2PCRA

Crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
261
structure length
238
Chain Sequence
NLKKYLEVAKIAALAGGQVLKENFGKSYVDKTSEERIKEVILKFFPDHEVVGESEYRWFIDPLDGTKNYINGFPIFAVSVGLVKGEEPIVGAVYLPYFDKLYWGAKGLGAYVNGKRIKVKDNESLKHAGVVYGFPSRSRRDISIYLNIFKDVFYEVGSMRRPGAAAVDLCMVAEGIFDGMMEFEMKPWDITAGLVILKEAGGVYTLVGEPFGVSDIIAGNKALHDFILQVAKKYMEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol-1-monophosphatase
publication title Crystal structure of Myo-inositol-1(or 4)-monophosphatase (aq_1983) from Aquifex Aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 73
structure length 238
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2pcrA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2pcrA02
1FBPA 1NUZA 3KBZA 1IMCA 4MJOA 2Y5KA 4AS5A 3D1RA 4GX4A 2QVRA 1DK4A 2R8TA 1FTAA 1FPDA 1RDZA 2FHYA 4GWUA 4O7IA 1D9QA 1FPFA 1VDWA 4GWSA 5DW8A 2F3DA 3KC1A 1IMAA 2P3VA 3B8BA 1FJ6A 2VT5A 1FBEA 1FBGA 4N81A 4AS4A 3IFCA 1CNQA 2OX3A 5ET5A 2Q8MA 1LBYA 4QXDA 5LDZA 1NI9A 1IMEA 4IR8A 1NUXA 1NV2A 1KA0A 4KXPA 1NV4A 2WBBA 3ROJA 1YZ0A 5EYHA 4GWYA 1RDYA 1EYIA 1Q9DA 1EYKA 2WEFA 1IMDA 1LBXA 4I3YA 4GX3A 1FPGA 4HXVA 2FIXA 2CZKA 2P3NA 4I3EA 1IMBA 1RDXA 3BIHA 3FBPA 2GQ1A 3IFAA 1XI6A 4PTKA 5IZ1A 2FBPA 2BJIA 1FBCA 1SPIA 2Y5LA 4GBVA 5J16A 1NUYA 2FIEA 2F3BA 1K9YA 1FPBA 1DBZA 5EQ9A 1K9ZA 3RPLB 4HE1A 5ET6A 1NUWA 2QFLA 3QMFA 1FBDA 2QVUA 1KZ8A 2OWZA 5ET8A 1FPLA 1IMFA 4GWWA 4H45A 1FPJA 4GWXA 1AWBA 5T3JA 2PCRA 1G0HA 1NV6A 5EQ7A 2CZHA 4HE2A 3KC0A 1YYZA 1FBFA 3A29A 1NV3A 1NV7A 1QGXA 1FJ9A 1JP4A 5A5LA 5IZ3B 1FRPA 4FBPA 1NV5A 2DDKA 5ET7A 3BIGA 1LBVA 1G0IA 1FPKA 2Q74A 1NV1A 1EYJA 3LV0A 5EQAA 3RPLA 2JJKA 3LUZA 5EYGA 1LEVA 1FPIA 1INPA 4HE0A 1DCUA 5FBPA 1FSAA 2FVZA 4H46A 2CZIA 1FPEA 2HHMA 2WBDA 5EQ8A 4G61A 3T0JA 3RYDA 4I40A 4GWZA 1KA1A 5I3SA 1YXIA 1LBZA 1LBWA 1FBHA 4GBWA 1NV0A 2QVVA 5ESYA 5IZ3A 4GX6A 1BK4A 5F24A
chains in the Genus database with same CATH superfamily
3UA8A 4U1ZA 4FORA 4OZ9A 4ND9A 4X04A 1M5CA 1XT8A 3K02A 1FPFA 4GWSA 3RTWB 4ESWA 1A55A 2OPEA 2V84A 1IMAA 3TTLA 2F6GA 3D4CA 5KDTA 1FBGA 2PMSA 1HSEA 1YPNA 3KFMA 3KSXA 3MVYA 1B1XA 1IMEA 2IEEA 3PUWE 1KA0A 3VDFA 1LCTA 5TP9B 2Q88A 2WEFA 2YLNA 4KR5A 3RT6B 2ZNTA 4Q30B 1LAHE 4FEBA 5H8QA 2I0CA 2XA5A 4QSEA 1A99A 2XXYA 3H6WA 1FBCA 3HSTA 2Q2CA 4NN3A 2H99A 3QXMA 1EZ9A 3UK4A 4AB5A 2O84X 1IXGA 1ZMGA 3MZ1A 3O97A 4OHNA 1QGXA 4N13A 3HPIA 5I56B 1Z7ME 3HHGA 4R73A 3H6VA 3BIGA 1EYJA 4NF5B 2LAOA 1FTLA 1LFGA 3ZKKA 1VFDA 1UTBB 1DCUA 2VD3A 3GBAA 3VXCA 2D5WA 1YTVA 1M5EA 4QSCA 5CRYA 4OFLA 5H8FA 2ESNA 3CRBA 4MMPA 3O6GA 1MY4A 4F22A 3C32A 2GHAA 4C1UA 4ZZAA 1I6BA 1D4NA 1F9BA 2DWIA 1B2HA 4N6PA 2AYSA 1XS5A 2H5YA 1FW0A 5K2XA 1ZKBA 3IB2A 2QMXA 1GV8A 3KBRA 2O7IA 3KG2A 4XKNA 1PEBA 3IFCA 2HCAA 3C36A 1Q1KA 2XD3A 3PUYE 2AIXA 2ZYMA 3BFUA 4EF1A 4RPOA 1A8FA 4YMBA 2CZLA 5CC2A 4E0XA 1LBXA 1IMBA 2GQ1A 3IFAA 2A5TA 3LUYA 3PMVA 3TQWA 3P7IA 2H9BA 2PFZA 5HM4B 1AL3A 2Z22A 2O68A 3O9PA 2P2AA 2L5VA 2QFLA 4FIMA 4O3BA 1PDAA 4F1VA 2O1MA 5I57B 4F31B 4G68C 1IQ7A 4FECA 1IXCA 1I6QA 