2JJKA

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate -1- phosphohydrolase) (e.c.3.1.3.11) complexed with a dual binding amp site inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Allosteric Fbpase Inhibitors Gain 10(5) Times in Potency When Simultaneously Binding Two Neighboring AMP Sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2jjkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2jjkA02
3B8BA 1FPFA 1FJ6A 1NUZA 2WEFA 1NUYA 1LEVA 5ET6A 1NV7A 1NV1A 3KC1A 1RDYA 5ET7A 4HE2A 1LBVA 2WBBA 4QXDA 5LDZA 4GBVA 1FBPA 3LV0A 1FPIA 4GWZA 1FPKA 1G0HA 3IFCA 3RPLA 3A29A 1NV3A 1NV5A 1DBZA 5EQ9A 4AS5A 1G0IA 2FIEA 5ET8A 3FBPA 4IR8A 1FBHA 1D9QA 2Q74A 4I3EA 1LBYA 4GBWA 2Y5KA 3RPLB 2P3VA 1LBXA 1FBGA 3QMFA 4GX3A 1FJ9A 1NV6A 2GQ1A 4KXPA 2CZHA 3KC0A 4G61A 1FBCA 2OWZA 4I40A 1IMAA 2BJIA 4H45A 5EQAA 1NV2A 2F3DA 1XI6A 2FIXA 5DW8A 4GWXA 1DCUA 2FBPA 4GWYA 1KA1A 1EYKA 5EYHA 2OX3A 3KBZA 5ET5A 1FRPA 4PTKA 3T0JA 1FPBA 1QGXA 1DK4A 1FPDA 2Q8MA 1FPGA 1EYIA 1LBWA 5IZ3A 1AWBA 4FBPA 1YYZA 5EQ8A 1SPIA 1RDZA 3BIHA 4O7IA 1INPA 1FBEA 1IMDA 2CZKA 1YZ0A 1FPJA 3LUZA 1FSAA 1IMCA 1FPEA 3BIGA 5IZ3B 4HE0A 2HHMA 4I3YA 1FBFA 1NUXA 5EYGA 3RYDA 1FPLA 1YXIA 2QFLA 5I3SA 4GX4A 1FBDA 5T3JA 3ROJA 1BK4A 2DDKA 5EQ7A 1NUWA 1KA0A 1IMBA 1VDWA 2P3NA 4GWSA 1K9YA 1LBZA 2JJKA 2QVUA 4HXVA 4GX6A 3D1RA 4H46A 4AS4A 1NV4A 1KZ8A 2WBDA 2FVZA 2PCRA 1CNQA 1EYJA 2QVRA 1K9ZA 2Y5LA 2FHYA 2QVVA 5F24A 4GWUA 5FBPA 4GWWA 5IZ1A 1FTAA 2F3BA 2CZIA 5ESYA 2R8TA 1NI9A 4MJOA 5J16A 1NV0A 1RDXA 5A5LA 4N81A 1IMEA 2VT5A 4HE1A 3IFAA 1IMFA 1JP4A 1Q9DA
chains in the Genus database with same CATH superfamily
3SDFA 3FVNA 2REGA 4N6DA 3S4UA 5ET6A 1CB6A 4F1UA 2QS2A 4X04A 4F3BA 3IFCA 1ZU0A 3D4GA 4AS5A 2F7CA 3PPQA 5DVJA 3QXMA 2Q74A 1JETA 1FW0A 3QK6A 4EQBA 3P7IA 2Y7WA 2QMWA 1DPPA 1NV6A 2GQ1A 4KXPA 2DVCA 4DXCA 1D9VA 4PFIA 3ILUB 3VLUA 4PGNA 1ANFA 1NV2A 3MZ9A 1XI6A 1B6HA 5I57A 5EYHA 1GGGA 3KBZA 2F6PA 4XFEA 1EYIA 4OVSA 3MSTA 4DXBA 1AH5A 4L17A 4FJPA 4KFQA 1ELJA 1IXGA 2WKYA 3CSGA 3BIGA 4H67A 4H6DA 1H44A 1NUXA 2M8CA 2F78A 4I9DA 3VFJA 3I5OA 1JVXA 1R1NA 3FXQA 4PBQA 3U93A 4X9TA 1H43A 2A5TA 2WBDA 1B5IA 2PCRA 4F3GA 3KJTA 2RKMA 1US5A 4YZZA 3VXCA 4AQ4A 2O84X 3VDFA 2XD3A 1UTHA 4XF5A 3IB1A 2LAOA 4ELRA 3G3GA 4O8MA 1FTMA 1D9YA 2F6GA 2XXHA 2RINA 2XXUA 5TU0A 1N0TA 1LEVA 1MPBA 3ISPA 5CBRA 2PT2A 1IUDA 4JSDA 3PUYE 1SW1A 4OVQA 1NV5A 1Q35A 3AXFA 4X8RA 4TQUQ 2H25A 1XC1A 4U23A 4IO2A 4MAGA 1LBYA 3KOTA 3QUFA 1FBGA 1EZPA 4PGPA 4MNPA 3ZKLA 3H7MA 3IORA 3KC0A 2PT1A 4NF5B 1IMAA 2I0CA 4WXJA 3VVEA 4C0RA 2HEUA 4EXKA 4F19A 3RQTA 1SVXB 4LUBA 1NL5A 4U1OA 4BDOA 1I6QA 1S9TA 4Z7EA 1I6AA 1B1XA 5HPQA 1YZ0A 3RY3A 1MQJA 4P1EA 3G3JA 4PFBA 4F2QA 1CE2A 4ELPA 4GX4A 3ROJA 4ZZAA 3N5LA 4QF9A 2GH9A 1DPEA 4FORA 1DTGA 4IO7A 3KN3A 2OLBA 4MMPA 2DQVA 2GFEA 3SEVA 5B70A 1RKMA 1ZKBA 4PFUA 4JXIA 1H3DA 1MDP1 3H3GA 3IOWA 4OEUA 1NV4A 1IIWA 3VVDA 3KN7A 4GWUA 1LSTA 4E0WA 1JQFA 4O94A 4OZ9A 1WVJA 4ONYA 2XXPA 3GLBA 2V84A 3SEUA 1JEVA 4DI3D 3MPLA 5FHOA 5CI5A 2HXWA 3PUVE 5ITOA 1MG1A 1VE4A 3MJNA 5DYHA 4HE2A 1SI0A 3ZKKA 3Q27A 2IEEA 3CFZA 4GWZA 4EXLA 1FPKA 4Q30B 2DE4A 3MW0A 2H5YA 3TEPA 4FAJA 4KCCA 1O63A 1FQEA 2XWVA 2ESNA 4I3EA 1GVCA 5AE4A 1LBXA 4QRZA 4KQPA 2AYSA 5L9OA 3CG3A 3U92A 4EDPA 1B05A 3PD9A 3CFXA 3TTKA 3QIMA 1MXZA 3KFMA 1KA1A 2OX3A 4YB5A 4RA1A 3BFTA 1MQDA 3EN3A 2GRVA 3N6TA 2V25A 1FSAA 5LOMA 4DCXA 2CEXA 4PE3A 3IOUA 3UIFA 3PPPA 1MH3A 5EQ7A 2XXXA 4N17A 4X48A 4Z0IA 1NKXA 2G93A 5ISUA 2O6AA 2E1SA 3SESA 2QVRA 2QSXA 5F24A 2UXAA 3BKIB 4H8JA 1DMBA 2F3BA 4RPNA 1XT8A 4RK9A 2UVHA 4N6PA 4NF8B 4MJOA 4OHNA 3HO7A 1L5TA 1LBBA 4IB2A 2OWTA 1OLAA 3OMBA 3FIRA 3CFLA 5L9SA 1R9QA 3R26A 2WEFA 5JEIA 1LB8A 5KCJA 1B5JA 4GWOA 4OWDA 1URGA 5ET8A 1FQDA 4ZZEA 5K2YA 1MDQA 4OVRA 1PBQA 3KSJA 4I62A 3KN8A 3CSBA 2DE2A 1VSOA 3TMGA 1YCJA 4N8YA 1B5HA 1SI1A 1ZJLA 2HFBA 5AA4A 3M3KA 3IJOB 1Y3QA 4F1VA 3RLFE 4XIGQ 1N04A 1MY3A 4FECA 4YKPA 3FJMA 1QGXA 1FPDA 1SW4A 1B3EA 4U1ZA 1B7UA 5EQ8A 3MP6A 5CMBA 4AB5A 1QKAA 1FBEA 4KR5A 1MXYA 1JW5A 5H8QB 4JVDA 3VVFA 4WEDA 3O28A 4FIMA 2HHMA 1MXXA 3RYDA 3G3HA 2QFLA 5T3JA 3U1OA 3PTYA 4N8GA 2ZYNA 3O6IA 3H4ZA 5JK4A 1BLFA 1LGBC 2Q88A 1B40A 2I3WA 4EUOA 4H0WA 2UVGA 3ZSFA 1IQ7A 5FTIA 3B50A 4O7MA 3T9XB 4ELQA 1IITA 5I2NA 