2JJKA

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate -1- phosphohydrolase) (e.c.3.1.3.11) complexed with a dual binding amp site inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Allosteric Fbpase Inhibitors Gain 10(5) Times in Potency When Simultaneously Binding Two Neighboring AMP Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2jjkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2jjkA02
5ET5A 1FPEA 1KA1A 4HE0A 4I40A 5ET7A 1FPKA 4GWXA 2Y5KA 4GWYA 1EYIA 3D1RA 1FPFA 4HXVA 1CNQA 4GWWA 2QFLA 5T3JA 1KA0A 2FIEA 3B8BA 1FBCA 2WBBA 1NV6A 1FBEA 1EYJA 1YZ0A 5EQ8A 4AS5A 1FSAA 1BK4A 1EYKA 1LBWA 1G0IA 2FBPA 1FRPA 2BJIA 3IFAA 4FBPA 4HE2A 4AS4A 1NV3A 4GWUA 1IMAA 1NUXA 4MJOA 2CZIA 2VT5A 1NV2A 4GBWA 5ET8A 1FBGA 3BIHA 5EQ7A 3IFCA 3RPLA 4GWSA 1DBZA 1K9YA 1K9ZA 4IR8A 1FJ6A 1NI9A 1LBVA 1NUYA 2DDKA 1JP4A 5EQAA 3LV0A 4O7IA 1NV4A 1IMEA 2OWZA 1YYZA 2F3DA 1FBFA 1G0HA 2GQ1A 1RDZA 1INPA 5EYGA 1IMFA 4PTKA 1RDYA 2R8TA 1NV1A 2P3NA 1VDWA 3A29A 4I3EA 2FIXA 1KZ8A 3KC0A 3QMFA 4GX4A 4QXDA 3RPLB 1Q9DA 1NV0A 2CZHA 1NUZA 1DCUA 3KBZA 1AWBA 2WBDA 5ET6A 1YXIA 1FTAA 1SPIA 5IZ1A 5DW8A 5J16A 1NV7A 1IMBA 1FPJA 4KXPA 1LBYA 1RDXA 1NUWA 4G61A 3RYDA 1FPBA 2HHMA 1FPGA 3FBPA 5EYHA 1NV5A 2Q74A 2PCRA 1FPIA 2P3VA 2QVUA 1FBHA 2F3BA 3KC1A 4GX3A 4GWZA 1QGXA 1LBZA 4I3YA 1LBXA 2OX3A 2FHYA 2QVRA 2WEFA 4HE1A 2Q8MA 5IZ3B 4H45A 1FPLA 5F24A 1FBPA 1IMCA 5LDZA 1FJ9A 5I3SA 1DK4A 5FBPA 4H46A 2CZKA 1FBDA 1FPDA 2FVZA 1XI6A 2JJKA 4GX6A 5ESYA 3BIGA 4N81A 3T0JA 4GBVA 1D9QA 5A5LA 3ROJA 5IZ3A 3LUZA 2Y5LA 5EQ9A 2QVVA 1IMDA 1LEVA
chains in the Genus database with same CATH superfamily
4HW8A 2G29A 4GVOA 3Q27A 4G8HA 1FQAA 3PPNA 4PDHA 4EXLA 3EHTA 1FBEA 5CBSA 3OEMA 3TMGA 1FQFA 4ZE9A 2UYEA 1NH8A 4O94A 4YB6A 4MF3A 1MXVA 3S4UA 3OXNA 3SETA 1NV2A 4H8IA 2REGA 2F97A 4PCDA 4PFUA 1YCJA 4PE3A 5I2KA 1DPEA 4IR8A 3UIFA 1H76A 4BDRA 1MQDA 2ANJA 5HM4B 3T9HB 3B50A 4H6DA 1UIUA 1RDZA 1US4A 5EYGA 3KN3A 1TT1A 4AB5A 3SEYA 3VV5A 4OETA 1NKXA 1SW2A 3KSXA 2CZHA 1DCUA 1FQEA 4QFKA 4G2ZA 1NV7A 1FPJA 4NF5B 1FTLA 2WYKA 1FQCA 2QS4A 3H06B 4XKNA 4RK2A 3UN6A 2FHYA 1URGA 1B7ZA 4HE1A 4YMBA 4H45A 1A55A 5IGAA 2PMSA 3OD7A 4GWOA 5ITOA 3MWBA 2XHDA 2DE4A 3IR1A 2UVJA 1FBDA 1FPDA 3UP9A 4GX6A 2AYSA 4N81A 1TXFA 2I58A 4X48A 3B7DA 3RTFB 3EF7A 2O1MA 3JV9A 1EYIA 4HXVA 4IGTA 1IXGA 4Z7EA 1EYJA 4JWYA 1PC3A 1LB9A 4N8YA 1MQJA 4HE2A 4U23A 5I58A 3LBSA 1R6ZA 2XXQA 1JW5A 4YKKA 2DWJA 1JP4A 4JBZA 3K0VA 4EF2A 3L6HA 3VFJA 1I69A 3OELA 1Q35A 2AL4A 1RDYA 1Z7NE 5DVJA 3FXUA 2RCAA 4GQOA 3RUMA 3R7XA 3QMFA 4OVPA 3HFUA 4GF8A 4NEDA 1SPIA 4H8JA 1POTA 5AA1A 1OQGA 5I2NB 3T1BA 3TTLA 2B3FA 1YAEA 4PQJA 1IMCA 2ZMBA 4U1OA 4P8BA 4H46A 4XTCQ 4MLVA 2Q8JA 4NF8A 3I5OA 4PFYA 3MZ1A 2Z23A 4MX6A 1IIWA 1XT8A 4H65A 1QJMA 1ZJLA 4LZ5A 4G68B 4JVDA 4OVQA 2XXPA 4YAHX 1BKAA 3E78A 2XXXA 1GVCA 3GZGA 4OFJA 4YKPA 1JW1A 1D4NA 3ZS6A 3KJTA 1LSTA 3VDFA 4PAIA 3KJ7A 1FSAA 5CC2A 4FBPA 3IOUA 1A8EA 2F6GA 3IB0A 3TEPA 3FV1A 1D3KA 1BLFA 1I6QA 3S9NC 3G3HA 4XKQA 4H67A 1M5FA 1BTJA 2G93A 5L9MA 3OO7A 3PMXA 1P1WA 5FHNA 2DDKA 3IO6A 4JWXA 2F3DA 4P9KA 2V25A 1B6HA 4NGUA 2OWSA 3RPLB 3PMWA 4YZZA 4AQ4A 5CMKA 5H8HB 4HCWA 5FTHA 3IX1A 3MP8A 1IMBA 4MLQA 5AA4B 3L6GA 5DTBA 4Q30B 2QVUA 2O6AA 5H8QA 1DSNA 2Q8MA 2A5TB 1PB7A 4OZ9A 5L8DA 5LDZA 1FJ9A 2HCAA 4KD5A 1VR5A 1LAGE 2ONKE 4F39A 1LBBA 5KDTA 2H4IA 3PPQA 3LSFB 2HFBA 4ESWA 3ROJA 4OHNA 4LVQA 4NWCA 3OO6A 4XXUA 3FD3A 3PUVE 4GWWA 1AMFA 2QFLA 2Z8FA 3QK6A 4KCCA 3S9MC 4ONYA 3QAXA 1SI0A 5F7VA 3G3KA 1BIYA 1OVTA 1NV3A 3N5LA 4YMAA 2A5SA 3DP6A 3IAZA 3PTYA 4GBWA 3CHGA 5TP9A 5JTYA 3M8UA 3CR9A 3TTMA 2PFZA 3KN7A 3MJNA 5CRYA 4QRZA 3M3FA 4ZEBA 4RPNA 3KBRA 3RY3A 4PAFA 4GD5A 5I56B 4EXKA 1KZ8A 2DP8A 1LAFE 4O8MA 2WBDA 4BDNA 3ECRA 1JNFA 1US5A 1B5JA 4L17A 1AOVA 2RC9A 4O3AA 1LCFA 3IJXB 4GWZA 3PUWE 1QGXA 3U1OA 3ILTB 3MVWA 5IZ3B 4KI0E 2H25A 2V4CA 1IXIA 2QS1A 4ELQA 2Z8EA 1NH7A 3K6WA 4FORA 3RGYA 2NVUB 4F22A 3CFZA 3MZ9A 1NNPA 2QJEA 1S7YA 4WEDA 1EU8A 3UA8A 1EZPA 4DI3D 1EZOA 4LATA 4P47A 3CFXA 2WBBA 5CI5A 2D5WA 1Y4TA 4N07A 5B70A 1LLSA 1USYH 5AA2B 2XXVA 1H3DA 4JVCA 4UA8A 1ANFA 3EHSA 2VPNA 2NXOA 3PPRA 3H7MA 3K1NA 2DE3A 1DBZA 4F3BA 1K9ZA 5BWJA 1PB8A 2PX1A 3E13X 1LBVA 5I84A 2H99A 4M1VA 2I0CA 2P2AA 1XVYA 2DYXA 1OMPA 3H6UA 4GX4A 