA 4MCOA 3W9VA 2HZKA 2CZIA 4F1UA 5ET5A 2VT5A 4N17A 4PAKA 2BJIA 5JK4A 4XFEA 2ZZWA 4NHBA 1INPA 4OANA 1FPIA 2Y5LA 2GQ1A 1FBEA 4YICA 3FBPA 2WBBA 1LBYA 2FHYA 1FBPA 1NV6A 1FPLA 4O8MA 2WBDA 1FBCA 5EQAA 1FJ6A 2XWKA 1FPGA 2DE2A 1DK4A 1FBGA 1NUZA 4OVSA 1IMDA 4PF6A 4PFRA 4MMPA 1IMAA 1EYIA 1LBWA 1NI9A 2Y5KA 3KC1A 4KXPA 1FRPA 2HPGA 2MKZA 2VPOA 4PDDA 5EYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZ8 A;  1NV5 A;  4G61 A;  2PCR A;  1DCU A;  3A29 A;  1NV3 A;  4O7I A;  4GWU A;  1Q9D A;  3BIH A;  4AS4 A;  1RDX A;  2QFL A;  4HE1 A;  1LEV A;  1K9Z A;  1NV7 A;  2QVU A;  4HE0 A;  1IMB A;  1D9Q A;  4FBP A;  2R8T A;  1NV2 A;  1LBX A;  1QGX A;  4IR8 A;  4HXV A;  3IFC A;  5ESY A;  5DW8 A;  1IMC A;  1FSA A;  4GX3 A;  1IMF A;  5ET7 A;  4MJO A;  1RDY A;  4N81 A;  5F24 A;  5T3J A;  1AWB A;  2WEF A;  3KBZ A;  1NUY A;  2FIX A;  5EQ7 A;  5IZ3 A;  4H45 A;  1LBV A;  2CZH A;  1EYJ A;  3RPL A;  2QVR A;  3QMF A;  4I40 A;  5IZ1 A;  1EYK A;  1LBZ A;  2CZI A;  1G0I A;  1XI6 A;  1IME A;  5ET5 A;  2OX3 A;  5LDZ A;  5EQ8 A;  3RYD A;  1VDW A;  2P3N A;  2VT5 A;  2P3V A;  5ET8 A;  4PTK A;  3BIG A;  2BJI A;  1KA1 A;  5J16 A;  4GWS A;  5FBP A;  2Q74 A;  2JJK A;  1YZ0 A;  1INP A;  3KC0 A;  2HHM A;  1FPI A;  2CZK A;  4GWW A;  2Y5L A;  2GQ1 A;  1FBE A;  2F3D A;  2F3B A;  4GX6 A;  1DBZ A;  1FPF A;  3FBP A;  5IZ3 B;  1FBD A;  2FIE A;  2WBB A;  1NUW A;  3LV0 A;  1LBY A;  2FHY A;  1FPK A;  1FBP A;  4GWZ A;  3RPL B;  1NV6 A;  1FPB A;  1FPL A;  3D1R A;  1BK4 A;  1K9Y A;  1FBC A;  2WBD A;  5EQA A;  1NV0 A;  3B8B A;  1FPE A;  1FJ6 A;  3T0J A;  1FPG A;  1FBH A;  1NV1 A;  4GX4 A;  4GWY A;  1YXI A;  1NUX A;  4GBW A;  4HE2 A;  1DK4 A;  1YYZ A;  4AS5 A;  1FBG A;  1NUZ A;  2FBP A;  1SPI A;  1IMD A;  1FJ9 A;  1FPD A;  3LUZ A;  5EQ9 A;  5A5L A;  2FVZ A;  1IMA A;  4GBV A;  1EYI A;  1LBW A;  1RDZ A;  1NI9 A;  2Y5K A;  3ROJ A;  1FBF A;  2DDK A;  2Q8M A;  1CNQ A;  3IFA A;  1FPJ A;  1FTA A;  4I3Y A;  4I3E A;  4GWX A;  3KC1 A;  2QVV A;  5EYH A;  4KXP A;  1KA0 A;  1FRP A;  1NV4 A;  4H46 A;  5ET6 A;  4QXD A;  5I3S A;  1G0H A;  5EYG A;  2OWZ A;  1JP4 A; 
#chains in the Genus database with same CATH topology