1N7WA 3MPKA 4KCDA 1Y9UA 4WEPA 3RTWB 1DSNA 1FTKA 1LBCA 1EZOA 3USDA 3KEIA 2VPNA 1J1NA 3G3FA 5ET7A 4FE8A 3TQLA 3LV0A 4YU0A 4NHBA 2KR0A 2VD3A 1II5A 2MKZA 4KD5A 3T66A 1PEBA 4LQ2A 1O64A 3EKIA 2Y5KA 3N94A 3IO6A 1MY1A 3PUZE 4NF0A 1XVYA 3UK4A 2QS1A 4C1UA 3TTRA 1RYXA 1VR5A 2Y7RA 4PP0A 3A3CA 3H03A 1FRPA 1DK4A 2KLFA 2F97A 4NTLA 2Q89A 4OQOA 3Q26A 5I57B 2I4BA 3BIHA 3EHTA 2XA5A 1IMCA 4I3YA 2DWIA 1I69A 4MLVA 3O66A 1OVBA 3KBRA 3SKPA 4NWCA 5TPAB 1QUIA 1AMFA 4DCYA 4MNCA 1IXIA 1B7HA 3U65A 2GHAA 2ZZVA 2QVVA 4MH5A 1MXUA 3ODBA 2RC9A 3UA8A 1R6ZA 1GTKA 4MNIA 4RJZA 4MFIA 4PDDA 2GHBA 1JEUA 1M5CA 4LQ5A 1WDNA 4G77A 2F35A 1Q9DA 2I6EA 1UTHB 1FJ6A 3H6VA 3THIA 2IA4A 4QFKA 4IO4A 2QPQA 4XKNA 5LDZA 1FBPA 3FVKA 1LAHE 3FV2A 4GIZA 4IO5A 3EPEA 2FIEA 4OANA 2RF1A 2V3QA 1NMUA 1B4HA 3H06B 3FUZA 1M5FA 1FBCA 2OWZA 4OVTA 3HFUA 4OEVA 4GFRA 2F7BA 5CMCA 4NMYA 4R73A 2QJEA 3TZAA 5ET5A 1P1OA 1OLCA 4LA9A 3T0JA 2Q8MA 4YMBA 4N91A 1YYZA 4PFTA 3C33A 2HPGA 2QL3A 1A55A 5H8HB 5IKBA 3IB0A 4PC9A 5CMMA 3MVZA 2HCAA 4AB6A 3CI8A 3TTLA 1VDWA 1D4NA 3VLVA 3S2VA 1K9YA 5DVFA 1Z7NE 2AIXA 3DELB 4P0IA 2Y5LA 3K6XA 3W15C 3NOHA 2I58A 5TPAA 4I8CA 4Q5TA 1F9BA 2HZLA 3MZ1A 4R6YA 4Q8RA 2ONSA 3SEYA 5AA2A 4GOTA 3B7DA 4PDHA 2I0BA 4BDRA 1QJMA 3MWBA 3DP8A 4Q0CA 3E9XA 1B32A 3KC1A 3WAEA 4DXUA 3PUWE 4K3FA 2DVZA 2X26A 4H65A 5H8FB 3TYHA 5K2XA 2Z8FA 4GD5A 3FBPA 4IR8A 4ZEDA 5I7IA 1BIYA 4OESA 2FA7A 1LFIA 4GBWA 2P0SA 4N4UA 1QULA 4LZ8A 4OERA 5F1QA 2BJIA 3F11A 4N6KA 4MCOA 4PAIA 5I5PA 4N07A 3I6VA 3EQ1A 1M5EA 3T93B 3FXRA 1EYKA 4G2ZA 5ICQA 5IZ3A 1AWBA 1SQYA 1B52A 2XXKA 1PB7A 1FCKA 2PYYA 2Q9TA 3CRBA 1AL3A 3RN8A 4P11A 2WX9A 1LLSA 4DI4B 4OYVA 4NWDA 5I58A 1MY0A 2ONRA 1GV8A 4F2OA 3ONMA 1Z7ME 5H8HA 4R74A 3RGYA 4H46A 3UGWA 3U94A 2DS9A 1USYH 1K9ZA 2OBGA 3C35A 1MPCA 2QS3A 4KPTA 5JTYA 4PAKA 4GWWA 3G3IA 4BDNA 4IO6A 1P1QA 3RT8A 1NV0A 3T9UA 1B3FA 4HE1A 2OCUA 1DBZA 2O7UA 3H6TA 1OQHA 5EYFA 3PMXA 5AA2D 1AIVA 4MX6A 3TPAA 1URDA 4PF8A 1A8EA 3E3KA 4DIGA 2BJJX 3TQWA 3K02A 4LZ5A 2XHDA 5CBSA 4LATA 1LFGA 1MS7A 4R6HA 5KCJB 3S9MC 2NUVA 2XWKA 4XKPA 4ELOA 5AA3A 3PU5A 4P8BA 5H8FA 3C36A 3K1MA 1FJ9A 1UQWA 4KI0E 3K0VA 2O69A 3K00A 4LZ7A 1B0HA 2XXWA 3BBRA 1NFTA 5CRYA 2UVJA 4H8IA 4F3SA 2DP8A 5AA4B 5I2KB 3OO9A 3MAMA 3K1PA 1INPA 2CZKA 4F39A 1D3KA 1P1UA 3JZJA 4OA4A 4YMAA 1B58A 4IGTA 2KQZA 1VFDA 5EYGA 1MQGA 1NH8A 4KYSA 1ZIUA 3DP6A 3FVGA 2X7QA 1PDAA 3TUSA 2VPOA 4F18A 3MUQA 5HBCA 3R7XA 4ESXA 2XXIA 3CHGA 1B3HA 4OMBA 5DEXA 2B4MA 5IZ1A 2B4LA 1SW2A 4IY6A 3GBAA 4PQJA 5EHMA 3M3FA 5A5LA 2E0SA 3TELA 5I2NB 3OO7A 3UP9A 4M4GA 2O7IA 3KOSA 1YAEA 2XXYA 3DP4A 3MP8A 1P99A 4R2BA 3OXNA 3OSQA 4OFJA 3EF7A 1G0IA 1BKAA 1ZMGA 3L6GA 4MLQA 4UABA 1MY2A 1Y1MA 2I48A 2DXYA 2ZMBA 2UVIA 4X1DA 3TFLA 4OFOA 4OVJA 1QVSA 3GZGA 3WAFA 1MQIA 4HTGA 5DW8A 4GWXA 5FHNA 1FTJA 4MIJA 5CM6A 4GWYA 4G8MA 3HV1A 1MXVA 3C32A 3FXUA 2ALUA 3LSWA 3K1NA 3KZGA 2F8DA 1SPIA 4O7IA 4F31B 1Y4CA 2V3TA 4O3AA 1MQHA 2ZYKA 3OELA 4PBHA 1YXIA 3MVWA 4I1DA 4NN3A 5I2KA 3VXBA 4C1TA 3A09A 4JB7A 2AL4A 2DXRA 4POXA 3HCQA 3OEKA 4HXVA 1QW0A 1KWHA 2XD2A 2YPNA 4LONB 1NNKA 1CNQA 1B46A 2FHYA 2ZNUA 3Q28A 4RPOA 5B7DA 1FTOA 1R9LA 5ESYA 4PFRA 4POWA 2G29A 1XHYA 4N81A 5A5XA 4FATA 1SW5A 1I6BA 4GRKA 3IL1B 3B8BA 4YICA 2ZZWA 1PB9A 5I59A 3PD8A 2L5VA 4QFOA 2O1LA 4PFYA 4N13A 1RDYA 2PBWA 3L6HA 2DOJA 5IM2A 2D5WA 1Y20A 3W9WA 1MXWA 4UA8A 5L9MA 4RK2A 4NAPA 3U8QA 5F7VA 1QKBA 1LAXA 2ABHA 3FXBA 4P9KA 4YB7A 2A5SA 5EQAA 1SYIA 4ZEKA 1RYOA 4F29A 4HCWA 3H6UA 2FBPA 4NEDA 4TLMB 1JVYA 2I4CA 4P3LA 1P1NA 4G8NA 4R75A 4ZDMA 5H8NA 4H5GA 1BTJA 4G4PA 4G68B 4QFPA 5BWJA 5DTBA 3IOTA 1IEJA 1TFDA 2HAUA 4R9GA 4X1BA 1FPLA 4RY1A 5I3SA 2OZZA 1NUWA 3M8UA 3S9NC 4P1LA 2XXRA 2P3NA 4QSCA 4E0XA 4GX6A 4GF8A 1IXCA 3CR9A 1WODA 4NE4A 3CIJA 2VOZA 4YKJA 1MM7A 2NVUB 2F7AA 4PFWA 3JYRA 2R9JA 1LCTA 5J16A 2NWJA 4EQ7A 3IFAA 3MVXA 4NF4B 4AS4A 3PMVA 4IY5A 2OK2A 2XXVA 3H6WA 5CC2A 2D3IA 4DLDA 3O2AA 4O3BA 2I3VA 3C31A 2R6GE 5AA2B 2UYEA 4RXLA 3K2DA 1FPIA 1LAFE 4OVPA 3RPLA 2XX7A 4YKKA 4ZS9A 4DDDA 3T96B 3B6QA 3ECRA 2HAVA 2OPDA 2ZXTA 3CG1A 2F34A 3HHFA 2D21A 5BUUA 2Y84A 1IZ1A 3IAZA 2F5XA 4OFLA 2B3BA 4NG7A 3O9PA 4PTKA 1LB9A 2PVUA 1FQBA 4MF3A 3B6TA 4YB6A 1RDZA 2DSFA 3RPWA 2P2AA 3KSXA 5IZ3B 2XWIA 4WKMA 4G68A 2DWJA 3VE1B 3D1RA 3Q29A 3EHSA 1LAGE 5I58B 