1Q9DA 5IAIA 4OVSA 4XKRA 4BDOA 1MS7A 1AH5A 3EHUA 5J16A 3IB1A 3OOAA 3D4GA 4KPTA 3RYDA 3G7WA 4MNPA 2F36A 4X9TA 3CRBA 3K2DA 4H5FA 1B3HA 4WXJA 3K00A 4F18A 4QF9A 1MH4A 2I49A 2CZKA 4IY5A 3RTWB 3RQTA 3E4RA 1R9QA 3F11A 2F35A 1B4HA 3TELA 1MH3A 1II5A 2P1SA 2F7CA 3M3LA 1B5IA 5HBCA 4MBPA 1IUDA 4OTEA 2QL3A 4HE0A 1XVXA 4GWYA 3R26A 1FPFA 4RK9A 4DDDA 1N76A 2UVIA 2HXRA 3H6TA 3O28A 4OANA 3OSRA 1VFEA 2V3QA 4OFLA 4GRKA 4R72A 1O7TA 4LP2B 2BJIA 4AS4A 2VD3A 3C9HA 2XXUA 4KYDA 2XXWA 2OCUA 3E9XA 3FATA 1DMBA 1FBGA 3ISPA 4OYVA 3FJMA 1A7LA 1B0HA 1OVBA 3RT8A 3UK4A 1B1HA 4FE8A 4O7IA 1MDQA 1INPA 1ZMGA 1SW5A 2XWIA 4NMYA 3A3CA 5M2VA 1JETA 4ZEIA 3DM0A 1YTVA 2V84A 3TTRA 4P0GA 1GV8A 2QMWA 4KXPA 5ICTA 3PUXE 3WAEA 5I7IA 3IOVA 4NF0A 3QIMA 4DCYA 4NG7A 4I3YA 2OX3A 1LFHA 2DS9A 2Q2CA 3OENA 2ZXTA 1MXYA 4F3GA 5I2NA 1XI6A 4I62A 3T9VA 2RINA 1GR2A 2QS2A 1O63A 2XX8A 5K2YA 5FTIA 2QVVA 3RPWA 1FPEA 3B6QA 4N4UA 1HSLA 4N6DA 4KFQA 4OFOA 4U4XA 3VVEA 3IB2A 3AXFA 5TPAB 2PT2A 4G68A 5DEXB 4R9GA 1ZBMA 3U72A 3MQ9A 2I0BA 2OZZA 3SEXA 1P1QA 3W9WA 4OESA 1NUXA 1YPNA 5CM6A 2ONRA 4OERA 2GRVA 4NWDA 1IQ7A 4JVIA 3W9VA 1NI9A 4IY6A 4H1XA 1LCTA 1IMEA 3S9EA 3T93B 4EQ7A 4OQOA 4ZECA 4G77A 4ELRA 4YKJA 4C1TA 5H8FB 4C0RA 2ZZXA 2Z22A 5F1QA 1MXUA 3IK6B 4PETA 3SEVA 5IZ1A 3TCHA 4PC9A 1WODA 3PPOA 1OIBA 4NF6B 3CSGA 1FPBA 1Y3PA 2I3VA 2Q88A 1T0KA 1FBHA 2PFYA 2F3BA 4IO4A 1J1NA 4QSCA 4XF5A 3V89B 5H8HA 3PPPA 2ABHA 2UYFA 2V93A 1FBPA 2HAUA 5I3SA 1Z7ME 3O6HA 1P1UA 2ESNA 5CMBA 4ELPA 1Y1MA 2A5TA 2F34A 1Y1ZA 2FNCA 3S9LC 2OWTA 3GXAA 1DPPA 2QPQA 2Y5KA 2CEYA 3QUJA 1VFDA 3T22A 3BKIB 2DXYA 4M4GA 3SZPA 2YLNA 3FGSA 3MVXA 4JXIA 3PMVA 2XXKA 5DYHA 4GWUA 3CSBA 3T9UA 4PGNA 3TODA 5IZZA 4ESXA 4MNIA 2ALUA 1LFIA 4Q0CA 2ZZWA 4LZ8A 3CG1A 4QSDA 2RC7A 5JK4A 1HSEA 1LB8A 4N15A 2OWZA 3FZVA 4PBQA 2UVHA 2X7QA 4EF1A 4QFNA 4Q5TA 4PTKA 2R8TA 4LZ7A 1VDWA 2B4LA 4NX1A 4H0WA 3N6UA 3QUFA 2Y7WA 4KYEA 2BJJX 1NUZA 3N26A 5ET6A 2VP1A 3MZBA 4X1BA 3KOSA 3W15C 2OJTA 2NOOA 3U92A 4F31B 2O7UA 2XXIA 5I56A 1NV5A 3U65A 1OLAA 2F78A 2V3TA 4LN5A 3FVGA 2QS3A 4ZEKA 4I8CA 4N8GA 2KR0A 4KCDA 4X8RA 5I58B 1N84A 4E0XA 2DXRA 1HSJA 2XXYA 3RT6B 3EKIA 2B65A 5IZ3A 4JSOA 3DP4A 4DXUA 1UIVA 3KEIA 5A5XB 3JYRA 4MIJA 3C32A 5JEIA 1Y9UA 3FJGA 5ET7A 4F1VA 1B1XA 1QW0A 2E0SA 1FBCA 4RA1A 1TWYA 5H8NA 1YZ0A 1FQDA 1LBWA 3TDJA 3IFAA 2HQ0A 1JEVA 3O2AA 4FEDA 4GLIA 3FXBA 2GFEA 3SESA 2CZIA 2VT5A 1FCKA 1B7UA 1H43A 1XHYA 2M8CA 4OEVA 1NNKA 4PFBA 2CEXA 3SKPA 1SW4A 1M5EA 5AA2A 1B2HA 2QMXA 4G4PA 1B4ZA 4NF8B 1N04A 3TFLA 2ZYKA 1ZKBA 3KBZA 2HEUA 4LQ2A 4BDLA 1B9JA 1MPBA 4ELOA 2GHAA 4N6PA 1LBYA 1GTKA 3K1MA 3SEUA 2O69A 4X04A 3LC8A 4N6KA 4ZEFA 1SYHA 2WKYA 2QVRA 4RY1A 1EZ9A 2WEFA 3I6VA 2XWKA 4F3SA 4GXAA 4I1DA 1RKMA 4YICA 2VHAA 3UORA 2O84X 2DWHA 1ATGA 1RYOA 4MCOA 3O6IA 4XFEA 4NF4A 5ESYA 1DOTA 4Z0IA 1VSOA 1NMUA 3OEKA 1QKBA 1NNTA 2F8DA 4XIGQ 1B58A 4R6KA 4BLAA 4PFRA 3D1RA 5HPQA 1KA0A 2OPDA 1SI1A 2ZYNA 3TAJA 2WX9A 2YPNA 3O6GA 1IITA 4DE8A 5EQ8A 4GIZA 1A99A 4AS5A 4OXVA 3FVKA 1DTGA 1MY1A 3MP1A 5LOMA 3QXMA 4IO6A 4XEQA 4TQUQ 4RPOA 3Q26A 2GHBA 3K6VA 4IGRA 3MSTA 3H6WA 4FECA 4F1YA 2REJA 3K4UA 3O66A 1K9YA 3HHGA 3IO4A 5IM2A 3KFMA 2Q89A 1N3WA 3USDA 1MY0A 5ELVA 2GQ1A 2PYYA 2ZYMA 1WDNA 4P1LA 3SEWA 4PBHA 1ZLQA 4DI4B 2P3NA 4H5GA 5AA2D 3ZKKA 1QUJA 2XD3A 1AL3A 5I59B 3GBAA 5DVFA 2B4MA 3HO7A 3O97A 5ITPA 4THIA 3PD9A 3T96B 4QFPA 3TTKA 3VLWA 1CB6A 3C4MA 3D4CA 4ZZAA 1TFDA 1M5CA 4R2FA 3VVFA 3MP6A 3H6VA 4QFOA 4MMPA 3U93A 4IO7A 3V5AA 1N0TA 2P0SA 1QKAA 1MY2A 4DXCA 5ISUA 2Y7RA 3FIRA 5AA3A 5AE4A 4U22A 2FVZA 3FV2A 3T0JA 4GBVA 1NFTA 1CE2A 4KHZE 3LUZA 3OMBA 3PV0E 3CFLA 4O3BA 2RF1A 4QSEA 2HXWA 3B6TA 3VVDA 1JEUA 4IO3A 4GL8A 4O3CA 4UACA 4ZZEA 1QULA 1UTBB 2F6PA 1B3EA 3EPEA 3TQLA 2FIEA 4NF5A 4E0WA 4JSDA 1NV6A 1UTHB 3FASA 4KQPA 3IOTA 3N94A 3Q28A 4PDDA 3MW0A 4F1UA 3BFTA 4MJOA 1VE4A 5TPAA 2Y7PA 3PGFA 3CG3A 3ONMA 4HS7A 2X26A 1F9BA 4IO2A 4LUBA 2Q2AA 4NE4A 4XKPA 3DELB 1FJ6A 3I3VA 3IORA 2L5VA 1YYZA 1NNFA 1G0HA 2ONSA 5IKBA 3IOWA 4R9FA 2R9JA 2Q9TA 4GOTA 5H8FA 2CMOA 4ECFA 3VLVA 2F7BA 1NUWA 1ELJA 5EYHA 2PVUA 1URDA 2DWIA 1FPIA 3V8XB 4RXLA 4OVRA 2ZZVA 3BFUA 3FVOA 3DLNA 4N17A 1FPLA 1NL5A 2I3WA 1JQFA 4FEBA 3PUYE 4NF6A 3E79A 4PGPA 3MPKA 2ZNUA 4U2RA 1B7HA 2XXTA 1JVXA 2NUVA 4NN3A 2Y5LA 1B46A 2XA5A 