 2Y7W A;  2QJE A;  1R9L A;  1ZJL A;  1AH5 A;  2Q8J A;  4L17 A;  4H8J A;  4X1D A;  4R6H A;  4YB5 A;  3E9X A;  3CI8 A;  1XVX A;  4HXV A;  5IM2 A;  1SDX A;  4MLV A;  1DTG A;  5ET7 A;  4N81 A;  2PT2 A;  3DLN A;  4R9G A;  4RK2 A;  3TQW A;  5L9S A;  4KCD A;  2BJJ X;  3BFU A;  5EQ8 A;  1B1X A;  2XWI A;  5ET8 A;  4HCY A;  1PDA A;  3VV5 A;  3IR1 A;  3TFL A;  1MPD A;  4M4G A;  2YJP A;  3KGC A;  3A3C A;  1B58 A;  3FGS A;  3R7X A;  4JVD A;  5H8S A;  1SVX B;  4JWY A;  4I62 A;  1B1H A;  3ZS6 A;  3CG1 A;  1A99 A;  3RNN A;  4GL8 A;  2XXR A;  2ZNU A;  1PC3 A;  4FAT A;  1ZU0 A;  5B7D A;  3T93 B;  1USY E;  4O3B A;  3KBR A;  5L8D A;  4AQ4 A;  2I4B A;  3PPO A;  1OVT A;  1XVY A;  1POT A;  3O28 A;  2YPN A;  1FBF A;  2ZYO A;  1CNQ A;  3HV1 A;  5IKB A;  5IGA A;  4ZEK A;  2V3Q A;  2Z8E A;  1OIB A;  3FVK A;  1MY3 A;  2DVZ A;  2VD3 A;  4EF2 A;  1PB8 A;  3HCQ A;  1IZ1 A;  1M5C A;  1QW0 A;  3MP8 A;  2R6G E;  3ISP A;  4G61 A;  3I6V A;  3PPN A;  4NF8 A;  1NV3 A;  4H8I A;  3SDF A;  1N7X A;  3K6X A;  5EHM A;  4RXL A;  2X7P A;  4F19 A;  2WKY A;  4UA8 A;  2H99 A;  2ZXT A;  3G3G A;  3TCH A;  4ECF A;  4IR8 A;  4XKQ A;  4PE3 A;  1N0T A;  2CEY A;  3T1B A;  1AWB A;  1WOD A;  3QK6 A;  4MH5 A;  3VVE A;  3TTM A;  4RPO A;  3FD3 A;  3UIF A;  2AL4 A;  3KSJ A;  1QUK A;  4DI4 B;  2CMO A;  4U23 A;  4DLD A;  2Q9T A;  1ZLQ A;  1I6Q A;  1I6B A;  3HFU A;  5FBP A;  2JJK A;  4LZ5 A;  3JYR A;  4MLQ A;  1HSJ A;  4OEU A;  4Z7E A;  4PCD A;  3GZG A;  5J1D A;  3D1R A;  1JW5 A;  1IXI A;  4ELR A;  3T66 A;  4KQP A;  3DEL B;  1MH4 A;  1XOC A;  1NMU A;  1CE2 A;  4ZDM A;  3T0J A;  1QJM A;  4DIG A;  5A5X B;  3OEM A;  4PGP A;  4PF8 A;  2CEX A;  4X1B A;  4I3Y A;  3OO9 A;  4O7M A;  4ELO A;  3Q29 A;  4R73 A;  2DWH A;  3Q28 A;  1A54 A;  5F7V A;  1LGB C;  4GF8 A;  5KCJ A;  4HE1 A;  1SBP A;  2PVU A;  5LOM A;  1NNT A;  5DEX B;  3A09 A;  2QS2 A;  1AL3 A;  2F35 A;  4R6Y A;  1QUJ A;  4EXL A;  2XXK A;  1FSA A;  3IJO B;  2WEF A;  1B5J A;  4RA1 A;  5EQ7 A;  5I2K A;  3H7M A;  4NGU A;  5CBR A;  1P99 A;  3TEP A;  3HN0 A;  3QMF A;  5ICQ A;  3CIJ A;  1EYK A;  3C32 A;  2I3V A;  3MVX A;  4H67 A;  5HPQ A;  1IME A;  1NNF A;  4R2B A;  4IO3 A;  3C33 A;  4Q0C A;  3S9M C;  3B6T A;  4G2Z A;  4ZS9 A;  2Q74 A;  3CFZ A;  4F31 B;  2Q89 A;  1NUW A;  3LSL A;  3TAJ A;  2P0S A;  4AB6 A;  2H4I A;  3PUY E;  2YLN A;  1FQF A;  4F2Q A;  1NV0 A;  3FVN A;  5M2V A;  4GWY A;  4NQ8 A;  1P1W A;  3MJN A;  4ZZA A;  2XXY A;  2V25 A;  4HE2 A;  3OOA A;  1IUD A;  5IZZ A;  2F7A A;  2L5V A;  2ZYN A;  4YMB A;  4RJZ A;  1N3W A;  5I57 A;  4LUB A;  4ND9 A;  1FPJ A;  4AB5 A;  4I3E A;  4YKJ A;  5I59 B;  4GWX A;  5EHS A;  4OTE A;  1SW5 A;  1LST A;  1KZ8 A;  1IQ7 A;  1I6A A;  4F2O A;  3KFM A;  4FED A;  3O66 A;  4AS4 A;  1RYO A;  3ECR A;  1IIT A;  3NOH A;  4UAB A;  3N6T A;  4NX1 A;  4OFO A;  4NTL A;  3RTW B;  5AA4 A;  3CSG A;  2THI A;  5TU0 A;  4Z0I A;  2ONK E;  