4JVCA 2FYIA 3SZPA 4EQ9A 4GL8A 3V83A 2Z8EA 5FBPA 4OETA 1NI9A 1VFEA 1FQFA 2R71A 2XXTA 3TTNA 5JTYB 3RT6B 1A8FA 2QRYA 3FD3A 2RCBA 1OVTA 3TCFA 1NV7A 3KGCA 1O7TA 2HZKA 2ZYMA 5I56B 4NF4A 1G0HA 4U4SA 3T22A 5EQ9A 3O6HA 3TDJA 3RNNA 1MY4A 1N7XA 4ZE8A 3MC2A 5FHMA 4OTEA 2RC8A 5J1DA 3QYTA 2Y7PA 1HSEA 1XOCA 2OJTA 4EF1A 3S9LC 1MH4A 2ZNSA 4QFLA 2H98A 4G61A 4JWXA 3KJ7A 4TOZA 3MP1A 3RUMA 3C34A 4BDMA 4MHFA 3PV0E 1JNFA 4GXSB 1N3XA 3OENA 2B3FA 4KHZE 1UTBA 2Y7KA 1BP5A 1JW1A 1FQAA 3T1BA 3FASA 4RNSA 2RC7A 5ITPA 1N84A 1FPJA 1H45A 1B2HA 1HSLA 1FPEA 1B3LA 1B3GA 2VHAA 2V3UA 4OENA 1S50A 5HM4B 2JJKA 1PB8A 2ZYOA 3G7WA 2FVZA 2ANJA 2O68A 3LR1A 2FNCA 1A99A 3UN6A 3C4MA 1FTAA 3HN0A 4ND9A 2XXQA 1MPDA 1EZ9A 5LTCA 3LSXA 4UACA 1RDXA 2QS4A 2Q8JA 5DEXB 4P0GA 2V4CA 1YTVA 3OO6A 2WYPA 1IMFA 2CZHA 1OIBA 1GR2A 4N15A 4GQOA 2ONKE 4NF6B 4BDQA 2Y7IA 1POTA 4JVIA 2WBBA 4RYAA 4QXDA 5TP9B 4NQ8A 1NV3A 2VD2A 2Q2AA 1MRPA 1TWYA 1FBHA 3FJGA 3E78A 1QUKA 3MYUA 5KDTB 1IXHA 4ZEFA 5DVIA 5I56A 3PPOA 1ZTYA 3PPRA 2B65A 4F22A 3FJ7A 4I40A 3A3UA 2XX9A 1DCUA 4GL0A 3BFUA 4MEVA 4HCYA 2VGQA 4EF2A 1LBWA 4FBPA 4GLIA 3S9EA 1SDXA 4IO3A 3GYYA 1SYHA 2DWHA 2PFZA 3HHGA 4HE0A 3ZS6A 3TCGA 2RCAA 3V89B 1LFHA 3LSLA 4IGRA 1US4A 1KA0A 3G3KA 3SEWA 5ICTA 4KYEA 2P1SA 3O29A 4GWSA 3MBPA 5DT6A 1LBZA 4P47A 3Q25A 2QVUA 3I3VA 4JWOA 1B51A 4HW8A 2PFYA 4ZEBA 5KZTA 4XXUA 3OD7A 2DWAA 4DZ1A 4DE8A 4THIA 4FEDA 3B6WA 2VT5A 3IX1A 3OO8A 1SBPA 1NUYA 4F3PA 3M3LA 4JDFA 5A5XB 1FQCA 3LBSA 1A40A 1N3WA 3A29A 1N76A 5I59B 4PE5B 4PETA 3ILTB 4NF6A 1D9QA 3VV5A 4ECFA 4NF5A 2NXOA 1P1WA 3TKDA 1PC3A 5TP9A 4XEQA 2OWSA 4ZE9A 3IOVA 3FVOA 2QMXA 4GVOA 3U72A 3TODA 3TAJA 5KDTA 1NH7A 2CMOA 3T9VA 3R6UA 3N26A 1B4ZA 4PCDA 1Y1ZA 3LUZA 4MBPA 5H8NB 3JV9A 3DLNA 1Y3NA 1ZBMA 3GBBA 1BK4A 4H5FA 2O1MA 1IMBA 1TFAA 4G68C 1OQGA 5CMKA 4JSOA 2Z23A 4F1YA 4NGUA 4U2RA 3T9HB 4LP2B 1EYJA 2F36A 1JW4A 1DOTA 4R72A 2CZIA 2R8TA 3HPIA 1NNFA 5IZZA 1H76A 3SETA 4H1XA 1POY1 4O3CA 3TCHA 1A7LA 3N6UA 3K6UA 1TXFA 2DYXA 1JP4A 1ZLQA 2Z8DA 3FV1A 1FPFA 1OMPA 4JWYA 3FATA 5IGAA 1LBVA 1USYE 1QUJA 2CEYA 4XKRA 2CZLA 2DE3A 2VP1A 3IJXB 4U21A 4U4XA 2THIA 2ZNTA 3SERA 4LN5A 5AA1A 3RPLB 2OPEA 1AOVA 3QMFA 2XWOA 1XVXA 1DTZA 3OSRA 1XS5A 2ZZXA 3D4CA 4U22A 4P56A 2I49A 2H9BA 1B7ZA 2WYKA 4R2FA 1Y4TA 1ATGA 1EU8A 1FPGA 4ESWA 2AL5A 4QHQA 4XKQA 5ELVA 3E79A 4JBZA 3SEXA 1SD3A 3K4UA 3K6WA 3IO4A 4PAFA 4BLAA 3LSFB 2PMSA 3MZBA 1FBFA 1HSJA 4YKIA 1Y3PA 3MVYA 3HSTA 1B9JA 3PMWA 1M5DA 3LUYA 1KZ8A 4QFNA 4QSDA 2H4IA 4NF8A 2Q2CA 1LCFA 1NNTA 3O97A 4XTCQ 3LC8A 2NOOA 2REJA 1IMEA 1B0LA 3KG2A 3V5AA 1A54A 3GXAA 3PUXE 1NUZA 3QUJA 1NV1A 4R6KA 3QSLA 4YAHX 4GBVA 2UYFA 4KYDA 1TT1A 3K6VA 4ZEIA 2H99A 3E4RA 1UIUA 1FTLA 2HXRA 1NNPA 2O51A 3O6GA 3C9HA 4OXVA 2P3VA 1EH3A 4ZECA 4GX3A 2YJPA 5L8DA 3OEMA 3PPNA 4H45A 2F3DA 1PBPA 2FIXA 5H8SA 3TTMA 3FGSA 2V93A 1M5BA 3IB2A 5H8QA 5M2VA 1FPBA 3UORA 4FEBA 4QBAA 3IR1A 4PF6A 3FZVA 2XX8A 1IMDA 3VLWA 1UTBB 4BDLA 1B1HA 1Q1KA 2A5TB 3W9VA 3RTFB 1T0KA 3OOAA 2X7PA 1FBDA 2DDKA 4TLLB 3MQ9A 2PX1A 3EHUA 2W7YA 3K01A 4R9FA 5FTHA 5IAIA 1MM6A 3PGFA 1URSA 2Z22A 1S7YA 4HS7A 4ISUA 4GXAA 4M1VA 4LVQA 5EHSA 1UIVA 4G8HA 2HQ0A 3IK6B 3E13X 3QAXA 5I84A 3DM0A 2YLNA 3CVGA 1YPNA 4QSEA 3V8XB 4NX1A
chains in the Genus database with same CATH topology
4N6DA 2VPNA 4N15A 5ET6A 4F1UA 5ET7A 4JVIA 2WBBA 4QXDA 3LV0A 4NHBA 4X04A 3IFCA 4NQ8A 1NV3A 2KR0A 4AS5A 1G0IA 2MKZA 1FBHA 4UABA 2Q74A 3E78A 3EKIA 3MYUA 2Y5KA 1NV6A 2GQ1A 4KXPA 4I40A 4NF0A 4PFIA 4PGNA 1NV2A 1XI6A 5DW8A 4GWXA 1DCUA 4MIJA 5CM6A 4MEVA 4GWYA 4HCYA 5EYHA 3KBZA 1FRPA 4XFEA 1DK4A 1EYIA 1LBWA 4OVSA 4FBPA 3MSTA 1SPIA 4O7IA 3BIHA 3GYYA 2XA5A 1IMCA 2PFZA 3BIGA 4PBHA 4HE0A 4I3YA 1NUXA 1YXIA 4NN3A 1KA0A 4MNCA 4GWSA 1LBZA 4P47A 4PBQA 4X9TA 2QVUA 4HXVA 2WBDA 2PCRA 2PFYA 3U65A 1CNQA 2ZZVA 2FHYA 2QVVA 4YZZA 4MNIA 5ESYA 4PFRA 4XF5A 4PDDA 4O8MA 4N81A 2VT5A 1Q9DA 3B8BA 4YICA 2ZZWA 1FJ6A 2L5VA 1NUYA 1LEVA 3ISPA 1RDYA 2QPQA 5LDZA 1FBPA 3A29A 4OVQA 1NV5A 5IM2A 4X8RA 4PETA 2FIEA 3W9WA 4OANA 2V3QA 1D9QA 4MAGA 4NAPA 1LBYA 4XEQA 1FBGA 4PGPA 4MNPA 3KC0A 4P9KA 3FXBA 1FBCA 2OWZA 1IMAA 4OVTA 5EQAA 3HFUA 4HCWA 4F19A 2FBPA 4P3LA 5ET5A 3T0JA 2Q8MA 4N91A 1YYZA 4PCDA 1YZ0A 2HPGA 3LUZA 4P1EA 4PFBA 4PC9A 1FPLA 5I3SA 4GX4A 3ROJA 1BK4A 1NUWA 1IMBA 