2KLFA 3A09A 1FPKA 2B3BA 2ZYOA 3TZAA 2R71A 4QHQA 4ZS9A 4FIMA 5I5PA 3HPIA 5I57B 1EYKA 1IXHA 5KCJB 4GFRA 2O1LA 1Y20A 2VPOA 3BBRA 3S2VA 4IB2A 5L9SA 4MEVA 1AIVA 1P1NA 3Q25A 4GWSA 1MXXA 4F2QA 1Q1KA 3HSTA 3TCFA 1LAXA 4U1ZA 3KSJA 4YB5A 3ZSFA 4NHBA 3MPLA 4MFIA 3HCQA 1FTKA 4I3EA 1WVJA 3DP8A 4ZEDA 1R9LA 2XX7A 4QXDA 4YU0A 2O68A 4DLDA 1MXZA 5DW8A 3LR1A 4PF8A 2D3IA 4QBAA 2Q74A 4IO5A 4U21A 4GX3A 2XWVA 1LBXA 4X1DA 4ZDMA 2HZLA 3FVNA 1FTJA 4HTGA 3KG2A 4R2BA 4P0IA 5L9OA 3BIGA 1XS5A 5LTCA 1MQHA 3RN8A 3G3GA 2QSXA 2WYPA 3RPLA 4WKMA 3LUYA 4R74A 2AIXA 3UGWA 2V3UA 3TTNA 1CNQA 5AA4A 3B8BA 3ZKLA 4JB7A 3HHFA 1B3FA 3C36A 5A5XA 1UQWA 3THIA 2R6GE 1BK4A 5I2KB 4RNSA 3HV1A 2O51A 4KYSA 5EYFA 1A40A 3K01A 2XX9A 2IEEA 4LQ5A 2OLBA 5FHOA 1P1OA 2I6EA 3MUQA 1PBPA 2DQVA 1NUYA 2GH9A 1MDP1 1SDXA 4PFWA 1P99A 1Y3NA 5DT6A 3K6UA 1PB9A 1IXCA 4PP0A 5EHMA 2ZNTA 3SDFA 2OPEA 3QYTA 2RKMA 1N7XA 3A29A 3CI8A 1RYXA 4OMBA 1FQBA 3C33A 1NV0A 1SYIA 1FTAA 1B40A 5KZTA 1URSA 2RC8A 4G61A 2HHMA 1MG1A 1MPCA 2VOZA 1SVXB 3V83A 2H98A 1B0LA 2VGQA 1JW4A 3K1PA 3GLBA 2UXAA 1FTOA 3QSLA 5FBPA 4DCXA 3E3KA 1EH3A 2JJKA 2NWJA 1B51A 2IA4A 2VD2A 3RNNA 2Y7KA 3C31A 3JZJA 4TOZA 3TCGA 4I9DA 3G3JA 3MYUA 1LEVA 4I40A 1ZIUA 4GWXA 1B3LA 3FUZA 2Y7IA 4JDFA 5T3JA 4DIGA 2E1SA 3TYHA 3WAFA 4P1EA 4R75A 1POY1 3M3KA 3K02A 4O7MA 3IJOB 2FBPA 1KWHA 4ISUA 4QFLA 4ND9A 4EDPA 1IMAA 4OENA 1D9VA 2I4CA 2YJPA 1MM6A 1FTMA 1OLCA 4R6HA 4MNCA 5EQ7A 5B7DA 3OSQA 1XOCA 4OVTA 1MRPA 4F19A 1DTZA 1BP5A 4PE5B 4EQBA 1IMFA 1SBPA 4NAPA 2PBWA 2H9BA 2DE2A 4G8NA 3EQ1A 2DSFA 2PT1A 3KOTA 2DOJA 1N3XA 4P11A 3VLUA 3FXQA 4Q8RA 1FPGA 1QVSA 4PF6A 3KN8A 1QUKA 4MH5A 4TLMB 1Y3QA 1LBZA 3FXRA 5I59A 5TU0A 1L5TA 3EN3A 3K6XA 1S50A 3T9XB 4G8MA 1DK4A 4OWDA 1PDAA 1GGGA 3B6WA 5H8SA 3LSWA 3P7IA 4RYAA 2THIA 3Q29A 1IZ1A 4EQ9A 1D9QA 5A5LA 2MKZA 3MBPA 4MHFA 3MC2A 1ZTYA 2XD2A 1I6BA 3U8QA 5ET5A 4FAJA 3MAMA 4FJPA 1KA1A 4F29A 1JVYA 5CMCA 1PEBA 3OO8A 1FW0A 1OQHA 4NQ8A 2QRYA 1A8FA 5CMMA 3LSLA 4JWOA 3PUZE 4NTLA 3TKDA 3CIJA 1ZU0A 3SERA 1G0IA 1FRPA 1UTBA 4MAGA 4PAKA 4EUOA 1PBQA 3MVYA 5ET8A 3ILUB 1UTHA 3LSXA 3BIHA 4LA9A 1LBCA 2Y84A 4PFIA 1M5BA 1B52A 4OA4A 1LGBC 4OVJA 5EQAA 4AB6A 3LV0A 1A54A 3FJ7A 1N7WA 4RJZA 5ICQA 1FBFA 2F7AA 2RCBA 4POXA 2F5XA 1TFAA 2O7IA 1NV1A 4G68C 2XXRA 4PFTA 4F2OA 2FYIA 2FIXA 3ODBA 4POWA 3C34A 1QUIA 1Y4CA 4U4SA 4ZE8A 1USYE 2Z8DA 5H8QB 1B3GA 2OK2A 3GBBA 1MQGA 3NOHA 4OEUA 1XC1A 1MXWA 5BUUA 4P56A 2OBGA 3RLFE 2PCRA 3PD8A 5H8NB 4UABA 1R1NA 3KC1A 1B32A 3H3GA 5KDTB 3U94A 4WEPA 1MM7A 5J1DA 4DXBA 3HN0A 4LONB 3PU5A 1O64A 3H03A 4N13A 4FATA 5EHSA 2HAVA 3N6TA 4K3FA 4DZ1A 3R6UA 5FHMA 3KZGA 2I48A 4P3LA 2DVZA 3TQWA 2UVGA 5K2XA 2FA7A 4HCYA 1H45A 5CBRA 4TLLB 5TP9B 5JTYB 1LAHE 3T66A 2W7YA 4KR5A 3G3FA 4F3PA 2ZNSA 4BDMA 4YKIA 2XXHA 4YB7A 1D9YA 3VE1B 1MPDA 1MY3A 3TUSA 1LFGA 2CZLA 3IFCA 3MVZA 5I57A 1SQYA 1S9TA 3A3UA 3VXBA 5KCJA 3GYYA 1IEJA 2DVCA 1NV4A 3O29A 4R6YA 2AL5A 4NF4B 1MY4A 2XWOA 1B5HA 2DWAA 3KC0A 2HPGA 5DVIA 5DEXA 1AWBA 2HZKA 1YXIA 3O9PA 1SD3A 4GL0A 3OO9A 3CVGA 1RDXA 3FBPA 2X7PA 2KQZA 2P3VA 2D21A 2I4BA 3KGCA 4BDQA 3H4ZA 3TPAA 4R73A 3IL1B 5F24A 1H44A 1SW1A 1I6AA 4GXSB 2H5YA 1MQIA 2LAOA 3VXCA 1M5DA 1B05A 4N91A 3C35A 5EQ9A 4C1UA 1IMDA 3G3IA
chains in the Genus database with same CATH topology
4MIJA 4DI3D 5ET7A 4F1VA 4P47A 1CNQA 4PDHA 3B8BA 1FBCA 2WBBA 1FBEA 1YZ0A 1BK4A 1LBWA 3IFAA 4O94A 4JVCA 3FXBA 2CZIA 2VT5A 1NV2A 2VPNA 4PCDA 4PFBA 2DE3A 2CEXA 4PE3A 1DBZA 1K9ZA 4IR8A 1LBVA 1NUYA 3B50A 1RDZA 4M1VA 5EYGA 3A29A 4GX4A 1Q9DA 1NV0A 2CZHA 1DCUA 3KBZA 4OVSA 1FTAA 5J16A 1NV7A 1FPJA 1LBYA 4G61A 3RYDA 2HHMA 4MNPA 4X9TA 2WYKA 4X04A 4N6KA 2FHYA 2QVRA 4F18A 2WEFA 4HE1A 2XWKA 4H45A 5IGAA 4YICA 5FBPA 2CZKA 2DE4A 1FBDA 1FPDA 4MCOA 4XFEA 2JJKA 4GX6A 5ESYA 4N81A 3MYUA 1LEVA 4HE0A 4I40A 4PFRA 4GWXA 4GWYA 1EYIA 3D1RA 1FPFA 4HXVA 5T3JA 1KA0A 2HXRA 4OANA 2WX9A 4P1EA 1EYJA 5EQ8A 2V3QA 4AS5A 4O7MA 4N8YA 2FBPA 2BJIA 4HE2A 4AS4A 1IMAA 4XEQA 3ISPA 1FBGA 3MSTA 4MNCA 5EQ7A 1K9YA 5IM2A 1JP4A 4O7IA 4OVTA 4F19A 1IMDA 2GQ1A 4P1LA 1INPA 1IMFA 4NAPA 1RDYA 4PBHA 2DE2A 2XWIA 4DI4B 2P3NA 3QMFA 4OVPA 3HFUA 1SPIA 2B4MA 4KXPA 1FPGA 5I7IA 4PF6A 3T1BA 4NF0A 1LBZA 4NG7A 4I3YA 2OX3A 4MMPA 1IMCA 4P8BA 1DK4A 4H46A 2FVZA 1XI6A 3T0JA 4GBVA 1D9QA 4MX6A 5A5LA 