4PC9 A;  3DP8 A;  3M3K A;  2QPQ A;  1N76 A;  2GFE A;  3L6H A;  4MCO A;  2DP8 A;  2Q2A A;  2CZI A;  5TPA A;  1EZO A;  2VT5 A;  4R75 A;  4BDQ A;  3PUZ E;  2KLF A;  3IJX B;  1H45 A;  3QAX A;  3RT8 A;  4ZE8 A;  2R71 A;  4HTG A;  2Y5L A;  3B6W A;  4IO2 A;  4GXA A;  2UVH A;  4GWO A;  3VLW A;  4BDR A;  3FV2 A;  3MW0 A;  4O8M A;  1FTL A;  1FBC A;  4DXC A;  5FTH A;  4U4X A;  4U1O A;  3GBA A;  3K6U A;  3O6G A;  2GH9 A;  3PPR A;  1BKA A;  1FTJ A;  5H8F A;  4PFR A;  3CSB A;  3FZV A;  1NH7 A;  2QSX A;  1LFI A;  3VXB A;  1MPC A;  1B52 A;  2HAV A;  1B3L A;  4KXP A;  1DSN A;  1Q1K A;  3QXM A;  2O51 A;  1JEV A;  4P1L A;  4X8R A;  4KD5 A;  1N7W A;  1XC1 A;  1QVS A;  4LZ7 A;  4FAJ A;  1B3G A;  4FEC A;  3CFL A;  4C1T A;  2PMS A;  4QFO A;  3H6U A;  3OEL A;  4N4U A;  5F24 A;  1MDP 1;  4OET A;  4RPN A;  2O6A A;  3EHS A;  5IZ3 A;  3EHU A;  1UTH A;  2A5T B;  5ISU A;  5AA2 D;  1MH3 A;  3PMV A;  5IZ1 A;  3ILU B;  4QHQ A;  4JVI A;  5I2N A;  3TDJ A;  1B7Z A;  1SD3 A;  5TPA B;  1SW4 A;  5FTI A;  1VDW A;  2P3V A;  1PB7 A;  4XTC Q;  4WKM A;  1PB9 A;  1B3H A;  5IAI A;  3O2A A;  2HHM A;  5TP9 A;  1NKX A;  3MVY A;  4F3B A;  1XT8 A;  2FIE A;  3K0V A;  4PFI A;  2HZL A;  3THI A;  4JB7 A;  4IO5 A;  3A3U A;  1K9Y A;  3N26 A;  3IB1 A;  4NF5 A;  3USD A;  2PFY A;  2LAO A;  4OVQ A;  2E0S A;  4EDP A;  3SEW A;  4F29 A;  1Y20 A;  4U2R A;  4N07 A;  3V83 A;  3N94 A;  4OVR A;  4LAT A;  3PGF A;  4NE4 A;  2NOO A;  3ROJ A;  4KYE A;  3IFA A;  4XKN A;  1HSE A;  1R1N A;  1P1O A;  3D4C A;  2ZNT A;  3KN7 A;  4YU0 A;  4JXI A;  2ZZV A;  1D9Q A;  4IO7 A;  4QFN A;  3A29 A;  3KEI A;  1SQY A;  3RY3 A;  4WED A;  1B51 A;  3TTK A;  2KR0 A;  1DMB A;  5DVI A;  4YKK A;  4OMB A;  4NN3 A;  4K3F A;  4C1U A;  3U65 A;  1BP5 A;  3F11 A;  2F7B A;  2GRV A;  3MBP A;  1FQD A;  1YAE A;  2XX9 A;  2DSF A;  4N6K A;  4MNI A;  4DE8 A;  1Y4C A;  4XEQ A;  3H4Z A;  1MY1 A;  3W15 C;  1R9Q A;  4P0G A;  1FQC A;  4QSE A;  3IOR A;  3TPA A;  5I2N B;  3KG2 A;  5AA2 A;  4PTK A;  3BIG A;  4PAF A;  3PUW E;  2QMW A;  3MZ9 A;  5H8Q A;  2I6E A;  3FVO A;  3S9E A;  3FJG A;  1B5H A;  5TP9 B;  3K6W A;  3G3I A;  3MUQ A;  4O3C A;  2IEE A;  4U22 A;  1B6H A;  3E79 A;  1FPK A;  3IO4 A;  3WAE A;  3RPL B;  5JTY B;  4OVP A;  1Y1M A;  1MXW A;  4N8Y A;  3GXA A;  3O97 A;  2OCU A;  4GX4 A;  1NV1 A;  1I69 A;  1ZBM A;  4PE5 B;  2RC9 A;  4FOR A;  4XXU A;  3U92 A;  1FJ9 A;  5CRY A;  3Q27 A;  5EQ9 A;  3TTL A;  4JWO A;  5H8N A;  4GOT A;  1XHY A;  4NED A;  1FTA A;  1H3D A;  3VDF A;  5H8H A;  2QMX A;  2B3F