2I48A 1NV7A 2UYFA 5H8NB 3VLWA 2XXIA 1NH7A 2DDKA 1AIVA 2WKYA 3B50A 3G3GA 1FPKA 1R9LA 4IY6A 5J1DA 3RPLA 4O3AA 4U23A 3K6VA 2QSXA 4EQ7A 3T0JA 1GTKA 2XXPA 1O63A 1OQGA 2DE4A 2HAUA 4NWCA 4JVCA 2Y84A 3C35A 1T0KA 1MQJA 1LGBC 5ICQA 3GZGA 1SQYA 3OSQA 1NKXA 3G3KA 3SEXA 1JW4A 3E4RA 2F5XA 4RY1A 3IJXB 5I2KB 2G93A 4H67A 2ONRA 3LR1A 3FJGA 1I69A 4PFTA 1YZ0A 5DYHA 1B7HA 1XC1A 1JQFA 2HZLA 3OELA 5I58B 3H03A 5L9MA 3DP6A 4R2BA 4ZEBA 3B6WA 4NG7A 1EZPA 4DCYA 1URSA 3H6UA 2KQZA 4PF6A 4QF9A 3MWBA 3FVNA 4R6YA 4LN5A 3DELB 3O2AA 4PE3A 4LATA 3TELA 1G0HA 2Z8DA 2CZHA 5AE4A 3TPAA 4MEVA 1AOVA 3ILTB 2Y7RA 4I62A 5LOMA 1N76A 4QFNA 5A5LA 3QSLA 4FATA 1FQFA 3Q28A 1QKBA 1SYIA 3I5OA 3IOVA 3OEKA 4LZ7A 5EQAA 3SDFA 5JTYA 1S7YA 3EN3A 3EHSA 4BLAA 3EF7A 4DE8A 3HO7A 4PBHA 2ZYKA 4UABA 1BTJA 4YKIA 3K0VA 4H8IA 5KDTB 2R71A 5FTHA 2XXTA 3SEUA 3Q27A 5JK4A 5DTBA 1FTJA 5IZ3A 1LB9A 2XXXA 3RN8A 2QS2A 3PTYA 3MPLA 4PC9A 4UA8A 1JEUA 3UP9A 4YKKA 1NFTA 2ZXTA 2Y5KA 4QFOA 5ISUA 1VSOA 3MQ9A 3TODA 1USYH 4GWUA 3VV5A 1H76A 3D4GA 5H8QB 1VDWA 1MQHA 2I4CA 2P3VA 2QL3A 2WYPA 3G3HA 3H6TA 1NI9A 3GYYA 2XWVA 3W9VA 5EYHA 1TXFA 3FVGA 4ZEIA 4MHFA 1FPGA 1B7UA 1TT1A 4LQ5A 3EHTA 1I6AA 3BBRA 1Y3NA 4OFOA 4DI4B 2BJIA 2YPNA 1SPIA 4N8YA 2FIEA 2F3BA 1Y1MA 4NHBA 3QMFA 5ITOA 2VHAA 4X1DA 4GLIA 4KYDA 4XEQA 5H8FB 3HV1A 2RC7A 3U94A 4RJZA 5ICTA 1MDP1 2QS3A 1JP4A 1LLSA 5FTIA 4FBPA 4QFLA 1JEVA 2JJKA 1NH8A 4X9TA 4DXCA 4OERA 5IZZA 1B32A 4ONYA 4DLDA 3N94A 2WBDA 4PETA 5I7IA 4AB6A 4FE8A 3SETA 5I3SA 3JZJA 2B3FA 3RLFE 4GWOA 2I3VA 3RY3A 4RXLA 1D9VA 3TZAA 3TYHA 1LAGE 3B6QA 3TMGA 3I6VA 3QYTA 1NUZA 1POTA 3CVGA 3QIMA 2Y7PA 4YB6A 1FTAA 3NOHA 1B46A 2A5TB 3OMBA 2M8CA 4IO3A 2D21A 1SW2A 4KPTA 5I2NA 5ELVA 4KCDA 3B7DA 3FVOA 3E78A 1UTHA 1N0TA 3PPNA 4GQOA 4PAKA 1B51A 4OQOA 2PT2A 3IORA 1XOCA 3FZVA 1N7XA 1DSNA 3FV2A 3KN7A 2UVIA 1Y3PA 3LC8A 3HCQA 3U93A 5H8HA 1D3KA 3RPLB 4NTLA 4BDRA 4H45A 4WEPA 2I49A 4TOZA 3LSLA 4C0RA 4YB7A 3PPRA 4OEUA 4XKRA 1NV3A 1FJ9A 3T9UA 4IO7A 1FQCA 2GH9A 1HSLA 3SESA 1OIBA 1NV5A 4PP0A 2QMWA 1LBVA 4H0WA 4Z0IA 5BUUA 5L9OA 4G4PA 4PFYA 3IB1A 3BFTA 4ZZEA 3T1BA 3DP8A 2DXYA 4ELQA 1ELJA 1S9TA 3V83A 3FXRA 4LQ2A 2RCBA 4G8NA 3TCFA 1QKAA 2XHDA 3VLVA 3S2VA 2F6PA 3LSXA 1OLCA 4KYSA 4GX4A 3CG1A 3TAJA 1SBPA 4K3FA 5H8SA 3CI8A 3PV0E 4MLQA 3CFXA 1SDXA 4NF4A 3IR1A 3QUFA 1N84A 4IR8A 1NV4A 1MDQA 1P1OA 3CSGA 4U22A 2DP8A 3KJ7A 4BDQA 3KJTA 3GXAA 3M3FA 2P3NA 1JVYA 2PYYA 4JB7A 2Q2AA 3FBPA 1N3XA 4QHQA 3KZGA 4OMBA 3IOTA 3MBPA 3PD8A 5JTYB 2XXRA 2Q89A 4OVQA 1MXWA 1VR5A 3OENA 3TTKA 3SKPA 3GBBA 2F36A 1J1NA 1LFIA 4R6KA 5DT6A 5FHOA 4YB5A 3TKDA 4I8CA 5IZ3B 4LUBA 1FQAA 1RYOA 2HFBA 1RKMA 4XF5A 2DYXA 4JWYA 3WAFA 5FBPA 2VP1A 4LP2B 2HHMA 3IK6B 4DDDA 4MNIA 4P1LA 2QJEA 5TU0A 3MZBA 5CBRA 4F19A 4PDHA 3MSTA 3FVKA 4L17A 5HPQA 3KN3A 2QS1A 4BDOA 5L9SA 2XX8A 1GVCA 2FHYA 1FPDA 1FQDA 4MFIA 1BLFA 1LBCA 1WVJA 3E3KA 4MCOA 5CBSA 3B8BA 2V3UA 2DWAA 3G3JA 1YCJA 3CFZA 2OX3A 4GD5A 2X7PA 2AL5A 2OCUA 3FXUA 4OENA 3IO6A 1EYIA 1EYKA 2Z8EA 4GX3A 4JVIA 2QRYA 4U2RA 4RPNA 1NNKA 4R9GA 1NNPA 3PPPA 4HE1A 