2MKZA 3LUZA 4MHFA 4JVDA 2QVVA 4OVQA 5ET5A 1FPEA 1KA1A 4N4UA 4N6DA 3E78A 4NQ8A 2FIEA 1NV6A 4PAIA 1FSAA 4PDDA 1G0IA 4F1UA 1FRPA 4FBPA 3W9WA 4MAGA 1NUXA 4MJOA 4PAKA 5CM6A 5ET8A 3BIHA 4JVIA 3W9VA 4PFIA 4OA4A 1FJ6A 1NI9A 2DDKA 5EQAA 3LV0A 1IMEA 2L5VA 1YYZA 2F3DA 1FBFA 1G0HA 4P9KA 2ZZXA 4NGUA 2F5XA 1NV1A 2FIXA 3RPLB 4YZZA 4HCWA 2Q9TA 4PETA 5IZ1A 4PC9A 3NOHA 1IMBA 1NUWA 1FPBA 5EYHA 4P56A 2PCRA 1FPIA 2QVUA 1FBHA 2PFYA 4UABA 4OVRA 2F3BA 3KC1A 2ZZVA 4XF5A 2Q8MA 4N17A 1FPLA 1FBPA 5LDZA 1FJ9A 5I3SA 5J1DA 3E79A 4PGPA 4NN3A 3ROJA 2Y5LA 2XA5A 1FPKA 4P3LA 2QPQA 2Y5KA 4GWWA 2CEYA 2QFLA 2DVZA 4HCYA 5I5PA 1EYKA 3SZPA 2XXKA 1NV3A 4GWUA 2VPOA 3PTYA 4GBWA 3CHGA 4MEVA 4PGNA 5IZZA 4MNIA 3IFCA 4GWSA 2ZZWA 3GYYA 2PFZA 1NV4A 5JK4A 4NHBA 4N15A 4PBQA 2OWZA 4PAFA 2XWOA 4PTKA 2R8TA 1VDWA 2B4LA 4I3EA 4NX1A 1KZ8A 3KC0A 4QXDA 2HPGA 4O8MA 1NUZA 1AWBA 2WBDA 5ET6A 1YXIA 2HZKA 5DW8A 4PF8A 1RDXA 3FBPA 4QBAA 1NV5A 2Q74A 3U65A 2KQZA 2P3VA 4GX3A 4GWZA 1QGXA 2XWVA 4LN5A 1LBXA 4N8GA 2HZLA 2KR0A 5IZ3B 5F24A 2V4CA 4X8RA 3BIGA 3EKIA 5LTCA 5IZ3A 4N91A 2WYPA 5EQ9A 3RPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ET5 A;  1FPE A;  1KA1 A;  4HE0 A;  4I40 A;  5ET7 A;  1FPK A;  4GWX A;  2Y5K A;  4GWY A;  1EYI A;  3D1R A;  1FPF A;  4HXV A;  1CNQ A;  4GWW A;  2QFL A;  5T3J A;  1KA0 A;  2FIE A;  3B8B A;  1FBC A;  2WBB A;  1NV6 A;  1FBE A;  1EYJ A;  1YZ0 A;  5EQ8 A;  4AS5 A;  1FSA A;  1BK4 A;  1EYK A;  1LBW A;  1G0I A;  2FBP A;  1FRP A;  2BJI A;  3IFA A;  4FBP A;  4HE2 A;  4AS4 A;  1NV3 A;  4GWU A;  1IMA A;  1NUX A;  4MJO A;  2CZI A;  2VT5 A;  1NV2 A;  4GBW A;  5ET8 A;  1FBG A;  3BIH A;  5EQ7 A;  3IFC A;  3RPL A;  4GWS A;  1DBZ A;  1K9Y A;  1K9Z A;  4IR8 A;  1FJ6 A;  1NI9 A;  1LBV A;  1NUY A;  2DDK A;  1JP4 A;  5EQA A;  3LV0 A;  4O7I A;  1NV4 A;  1IME A;  2OWZ A;  1YYZ A;  2F3D A;  1FBF A;  1G0H A;  2GQ1 A;  1RDZ A;  1INP A;  5EYG A;  1IMF A;  4PTK A;  1RDY A;  2R8T A;  1NV1 A;  2P3N A;  1VDW A;  3A29 A;  4I3E A;  2FIX A;  1KZ8 A;  3KC0 A;  3QMF A;  4GX4 A;  4QXD A;  3RPL B;  1Q9D A;  1NV0 A;  2CZH A;  1NUZ A;  1DCU A;  3KBZ A;  1AWB A;  2WBD A;  5ET6 A;  1YXI A;  1FTA A;  1SPI A;  5IZ1 A;  5DW8 A;  5J16 A;  1NV7 A;  1IMB A;  1FPJ A;  4KXP A;  1LBY A;  1RDX A;  1NUW A;  4G61 A;  3RYD A;  1FPB A;  2HHM A;  1FPG A;  3FBP A;  5EYH A;  1NV5 A;  2Q74 A;  2PCR A;  1FPI A;  2P3V A;  2QVU A;  1FBH A;  2F3B A;  3KC1 A;  4GX3 A;  4GWZ A;  1QGX A;  1LBZ A;  4I3Y A;  1LBX A;  2OX3 A;  2FHY A;  2QVR A;  2WEF A;  4HE1 A;  2Q8M A;  5IZ3 B;  4H45 A;  1FPL A;  5F24 A;  1FBP A;  1IMC A;  5LDZ A;  1FJ9 A;  5I3S A;  1DK4 A;  5FBP A;  4H46 A;  2CZK A;  1FBD A;  1FPD A;  2FVZ A;  1XI6 A;  2JJK A;  4GX6 A;  5ESY A;  3BIG A;  4N81 A;  3T0J A;  4GBV A;  1D9Q A;  5A5L A;  3ROJ A;  5IZ3 A;  3LUZ A;  2Y5L A;  5EQ9 A;  2QVV A;  1IMD A;  1LEV A; 
#chains in the Genus database with same CATH topology
 4HW8 A;  2G29 A;  4GVO A;  3Q27 A;  4G8H A;  1FQA A;  3PPN A;  4PDH A;  4EXL A;  3EHT A;  1FBE A;  5CBS A;  3OEM A;  3TMG A;  1FQF A;  4ZE9 A;  2UYE A;  1NH8 A;  4O94 A;  4YB6 A;  4MF3 A;  1MXV A;  3S4U A;  3OXN A;  3SET A;  1NV2 A;  4H8I A;  2REG A;  2F97 A;  4PCD A;  4PFU A;  1YCJ A;  4PE3 A;  5I2K A;  1DPE A;  4IR8 A;  3UIF A;  1H76 A;  4BDR A;  1MQD A;  2ANJ A;  5HM4 B;  3T9H B;  3B50 A;  4H6D A;  1UIU A;  1RDZ A;  1US4 A;  5EYG A;  3KN3 A;  1TT1 A;  4AB5 A;  3SEY A;  3VV5 A;  4OET A;  1NKX A;  1SW2 A;  3KSX A;  2CZH A;  1DCU A;  1FQE A;  4QFK A;  4G2Z A;  1NV7 A;  1FPJ A;  4NF5 B;  1FTL A;  2WYK A;  1FQC A;  2QS4 A;  3H06 B;  4XKN A;  4RK2 A;  3UN6 A;  2FHY A;  1URG A;  1B7Z A;  4HE1 A;  4YMB A;  4H45 A;  1A55 A;  5IGA A;  2PMS A;  3OD7 A;  4GWO A;  5ITO A;  3MWB A;  2XHD A;  2DE4 A;  3IR1 A;  2UVJ A;  1FBD A;  1FPD A;  3UP9 A;  4GX6 A;  2AYS A;  4N81 A;  1TXF A;  2I58 A;  4X48 A;  3B7D A;  3RTF B;  3EF7 A;  2O1M A;  3JV9 A;  1EYI A;  4HXV A;  4IGT A;  1IXG A;  4Z7E A;  1EYJ A;  4JWY A;  1PC3 A;  1LB9 A;  4N8Y A;  1MQJ A;  4HE2 A;  4U23 A;  5I58 A;  3LBS A;  1R6Z A;  2XXQ A;  1JW5 A;  4YKK A;  2DWJ A;  1JP4 A;  4JBZ A;  3K0V A;  4EF2 A;  3L6H A;  3VFJ A;  1I69 A;  3OEL A;  1Q35 A;  2AL4 A;  1RDY A;  1Z7N E;  5DVJ A;  3FXU A;  2RCA