4P1LA 1VDWA 2P3NA 4MMPA 1K9YA 4GX6A 4NGUA 1NV4A 1EYJA 2Y5LA 3NOHA 4GWUA 2HZLA 2CZIA 2R8TA 4O94A 5IZZA 5J16A 3IFAA 4AS4A 1JP4A 4PDHA 4DI3D 1FPFA 3KC1A 5IGAA 4HE2A 1LBVA 2DVZA 1FPIA 4GWZA 2CEYA 4OVPA 1FPKA 3RPLA 2DE4A 2DE3A 3FBPA 4IR8A 5I7IA 4LN5A 2XWVA 4I3EA 4GBWA 3RPLB 1LBXA 3QMFA 2XWOA 4N4UA 1IMFA 2BJIA 2ZZXA 4N6KA 4P56A 4MCOA 4PAIA 5I5PA 2WYKA 1KA1A 1EYKA 2OX3A 2F5XA 4NG7A 4PTKA 1FPGA 5IZ3A 1AWBA 1RDZA 2XXKA 3E79A 2Q9TA 1FSAA 4PAFA 5IZ3B 2CEXA 1FBFA 4PE3A 2XWIA 2WX9A 4DI4B 5EQ7A 4N17A 3D1RA 4H46A 1KZ8A 2QVRA 1K9ZA 4JVCA 3SZPA 5F24A 5FBPA 4PAKA 4GWWA 2F3BA 1NI9A 4MJOA 1NV0A 1IMEA 4HE1A 1DBZA 1NUZA 2WEFA 4MX6A 1NV7A 1NV1A 2HZKA 4PF8A 4GBVA 1G0HA 5EQ9A 5ET8A 2HXRA 4OVRA 2XWKA 2P3VA 5J1DA 2DE2A 4P8BA 4GX3A 1FJ9A 4G61A 4N8YA 4H45A 2F3DA 2FIXA 4F1VA 4MHFA 1FPBA 1QGXA 1FPDA 5EQ8A 3T1BA 4QBAA 4PF6A 1INPA 1FBEA 1IMDA 2CZKA 1FPJA 4JVDA 1FPEA 4OA4A 2HHMA 2KQZA 5EYGA 3RYDA 3W9VA 2QFLA 1FBDA 5T3JA 2DDKA 3PTYA 4N8GA 2VPOA 4F18A 5JK4A 2JJKA 2FVZA 3B50A 3CHGA 4O7MA 2B4MA 4M1VA 5IZ1A 2B4LA 1FTAA 5LTCA 1RDXA 5A5LA 2V4CA 2WYPA 2CZHA 4NX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8B A;  1FPF A;  1FJ6 A;  1NUZ A;  2WEF A;  1NUY A;  1LEV A;  5ET6 A;  1NV7 A;  1NV1 A;  3KC1 A;  1RDY A;  5ET7 A;  4HE2 A;  1LBV A;  2WBB A;  4QXD A;  5LDZ A;  4GBV A;  1FBP A;  3LV0 A;  1FPI A;  4GWZ A;  1FPK A;  1G0H A;  3IFC A;  3RPL A;  3A29 A;  1NV3 A;  1NV5 A;  1DBZ A;  5EQ9 A;  4AS5 A;  1G0I A;  2FIE A;  5ET8 A;  3FBP A;  4IR8 A;  1FBH A;  1D9Q A;  2Q74 A;  4I3E A;  1LBY A;  4GBW A;  2Y5K A;  3RPL B;  2P3V A;  1LBX A;  1FBG A;  3QMF A;  4GX3 A;  1FJ9 A;  1NV6 A;  2GQ1 A;  4KXP A;  2CZH A;  3KC0 A;  4G61 A;  1FBC A;  2OWZ A;  4I40 A;  1IMA A;  2BJI A;  4H45 A;  5EQA A;  1NV2 A;  2F3D A;  1XI6 A;  2FIX A;  5DW8 A;  4GWX A;  1DCU A;  2FBP A;  4GWY A;  1KA1 A;  1EYK A;  5EYH A;  2OX3 A;  3KBZ A;  5ET5 A;  1FRP A;  4PTK A;  3T0J A;  1FPB A;  1QGX A;  1DK4 A;  1FPD A;  2Q8M A;  1FPG A;  1EYI A;  1LBW A;  5IZ3 A;  1AWB A;  4FBP A;  1YYZ A;  5EQ8 A;  1SPI A;  1RDZ A;  3BIH A;  4O7I A;  1INP A;  1FBE A;  1IMD A;  2CZK A;  1YZ0 A;  1FPJ A;  3LUZ A;  1FSA A;  1IMC A;  1FPE A;  3BIG A;  5IZ3 B;  4HE0 A;  2HHM A;  4I3Y A;  1FBF A;  1NUX A;  5EYG A;  3RYD A;  1FPL A;  1YXI A;  2QFL A;  5I3S A;  4GX4 A;  1FBD A;  5T3J A;  3ROJ A;  1BK4 A;  2DDK A;  5EQ7 A;  1NUW A;  1KA0 A;  1IMB A;  1VDW A;  2P3N A;  4GWS A;  1K9Y A;  1LBZ A;  2JJK A;  2QVU A;  4HXV A;  4GX6 A;  3D1R A;  4H46 A;  4AS4 A;  1NV4 A;  1KZ8 A;  2WBD A;  2FVZ A;  2PCR A;  1CNQ A;  1EYJ A;  2QVR A;  1K9Z A;  2Y5L A;  2FHY A;  2QVV A;  5F24 A;  4GWU A;  5FBP A;  4GWW A;  5IZ1 A;  1FTA A;  2F3B A;  2CZI A;  5ESY A;  2R8T A;  1NI9 A;  4MJO A;  5J16 A;  1NV0 A;  1RDX A;  5A5L A;  4N81 A;  1IME A;  2VT5 A;  4HE1 A;  3IFA A;  1IMF A;  1JP4 A;  1Q9D A; 
#chains in the Genus database with same CATH topology
 3SDF A;  3FVN A;  2REG A;  4N6D A;  3S4U A;  5ET6 A;  1CB6 A;  4F1U A;  2QS2 A;  4X04 A;  4F3B A;  3IFC A;  1ZU0 A;  3D4G A;  4AS5 A;  2F7C A;  3PPQ A;  5DVJ A;  3QXM A;  2Q74 A;  1JET A;  1FW0 A;  3QK6 A;  4EQB A;  3P7I A;  2Y7W A;  2QMW A;  1DPP A;  1NV6 A;  2GQ1 A;  4KXP A;  2DVC A;  4DXC A;  1D9V A;  4PFI A;  3ILU B;  3VLU A;  4PGN A;  1ANF A;  1NV2 A;  3MZ9 A;  1XI6 A;  1B6H A;  5I57 A;  5EYH A;  1GGG A;  3KBZ A;  2F6P A;  4XFE A;  1EYI A;  4OVS A;  3MST A;  4DXB A;  1AH5 A;  4L17 A;  4FJP A;  4KFQ A;  1ELJ A;  1IXG A;  2WKY A;  3CSG A;  3BIG A;  4H67 A;  4H6D A;  1H44 A;  1NUX A;  2M8C A;  2F78 A;  4I9D A;  3VFJ A;  3I5O A;  1JVX A;  1R1N A;  3FXQ A;  4PBQ A;  3U93 A;  4X9T A;  1H43 A;  2A5T A;  2WBD A;  1B5I A;  2PCR A;  4F3G A;  3KJT A;  2RKM A;  1US5 A;  4YZZ A;  3VXC A;  4AQ4 A;  2O84 X;  3VDF A;  2XD3 A;  1UTH A;  4XF5 A;  3IB1 A;  2LAO A;  4ELR A;  3G3G A;  4O8M A;  1FTM A;  1D9Y A;  2F6G A;  2XXH A;  2RIN A;  2XXU A;  5TU0 A;  1N0T A;  1LEV A;  1MPB A;  3ISP A;  5CBR A;  2PT2 A;  1IUD A;  4JSD A;  3PUY E;  1SW1 A;  4OVQ A;  1NV5 A;  1Q35 A;  3AXF A;  4X8R A;  4TQU Q;  2H25 A;  1XC1 A;  4U23 A;  4IO2 A;  4MAG A;  1LBY A;  3KOT A;  3QUF A;  1FBG A;  1EZP A;  4PGP A;  4MNP A;  3ZKL A;  3H7M A;  3IOR A;  3KC0 A;  2PT1 A;  