4HW8A 4UACA 1FBDA 2Z23A 2V3QA 4I9DA 3SEVA 4GL8A 1FPJA 1NMUA 3MJNA 1H3DA 2F7CA 4JDFA 3KC0A 1DPPA 1SW1A 3RGYA 5AA4B 2ONSA 5ET7A 4HCWA 4OTEA 3OSRA 2Q8JA 5EYGA 3CIJA 1FPIA 4TLLB 2B65A 1SW5A 4PFRA 4PBQA 4H46A 1FPEA 1SW4A 4QFKA 2UVHA 2NWJA 1LBZA 2F97A 4ZE9A 1MY3A 2ALUA 5I2NB 4N4UA 4GF8A 5ESYA 1UTHB 3IB0A 4F18A 3O6IA 3KBZA 2I0BA 1MQDA 4YU0A 2R8TA 3QAXA 1QUKA 1FQEA 3QUJA 5DVFA 2O7UA 2PX1A 4PQJA 5I59A 5IKBA 3TUSA 3IX1A 5H8HB 4N6KA 5F1QA 3V89B 4U4XA 1BIYA 3FV1A 1MXUA 3CG3A 3DLNA 2E0SA 3FD3A 1B5HA 2PBWA 4OANA 2V93A 4ELPA 1B5IA 3T9XB 3BIHA 4RA1A 3M8UA 4PTKA 4N6DA 4PGPA 1Y1ZA 1MM6A 2ONKE 4GXSB 5IM2A 3C4MA 2F7BA 1DOTA 2HZKA 4NE4A 4R72A 1EZOA 1YYZA 1XHYA 2THIA 3SEWA 1B5JA 3SEYA 1QVSA 1NNTA 1VFEA 2DQVA 1G0IA 1EU8A 5M2VA 5EYFA 3M3KA 4DCXA 3T9HB 4KD5A 3IOWA 4GWZA 2QPQA 4P9KA 3EKIA 4NF4B 4XKQA 1MXVA 4EXKA 2DWHA 4IGRA 4G8HA 4ZEKA 3A09A 1URDA 5B70A 3O29A 4E0WA 1A54A 3FJ7A 1JW1A 4MJOA 2I3WA 2XXKA 3MP1A 4NAPA 4EQ9A 1RDZA 3G3IA 2UXAA 4OFJA 5DW8A 2F3DA 4DIGA 2PVUA 3FATA 4NX1A 1MRPA 3THIA 1ZIUA 1Z7NE 3VVDA 2PFYA 3N6UA 2VGQA 4IO2A 3K6WA 2D3IA 4ZEDA 2WYKA 5TP9A 3K6UA 3MZ9A 4OVTA 4I3YA 1XVYA 2W7YA 2FIXA 4MX6A 1FTKA 1SI1A 1LCFA 5KCJA 1OLAA 2HXWA 4N8GA 4ZEFA 1EH3A 2OWTA 1MY0A 2R9JA 5AA1A 4P8BA 1K9ZA 3PPQA 1CB6A 1FPLA 5FHMA 4X8RA 2DVCA 1OVBA 2A5SA 1POY1 3A29A 1B9JA 4BDLA 3IAZA 2ZNUA 2O69A 3VVFA 5K2YA 4N07A 4OYVA 1Y9UA 1B05A 1NL5A 4O7MA 1P1UA 3V5AA 5CM6A 1O7TA 5CI5A 4OVPA 1B4HA 3CFLA 1FSAA 3EQ1A 1A7LA 3PUZE 1B6HA 1FQBA 1FBHA 1QUIA 1URGA 3H06B 3O6HA 4LZ8A 4U21A 4ELRA 2CEXA 3VVEA 5TPAA 4IO4A 3U92A 2V3TA 4MNCA 4PFUA 4F3BA 2QVRA 4ELOA 1DK4A 3A3UA 4O7IA 2X26A 3LSFB 4R9FA 2WX9A 3H3GA 1USYE 2GHBA 4F2QA 2FNCA 1CNQA 1MXXA 1DMBA 1Y20A 1LAXA 3ROJA 4H5FA 4ZS9A 3KOTA 1P1NA 4Z7EA 1MH4A 1Q35A 3BKIB 3TCHA 2OPDA 3MVZA 3TQLA 1RDXA 3CHGA 4PDDA 1P99A 1ZU0A 3OD7A 4NF6A 4OEVA 3S4UA 3Q26A 1OQHA 2VPNA 4HS7A 1D9YA 2Y7WA 4JWXA 3K6XA 4XIGQ 1MPBA 3U65A 1OVTA 2PCRA 5EQ7A 1FTMA 2ZZWA 4P0GA 2OK2A 2HEUA 5AA3A 4GOTA 2RKMA 1IXIA 2VOZA 2Y7IA 1RYXA 1JVXA 1B3FA 3JV9A 4Q5TA 3FASA 2F35A 3LUZA 4R6HA 2KLFA 4NF8A 4IGTA 2XXQA 1ZLQA 3RYDA 3KN8A 2QVVA 2DOJA 2DWJA 5DVIA 4GX6A 4QRZA 5CMMA 3SERA 4RNSA 1R6ZA 1FBPA 4DI3D 2R6GE 1MG1A 5KZTA 4MF3A 4ZDMA 2RC9A 4POXA 4KI0E 1FBEA 5DVJA 1P1WA 3K1PA 5LDZA 3PUVE 1B3GA 1GR2A 1IMDA 4ECFA 3MVWA 4H8JA 4WKMA 2OWSA 2OBGA 1TWYA 4HXVA 1LAFE 3O28A 4FEDA 2Q9TA 3K1NA 4PE5B 1SVXB 1B3LA 2FBPA 4HTGA 1MY1A 2B4MA 4JSDA 1PB7A 4GBVA 3PMWA 1QW0A 3MVXA 4TQUQ 4X1BA 1GGGA 2F78A 5ET6A 4M1VA 2IA4A 1UIUA 2XX7A 3HFUA 1WODA 3TEPA 2UYEA 5DEXA 4U1OA 5FHNA 4OETA 1FBFA 4N91A 4N17A 2XXUA 3MP8A 2REGA 4NWDA 3RUMA 1QULA 4N15A 3DM0A 1H45A 4RK9A 3E9XA 1LFHA 3GLBA 1N7WA 2X7QA 4F39A 4OVRA 4PFWA 4I40A 1KA1A 1NV0A 4QBAA 4NMYA 4O8MA 5F24A 4GIZA 4YZZA 1WDNA 4AS5A 4H6DA 1B3EA 1ANFA 2OJTA 4JBZA 3EHUA 4H65A 1D9QA 4ZE8A 4MIJA 2Y7KA 5KCJB 4P1EA 2DE2A 4DZ1A 4I1DA 4MLVA 2V4CA 1N04A 4YKPA 4QXDA 1IXHA 4P3LA 4KXPA 5F7VA 3C31A 1PBPA 1LBBA 1PB8A 1Q9DA 4Q0CA 2DE3A 1ZTYA 1FTOA 2DSFA 1QJMA 4JVDA 3TTNA 4G2ZA 3MUQA 4HCYA 3H7MA 5J16A 