A;  4GQO A;  3RUM A;  3R7X A;  3QMF A;  4OVP A;  3HFU A;  4GF8 A;  4NED A;  1SPI A;  4H8J A;  1POT A;  5AA1 A;  1OQG A;  5I2N B;  3T1B A;  3TTL A;  2B3F A;  1YAE A;  4PQJ A;  1IMC A;  2ZMB A;  4U1O A;  4P8B A;  4H46 A;  4XTC Q;  4MLV A;  2Q8J A;  4NF8 A;  3I5O A;  4PFY A;  3MZ1 A;  2Z23 A;  4MX6 A;  1IIW A;  1XT8 A;  4H65 A;  1QJM A;  1ZJL A;  4LZ5 A;  4G68 B;  4JVD A;  4OVQ A;  2XXP A;  4YAH X;  1BKA A;  3E78 A;  2XXX A;  1GVC A;  3GZG A;  4OFJ A;  4YKP A;  1JW1 A;  1D4N A;  3ZS6 A;  3KJT A;  1LST A;  3VDF A;  4PAI A;  3KJ7 A;  1FSA A;  5CC2 A;  4FBP A;  3IOU A;  1A8E A;  2F6G A;  3IB0 A;  3TEP A;  3FV1 A;  1D3K A;  1BLF A;  1I6Q A;  3S9N C;  3G3H A;  4XKQ A;  4H67 A;  1M5F A;  1BTJ A;  2G93 A;  5L9M A;  3OO7 A;  3PMX A;  1P1W A;  5FHN A;  2DDK A;  3IO6 A;  4JWX A;  2F3D A;  4P9K A;  2V25 A;  1B6H A;  4NGU A;  2OWS A;  3RPL B;  3PMW A;  4YZZ A;  4AQ4 A;  5CMK A;  5H8H B;  4HCW A;  5FTH A;  3IX1 A;  3MP8 A;  1IMB A;  4MLQ A;  5AA4 B;  3L6G A;  5DTB A;  4Q30 B;  2QVU A;  2O6A A;  5H8Q A;  1DSN A;  2Q8M A;  2A5T B;  1PB7 A;  4OZ9 A;  5L8D A;  5LDZ A;  1FJ9 A;  2HCA A;  4KD5 A;  1VR5 A;  1LAG E;  2ONK E;  4F39 A;  1LBB A;  5KDT A;  2H4I A;  3PPQ A;  3LSF B;  2HFB A;  4ESW A;  3ROJ A;  4OHN A;  4LVQ A;  4NWC A;  3OO6 A;  4XXU A;  3FD3 A;  3PUV E;  4GWW A;  1AMF A;  2QFL A;  2Z8F A;  3QK6 A;  4KCC A;  3S9M C;  4ONY A;  3QAX A;  1SI0 A;  5F7V A;  3G3K A;  1BIY A;  1OVT A;  1NV3 A;  3N5L A;  4YMA A;  2A5S A;  3DP6 A;  3IAZ A;  3PTY A;  4GBW A;  3CHG A;  5TP9 A;  5JTY A;  3M8U A;  3CR9 A;  3TTM A;  2PFZ A;  3KN7 A;  3MJN A;  5CRY A;  4QRZ A;  3M3F A;  4ZEB A;  4RPN A;  3KBR A;  3RY3 A;  4PAF A;  4GD5 A;  5I56 B;  4EXK A;  1KZ8 A;  2DP8 A;  1LAF E;  4O8M A;  2WBD A;  4BDN A;  3ECR A;  1JNF A;  1US5 A;  1B5J A;  4L17 A;  1AOV A;  2RC9 A;  4O3A A;  1LCF A;  3IJX B;  4GWZ A;  3PUW E;  1QGX A;  3U1O A;  3ILT B;  3MVW A;  5IZ3 B;  4KI0 E;  2H25 A;  2V4C A;  1IXI A;  2QS1 A;  4ELQ A;  2Z8E A;  1NH7 A;  3K6W A;  4FOR A;  3RGY A;  2NVU B;  4F22 A;  3CFZ A;  3MZ9 A;  1NNP A;  2QJE A;  1S7Y A;  4WED A;  1EU8 A;  3UA8 A;  1EZP A;  4DI3 D;  1EZO A;  4LAT A;  4P47 A;  3CFX A;  2WBB A;  5CI5 A;  2D5W A;  1Y4T A;  4N07 A;  5B70 A;  1LLS A;  1USY H;  5AA2 B;  2XXV A;  1H3D A;  4JVC A;  4UA8 A;  1ANF A;  3EHS A;  2VPN A;  2NXO A;  3PPR A;  3H7M A;  3K1N A;  2DE3 A;  1DBZ A;  4F3B A;  1K9Z A;  5BWJ A;  1PB8 A;  2PX1 A;  3E13 X;  1LBV A;  5I84 A;  2H99 A;  4M1V A;  2I0C A;  2P2A A;  1XVY A;  2DYX A;  1OMP A;  3H6U A;  4GX4 A;  1Q9D A;  5IAI A;  4OVS A;  4XKR A;  4BDO A;  1MS7 A;  1AH5 A;  3EHU A;  5J16 A;  3IB1 A;  3OOA A;  3D4G A;  4KPT A;  3RYD A;  3G7W A;  4MNP A;  2F36 A;  4X9T A;  3CRB A;  3K2D A;  4H5F A;  1B3H A;  4WXJ A;  3K00 A;  4F18 A;  4QF9 A;  1MH4 A;  2I49 A;  2CZK A;  4IY5 A;  3RTW B;  3RQT A;  3E4R A;  1R9Q A;  3F11 A;  2F35 A;  1B4H A;  3TEL A;  1MH3 A;  1II5 A;  2P1S A;  2F7C A;  3M3L A;  1B5I A;  5HBC A;  4MBP A;  1IUD A;  4OTE A;  2QL3 A;  4HE0 A;  1XVX A;  4GWY A;  3R26 A;  1FPF A;  4RK9 A;  4DDD A;  1N76 A;  2UVI A;  2HXR A;  3H6T A;  3O28 A;  4OAN A;  3OSR A;  1VFE A;  2V3Q A;  4OFL A;  4GRK A;  4R72 A;  1O7T A;  4LP2 B;  2BJI A;  4AS4 A;  2VD3 A;  3C9H A;  2XXU A;  4KYD A;  2XXW A;  2OCU A;  3E9X A;  3FAT A;  1DMB A;  1FBG A;  3ISP A;  4OYV A;  3FJM A;  1A7L A;  1B0H A;  1OVB A;  3RT8 A;  3UK4 A;  1B1H A;  4FE8 A;  4O7I A;  1MDQ A;  1INP A;  1ZMG A;  1SW5 A;  2XWI A;  4NMY A;  3A3C A;  5M2V A;  1JET A;  4ZEI A;  3DM0 A;  1YTV A;  2V84 A;  3TTR A;  4P0G A;  1GV8 A;  2QMW A;  4KXP A;  5ICT A;  3PUX E;  3WAE A;  5I7I A;  3IOV A;  4NF0 A;  3QIM A;  4DCY A;  4NG7 A;  4I3Y A;  2OX3 A;  1LFH A;  2DS9 A;  2Q2C A;  3OEN A;  2ZXT A;  1MXY A;  4F3G A;  5I2N A;  1XI6 A;  4I62 A;  3T9V A;  2RIN A;  1GR2 A;  2QS2 A;  1O63 A;  2XX8 A;  5K2Y A;  5FTI A;  2QVV A;  3RPW A;  1FPE A;  3B6Q A;  4N4U A;  1HSL A;  4N6D A;  4KFQ A;  4OFO A;  4U4X A;  3VVE A;  3IB2 A;  3AXF A;  5TPA B;  2PT2 A;  4G68 A;  5DEX B;  4R9G A;  1ZBM A;  3U72 A;  3MQ9 A;  2I0B A;  2OZZ A;  3SEX A;  1P1Q A;  3W9W A;  4OES A;  1NUX A;  1YPN A;  5CM6 A;  2ONR A;  4OER A;  2GRV A;  4NWD A;  1IQ7 A;  4JVI