A;  3IK6 B;  2QVV A;  4P9K A;  1KA0 A;  5I3S A;  3U93 A;  3TUS A;  2XWV A;  3WAF A;  1FQB A;  1UIU A;  4YKI A;  3U1O A;  2D5W A;  2XA5 A;  2Y7R A;  4MAG A;  4ZE9 A;  4HE0 A;  4N8G A;  3GLB A;  3K4U A;  1QGX A;  1II5 A;  3G3J A;  3IB2 A;  3IOW A;  1JVY A;  3KSX A;  5AA3 A;  4MNC A;  2ALU A;  1JVX A;  3H03 A;  1MY4 A;  3VLU A;  2VGQ A;  3IO6 A;  2O1M A;  4F39 A;  3SZP A;  4PQJ A;  4KYD A;  2H5Y A;  3H6W A;  1EYJ A;  3ZKK A;  4U21 A;  4GQO A;  1NH8 A;  1AOV A;  3RYD A;  4F1Y A;  1GR2 A;  2FNC A;  3RLF E;  3EHT A;  3AXF A;  1LFG A;  1ZTY A;  1UTB A;  2CZK A;  4GWW A;  4O3A A;  2QS3 A;  4G8N A;  4OQO A;  2HAU A;  3QIM A;  4TOZ A;  4BLA A;  4GWZ A;  4EUO A;  1TT1 A;  2F34 A;  3EKI A;  1BK4 A;  3FXR A;  4R6K A;  2AL5 A;  4OFL A;  2VP1 A;  2B3B A;  3K1P A;  2AYS A;  4DCX A;  1NUX A;  4NF6 A;  1WVJ A;  4RNS A;  4N6D A;  5I56 A;  2F8D A;  4PDH A;  4EQ7 A;  2FVZ A;  4P56 A;  1DPP A;  2DE4 A;  3K6V A;  2Q8M A;  2Z8F A;  5DTB A;  3OEK A;  3CVG A;  2ZYK A;  4F3P A;  4BDN A;  2XXH A;  2DE3 A;  1B3E A;  2XHD A;  1SYI A;  4R2F A;  3C34 A;  4GFR A;  4C0R A;  2QFL A;  1QUI A;  5AA1 A;  1RYX A;  1QUL A;  1J1N A;  2RC7 A;  2Z23 A;  1IMB A;  4FBP A;  2R8T A;  3O29 A;  1F9B A;  4ZEB A;  5CMK A;  1IMC A;  4MJO A;  2V4C A;  4F3G A;  3IL1 B;  1DTZ A;  1GV8 A;  3VFJ A;  4NF8 B;  4NWD A;  2OK2 A;  5ELV A;  2QVR A;  3R26 A;  4PP0 A;  3S2V A;  3MP1 A;  1YPN A;  4F1U A;  2RCB A;  4RK9 A;  3GBB A;  3HHG A;  3TCG A;  2OBG A;  2BJI A;  2ZZW A;  1SW1 A;  1US5 A;  1INP A;  5HM4 B;  1FPI A;  2OJT A;  3PUX E;  4YIC A;  3ZSF A;  2PX1 A;  4QFL A;  1UIV A;  4X48 A;  3E13 X;  2O1L A;  3HST A;  2UYF A;  4XKP A;  4DXB A;  4RYA A;  1FPL A;  2WBD A;  3RPW A;  2F36 A;  1LAG E;  1MY2 A;  5CC2 A;  2DE2 A;  3N5L A;  4XIG Q;  1VSO A;  4OVS A;  1EH3 A;  1IMD A;  1B4H A;  5JEI A;  1MXU A;  5I56 B;  5ITO A;  3Q25 A;  4KCC A;  3I3V A;  1TFA A;  1LBW A;  3TOD A;  4GXS B;  4LP2 B;  3U8Q A;  3KJT A;  4H5F A;  4OYV A;  1MQJ A;  2HFB A;  4IO4 A;  3SEX A;  2E1S A;  5EYG A;  3RN8 A;  1IIW A;  4YB7 A;  4H6D A;  1B46 A;  3U72 A;  1URD A;  4LQ2 A;  3EPE A;  4BDO A;  1B5I A;  3H6T A;  4IB2 A;  2F78 A;  3M3F A;  2W7Y A;  4HCW A;  2F5X A;  5ESY A;  2XXT A;  1IMF A;  1RDY A;  2O84 X;  4OFJ A;  3PD8 A;  1O63 A;  1Y1Z A;  4OVJ A;  1B40 A;  1O64 A;  2ZNS A;  2GHA A;  1FW0 A;  3IOT A;  5KCJ B;  3JV9 A;  1LFH A;  5CM6 A;  5KDT A;  2X26 A;  1XS5 A;  2H98 A;  5AE4 A;  3PPQ A;  3K02 A;  3MPL A;  3LUY A;  4PBH A;  3TMG A;  2XXU A;  3CRB A;  4E0W A;  3ILT B;  2QS1 