3U8QA 1UIVA 1R9QA 3PGFA 1US5A 5CMKA 1KZ8A 2OWZA 3Q25A 4Q8RA 3UGWA 3K1MA 4YICA 3OO8A 4U4SA 1TFDA 5TPAB 2OLBA 1R1NA 2DVZA 1PC3A 4GXAA 1LEVA 4JWOA 1INPA 3B6TA 1JNFA 4P47A 3JYRA 1IIWA 1HSJA 4DXUA 3S9LC 2CZIA 1PBQA 4ISUA 5JEIA 1Y3QA 3FGSA 1M5BA 3CR9A 3IO4A 3HN0A 3S9MC 4F29A 4NGUA 4P0IA 4EXLA 4G77A 4PFIA 1IMCA 3D1RA 1MM7A 1LB8A 2KR0A 4H5GA 5HBCA 3UORA 5AA2A 2G29A 1A40A 5IGAA 4NF6B 3OEMA 4RYAA 2Q8MA 1LBYA 2FYIA 4KCCA 3K01A 3L6GA 1RDYA 3E79A 4PGNA 2ZYOA 1B0LA 1Y4CA 4R74A 2VPOA 1IITA 3S9NC 3ZKLA 4O3CA 3OOAA 1O64A 4G68A 1M5FA 2NUVA 4F3PA 4F3GA 1MQGA 4MAGA 2V25A 3ECRA 2RINA 5ET8A 4NF8B 1IMFA 1MPCA 5I5PA 3C33A 1AWBA 5T3JA 1JW5A 1IEJA 4PAFA 1L5TA 2REJA 4XTCQ 1FRPA 4EUOA 3WAEA 3LBSA 4WEDA 3PU5A 3G3FA 3CSBA 4FJPA 3TTRA 2Q74A 2RF1A 3DP4A 2XXHA 3VLUA 4PFBA 2ANJA 1B58A 1A8EA 3TFLA 2I58A 1H44A 4P56A 1P1QA 3K2DA 3OO6A 4JXIA 3E13X 4POWA 3AXFA 3U1OA 2XWKA 1B1HA 4G8MA 4FAJA 3KGCA 3OO7A 5LTCA 1SYHA 4F1UA 4C1TA 1ZJLA 3IJOB 3LSWA 2H25A 1TFAA 3ILUB 5CMCA 3A3CA 3KC1A 1B4ZA 4MNPA 3R26A 1FJ6A 2VT5A 1AMFA 5A5XA 4XXUA 3K4UA 1NUXA 1SD3A 4IO6A 3W15C 1LSTA 2CMOA 5DEXB 4EF2A 4I3EA 4O94A 4X48A 2GRVA 1MY2A 5IZ1A 4NQ8A 4R2FA 3TTMA 1PB9A 1ZBMA 1NUYA 5EQ9A 1US4A 1MQIA 1NUWA 3W9WA 3UN6A 4GVOA 4GWXA 3N26A 4HE2A 2P1SA 4IB2A 2OZZA 2RCAA 2XWIA 4MBPA 3S9EA 3MPKA 3FJMA 4OXVA 4OVSA 1JETA 5L8DA 4JSOA 2DS9A 4YAHX 2ZNSA 3T93B 3UIFA 2VD2A 3RNNA 5IAIA 4HE0A 3U72A 3OO9A 2FVZA 3MAMA 1CE2A 3KEIA 2NVUB 1YXIA 2H98A 4R75A 3K00A 4PCDA 1MH3A 2I4BA 3RT8A 5I56A 1H43A 1MXYA 4LONB 2ZMBA 3VFJA 2H4IA 4NF5A 4KQPA 4NF0A 3V8XB 1MXZA 1UTBA 3R6UA 2O51A 3L6HA 1ATGA 1B7ZA 3KSJA 4ESXA 2B4LA 4AS4A 3RTFB 3N6TA 5AA2D 1NV2A 4QFPA 1Y4TA 4YMAA 4QSDA 4GRKA 3RPWA 2DXRA 4OVJA 1N3WA 3TCGA 1MPDA 1B3HA 2FA7A 3MP6A 2CZKA 2HXRA 3F11A 4YKJA 2ABHA 4OESA 1XVXA 4KYEA 2YJPA 2HAVA 1K9YA 1FPBA 2B3BA 1B52A 3FXQA 4AQ4A 3M3LA 5BWJA 4F3SA 3ZS6A 4GWWA 2F8DA 3PUXE 1OMPA 1NV6A 3C34A 3HHFA 3MYUA 3T9VA 2F7AA 2RC8A 1IZ1A 4EQBA 5EHSA 3C9HA 2O6AA 4KHZE 1IUDA 3VE1B 2P0SA 5AA4A 4M4GA 4MH5A 2O1LA 2I6EA 1B0HA 2GFEA 3KOSA 3IL1B 5I84A 4NEDA 5I57A 2AL4A 3RQTA 4IY5A 2ZZXA 2XD2A 3T66A 2E1SA 5AA2B 4G61A 5B7DA 4XFEA 2ZZVA 1LBWA 4BDNA 2ZYNA 5H8NA 3FUZA 4LZ5A 5CMBA 2UVJA 1YAEA 2Z8FA 1BK4A 4IO5A 1AH5A 4WXJA 3O66A 4PF8A 1SI0A 5ITPA 3PD9A 4BDMA 1II5A 4EDPA 1S50A 4G68B 4P11A 4DXBA 2HPGA 4N81A 5I59B 1QUJA 3R7XA 5ET5A 2F34A 3ODBA 4OWDA 4OA4A 2WBBA 2NXOA 4GWYA 3MC2A 2PT1A 2XX9A 1DTGA 2QS4A 2HQ0A 3FIRA 1KWHA 3VXBA 3ISPA 1UQWA 2NOOA 1M5DA 1XI6A 4KFQA 5I2KA 2Y5LA 4F1YA 2BJJX 3G7WA 4H1XA 4GFRA 1DBZA 3USDA 2QVUA 4RK2A 3IOUA 5EHMA 1B40A 3OXNA 4LVQA 4TLMB 5I58A 4THIA 2XWOA 4XKPA 1DPEA 4PAIA 3T96B 2CEYA 3FXBA 3SZPA 4LA9A 3QK6A 3MW0A 2XXVA 3H4ZA 4GL0A 1DTZA 3I3VA 2UVGA 1NV1A 3LV0A 1BKAA 1FCKA 3ZSFA 3Q29A 4ZECA 1NNFA 1BP5A 5EQ8A 2MKZA 1VE4A 4F2OA 3TDJA 3N5LA 4GBWA 2XXWA 3PPOA 3T22A 5A5XB 1MS7A 3PMXA 3EPEA 3ONMA
chains in the Genus database with same CATH topology