A;  3W9V A;  1NI9 A;  4IY6 A;  4H1X A;  1LCT A;  1IME A;  3S9E A;  3T93 B;  4EQ7 A;  4OQO A;  4ZEC A;  4G77 A;  4ELR A;  4YKJ A;  4C1T A;  5H8F B;  4C0R A;  2ZZX A;  2Z22 A;  5F1Q A;  1MXU A;  3IK6 B;  4PET A;  3SEV A;  5IZ1 A;  3TCH A;  4PC9 A;  1WOD A;  3PPO A;  1OIB A;  4NF6 B;  3CSG A;  1FPB A;  1Y3P A;  2I3V A;  2Q88 A;  1T0K A;  1FBH A;  2PFY A;  2F3B A;  4IO4 A;  1J1N A;  4QSC A;  4XF5 A;  3V89 B;  5H8H A;  3PPP A;  2ABH A;  2UYF A;  2V93 A;  1FBP A;  2HAU A;  5I3S A;  1Z7M E;  3O6H A;  1P1U A;  2ESN A;  5CMB A;  4ELP A;  1Y1M A;  2A5T A;  2F34 A;  1Y1Z A;  2FNC A;  3S9L C;  2OWT A;  3GXA A;  1DPP A;  2QPQ A;  2Y5K A;  2CEY A;  3QUJ A;  1VFD A;  3T22 A;  3BKI B;  2DXY A;  4M4G A;  3SZP A;  2YLN A;  3FGS A;  3MVX A;  4JXI A;  3PMV A;  2XXK A;  5DYH A;  4GWU A;  3CSB A;  3T9U A;  4PGN A;  3TOD A;  5IZZ A;  4ESX A;  4MNI A;  2ALU A;  1LFI A;  4Q0C A;  2ZZW A;  4LZ8 A;  3CG1 A;  4QSD A;  2RC7 A;  5JK4 A;  1HSE A;  1LB8 A;  4N15 A;  2OWZ A;  3FZV A;  4PBQ A;  2UVH A;  2X7Q A;  4EF1 A;  4QFN A;  4Q5T A;  4PTK A;  2R8T A;  4LZ7 A;  1VDW A;  2B4L A;  4NX1 A;  4H0W A;  3N6U A;  3QUF A;  2Y7W A;  4KYE A;  2BJJ X;  1NUZ A;  3N26 A;  5ET6 A;  2VP1 A;  3MZB A;  4X1B A;  3KOS A;  3W15 C;  2OJT A;  2NOO A;  3U92 A;  4F31 B;  2O7U A;  2XXI A;  5I56 A;  1NV5 A;  3U65 A;  1OLA A;  2F78 A;  2V3T A;  4LN5 A;  3FVG A;  2QS3 A;  4ZEK A;  4I8C A;  4N8G A;  2KR0 A;  4KCD A;  4X8R A;  5I58 B;  1N84 A;  4E0X A;  2DXR A;  1HSJ A;  2XXY A;  3RT6 B;  3EKI A;  2B65 A;  5IZ3 A;  4JSO A;  3DP4 A;  4DXU A;  1UIV A;  3KEI A;  5A5X B;  3JYR A;  4MIJ A;  3C32 A;  5JEI A;  1Y9U A;  3FJG A;  5ET7 A;  4F1V A;  1B1X A;  1QW0 A;  2E0S A;  1FBC A;  4RA1 A;  1TWY A;  5H8N A;  1YZ0 A;  1FQD A;  1LBW A;  3TDJ A;  3IFA A;  2HQ0 A;  1JEV A;  3O2A A;  4FED A;  4GLI A;  3FXB A;  2GFE A;  3SES A;  2CZI A;  2VT5 A;  1FCK A;  1B7U A;  1H43 A;  1XHY A;  2M8C A;  4OEV A;  1NNK A;  4PFB A;  2CEX A;  3SKP A;  1SW4 A;  1M5E A;  5AA2 A;  1B2H A;  2QMX A;  4G4P A;  1B4Z A;  4NF8 B;  1N04 A;  3TFL A;  2ZYK A;  1ZKB A;  3KBZ A;  2HEU A;  4LQ2 A;  4BDL A;  1B9J A;  1MPB A;  4ELO A;  2GHA A;  4N6P A;  1LBY A;  1GTK A;  3K1M A;  3SEU A;  2O69 A;  4X04 A;  3LC8 A;  4N6K A;  4ZEF A;  1SYH A;  2WKY A;  2QVR A;  4RY1 A;  1EZ9 A;  2WEF A;  3I6V A;  2XWK A;  4F3S A;  4GXA A;  4I1D A;  1RKM A;  4YIC A;  2VHA A;  3UOR A;  2O84 X;  2DWH A;  1ATG A;  1RYO A;  4MCO A;  3O6I A;  4XFE A;  4NF4 A;  5ESY A;  1DOT A;  4Z0I A;  1VSO A;  1NMU A;  3OEK A;  1QKB A;  1NNT A;  2F8D A;  4XIG Q;  1B58 A;  4R6K A;  4BLA A;  4PFR A;  3D1R A;  5HPQ A;  1KA0 A;  2OPD A;  1SI1 A;  2ZYN A;  3TAJ A;  2WX9 A;  2YPN A;  3O6G A;  1IIT A;  4DE8 A;  5EQ8 A;  4GIZ A;  1A99 A;  4AS5 A;  4OXV A;  3FVK A;  1DTG A;  1MY1 A;  3MP1 A;  5LOM A;  3QXM A;  4IO6 A;  4XEQ A;  4TQU Q;  4RPO A;  3Q26 A;  2GHB A;  3K6V A;  4IGR A;  3MST A;  3H6W A;  4FEC A;  4F1Y A;  2REJ A;  3K4U A;  3O66 A;  1K9Y A;  3HHG A;  3IO4 A;  5IM2 A;  3KFM A;  2Q89 A;  1N3W A;  3USD A;  1MY0 A;  5ELV A;  2GQ1 A;  2PYY A;  2ZYM A;  1WDN A;  4P1L A;  3SEW A;  4PBH A;  1ZLQ A;  4DI4 B;  2P3N A;  4H5G A;  5AA2 D;  3ZKK A;  1QUJ A;  2XD3 A;  1AL3 A;  5I59 B;  3GBA A;  5DVF A;  2B4M A;  3HO7 A;  3O97 A;  5ITP A;  4THI A;  3PD9 A;  3T96 B;  4QFP A;  3TTK A;  3VLW A;  1CB6 A;  3C4M A;  3D4C A;  4ZZA A;  1TFD A;  1M5C A;  4R2F A;  3VVF A;  3MP6 A;  3H6V A;  4QFO A;  4MMP A;  3U93 A;  4IO7 A;  3V5A A;  1N0T A;  2P0S A;  1QKA A;  1MY2 A;  4DXC A;  5ISU A;  2Y7R A;  3FIR A;  5AA3 A;  5AE4 A;  4U22 A;  2FVZ A;  3FV2 A;  3T0J A;  4GBV A;  1NFT A;  1CE2 A;  4KHZ E;  3LUZ A;  3OMB A;  3PV0 E;  3CFL A;  4O3B A;  2RF1 A;  4QSE A;  2HXW A;  3B6T A;  3VVD A;  1JEU A;  4IO3 A;  4GL8 A;  4O3C A;  4UAC A;  4ZZE A;  1QUL A;  1UTB B;  2F6P A;  1B3E A;  3EPE A;  3TQL A;  2FIE A;  4NF5 A;  4E0W A;  4JSD A;  1NV6 A;  1UTH B;  3FAS A;  4KQP A;  3IOT A;  3N94 A;  3Q28 A;  4PDD A;  3MW0 A;  4F1U A;  3BFT A;  4MJO A;  1VE4 A;  5TPA A;  2Y7P A;  3PGF A;  3CG3 A;  3ONM A;  4HS7 A;  2X26 A;  1F9B A;  4IO2 A;  4LUB A;  2Q2A A;  4NE4 A;  4XKP A;  3DEL B;  1FJ6 A;  3I3V A;  3IOR A;  2L5V A;  1YYZ A;  1NNF A;  1G0H