4NF5 B;  1IMA A;  2I0C A;  4WXJ A;  3VVE A;  4C0R A;  2HEU A;  4EXK A;  4F19 A;  3RQT A;  1SVX B;  4LUB A;  1NL5 A;  4U1O A;  4BDO A;  1I6Q A;  1S9T A;  4Z7E A;  1I6A A;  1B1X A;  5HPQ A;  1YZ0 A;  3RY3 A;  1MQJ A;  4P1E A;  3G3J A;  4PFB A;  4F2Q A;  1CE2 A;  4ELP A;  4GX4 A;  3ROJ A;  4ZZA A;  3N5L A;  4QF9 A;  2GH9 A;  1DPE A;  4FOR A;  1DTG A;  4IO7 A;  3KN3 A;  2OLB A;  4MMP A;  2DQV A;  2GFE A;  3SEV A;  5B70 A;  1RKM A;  1ZKB A;  4PFU A;  4JXI A;  1H3D A;  1MDP 1;  3H3G A;  3IOW A;  4OEU A;  1NV4 A;  1IIW A;  3VVD A;  3KN7 A;  4GWU A;  1LST A;  4E0W A;  1JQF A;  4O94 A;  4OZ9 A;  1WVJ A;  4ONY A;  2XXP A;  3GLB A;  2V84 A;  3SEU A;  1JEV A;  4DI3 D;  3MPL A;  5FHO A;  5CI5 A;  2HXW A;  3PUV E;  5ITO A;  1MG1 A;  1VE4 A;  3MJN A;  5DYH A;  4HE2 A;  1SI0 A;  3ZKK A;  3Q27 A;  2IEE A;  3CFZ A;  4GWZ A;  4EXL A;  1FPK A;  4Q30 B;  2DE4 A;  3MW0 A;  2H5Y A;  3TEP A;  4FAJ A;  4KCC A;  1O63 A;  1FQE A;  2XWV A;  2ESN A;  4I3E A;  1GVC A;  5AE4 A;  1LBX A;  4QRZ A;  4KQP A;  2AYS A;  5L9O A;  3CG3 A;  3U92 A;  4EDP A;  1B05 A;  3PD9 A;  3CFX A;  3TTK A;  3QIM A;  1MXZ A;  3KFM A;  1KA1 A;  2OX3 A;  4YB5 A;  4RA1 A;  3BFT A;  1MQD A;  3EN3 A;  2GRV A;  3N6T A;  2V25 A;  1FSA A;  5LOM A;  4DCX A;  2CEX A;  4PE3 A;  3IOU A;  3UIF A;  3PPP A;  1MH3 A;  5EQ7 A;  2XXX A;  4N17 A;  4X48 A;  4Z0I A;  1NKX A;  2G93 A;  5ISU A;  2O6A A;  2E1S A;  3SES A;  2QVR A;  2QSX A;  5F24 A;  2UXA A;  3BKI B;  4H8J A;  1DMB A;  2F3B A;  4RPN A;  1XT8 A;  4RK9 A;  2UVH A;  4N6P A;  4NF8 B;  4MJO A;  4OHN A;  3HO7 A;  1L5T A;  1LBB A;  4IB2 A;  2OWT A;  1OLA A;  3OMB A;  3FIR A;  3CFL A;  5L9S A;  1R9Q A;  3R26 A;  2WEF A;  5JEI A;  1LB8 A;  5KCJ A;  1B5J A;  4GWO A;  4OWD A;  1URG A;  5ET8 A;  1FQD A;  4ZZE A;  5K2Y A;  1MDQ A;  4OVR A;  1PBQ A;  3KSJ A;  4I62 A;  3KN8 A;  3CSB A;  2DE2 A;  1VSO A;  3TMG A;  1YCJ A;  4N8Y A;  1B5H A;  1SI1 A;  1ZJL A;  2HFB A;  5AA4 A;  3M3K A;  3IJO B;  1Y3Q A;  4F1V A;  3RLF E;  4XIG Q;  1N04 A;  1MY3 A;  4FEC A;  4YKP A;  3FJM A;  1QGX A;  1FPD A;  1SW4 A;  1B3E A;  4U1Z A;  1B7U A;  5EQ8 A;  3MP6 A;  5CMB A;  4AB5 A;  1QKA A;  1FBE A;  4KR5 A;  1MXY A;  1JW5 A;  5H8Q B;  4JVD A;  3VVF A;  4WED A;  3O28 A;  4FIM A;  2HHM A;  1MXX A;  3RYD A;  3G3H A;  2QFL A;  5T3J A;  3U1O A;  3PTY A;  4N8G A;  2ZYN A;  3O6I A;  3H4Z A;  5JK4 A;  1BLF A;  1LGB C;  2Q88 A;  1B40 A;  2I3W A;  4EUO A;  4H0W A;  2UVG A;  3ZSF A;  1IQ7 A;  5FTI A;  3B50 A;  4O7M A;  3T9X B;  4ELQ A;  1IIT A;  5I2N A;  1N7W A;  3MPK A;  4KCD A;  1Y9U A;  4WEP A;  3RTW B;  1DSN A;  1FTK A;  1LBC A;  1EZO A;  3USD A;  3KEI A;  2VPN A;  1J1N A;  3G3F A;  5ET7 A;  4FE8 A;  3TQL A;  3LV0 A;  4YU0 A;  4NHB A;  2KR0 A;  2VD3 A;  1II5 A;  2MKZ A;  4KD5 A;  3T66 A;  1PEB A;  4LQ2 A;  1O64 A;  3EKI A;  2Y5K A;  3N94 A;  3IO6 A;  1MY1 A;  3PUZ E;  4NF0 A;  1XVY A;  3UK4 A;  2QS1 A;  4C1U A;  3TTR A;  1RYX A;  1VR5 A;  2Y7R A;  4PP0 A;  3A3C A;  3H03 A;  1FRP A;  1DK4 A;  2KLF A;  2F97 A;  4NTL A;  2Q89 A;  4OQO A;  3Q26 A;  5I57 B;  2I4B A;  3BIH A;  3EHT A;  2XA5 A;  1IMC A;  4I3Y A;  2DWI A;  1I69 A;  4MLV A;  3O66 A;  1OVB A;  3KBR A;  3SKP A;  4NWC A;  5TPA B;  1QUI A;  1AMF A;  4DCY A;  4MNC A;  1IXI A;  1B7H A;  3U65 A;  2GHA A;  2ZZV A;  2QVV A;  4MH5 A;  1MXU A;  3ODB A;  2RC9 A;  3UA8 A;  1R6Z A;  1GTK A;  4MNI A;  4RJZ A;  4MFI A;  4PDD A;  2GHB A;  1JEU A;  1M5C A;  4LQ5 A;  1WDN A;  4G77 A;  2F35 A;  1Q9D A;  2I6E A;  1UTH B;  1FJ6 A;  3H6V A;  3THI A;  2IA4 A;  4QFK A;  4IO4 A;  2QPQ A;  4XKN A;  5LDZ A;  1FBP A;  3FVK A;  1LAH E;  3FV2 A;  4GIZ A;  4IO5 A;  3EPE A;  2FIE A;  4OAN A;  2RF1 A;  2V3Q A;  1NMU A;  1B4H A;  3H06 B;  3FUZ A;  1M5F A;  1FBC A;  2OWZ A;  4OVT A;  3HFU A;  4OEV A;  4GFR A;  2F7B A;  5CMC A;  4NMY A;  4R73 A;  2QJE A;  3TZA A;  5ET5 A;  1P1O A;  1OLC A;  4LA9 A;  3T0J A;  2Q8M A;  4YMB A;  4N91 A;  1YYZ A;  4PFT A;  3C33 A;  2HPG A;  2QL3 A;  1A55 A;  5H8H B;  5IKB A;  3IB0 A;  4PC9 A;  5CMM A;  3MVZ A;  2HCA A;  4AB6 A;  3CI8 A;  3TTL A;  1VDW A;  1D4N A;  3VLV A;  3S2V A;  1K9Y A;  5DVF A;  1Z7N E;  2AIX A;  3DEL B;  4P0I A;  2Y5L A;  3K6X A;  3W15 