1NUZA 4PFIA 1IMCA 4MJOA 4X04A 3D1RA 2XXKA 4NAPA 1FTAA 1RDZA 3NOHA 2KR0A 1FPFA 4GWSA 5DW8A 2F3DA 1IMAA 1FBGA 5IGAA 4NX1A 2Q8MA 1LBYA 2PFYA 1IMEA 1KA0A 3E78A 2WYKA 4OVTA 1RDYA 3E79A 4PGNA 2WEFA 4I3YA 4PAKA 2FIXA 4MX6A 2XA5A 2VPOA 4N8GA 1FBCA 4P8BA 3RPLB 1K9ZA 4NN3A 4MAGA 5ET8A 1FPLA 1IMFA 4H45A 4X8RA 5I5PA 1AWBA 5T3JA 3A29A 1NV3A 4PAFA 1QGXA 1FJ9A 1FRPA 1NV5A 3BIGA 1LBVA 2Q74A 1EYJA 4O7MA 5CM6A 4PFBA 4OVPA 1DCUA 3T1BA 1FSAA 4P56A 4MMPA 1FBHA 2CEXA 2XWKA 4MNCA 5LTCA 4F1UA 4GX4A 2QVRA 1DK4A 4O7IA 2WX9A 3KC1A 4MNPA 1FJ6A 2VT5A 3IFCA 1CNQA 4IR8A 1NUXA 3ROJA 1NV4A 1LBXA 2P3NA 4I3EA 1IMBA 4O94A 1RDXA 3FBPA 2GQ1A 3CHGA 3IFAA 4PDDA 5IZ1A 4NQ8A 2PFZA 1NUYA 5EQ9A 2L5VA 1NUWA 4OVQA 2QFLA 3W9WA 2VPNA 4F1VA 3U65A 4GWXA 2PCRA 5EQ7A 4HE2A 2ZZWA 2XWIA 1NV7A 4OVSA 5IZ3B 2DDKA 3B50A 1FPKA 5J1DA 3RPLA 4XF5A 3LUZA 4HE0A 5FBPA 2FVZA 2HHMA 4MNIA 3T0JA 3RYDA 4P1LA 1YXIA 2DE4A 4PCDA 2QVVA 4F19A 4JVCA 4PDHA 4GX6A 3MSTA 1FBPA 4DI3D 4NF0A 2FHYA 1FPDA 2F5XA 4MCOA 3B8BA 1FBEA 2B4LA 4AS4A 2OX3A 5LDZA 1NV2A 1YZ0A 1EYIA 1EYKA 1IMDA 4GX3A 2HZLA 4HXVA 2CZKA 4JVIA 2HXRA 2Q9TA 2FBPA 2B4MA 4NG7A 4GBVA 1K9YA 1FPBA 4HE1A 5ET6A 4M1VA 2KQZA 1FBDA 4PF6A 2V3QA 4GWWA 3HFUA 1FPJA 4LN5A 4PE3A 1G0HA 1NV6A 2CZHA 3MYUA 3KC0A 4MEVA 1FBFA 4N91A 4N17A 5A5LA 5ET7A 4HCWA 5EQAA 4N15A 5EYGA 1FPIA 4OVRA 4PBHA 4PFRA 4UABA 2ZZXA 4PBQA 4H46A 1FPEA 4G61A 4XFEA 4I40A 1KA1A 2ZZVA 1LBZA 1LBWA 1NV0A 4N4UA 4QBAA 5JK4A 5ESYA 4O8MA 5IZ3A 1BK4A 5F24A 3PTYA 4PC9A 4F18A 4PF8A 3KBZA 4YZZA 2Y5KA 4AS5A 2R8TA 4GWUA 1D9QA 1VDWA 4MIJA 4P1EA 2P3VA 2DE2A 2HPGA 4N81A 2V4CA 2WYPA 5ET5A 4N6KA 4QXDA 4P3LA 1NI9A 3GYYA 4OA4A 4KXPA 2WBBA 2XWVA 4OANA 3W9VA 5EYHA 4GWYA 1Q9DA 4MHFA 2DE3A 1FPGA 3ISPA 3BIHA 1XI6A 4JVDA 4PTKA 4N6DA 4PGPA 4DI4B 2BJIA 4N8YA 1SPIA 4HCYA 2Y5LA 5J16A 5IM2A 2FIEA 2F3BA 1DBZA 4NHBA 3QMFA 2HZKA 2QVUA 1KZ8A 2OWZA 4XEQA 2XWOA 4YICA 1YYZA 4PAIA 2CEYA 3FXBA 3SZPA 1JP4A 4FBPA 1G0IA 1NV1A 3LV0A 2DVZA 2JJKA 4X9TA 1LEVA 5IZZA 1INPA 4P47A 2CZIA 2WBDA 4PETA 5I7IA 5EQ8A 2MKZA 4GWZA 5I3SA 2QPQA 4GBWA 4P9KA 3EKIA 4NGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBP A;  1NUZ A;  3KBZ A;  1IMC A;  4MJO A;  2Y5K A;  4AS5 A;  3D1R A;  4GX4 A;  2QVR A;  1DK4 A;  2R8T A;  1FTA A;  1FPD A;  1RDZ A;  2FHY A;  4GWU A;  4O7I A;  1D9Q A;  1FPF A;  1VDW A;  4GWS A;  5DW8 A;  2F3D A;  3KC1 A;  1IMA A;  2P3V A;  3B8B A;  1FJ6 A;  2VT5 A;  1FBE A;  1FBG A;  4N81 A;  4AS4 A;  3IFC A;  1CNQ A;  2OX3 A;  5ET5 A;  2Q8M A;  1LBY A;  4QXD A;  5LDZ A;  1NI9 A;  1IME A;  4IR8 A;  1NUX A;  1NV2 A;  1KA0 A;  4KXP A;  1NV4 A;  2WBB A;  3ROJ A;  1YZ0 A;  5EYH A;  4GWY A;  1RDY A;  1EYI A;  1Q9D A;  1EYK A;  2WEF A;  1IMD A;  1LBX A;  4I3Y A;  4GX3 A;  1FPG A;  4HXV A;  2FIX A;  2CZK A;  2P3N A;  4I3E A;  1IMB A;  1RDX A;  3BIH A;  3FBP A;  2GQ1 A;  3IFA A;  1XI6 A;  4PTK A;  5IZ1 A;  2FBP A;  2BJI A;  1FBC A;  1SPI A;  2Y5L A;  4GBV A;  5J16 A;  1NUY A;  2FIE A;  2F3B A;  1K9Y A;  1FPB A;  1DBZ A;  5EQ9 A;  1K9Z A;  3RPL B;  4HE1 A;  5ET6 A;  1NUW A;  2QFL A;  3QMF A;  1FBD A;  2QVU A;  1KZ8 A;  2OWZ A;  5ET8 A;  1FPL A;  1IMF A;  4GWW