A;  2ONS A;  5IKB A;  3IOW A;  4R9F A;  2R9J A;  2Q9T A;  4GOT A;  5H8F A;  2CMO A;  4ECF A;  3VLV A;  2F7B A;  1NUW A;  1ELJ A;  5EYH A;  2PVU A;  1URD A;  2DWI A;  1FPI A;  3V8X B;  4RXL A;  4OVR A;  2ZZV A;  3BFU A;  3FVO A;  3DLN A;  4N17 A;  1FPL A;  1NL5 A;  2I3W A;  1JQF A;  4FEB A;  3PUY E;  4NF6 A;  3E79 A;  4PGP A;  3MPK A;  2ZNU A;  4U2R A;  1B7H A;  2XXT A;  1JVX A;  2NUV A;  4NN3 A;  2Y5L A;  1B46 A;  2XA5 A;  2KLF A;  3A09 A;  1FPK A;  2B3B A;  2ZYO A;  3TZA A;  2R71 A;  4QHQ A;  4ZS9 A;  4FIM A;  5I5P A;  3HPI A;  5I57 B;  1EYK A;  1IXH A;  5KCJ B;  4GFR A;  2O1L A;  1Y20 A;  2VPO A;  3BBR A;  3S2V A;  4IB2 A;  5L9S A;  4MEV A;  1AIV A;  1P1N A;  3Q25 A;  4GWS A;  1MXX A;  4F2Q A;  1Q1K A;  3HST A;  3TCF A;  1LAX A;  4U1Z A;  3KSJ A;  4YB5 A;  3ZSF A;  4NHB A;  3MPL A;  4MFI A;  3HCQ A;  1FTK A;  4I3E A;  1WVJ A;  3DP8 A;  4ZED A;  1R9L A;  2XX7 A;  4QXD A;  4YU0 A;  2O68 A;  4DLD A;  1MXZ A;  5DW8 A;  3LR1 A;  4PF8 A;  2D3I A;  4QBA A;  2Q74 A;  4IO5 A;  4U21 A;  4GX3 A;  2XWV A;  1LBX A;  4X1D A;  4ZDM A;  2HZL A;  3FVN A;  1FTJ A;  4HTG A;  3KG2 A;  4R2B A;  4P0I A;  5L9O A;  3BIG A;  1XS5 A;  5LTC A;  1MQH A;  3RN8 A;  3G3G A;  2QSX A;  2WYP A;  3RPL A;  4WKM A;  3LUY A;  4R74 A;  2AIX A;  3UGW A;  2V3U A;  3TTN A;  1CNQ A;  5AA4 A;  3B8B A;  3ZKL A;  4JB7 A;  3HHF A;  1B3F A;  3C36 A;  5A5X A;  1UQW A;  3THI A;  2R6G E;  1BK4 A;  5I2K B;  4RNS A;  3HV1 A;  2O51 A;  4KYS A;  5EYF A;  1A40 A;  3K01 A;  2XX9 A;  2IEE A;  4LQ5 A;  2OLB A;  5FHO A;  1P1O A;  2I6E A;  3MUQ A;  1PBP A;  2DQV A;  1NUY A;  2GH9 A;  1MDP 1;  1SDX A;  4PFW A;  1P99 A;  1Y3N A;  5DT6 A;  3K6U A;  1PB9 A;  1IXC A;  4PP0 A;  5EHM A;  2ZNT A;  3SDF A;  2OPE A;  3QYT A;  2RKM A;  1N7X A;  3A29 A;  3CI8 A;  1RYX A;  4OMB A;  1FQB A;  3C33 A;  1NV0 A;  1SYI A;  1FTA A;  1B40 A;  5KZT A;  1URS A;  2RC8 A;  4G61 A;  2HHM A;  1MG1 A;  1MPC A;  2VOZ A;  1SVX B;  3V83 A;  2H98 A;  1B0L A;  2VGQ A;  1JW4 A;  3K1P A;  3GLB A;  2UXA A;  1FTO A;  3QSL A;  5FBP A;  4DCX A;  3E3K A;  1EH3 A;  2JJK A;  2NWJ A;  1B51 A;  2IA4 A;  2VD2 A;  3RNN A;  2Y7K A;  3C31 A;  3JZJ A;  4TOZ A;  3TCG A;  4I9D A;  3G3J A;  3MYU A;  1LEV A;  4I40 A;  1ZIU A;  4GWX A;  1B3L A;  3FUZ A;  2Y7I A;  4JDF A;  5T3J A;  4DIG A;  2E1S A;  3TYH A;  3WAF A;  4P1E A;  4R75 A;  1POY 1;  3M3K A;  3K02 A;  4O7M A;  3IJO B;  2FBP A;  1KWH A;  4ISU A;  4QFL A;  4ND9 A;  4EDP A;  1IMA A;  4OEN A;  1D9V A;  2I4C A;  2YJP A;  1MM6 A;  1FTM A;  1OLC A;  4R6H A;  4MNC A;  5EQ7 A;  5B7D A;  3OSQ A;  1XOC A;  4OVT A;  1MRP A;  4F19 A;  1DTZ A;  1BP5 A;  4PE5 B;  4EQB A;  1IMF A;  1SBP A;  4NAP A;  2PBW A;  2H9B A;  2DE2 A;  4G8N A;  3EQ1 A;  2DSF A;  2PT1 A;  3KOT A;  2DOJ A;  1N3X A;  4P11 A;  3VLU A;  3FXQ A;  4Q8R A;  1FPG A;  1QVS A;  4PF6 A;  3KN8 A;  1QUK A;  4MH5 A;  4TLM B;  1Y3Q A;  1LBZ A;  3FXR A;  5I59 A;  5TU0 A;  1L5T A;  3EN3 A;  3K6X A;  1S50 A;  3T9X B;  4G8M A;  1DK4 A;  4OWD A;  1PDA A;  1GGG A;  3B6W A;  5H8S A;  3LSW A;  3P7I A;  4RYA A;  2THI A;  3Q29 A;  1IZ1 A;  4EQ9 A;  1D9Q A;  5A5L A;  2MKZ A;  3MBP A;  4MHF A;  3MC2 A;  1ZTY A;  2XD2 A;  1I6B A;  3U8Q A;  5ET5 A;  4FAJ A;  3MAM A;  4FJP A;  1KA1 A;  4F29 A;  1JVY A;  5CMC A;  1PEB A;  3OO8 A;  1FW0 A;  1OQH A;  4NQ8 A;  2QRY A;  1A8F A;  5CMM A;  3LSL A;  4JWO A;  3PUZ E;  4NTL A;  3TKD A;  3CIJ A;  1ZU0 A;  3SER A;  1G0I A;  1FRP A;  1UTB A;  4MAG A;  4PAK A;  4EUO A;  1PBQ A;  3MVY A;  5ET8 A;  3ILU B;  1UTH A;  3LSX A;  3BIH A;  4LA9 A;  1LBC A;  2Y84 A;  4PFI A;  1M5B A;  1B52 A;  4OA4 A;  1LGB C;  4OVJ A;  5EQA A;  4AB6 A;  3LV0 A;  1A54 A;  3FJ7 A;  1N7W A;  4RJZ A;  5ICQ A;  1FBF A;  2F7A A;  2RCB A;  4POX A;  2F5X A;  1TFA A;  2O7I A;  1NV1 A;  4G68 C;  2XXR A;  4PFT A;  4F2O A;  2FYI A;  2FIX A;  3ODB A;  4POW A;  3C34 A;  1QUI A;  1Y4C A;  4U4S A;  4ZE8 A;  1USY E;  2Z8D A;  5H8Q B;  1B3G A;  2OK2 A;  3GBB A;  1MQG A;  3NOH A;  4OEU A;  1XC1 A;  1MXW A;  5BUU A;  4P56 A;  2OBG A;  3RLF E;  2PCR A;  3PD8 A;  5H8N B;  4UAB A;  1R1N A;  3KC1 A;  1B32 A;  3H3G A;  5KDT B;  3U94 A;  4WEP A;  1MM7 A;  5J1D A;  4DXB A;  3HN0 A;  4LON