C;  3NOH A;  2I58 A;  5TPA A;  4I8C A;  4Q5T A;  1F9B A;  2HZL A;  3MZ1 A;  4R6Y A;  4Q8R A;  2ONS A;  3SEY A;  5AA2 A;  4GOT A;  3B7D A;  4PDH A;  2I0B A;  4BDR A;  1QJM A;  3MWB A;  3DP8 A;  4Q0C A;  3E9X A;  1B32 A;  3KC1 A;  3WAE A;  4DXU A;  3PUW E;  4K3F A;  2DVZ A;  2X26 A;  4H65 A;  5H8F B;  3TYH A;  5K2X A;  2Z8F A;  4GD5 A;  3FBP A;  4IR8 A;  4ZED A;  5I7I A;  1BIY A;  4OES A;  2FA7 A;  1LFI A;  4GBW A;  2P0S A;  4N4U A;  1QUL A;  4LZ8 A;  4OER A;  5F1Q A;  2BJI A;  3F11 A;  4N6K A;  4MCO A;  4PAI A;  5I5P A;  4N07 A;  3I6V A;  3EQ1 A;  1M5E A;  3T93 B;  3FXR A;  1EYK A;  4G2Z A;  5ICQ A;  5IZ3 A;  1AWB A;  1SQY A;  1B52 A;  2XXK A;  1PB7 A;  1FCK A;  2PYY A;  2Q9T A;  3CRB A;  1AL3 A;  3RN8 A;  4P11 A;  2WX9 A;  1LLS A;  4DI4 B;  4OYV A;  4NWD A;  5I58 A;  1MY0 A;  2ONR A;  1GV8 A;  4F2O A;  3ONM A;  1Z7M E;  5H8H A;  4R74 A;  3RGY A;  4H46 A;  3UGW A;  3U94 A;  2DS9 A;  1USY H;  1K9Z A;  2OBG A;  3C35 A;  1MPC A;  2QS3 A;  4KPT A;  5JTY A;  4PAK A;  4GWW A;  3G3I A;  4BDN A;  4IO6 A;  1P1Q A;  3RT8 A;  1NV0 A;  3T9U A;  1B3F A;  4HE1 A;  2OCU A;  1DBZ A;  2O7U A;  3H6T A;  1OQH A;  5EYF A;  3PMX A;  5AA2 D;  1AIV A;  4MX6 A;  3TPA A;  1URD A;  4PF8 A;  1A8E A;  3E3K A;  4DIG A;  2BJJ X;  3TQW A;  3K02 A;  4LZ5 A;  2XHD A;  5CBS A;  4LAT A;  1LFG A;  1MS7 A;  4R6H A;  5KCJ B;  3S9M C;  2NUV A;  2XWK A;  4XKP A;  4ELO A;  5AA3 A;  3PU5 A;  4P8B A;  5H8F A;  3C36 A;  3K1M A;  1FJ9 A;  1UQW A;  4KI0 E;  3K0V A;  2O69 A;  3K00 A;  4LZ7 A;  1B0H A;  2XXW A;  3BBR A;  1NFT A;  5CRY A;  2UVJ A;  4H8I A;  4F3S A;  2DP8 A;  5AA4 B;  5I2K B;  3OO9 A;  3MAM A;  3K1P A;  1INP A;  2CZK A;  4F39 A;  1D3K A;  1P1U A;  3JZJ A;  4OA4 A;  4YMA A;  1B58 A;  4IGT A;  2KQZ A;  1VFD A;  5EYG A;  1MQG A;  1NH8 A;  4KYS A;  1ZIU A;  3DP6 A;  3FVG A;  2X7Q A;  1PDA A;  3TUS A;  2VPO A;  4F18 A;  3MUQ A;  5HBC A;  3R7X A;  4ESX A;  2XXI A;  3CHG A;  1B3H A;  4OMB A;  5DEX A;  2B4M A;  5IZ1 A;  2B4L A;  1SW2 A;  4IY6 A;  3GBA A;  4PQJ A;  5EHM A;  3M3F A;  5A5L A;  2E0S A;  3TEL A;  5I2N B;  3OO7 A;  3UP9 A;  4M4G A;  2O7I A;  3KOS A;  1YAE A;  2XXY A;  3DP4 A;  3MP8 A;  1P99 A;  4R2B A;  3OXN A;  3OSQ A;  4OFJ A;  3EF7 A;  1G0I A;  1BKA A;  1ZMG A;  3L6G A;  4MLQ A;  4UAB A;  1MY2 A;  1Y1M A;  2I48 A;  2DXY A;  2ZMB A;  2UVI A;  4X1D A;  3TFL A;  4OFO A;  4OVJ A;  1QVS A;  3GZG A;  3WAF A;  1MQI A;  4HTG A;  5DW8 A;  4GWX A;  5FHN A;  1FTJ A;  4MIJ A;  5CM6 A;  4GWY A;  4G8M A;  3HV1 A;  1MXV A;  3C32 A;  3FXU A;  2ALU A;  3LSW A;  3K1N A;  3KZG A;  2F8D A;  1SPI A;  4O7I A;  4F31 B;  1Y4C A;  2V3T A;  4O3A A;  1MQH A;  2ZYK A;  3OEL A;  4PBH A;  1YXI A;  3MVW A;  4I1D A;  4NN3 A;  5I2K A;  3VXB A;  4C1T A;  3A09 A;  4JB7 A;  2AL4 A;  2DXR A;  4POX A;  3HCQ A;  3OEK A;  4HXV A;  1QW0 A;  1KWH A;  2XD2 A;  2YPN A;  4LON B;  1NNK A;  1CNQ A;  1B46 A;  2FHY A;  2ZNU A;  3Q28 A;  4RPO A;  5B7D A;  1FTO A;  1R9L A;  5ESY A;  4PFR A;  4POW A;  2G29 A;  1XHY A;  4N81 A;  5A5X A;  4FAT A;  1SW5 A;  1I6B A;  4GRK A;  3IL1 B;  3B8B A;  4YIC A;  2ZZW A;  1PB9 A;  5I59 A;  3PD8 A;  2L5V A;  4QFO A;  2O1L A;  4PFY A;  4N13 A;  1RDY A;  2PBW A;  3L6H A;  2DOJ A;  5IM2 A;  2D5W A;  1Y20 A;  3W9W A;  1MXW A;  4UA8 A;  5L9M A;  4RK2 A;  4NAP A;  3U8Q A;  5F7V A;  1QKB A;  1LAX A;  2ABH A;  3FXB A;  4P9K A;  4YB7 A;  2A5S A;  5EQA A;  1SYI A;  4ZEK A;  1RYO A;  4F29 A;  4HCW A;  3H6U A;  2FBP A;  4NED A;  4TLM B;  1JVY A;  2I4C A;  4P3L A;  1P1N A;  4G8N A;  4R75 A;  4ZDM A;  5H8N A;  4H5G A;  1BTJ A;  4G4P A;  4G68 B;  4QFP A;  5BWJ A;  5DTB A;  3IOT A;  1IEJ A;  1TFD A;  2HAU A;  4R9G A;  4X1B A;  1FPL A;  4RY1 A;  5I3S A;  2OZZ A;  1NUW A;  3M8U A;  3S9N C;  4P1L A;  2XXR A;  2P3N A;  4QSC A;  4E0X A;  4GX6 A;  4GF8 A;  1IXC A;  3CR9 A;  1WOD A;  4NE4 A;  3CIJ A;  2VOZ A;  4YKJ A;  1MM7 A;  2NVU B;  2F7A A;  4PFW A;  3JYR A;  2R9J A;  1LCT A;  5J16 A;  2NWJ A;  4EQ7 A;  3IFA A;  3MVX A;  4NF4 B;  4AS4 A;  3PMV A;  4IY5 A;  2OK2 A;  2XXV A;  3H6W A;  5CC2 A;  2D3I A;  4DLD A;  3O2A A;  4O3B A;  2I3V A;  3C31 A;  2R6G E;  5AA2 B;  2UYE A;  4RXL A;  3K2D A;  1FPI A;  1LAF E;  4OVP