A;  4H45 A;  1FPJ A;  4GWX A;  1AWB A;  5T3J A;  2PCR A;  1G0H A;  1NV6 A;  5EQ7 A;  2CZH A;  4HE2 A;  3KC0 A;  1YYZ A;  1FBF A;  3A29 A;  1NV3 A;  1NV7 A;  1QGX A;  1FJ9 A;  1JP4 A;  5A5L A;  5IZ3 B;  1FRP A;  4FBP A;  1NV5 A;  2DDK A;  5ET7 A;  3BIG A;  1LBV A;  1G0I A;  1FPK A;  2Q74 A;  1NV1 A;  1EYJ A;  3LV0 A;  5EQA A;  3RPL A;  2JJK A;  3LUZ A;  5EYG A;  1LEV A;  1FPI A;  1INP A;  4HE0 A;  1DCU A;  5FBP A;  1FSA A;  2FVZ A;  4H46 A;  2CZI A;  1FPE A;  2HHM A;  2WBD A;  5EQ8 A;  4G61 A;  3T0J A;  3RYD A;  4I40 A;  4GWZ A;  1KA1 A;  5I3S A;  1YXI A;  1LBZ A;  1LBW A;  1FBH A;  4GBW A;  1NV0 A;  2QVV A;  5ESY A;  5IZ3 A;  4GX6 A;  1BK4 A;  5F24 A; 
#chains in the Genus database with same CATH topology
 3UA8 A;  4U1Z A;  4FOR A;  4OZ9 A;  4ND9 A;  4X04 A;  1M5C A;  1XT8 A;  3K02 A;  1FPF A;  4GWS A;  3RTW B;  4ESW A;  1A55 A;  2OPE A;  2V84 A;  1IMA A;  3TTL A;  2F6G A;  3D4C A;  5KDT A;  1FBG A;  2PMS A;  1HSE A;  1YPN A;  3KFM A;  3KSX A;  3MVY A;  1B1X A;  1IME A;  2IEE A;  3PUW E;  1KA0 A;  3VDF A;  1LCT A;  5TP9 B;  2Q88 A;  2WEF A;  2YLN A;  4KR5 A;  3RT6 B;  2ZNT A;  4Q30 B;  1LAH E;  4FEB A;  5H8Q A;  2I0C A;  2XA5 A;  4QSE A;  1A99 A;  2XXY A;  3H6W A;  1FBC A;  3HST A;  2Q2C A;  4NN3 A;  2H99 A;  3QXM A;  1EZ9 A;  3UK4 A;  4AB5 A;  2O84 X;  1IXG A;  1ZMG A;  3MZ1 A;  3O97 A;  4OHN A;  1QGX A;  4N13 A;  3HPI A;  5I56 B;  1Z7M E;  3HHG A;  4R73 A;  3H6V A;  3BIG A;  1EYJ A;  4NF5 B;  2LAO A;  1FTL A;  1LFG A;  3ZKK A;  1VFD A;  1UTB B;  1DCU A;  2VD3 A;  3GBA A;  3VXC A;  2D5W A;  1YTV A;  1M5E A;  4QSC A;  5CRY A;  4OFL A;  5H8F A;  2ESN A;  3CRB A;  4MMP A;  3O6G A;  1MY4 A;  4F22 A;  3C32 A;  2GHA A;  4C1U A;  4ZZA A;  1I6B A;  1D4N A;  1F9B A;  2DWI A;  1B2H A;  4N6P A;  2AYS A;  1XS5 A;  2H5Y A;  1FW0 A;  5K2X A;  1ZKB A;  3IB2 A;  2QMX A;  1GV8 A;  3KBR A;  2O7I A;  3KG2 A;  4XKN A;  1PEB A;  3IFC A;  2HCA A;  3C36 A;  1Q1K A;  2XD3 A;  3PUY E;  2AIX A;  2ZYM A;  3BFU A;  4EF1 A;  4RPO A;  1A8F A;  4YMB A;  2CZL A;  5CC2 A;  4E0X A;  1LBX A;  1IMB A;  2GQ1 A;  3IFA A;  2A5T A;  3LUY A;  3PMV A;  3TQW A;  3P7I A;  2H9B A;  2PFZ A;  5HM4 B;  1AL3 A;  2Z22 A;  2O68 A;  3O9P A;  2P2A A;  2L5V A;  2QFL A;  4FIM A;  4O3B A;  1PDA A;  4F1V A;  2O1M A;  5I57 B;  4F31 B;  4G68 C;  1IQ7 A;  4FEC A;  1IXC A;  1I6Q A;  2I48 A;  1NV7 A;  2UYF A;  5H8N B;  3VLW A;  2XXI A;  1NH7 A;  2DDK A;  1AIV A;  2WKY A;  3B50 A;  3G3G A;  1FPK A;  1R9L A;  4IY6 A;  5J1D A;  3RPL A;  4O3A A;  4U23 A;  3K6V A;  2QSX A;  4EQ7 A;  3T0J A;  1GTK A;  2XXP A;  1O63 A;  1OQG A;  2DE4 A;  2HAU A;  4NWC A;  4JVC A;  2Y84 A;  3C35 A;  1T0K A;  1MQJ A;  1LGB C;  5ICQ A;  3GZG A;  1SQY A;  3OSQ A;  1NKX A;  3G3K A;  3SEX A;  1JW4 A;  3E4R A;  2F5X A;  4RY1 A;  3IJX B;  5I2K B;  2G93 A;  4H67 A;  2ONR A;  3LR1 A;  3FJG A;  1I69 A;  4PFT A;  1YZ0 A;  5DYH A;  1B7H A;  1XC1 A;  1JQF A;  2HZL A;  3OEL A;  5I58 B;  3H03 A;  5L9M A;  3DP6 A;  4R2B A;  4ZEB