A;  4GX6 A;  5I2K B;  4WXJ A;  1FPB A;  4N13 A;  4Q5T A;  3HO7 A;  3VLV A;  2I48 A;  4XF5 A;  4G68 A;  4IGR A;  3MZB A;  4KI0 E;  4AS5 A;  2QS4 A;  4OVT A;  1OLC A;  4ZED A;  3MAM A;  3DP4 A;  3BBR A;  3LUZ A;  2F6P A;  3OXN A;  5EYF A;  1B2H A;  3PMW A;  4OA4 A;  4G68 C;  4JVC A;  4QRZ A;  1G0H A;  1QKB A;  2UYE A;  2R9J A;  4E0X A;  1DCU A;  1ATG A;  4O7I A;  4ZEI A;  3DP6 A;  4LON B;  1POY 1;  1O7T A;  4I9D A;  3TCF A;  1S7Y A;  2Y7P A;  3MQ9 A;  3C35 A;  5I57 B;  4U1Z A;  2HXW A;  3SEV A;  4MX6 A;  1EZ9 A;  4FE8 A;  4LZ8 A;  2ZMB A;  2XXP A;  3SES A;  3E4R A;  2CZL A;  1A8F A;  3C9H A;  3K2D A;  5LTC A;  1VFD A;  2ONR A;  4ISU A;  2I3W A;  3MP6 A;  5FHN A;  1MQH A;  2OPE A;  4I40 A;  5I58 A;  1LBZ A;  4R74 A;  2Q2C A;  3KZG A;  5LDZ A;  4THI A;  1D9V A;  4DCY A;  1M5E A;  5KZT A;  2B4L A;  1URG A;  2D21 A;  4NAP A;  3LSF B;  4NF4 A;  4PAI A;  5AA4 B;  1A7L A;  2F3B A;  1B7U A;  4PGN A;  1Y4T A;  2DOJ A;  2O69 A;  2UVI A;  4YAH X;  4UAC A;  5F1Q A;  3K1M A;  2G93 A;  3S4U A;  3MYU A;  1D9Y A;  3H6V A;  3FJ7 A;  4OEN A;  3W9W A;  4H0W A;  4ESW A;  3SER A;  1YXI A;  4P47 A;  2QL3 A;  1LB9 A;  1YYZ A;  2RIN A;  3S9L C;  2FBP A;  1SPI A;  3KOS A;  1Z7M E;  1GVC A;  1LAH E;  1CB6 A;  4TLL B;  3KN3 A;  3B6Q A;  4I1D A;  3PTY A;  4YZZ A;  3T96 B;  4G77 A;  4LA9 A;  2F6G A;  4QXD A;  1MPB A;  4JSD A;  3UOR A;  2PCR A;  4LVQ A;  4M1V A;  1MM6 A;  2PYY A;  1NNK A;  5H8F B;  5K2Y A;  1OQH A;  1NL5 A;  1NV7 A;  3MVZ A;  3VVD A;  2I4C A;  3BKI B;  5FHM A;  4MNP A;  2V93 A;  4GL0 A;  3G3H A;  4GD5 A;  4OZ9 A;  3V8X B;  3M3L A;  5DW8 A;  5CMM A;  1NUY A;  4OWD A;  1ELJ A;  1ZIU A;  4PBQ A;  4EF1 A;  2VOZ A;  4F1V A;  2OX3 A;  1MG1 A;  5I5P A;  2PT1 A;  4YB6 A;  2XD3 A;  1Y3Q A;  2OLB A;  3T9U A;  5L9M A;  2FA7 A;  1JNF A;  4MF3 A;  3VE1 B;  3K00 A;  2XWO A;  1N3X A;  1DBZ A;  5IZ3 B;  1B7H A;  1FBD A;  3QYT A;  3QUJ A;  3FUZ A;  2AIX A;  1UTH B;  2XXW A;  4HS7 A;  4OER A;  4I8C A;  1LCF A;  5HBC A;  4YMA A;  4HW8 A;  1Y3N A;  4NF0 A;  4LQ5 A;  1MXY A;  1OQG A;  4JDF A;  4EXK A;  1VE4 A;  3G3F A;  4XKR A;  4POX A;  4RY1 A;  4OXV A;  2OZZ A;  4NWC A;  4P1E A;  2H9B A;  2V84 A;  4R9F A;  2IA4 A;  4MFI A;  4IO6 A;  1LBC A;  4P8B A;  3TTN A;  3OEN A;  3FJM A;  4NF5 B;  1NV5 A;  3KJ7 A;  5CI5 A;  4GVO A;  1A40 A;  3HPI A;  1BLF A;  4BDM A;  3PD9 A;  2REG A;  4EQ9 A;  1MY0 A;  3FAS A;  1YCJ A;  1D4N A;  1LEV A;  1K9Z A;  1H76 A;  3K01 A;  3EF7 A;  4YKP A;  3EQ1 A;  4MIJ A;  3O9P A;  5ICT A;  3IOV A;  2HQ0 