B;  3PU5 A;  1O64 A;  3H03 A;  4N13 A;  4FAT A;  5EHS A;  2HAV A;  3N6T A;  4K3F A;  4DZ1 A;  3R6U A;  5FHM A;  3KZG A;  2I48 A;  4P3L A;  2DVZ A;  3TQW A;  2UVG A;  5K2X A;  2FA7 A;  4HCY A;  1H45 A;  5CBR A;  4TLL B;  5TP9 B;  5JTY B;  1LAH E;  3T66 A;  2W7Y A;  4KR5 A;  3G3F A;  4F3P A;  2ZNS A;  4BDM A;  4YKI A;  2XXH A;  4YB7 A;  1D9Y A;  3VE1 B;  1MPD A;  1MY3 A;  3TUS A;  1LFG A;  2CZL A;  3IFC A;  3MVZ A;  5I57 A;  1SQY A;  1S9T A;  3A3U A;  3VXB A;  5KCJ A;  3GYY A;  1IEJ A;  2DVC A;  1NV4 A;  3O29 A;  4R6Y A;  2AL5 A;  4NF4 B;  1MY4 A;  2XWO A;  1B5H A;  2DWA A;  3KC0 A;  2HPG A;  5DVI A;  5DEX A;  1AWB A;  2HZK A;  1YXI A;  3O9P A;  1SD3 A;  4GL0 A;  3OO9 A;  3CVG A;  1RDX A;  3FBP A;  2X7P A;  2KQZ A;  2P3V A;  2D21 A;  2I4B A;  3KGC A;  4BDQ A;  3H4Z A;  3TPA A;  4R73 A;  3IL1 B;  5F24 A;  1H44 A;  1SW1 A;  1I6A A;  4GXS B;  2H5Y A;  1MQI A;  2LAO A;  3VXC A;  1M5D A;  1B05 A;  4N91 A;  3C35 A;  5EQ9 A;  4C1U A;  1IMD A;  3G3I A; 
#chains in the Genus database with same CATH homology
 4MIJ A;  4DI3 D;  5ET7 A;  4F1V A;  4P47 A;  1CNQ A;  4PDH A;  3B8B A;  1FBC A;  2WBB A;  1FBE A;  1YZ0 A;  1BK4 A;  1LBW A;  3IFA A;  4O94 A;  4JVC A;  3FXB A;  2CZI A;  2VT5 A;  1NV2 A;  2VPN A;  4PCD A;  4PFB A;  2DE3 A;  2CEX A;  4PE3 A;  1DBZ A;  1K9Z A;  4IR8 A;  1LBV A;  1NUY A;  3B50 A;  1RDZ A;  4M1V A;  5EYG A;  3A29 A;  4GX4 A;  1Q9D A;  1NV0 A;  2CZH A;  1DCU A;  3KBZ A;  4OVS A;  1FTA A;  5J16 A;  1NV7 A;  1FPJ A;  1LBY A;  4G61 A;  3RYD A;  2HHM A;  4MNP A;  4X9T A;  2WYK A;  4X04 A;  4N6K A;  2FHY A;  2QVR A;  4F18 A;  2WEF A;  4HE1 A;  2XWK A;  4H45 A;  5IGA A;  4YIC A;  5FBP A;  2CZK A;  2DE4 A;  1FBD A;  1FPD A;  4MCO A;  4XFE A;  2JJK A;  4GX6 A;  5ESY A;  4N81 A;  3MYU A;  1LEV A;  4HE0 A;  4I40 A;  4PFR A;  4GWX A;  4GWY A;  1EYI A;  3D1R A;  1FPF A;  4HXV A;  5T3J A;  1KA0 A;  2HXR A;  4OAN A;  2WX9 A;  4P1E A;  1EYJ A;  5EQ8 A;  2V3Q A;  4AS5 A;  4O7M A;  4N8Y A;  2FBP A;  2BJI A;  4HE2 A;  4AS4 A;  1IMA A;  4XEQ A;  3ISP A;  1FBG A;  3MST A;  4MNC A;  5EQ7 A;  1K9Y A;  5IM2 A;  1JP4 A;  4O7I A;  4OVT A;  4F19 A;  1IMD A;  2GQ1 A;  4P1L A;  1INP A;  1IMF A;  4NAP A;  1RDY A;  4PBH A;  2DE2 A;  2XWI A;  4DI4 B;  2P3N A;  3QMF A;  4OVP A;  3HFU A;  1SPI A;  2B4M A;  4KXP A;  1FPG A;  5I7I A;  4PF6 A;  3T1B A;  4NF0 A;  1LBZ A;  4NG7 A;  4I3Y A;  2OX3 A;  4MMP A;  1IMC A;  4P8B A;  1DK4 A;  4H46 A;  2FVZ A;  1XI6 A;  3T0J A;  4GBV A;  1D9Q A;  4MX6 A;  5A5L A;  2MKZ A;  3LUZ A;  4MHF A;  4JVD A;  2QVV A;  4OVQ A;  5ET5 A;  1FPE A;  1KA1 A;  4N4U A;  4N6D A;  3E78 A;  4NQ8 A;  2FIE A;  1NV6 A;  4PAI A;  1FSA A;  4PDD A;  1G0I A;  4F1U A;  1FRP A;  4FBP A;  3W9W A;  4MAG A;  1NUX A;  4MJO A;  4PAK A;  5CM6 A;  5ET8 A;  3BIH A;  4JVI A;  3W9V A;  4PFI A;  4OA4 A;  1FJ6 A;  1NI9 A;  2DDK A;  5EQA A;  3LV0 A;  1IME A;  2L5V A;  1YYZ A;  2F3D A;  1FBF A;  1G0H A;  4P9K A;  2ZZX A;  4NGU A;  2F5X A;  1NV1 A;  2FIX A;  3RPL B;  4YZZ A;  4HCW A;  2Q9T A;  4PET A;  5IZ1 A;  4PC9 A;  3NOH A;  1IMB A;  1NUW A;  1FPB A;  5EYH A;  4P56 A;  2PCR A;  1FPI A;  2QVU A;  1FBH A;  2PFY A;  4UAB A;  4OVR A;  2F3B A;  3KC1 A;  2ZZV A;  4XF5 A;  2Q8M A;  4N17 A;  1FPL A;  1FBP A;  5LDZ A;  1FJ9 A;  5I3S A;  5J1D A;  3E79 A;  4PGP A;  4NN3 A;  3ROJ A;  2Y5L A;  2XA5 A;  1FPK A;  4P3L A;  2QPQ A;  2Y5K A;  4GWW A;  2CEY A;  2QFL A;  2DVZ A;  4HCY A;  5I5P A;  1EYK A;  3SZP A;  2XXK A;  1NV3 A;  4GWU A;  2VPO A;  3PTY A;  4GBW A;  3CHG A;  4MEV A;  4PGN A;  5IZZ A;  4MNI A;  3IFC A;  4GWS A;  2ZZW A;  3GYY A;  2PFZ A;  1NV4 A;  5JK4 A;  4NHB A;  4N15 A;  4PBQ A;  2OWZ A;  4PAF A;  2XWO A;  4PTK A;  2R8T A;  1VDW A;  2B4L A;  4I3E A;  4NX1 A;  1KZ8 A;  3KC0 A;  4QXD A;  2HPG A;  4O8M A;  1NUZ A;  1AWB A;  2WBD A;  5ET6 A;  1YXI A;  2HZK A;  5DW8 A;  4PF8 A;  1RDX A;  3FBP A;  4QBA A;  1NV5 A;  2Q74 A;  3U65 A;  2KQZ A;  2P3V A;  4GX3 A;  4GWZ A;  1QGX A;  2XWV A;  4LN5 A;  1LBX A;  4N8G A;  2HZL A;  2KR0 A;  5IZ3 B;  5F24 A;  2V4C A;  4X8R A;  3BIG A;  3EKI A;  5LTC A;  5IZ3 A;  4N91 A;  2WYP A;  5EQ9 A;  3RPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...