A;  3B6W A;  4NG7 A;  1EZP A;  4DCY A;  1URS A;  3H6U A;  2KQZ A;  4PF6 A;  4QF9 A;  3MWB A;  3FVN A;  4R6Y A;  4LN5 A;  3DEL B;  3O2A A;  4PE3 A;  4LAT A;  3TEL A;  1G0H A;  2Z8D A;  2CZH A;  5AE4 A;  3TPA A;  4MEV A;  1AOV A;  3ILT B;  2Y7R A;  4I62 A;  5LOM A;  1N76 A;  4QFN A;  5A5L A;  3QSL A;  4FAT A;  1FQF A;  3Q28 A;  1QKB A;  1SYI A;  3I5O A;  3IOV A;  3OEK A;  4LZ7 A;  5EQA A;  3SDF A;  5JTY A;  1S7Y A;  3EN3 A;  3EHS A;  4BLA A;  3EF7 A;  4DE8 A;  3HO7 A;  4PBH A;  2ZYK A;  4UAB A;  1BTJ A;  4YKI A;  3K0V A;  4H8I A;  5KDT B;  2R71 A;  5FTH A;  2XXT A;  3SEU A;  3Q27 A;  5JK4 A;  5DTB A;  1FTJ A;  5IZ3 A;  1LB9 A;  2XXX A;  3RN8 A;  2QS2 A;  3PTY A;  3MPL A;  4PC9 A;  4UA8 A;  1JEU A;  3UP9 A;  4YKK A;  1NFT A;  2ZXT A;  2Y5K A;  4QFO A;  5ISU A;  1VSO A;  3MQ9 A;  3TOD A;  1USY H;  4GWU A;  3VV5 A;  1H76 A;  3D4G A;  5H8Q B;  1VDW A;  1MQH A;  2I4C A;  2P3V A;  2QL3 A;  2WYP A;  3G3H A;  3H6T A;  1NI9 A;  3GYY A;  2XWV A;  3W9V A;  5EYH A;  1TXF A;  3FVG A;  4ZEI A;  4MHF A;  1FPG A;  1B7U A;  1TT1 A;  4LQ5 A;  3EHT A;  1I6A A;  3BBR A;  1Y3N A;  4OFO A;  4DI4 B;  2BJI A;  2YPN A;  1SPI A;  4N8Y A;  2FIE A;  2F3B A;  1Y1M A;  4NHB A;  3QMF A;  5ITO A;  2VHA A;  4X1D A;  4GLI A;  4KYD A;  4XEQ A;  5H8F B;  3HV1 A;  2RC7 A;  3U94 A;  4RJZ A;  5ICT A;  1MDP 1;  2QS3 A;  1JP4 A;  1LLS A;  5FTI A;  4FBP A;  4QFL A;  1JEV A;  2JJK A;  1NH8 A;  4X9T A;  4DXC A;  4OER A;  5IZZ A;  1B32 A;  4ONY A;  4DLD A;  3N94 A;  2WBD A;  4PET A;  5I7I A;  4AB6 A;  4FE8 A;  3SET A;  5I3S A;  3JZJ A;  2B3F A;  3RLF E;  4GWO A;  2I3V A;  3RY3 A;  4RXL A;  1D9V A;  3TZA A;  3TYH A;  1LAG E;  3B6Q A;  3TMG A;  3I6V A;  3QYT A;  1NUZ A;  1POT A;  3CVG A;  3QIM A;  2Y7P A;  4YB6 A;  1FTA A;  3NOH A;  1B46 A;  2A5T B;  3OMB A;  2M8C A;  4IO3 A;  2D21 A;  1SW2 A;  4KPT A;  5I2N A;  5ELV A;  4KCD A;  3B7D A;  3FVO A;  3E78 A;  1UTH A;  1N0T A;  3PPN A;  4GQO A;  4PAK A;  1B51 A;  4OQO A;  2PT2 A;  3IOR A;  1XOC A;  3FZV A;  1N7X A;  1DSN A;  3FV2 A;  3KN7 A;  2UVI A;  1Y3P A;  3LC8 A;  3HCQ A;  3U93 A;  5H8H A;  1D3K A;  3RPL B;  4NTL A;  4BDR A;  4H45 A;  4WEP A;  2I49 A;  4TOZ A;  3LSL A;  4C0R A;  4YB7 A;  3PPR A;  4OEU A;  4XKR A;  1NV3 A;  1FJ9 A;  3T9U A;  4IO7 A;  1FQC A;  2GH9 A;  1HSL A;  3SES A;  1OIB A;  1NV5 A;  4PP0 A;  2QMW A;  1LBV A;  4H0W A;  4Z0I A;  5BUU A;  5L9O A;  4G4P A;  4PFY A;  3IB1 A;  3BFT A;  4ZZE A;  3T1B A;  3DP8 A;  2DXY A;  4ELQ A;  1ELJ A;  1S9T A;  3V83 A;  3FXR A;  4LQ2 A;  2RCB A;  4G8N A;  3TCF A;  1QKA A;  2XHD A;  3VLV A;  3S2V A;  2F6P A;  3LSX A;  1OLC A;  4KYS A;  4GX4 A;  3CG1 A;  3TAJ A;  1SBP A;  4K3F A;  5H8S A;  3CI8 A;  3PV0 E;  4MLQ A;  3CFX A;  1SDX A;  4NF4 A;  3IR1 A;  3QUF A;  1N84 A;  4IR8 A;  1NV4 A;  1MDQ A;  1P1O A;  3CSG A;  4U22 A;  2DP8 A;  3KJ7 A;  4BDQ A;  3KJT A;  3GXA A;  3M3F A;  2P3N A;  1JVY A;  2PYY A;  4JB7 A;  2Q2A A;  3FBP A;  1N3X A;  4QHQ A;  3KZG A;  4OMB A;  3IOT A;  3MBP A;  