A;  2CZH A;  1TXF A;  1IXC A;  3W9V A;  2HZK A;  1BTJ A;  4F3S A;  4IGT A;  4N17 A;  2DXR A;  4PAK A;  5CMB A;  5CMC A;  5A5X A;  1FQE A;  2HCA A;  4P11 A;  1R6Z A;  4DZ1 A;  1FBE A;  4ELQ A;  2XX7 A;  3FVG A;  4NMY A;  2WBB A;  3TYH A;  1LBY A;  2FHY A;  1FBP A;  2NUV A;  4OEV A;  2OPD A;  2DS9 A;  5DVJ A;  2XWK A;  5AA2 B;  3FXQ A;  4KFQ A;  2RF1 A;  2FYI A;  5H8Q B;  1DK4 A;  3TZA A;  1FBG A;  1FTO A;  1IXH A;  3T9X B;  4PF6 A;  4MMP A;  5DEX A;  1B3F A;  3IOU A;  1EYI A;  5DVF A;  3LC8 A;  4JWX A;  3KC1 A;  4F22 A;  4DXU A;  2HPG A;  2MKZ A;  2VPO A;  3IX1 A;  4G4P A;  1UQW A;  3FV1 A;  4KHZ E;  1MXZ A;  4DI3 D;  3BIH A;  4PET A;  1B4Z A;  4PFU A;  3I5O A;  4H5G A;  4MBP A;  5H8N B;  4GIZ A;  2P2A A;  3RGY A;  1HSL A;  3PV0 E;  1Y3P A;  1SI0 A;  1KWH A;  1ZMG A;  2X7Q A;  5H8H B;  2QRY A;  2VPN A;  3QSL A;  3PPP A;  4O94 A;  4PFY A;  4ESX A;  1YTV A;  1DPE A;  4QFK A;  4H65 A;  3ONM A;  5CBS A;  3P7I A;  4ZEC A;  1SYH A;  1XI6 A;  3RTF B;  3JZJ A;  2V3T A;  2P3N A;  4QFP A;  4Q8R A;  4ONY A;  2HEU A;  1A55 A;  5J16 A;  3T9H B;  1YZ0 A;  3KC0 A;  3E78 A;  1QKA A;  3OO7 A;  1US4 A;  2GHB A;  1IEJ A;  3RUM A;  1M5D A;  3UK4 A;  2XXQ A;  2ANJ A;  4QF9 A;  5I59 A;  1JW1 A;  3B7D A;  2DQV A;  4IY6 A;  1VFE A;  3T9V A;  3LBS A;  1B0L A;  3B8B A;  1PBP A;  1PEB A;  4FIM A;  1FBH A;  1H44 A;  3UGW A;  4KYS A;  1USY H;  4PFB A;  1UTB B;  4FJP A;  1WDN A;  1OMP A;  1FPD A;  1MQI A;  4GLI A;  3MC2 A;  3V5A A;  1RDZ A;  2DDK A;  2PFZ A;  5BUU A;  2WYK A;  2XXX A;  2NWJ A;  2F7C A;  2I49 A;  1B05 A;  1NFT A;  3SKP A;  2OWZ A;  1JP4 A;  2DVC A;  4ELP A;  1LAF E;  1N84 A;  4GWU A;  3TQL A;  4NF6 B;  2XD2 A;  4POW A;  3ZKL A;  3PU5 A;  3CG3 A;  2DXY A;  3CFX A;  3OSR A;  1AIV A;  4KR5 A;  4N6P A;  3TEL A;  1LBX A;  2RC8 A;  1S9T A;  4JBZ A;  3IFC A;  1T0K A;  4QSD A;  3DM0 A;  2WYP A;  3KBZ A;  2FIX A;  5DYH A;  1VR5 A;  2UVG A;  4X9T A;  2OWT A;  2DWJ A;  5ITP A;  1FQA A;  2Y7K A;  3G7W A;  4X04 A;  4Q30 B;  3CR9 A;  2NXO A;  3FXU A;  2F97 A;  2ZYM A;  1MDQ A;  1A8E A;  1L5T A;  3OO6 A;  3UP9 A;  2F3D A;  1MRP A;  2P1S A;  1MQG A;  3PMX A;  3EN3 A;  2Y7I A;  1EZP A;  1B0H A;  3D4G A;  1FTM A;  4GBW A;  5L9O A;  1OLA A;  3OSQ A;  1BIY A;  2ABH A;  4H1X A;  4BDL A;  3G3K A;  1TWY A;  3E3K A;  1FCK A;  3KN8 A;  2B65 A;  3GYY A;  1GGG A;  5EYH A;  4P3L A;  1D3K A;  3S9N C;  1NV4 A;  5ET6 A;  1LCT A;  2ESN A;  4NG7 A;  3RT6 B;  1PBQ A;  1RKM A;  2A5T A;  4OHN A;  5FHO A;  4PFW A;  3N6U A;  1P1N A;  