A;  3RPL A;  2XX7 A;  4YKK A;  4ZS9 A;  4DDD A;  3T96 B;  3B6Q A;  3ECR A;  2HAV A;  2OPD A;  2ZXT A;  3CG1 A;  2F34 A;  3HHF A;  2D21 A;  5BUU A;  2Y84 A;  1IZ1 A;  3IAZ A;  2F5X A;  4OFL A;  2B3B A;  4NG7 A;  3O9P A;  4PTK A;  1LB9 A;  2PVU A;  1FQB A;  4MF3 A;  3B6T A;  4YB6 A;  1RDZ A;  2DSF A;  3RPW A;  2P2A A;  3KSX A;  5IZ3 B;  2XWI A;  4WKM A;  4G68 A;  2DWJ A;  3VE1 B;  3D1R A;  3Q29 A;  3EHS A;  1LAG E;  5I58 B;  4JVC A;  2FYI A;  3SZP A;  4EQ9 A;  4GL8 A;  3V83 A;  2Z8E A;  5FBP A;  4OET A;  1NI9 A;  1VFE A;  1FQF A;  2R71 A;  2XXT A;  3TTN A;  5JTY B;  3RT6 B;  1A8F A;  2QRY A;  3FD3 A;  2RCB A;  1OVT A;  3TCF A;  1NV7 A;  3KGC A;  1O7T A;  2HZK A;  2ZYM A;  5I56 B;  4NF4 A;  1G0H A;  4U4S A;  3T22 A;  5EQ9 A;  3O6H A;  3TDJ A;  3RNN A;  1MY4 A;  1N7X A;  4ZE8 A;  3MC2 A;  5FHM A;  4OTE A;  2RC8 A;  5J1D A;  3QYT A;  2Y7P A;  1HSE A;  1XOC A;  2OJT A;  4EF1 A;  3S9L C;  1MH4 A;  2ZNS A;  4QFL A;  2H98 A;  4G61 A;  4JWX A;  3KJ7 A;  4TOZ A;  3MP1 A;  3RUM A;  3C34 A;  4BDM A;  4MHF A;  3PV0 E;  1JNF A;  4GXS B;  1N3X A;  3OEN A;  2B3F A;  4KHZ E;  1UTB A;  2Y7K A;  1BP5 A;  1JW1 A;  1FQA A;  3T1B A;  3FAS A;  4RNS A;  2RC7 A;  5ITP A;  1N84 A;  1FPJ A;  1H45 A;  1B2H A;  1HSL A;  1FPE A;  1B3L A;  1B3G A;  2VHA A;  2V3U A;  4OEN A;  1S50 A;  5HM4 B;  2JJK A;  1PB8 A;  2ZYO A;  3G7W A;  2FVZ A;  2ANJ A;  2O68 A;  3LR1 A;  2FNC A;  1A99 A;  3UN6 A;  3C4M A;  1FTA A;  3HN0 A;  4ND9 A;  2XXQ A;  1MPD A;  1EZ9 A;  5LTC A;  3LSX A;  4UAC A;  1RDX A;  2QS4 A;  2Q8J A;  5DEX B;  4P0G A;  2V4C A;  1YTV A;  3OO6 A;  2WYP A;  1IMF A;  2CZH A;  1OIB A;  1GR2 A;  4N15 A;  4GQO A;  2ONK E;  4NF6 B;  4BDQ A;  2Y7I A;  1POT A;  4JVI A;  2WBB A;  4RYA A;  4QXD A;  5TP9 B;  4NQ8 A;  1NV3 A;  2VD2 A;  2Q2A A;  1MRP A;  1TWY A;  1FBH A;  3FJG A;  3E78 A;  1QUK A;  3MYU A;  5KDT B;  1IXH A;  4ZEF A;  5DVI A;  5I56 A;  3PPO A;  1ZTY A;  3PPR A;  2B65 A;  4F22 A;  3FJ7 A;  4I40 A;  3A3U A;  2XX9 A;  1DCU A;  4GL0 A;  3BFU A;  4MEV A;  4HCY A;  2VGQ A;  4EF2 A;  1LBW A;  4FBP A;  4GLI A;  3S9E A;  1SDX A;  4IO3 A;  3GYY A;  1SYH A;  2DWH A;  2PFZ A;  3HHG A;  4HE0 A;  3ZS6 A;  3TCG A;  2RCA A;  3V89 B;  1LFH A;  3LSL A;  4IGR A;  1US4 A;  1KA0 A;  3G3K A;  3SEW A;  5ICT A;  4KYE A;  2P1S A;  3O29 A;  4GWS A;  3MBP A;  5DT6 A;  1LBZ A;  4P47 A;  3Q25 A;  2QVU A;  3I3V A;  4JWO A;  1B51 A;  4HW8 A;  2PFY A;  4ZEB A;  5KZT A;  4XXU A;  3OD7 A;  2DWA A;  4DZ1 A;  4DE8 A;  4THI A;  4FED A;  3B6W A;  2VT5 A;  3IX1 A;  3OO8 A;  1SBP A;  1NUY A;  4F3P A;  3M3L A;  4JDF A;  5A5X B;  1FQC A;  3LBS A;  1A40 A;  1N3W A;  3A29 A;  1N76 A;  5I59 B;  4PE5 B;  4PET A;  3ILT B;  4NF6 A;  1D9Q A;  3VV5 A;  4ECF A;  4NF5 A;  2NXO A;  1P1W A;  3TKD A;  1PC3 A;  5TP9 A;  4XEQ A;  2OWS A;  4ZE9 A;  3IOV A;  3FVO A;  2QMX A;  4GVO A;  3U72 A;  3TOD A;  3TAJ A;  5KDT A;  1NH7 A;  2CMO A;  3T9V A;  3R6U A;  3N26 A;  1B4Z A;  4PCD A;  1Y1Z A;  3LUZ A;  4MBP A;  5H8N B;  3JV9 A;  3DLN A;  1Y3N A;  1ZBM A;  3GBB A;  1BK4 A;  4H5F A;  2O1M A;  1IMB A;  1TFA A;  4G68 C;  1OQG A;  5CMK A;  4JSO A;  2Z23 A;  4F1Y A;  4NGU A;  4U2R A;  3T9H B;  4LP2 B;  1EYJ A;  2F36 A;  1JW4 A;  1DOT A;  4R72 A;  2CZI A;  2R8T A;  3HPI A;  1NNF A;  5IZZ A;  1H76 A;  3SET A;  4H1X A;  1POY 1;  4O3C A;  3TCH A;  1A7L A;  3N6U A;  3K6U A;  1TXF A;  2DYX A;  1JP4 A;  1ZLQ A;  2Z8D A;  3FV1 A;  1FPF A;  1OMP A;  4JWY A;  3FAT A;  5IGA A;  1LBV A;  1USY E;  1QUJ A;  2CEY A;  4XKR A;  2CZL A;  2DE3 A;  2VP1 A;  3IJX B;  4U21 A;  4U4X A;  2THI A;  2ZNT A;  3SER A;  4LN5 A;  5AA1 A;  3RPL B;  2OPE A;  1AOV A;  3QMF A;  2XWO A;  1XVX A;  1DTZ A;  3OSR A;  1XS5 A;  2ZZX A;  3D4C A;  4U22 A;  4P56 A;  2I49 A;  2H9B A;  1B7Z A;  2WYK A;  4R2F A;  1Y4T A;  1ATG A;  1EU8 A;  1FPG A;  4ESW A;  2AL5 A;  4QHQ A;  4XKQ A;  5ELV A;  3E79 A;  4JBZ A;  3SEX A;  1SD3 A;  3K4U A;  3K6W A;  3IO4 A;  4PAF A;  4BLA A;  3LSF B;  2PMS A;  3MZB A;  1FBF A;  1HSJ A;  4YKI A;  1Y3P A;  3MVY A;  3HST A;  1B9J A;  3PMW A;  1M5D A;  3LUY A;  1KZ8 A;  4QFN A;  4QSD A;  2H4I A;  4NF8 A;  2Q2C A;  1LCF A;  1NNT A;  3O97 A;  4XTC Q;  3LC8 A;  2NOO