2A5S A;  2QVU A;  1LBB A;  1B9J A;  1P1Q A;  2O68 A;  3O6I A;  1B32 A;  1IXG A;  1NV2 A;  1URS A;  4WEP A;  3MWB A;  2PBW A;  3FIR A;  3TKD A;  1M5B A;  1JQF A;  3L6G A;  5B70 A;  2UXA A;  1SW2 A;  4GX3 A;  5T3J A;  2VHA A;  4N15 A;  4G8M A;  2M8C A;  1OVB A;  5K2X A;  4H45 A;  1LBV A;  3QUF A;  2H25 A;  4KPT A;  2HXR A;  1ANF A;  1G0I A;  4MEV A;  3CHG A;  3LR1 A;  1JEU A;  3C4M A;  1KA1 A;  3FXB A;  4GWS A;  3MST A;  3TTR A;  3RQT A;  3ODB A;  1Y9U A;  4N91 A;  5BWJ A;  1FPF A;  1P1U A;  1Q35 A;  2WX9 A;  3LV0 A;  3O6H A;  2RKM A;  1MXX A;  1ZKB A;  1MS7 A;  2XXV A;  4TQU Q;  3B50 A;  5KDT B;  1S50 A;  1FPE A;  3IAZ A;  2V3U A;  2I58 A;  2UVJ A;  3BFT A;  4U4S A;  2REJ A;  4F18 A;  3KOT A;  3MVW A;  5A5L A;  2XX8 A;  4GBV A;  1NNP A;  1LB8 A;  4ZEF A;  3FAT A;  4LN5 A;  3C31 A;  2Q88 A;  3C36 A;  2B4M A;  4H46 A;  3K1N A;  1DOT A;  2ZZX A;  2I0B A;  4G68 B;  5I7I A;  3PUV E;  4PFT A;  1Q9D A;  3VXC A;  1RDX A;  3OO8 A;  1TFD A;  3HHF A;  4TLM B;  1SI1 A;  1MM7 A;  3H3G A;  4MHF A;  2VD2 A;  3T22 A;  3OMB A;  2KQZ A;  2RCA A;  1AMF A;  1LAX A;  4QBA A;  2I0C A;  2O7I A;  3M8U A;  3LSW A;  5I84 A;  4IY5 A;  3RPL A;  1MQD A;  3IB0 A;  5JTY A;  3SET A;  2NVU B;  2Y84 A;  5ET5 A;  3Q26 A;  1FTK A;  2G29 A;  3V89 B;  3OD7 A;  4QSC A;  1GTK A;  3H06 B;  3VVF A;  1M5F A;  2Z8D A;  4XFE A;  5JK4 A;  1LLS A;  3SEY A;  4NHB A;  4OAN A;  3MPK A;  2ONS A;  2GQ1 A;  1Z7N E;  3FBP A;  3R6U A;  1NV6 A;  4FEB A;  3SEU A;  5I58 B;  1MXV A;  5EQA A;  4DDD A;  4P0I A;  2DWI A;  1FJ6 A;  1FPG A;  4ZZE A;  1JET A;  3UN6 A;  3UA8 A;  2Z22 A;  1N04 A;  4OES A;  1NUZ A;  1H43 A;  4GRK A;  4JSO A;  4NF4 B;  4R72 A;  2D3I A;  2DYX A;  1IMA A;  1NI9 A;  2Y5K A;  1JW4 A;  5DT6 A;  3U94 A;  2OWS A;  3MZ1 A;  3LSX A;  2O7U A;  4G8H A;  1EU8 A;  1FRP A;  4EQB A;  2XXI A;  4PDD A;  2DWA A; 
#chains in the Genus database with same CATH homology
 4P1L A;  4DI3 D;  4X8R A;  3BIH A;  4PET A;  4HCW A;  4HXV A;  5IM2 A;  2F5X A;  5ESY A;  4N4U A;  1IMF A;  5ET7 A;  1RDY A;  4N81 A;  5F24 A;  2VPN A;  4O94 A;  5IZ3 A;  5IZ1 A;  1XI6 A;  5CM6 A;  4JVI A;  5EQ8 A;  1VDW A;  2XWI A;  2P3N A;  5ET8 A;  2P3V A;  4HCY A;  5J16 A;  4PBH A;  1YZ0 A;  3KC0 A;  3E78 A;  2HHM A;  4JVD A;  4GX6 A;  2FIE A;  4PFI A;  2HZL A;  1FPB A;  1K9Y A;  3B8B A;  4XF5 A;  1FBH A;  2PFY A;  4OVQ A;  4AS5 A;  4OVT A;  4PFB A;  4OVR A;  1FPD A;  3LUZ A;  1RDZ A;  3ROJ A;  1FBF A;  2DDK A;  2PFZ A;  2WYK A;  1CNQ A;  4OA4 A;  3IFA A;  5IGA A;  2V3Q A;  4JVC A;  2DVZ A;  1G0H A;  3ISP A;  2OWZ A;  2ZZV A;  4G61 A;  1D9Q A;  1JP4 A;  1DCU A;  3A29 A;  1NV3 A;  4O7I A;  4GWU A;  4F19 A;  2KR0 A;  4NN3 A;  1LBX A;  4IR8 A;  4MX6 A;  4PE3 A;  3U65 A;  3IFC A;  2CEY A;  2WYP A;  3T1B A;  1AWB A;  5LTC A;  4N6K A;  3KBZ A;  2FIX A;  4MNI A;  4X9T A;  4XEQ A;  4I40 A;  1LBZ A;  4DI4 B;  4X04 A;  5LDZ A;  4PTK A;  3BIG A;  2Q9T A;  4PAF A;  3HFU A;  5FBP A;  2B4L A;  2JJK A;  4NAP A;  2F3D A;  4PAI A;  2F3B A;  4PGN A;  4PCD A;  3E79 A;  1FPK A;  3RPL B;  5J1D A;  3D1R A;  3MYU A;  4OVP A;  4N8Y A;  3W9W A;  3T0J A;  4GX4 A;  1NV1 A;  1YXI A;  4P47 A;  4GBW A;  1YYZ A;  2FBP A;  1SPI A;  4PGP A;  1FJ9 A;  5EQ9 A;  4PF8 A;  2CEX A;  3GYY A;  1FTA A;  4I3Y A;  3PTY A;  4YZZ A;  5EYH A;  2QVV A;  4P3L A;  4P9K A;  4O7M A;  1KA0 A;  1NV4 A;  5I3S A;  5ET6 A;  4QXD A;  4NG7 A;  2XWV A;  2PCR A;  4M1V A;  4HE1 A;  2XA5 A;  4MAG A;  1NV7 A;  2QVU A;  4HE0 A;  4N8G A;  1NV2 A;  4MNP A;  1QGX A;  5DW8 A;  4MNC A;  2XXK A;  1FSA A;  4GX3 A;  5T3J A;  2WEF A;  4N15 A;  1NUY A;  5EQ7 A;  3SZP A;  4NGU A;  4H45 A;  1LBV A;  1EYJ A;  3QMF A;  4PBQ A;  1EYK A;  2HXR A;  1G0I A;  4MEV A;  3CHG A;  4F1V A;  1IME A;  2OX3 A;  3RYD A;  5I5P A;  1KA1 A;  3FXB A;  4GWS A;  2Q74 A;  3MST A;  2CZK A;  4GWW A;  4N91 A;  2XWO A;  1DBZ A;  1FPF A;  5IZ3 B;  1FBD A;  2WX9 A;  1NUW A;  3LV0 A;  4GWZ A;  3EKI A;  1BK4 A;  3B50 A;  4NF0 A;  1NV0 A;  1FPE A;  4GWY A;  4NQ8 A;  1NUX A;  4HE2 A;  5IZZ A;  4F18 A;  4N6D A;  4P1E A;  2L5V A;  4PDH A;  5A5L A;  2FVZ A;  4GBV A;  4P56 A;  2DE4 A;  2Q8M A;  1FPJ A;  4I3E A;  4P8B A;  4LN5 A;  4GWX A;  2B4M A;  4H46 A;  2ZZX A;  1KZ8 A;  1NV5 A;  2DE3 A;  5I7I A;  1Q9D A;  4AS4 A;  1RDX A;  2QFL A;  1LEV A;  1K9Z A;  1IMB A;  4FBP A;  2R8T A;  3NOH A;  4UAB A;  4NX1 A;  4MHF A;  1IMC A;  4MJO A;  2KQZ A;  2V4C A;  4MIJ A;  4QBA A;  4PC9 A;  2CZH A;  3RPL A;  2QVR A;  2QPQ A;  4MCO A;  3W9V A;  2HZK A;  2CZI A;  4F1U A;  5ET5 A;  2VT5 A;  4N17 A;  4PAK A;  2BJI A;  5JK4 A;  4XFE A;  2ZZW A;  4NHB A;  1INP A;  4OAN A;  1FPI A;  2Y5L A;  2GQ1 A;  1FBE A;  4YIC A;  3FBP A;  2WBB A;  1LBY A;  2FHY A;  1FBP A;  1NV6 A;  1FPL A;  4O8M A;  2WBD A;  1FBC A;  5EQA A;  1FJ6 A;  2XWK A;  1FPG A;  2DE2 A;  1DK4 A;  1FBG A;  1NUZ A;  4OVS A;  1IMD A;  4PF6 A;  4PFR A;  4MMP A;  1IMA A;  1EYI A;  1LBW A;  1NI9 A;  2Y5K A;  3KC1 A;  4KXP A;  1FRP A;  2HPG A;  2MKZ A;  2VPO A;  4PDD A;  5EYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...