A;  2REJ A;  1IME A;  1B0L A;  3KG2 A;  3V5A A;  1A54 A;  3GXA A;  3PUX E;  1NUZ A;  3QUJ A;  1NV1 A;  4R6K A;  3QSL A;  4YAH X;  4GBV A;  2UYF A;  4KYD A;  1TT1 A;  3K6V A;  4ZEI A;  2H99 A;  3E4R A;  1UIU A;  1FTL A;  2HXR A;  1NNP A;  2O51 A;  3O6G A;  3C9H A;  4OXV A;  2P3V A;  1EH3 A;  4ZEC A;  4GX3 A;  2YJP A;  5L8D A;  3OEM A;  3PPN A;  4H45 A;  2F3D A;  1PBP A;  2FIX A;  5H8S A;  3TTM A;  3FGS A;  2V93 A;  1M5B A;  3IB2 A;  5H8Q A;  5M2V A;  1FPB A;  3UOR A;  4FEB A;  4QBA A;  3IR1 A;  4PF6 A;  3FZV A;  2XX8 A;  1IMD A;  3VLW A;  1UTB B;  4BDL A;  1B1H A;  1Q1K A;  2A5T B;  3W9V A;  3RTF B;  1T0K A;  3OOA A;  2X7P A;  1FBD A;  2DDK A;  4TLL B;  3MQ9 A;  2PX1 A;  3EHU A;  2W7Y A;  3K01 A;  4R9F A;  5FTH A;  5IAI A;  1MM6 A;  3PGF A;  1URS A;  2Z22 A;  1S7Y A;  4HS7 A;  4ISU A;  4GXA A;  4M1V A;  4LVQ A;  5EHS A;  1UIV A;  4G8H A;  2HQ0 A;  3IK6 B;  3E13 X;  3QAX A;  5I84 A;  3DM0 A;  2YLN A;  3CVG A;  1YPN A;  4QSE A;  3V8X B;  4NX1 A; 
#chains in the Genus database with same CATH homology
 4N6D A;  2VPN A;  4N15 A;  5ET6 A;  4F1U A;  5ET7 A;  4JVI A;  2WBB A;  4QXD A;  3LV0 A;  4NHB A;  4X04 A;  3IFC A;  4NQ8 A;  1NV3 A;  2KR0 A;  4AS5 A;  1G0I A;  2MKZ A;  1FBH A;  4UAB A;  2Q74 A;  3E78 A;  3EKI A;  3MYU A;  2Y5K A;  1NV6 A;  2GQ1 A;  4KXP A;  4I40 A;  4NF0 A;  4PFI A;  4PGN A;  1NV2 A;  1XI6 A;  5DW8 A;  4GWX A;  1DCU A;  4MIJ A;  5CM6 A;  4MEV A;  4GWY A;  4HCY A;  5EYH A;  3KBZ A;  1FRP A;  4XFE A;  1DK4 A;  1EYI A;  1LBW A;  4OVS A;  4FBP A;  3MST A;  1SPI A;  4O7I A;  3BIH A;  3GYY A;  2XA5 A;  1IMC A;  2PFZ A;  3BIG A;  4PBH A;  4HE0 A;  4I3Y A;  1NUX A;  1YXI A;  4NN3 A;  1KA0 A;  4MNC A;  4GWS A;  1LBZ A;  4P47 A;  4PBQ A;  4X9T A;  2QVU A;  4HXV A;  2WBD A;  2PCR A;  2PFY A;  3U65 A;  1CNQ A;  2ZZV A;  2FHY A;  2QVV A;  4YZZ A;  4MNI A;  5ESY A;  4PFR A;  4XF5 A;  4PDD A;  4O8M A;  4N81 A;  2VT5 A;  1Q9D A;  3B8B A;  4YIC A;  2ZZW A;  1FJ6 A;  2L5V A;  1NUY A;  1LEV A;  3ISP A;  1RDY A;  2QPQ A;  5LDZ A;  1FBP A;  3A29 A;  4OVQ A;  1NV5 A;  5IM2 A;  4X8R A;  4PET A;  2FIE A;  3W9W A;  4OAN A;  2V3Q A;  1D9Q A;  4MAG A;  4NAP A;  1LBY A;  4XEQ A;  1FBG A;  4PGP A;  4MNP A;  3KC0 A;  4P9K A;  3FXB A;  1FBC A;  2OWZ A;  1IMA A;  4OVT A;  5EQA A;  3HFU A;  4HCW A;  4F19 A;  2FBP A;  4P3L A;  5ET5 A;  3T0J A;  2Q8M A;  4N91 A;  1YYZ A;  4PCD A;  1YZ0 A;  2HPG A;  3LUZ A;  4P1E A;  4PFB A;  4PC9 A;  1FPL A;  5I3S A;  4GX4 A;  3ROJ A;  1BK4 A;  1NUW A;  1IMB A;  4P1L A;  1VDW A;  2P3N A;  4MMP A;  1K9Y A;  4GX6 A;  4NGU A;  1NV4 A;  1EYJ A;  2Y5L A;  3NOH A;  4GWU A;  2HZL A;  2CZI A;  2R8T A;  4O94 A;  5IZZ A;  5J16 A;  3IFA A;  4AS4 A;  1JP4 A;  4PDH A;  4DI3 D;  1FPF A;  3KC1 A;  5IGA A;  4HE2 A;  1LBV A;  2DVZ A;  1FPI A;  4GWZ A;  2CEY A;  4OVP A;  1FPK A;  3RPL A;  2DE4 A;  2DE3 A;  3FBP A;  4IR8 A;  5I7I A;  4LN5 A;  2XWV A;  4I3E A;  4GBW A;  3RPL B;  1LBX A;  3QMF A;  2XWO A;  4N4U A;  1IMF A;  2BJI A;  2ZZX A;  4N6K A;  4P56 A;  4MCO A;  4PAI A;  5I5P A;  2WYK A;  1KA1 A;  1EYK A;  2OX3 A;  2F5X A;  4NG7 A;  4PTK A;  1FPG A;  5IZ3 A;  1AWB A;  1RDZ A;  2XXK A;  3E79 A;  2Q9T A;  1FSA A;  4PAF A;  5IZ3 B;  2CEX A;  1FBF A;  4PE3 A;  2XWI A;  2WX9 A;  4DI4 B;  5EQ7 A;  4N17 A;  3D1R A;  4H46 A;  1KZ8 A;  2QVR A;  1K9Z A;  4JVC A;  3SZP A;  5F24 A;  5FBP A;  4PAK A;  4GWW A;  2F3B A;  1NI9 A;  4MJO A;  1NV0 A;  1IME A;  4HE1 A;  1DBZ A;  1NUZ A;  2WEF A;  4MX6 A;  1NV7 A;  1NV1 A;  2HZK A;  4PF8 A;  4GBV A;  1G0H A;  5EQ9 A;  5ET8 A;  2HXR A;  4OVR A;  2XWK A;  2P3V A;  5J1D A;  2DE2 A;  4P8B A;  4GX3 A;  1FJ9 A;  4G61 A;  4N8Y A;  4H45 A;  2F3D A;  2FIX A;  4F1V A;  4MHF A;  1FPB A;  1QGX A;  1FPD A;  5EQ8 A;  3T1B A;  4QBA A;  4PF6 A;  1INP A;  1FBE A;  1IMD A;  2CZK A;  1FPJ A;  4JVD A;  1FPE A;  4OA4 A;  2HHM A;  2KQZ A;  5EYG A;  3RYD A;  3W9V A;  2QFL A;  1FBD A;  5T3J A;  2DDK A;  3PTY A;  4N8G A;  2VPO A;  4F18 A;  5JK4 A;  2JJK A;  2FVZ A;  3B50 A;  3CHG A;  4O7M A;  2B4M A;  4M1V A;  5IZ1 A;  2B4L A;  1FTA A;  5LTC A;  1RDX A;  5A5L A;  2V4C A;  2WYP A;  2CZH A;  4NX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...