3PD8 A;  5JTY B;  2XXR A;  2Q89 A;  4OVQ A;  1MXW A;  1VR5 A;  3OEN A;  3TTK A;  3SKP A;  3GBB A;  2F36 A;  1J1N A;  1LFI A;  4R6K A;  5DT6 A;  5FHO A;  4YB5 A;  3TKD A;  4I8C A;  5IZ3 B;  4LUB A;  1FQA A;  1RYO A;  2HFB A;  1RKM A;  4XF5 A;  2DYX A;  4JWY A;  3WAF A;  5FBP A;  2VP1 A;  4LP2 B;  2HHM A;  3IK6 B;  4DDD A;  4MNI A;  4P1L A;  2QJE A;  5TU0 A;  3MZB A;  5CBR A;  4F19 A;  4PDH A;  3MST A;  3FVK A;  4L17 A;  5HPQ A;  3KN3 A;  2QS1 A;  4BDO A;  5L9S A;  2XX8 A;  1GVC A;  2FHY A;  1FPD A;  1FQD A;  4MFI A;  1BLF A;  1LBC A;  1WVJ A;  3E3K A;  4MCO A;  5CBS A;  3B8B A;  2V3U A;  2DWA A;  3G3J A;  1YCJ A;  3CFZ A;  2OX3 A;  4GD5 A;  2X7P A;  2AL5 A;  2OCU A;  3FXU A;  4OEN A;  3IO6 A;  1EYI A;  1EYK A;  2Z8E A;  4GX3 A;  4JVI A;  2QRY A;  4U2R A;  4RPN A;  1NNK A;  4R9G A;  1NNP A;  3PPP A;  4HE1 A;  4HW8 A;  4UAC A;  1FBD A;  2Z23 A;  2V3Q A;  4I9D A;  3SEV A;  4GL8 A;  1FPJ A;  1NMU A;  3MJN A;  1H3D A;  2F7C A;  4JDF A;  3KC0 A;  1DPP A;  1SW1 A;  3RGY A;  5AA4 B;  2ONS A;  5ET7 A;  4HCW A;  4OTE A;  3OSR A;  2Q8J A;  5EYG A;  3CIJ A;  1FPI A;  4TLL B;  2B65 A;  1SW5 A;  4PFR A;  4PBQ A;  4H46 A;  1FPE A;  1SW4 A;  4QFK A;  2UVH A;  2NWJ A;  1LBZ A;  2F97 A;  4ZE9 A;  1MY3 A;  2ALU A;  5I2N B;  4N4U A;  4GF8 A;  5ESY A;  1UTH B;  3IB0 A;  4F18 A;  3O6I A;  3KBZ A;  2I0B A;  1MQD A;  4YU0 A;  2R8T A;  3QAX A;  1QUK A;  1FQE A;  3QUJ A;  5DVF A;  2O7U A;  2PX1 A;  4PQJ A;  5I59 A;  5IKB A;  3TUS A;  3IX1 A;  5H8H B;  4N6K A;  5F1Q A;  3V89 B;  4U4X A;  1BIY A;  3FV1 A;  1MXU A;  3CG3 A;  3DLN A;  2E0S A;  3FD3 A;  1B5H A;  2PBW A;  4OAN A;  2V93 A;  4ELP A;  1B5I A;  3T9X B;  3BIH A;  4RA1 A;  3M8U A;  4PTK A;  4N6D A;  4PGP A;  1Y1Z A;  1MM6 A;  2ONK E;  4GXS B;  5IM2 A;  3C4M A;  2F7B A;  1DOT A;  2HZK A;  4NE4 A;  4R72 A;  1EZO A;  1YYZ A;  1XHY A;  2THI A;  3SEW A;  1B5J A;  3SEY A;  1QVS A;  1NNT A;  1VFE A;  2DQV A;  1G0I A;  1EU8 A;  5M2V A;  5EYF A;  3M3K A;  4DCX A;  3T9H B;  4KD5 A;  3IOW A;  4GWZ A;  2QPQ A;  4P9K A;  3EKI A;  4NF4 B;  4XKQ A;  1MXV A;  4EXK A;  2DWH A;  4IGR A;  4G8H A;  4ZEK A;  3A09 A;  1URD A;  5B70 A;  3O29 A;  4E0W A;  1A54 A;  3FJ7 A;  1JW1 A;  4MJO A;  2I3W A;  2XXK A;  3MP1 A;  4NAP A;  4EQ9 A;  1RDZ A;  3G3I A;  2UXA A;  4OFJ A;  5DW8 A;  2F3D A;  4DIG A;  2PVU A;  3FAT A;  4NX1 A;  1MRP A;  3THI A;  1ZIU A;  1Z7N E;  3VVD A;  2PFY A;  3N6U A;  2VGQ A;  4IO2 A;  3K6W A;  2D3I A;  4ZED A;  2WYK A;  5TP9 A;  3K6U A;  3MZ9 A;  4OVT A;  4I3Y A;  1XVY A;  2W7Y A;  2FIX A;  4MX6 A;  1FTK A;  1SI1 A;  1LCF A;  5KCJ A;  1OLA A;  2HXW A;  4N8G A;  4ZEF A;  1EH3 A;  2OWT A;  1MY0 A;  2R9J A;  5AA1 A;  4P8B A;  1K9Z A;  3PPQ A;  1CB6 A;  1FPL A;  5FHM A;  4X8R A;  2DVC A;  1OVB A;  2A5S A;  1POY 1;  3A29 A;  1B9J A;  4BDL A;  3IAZ A;  2ZNU A;  2O69 A;  3VVF A;  5K2Y A;  4N07 A;  4OYV A;  1Y9U A;  1B05 A;  1NL5 A;  4O7M A;  1P1U A;  3V5A A;  5CM6 A;  1O7T A;  5CI5 A;  4OVP A;  1B4H A;  3CFL A;  1FSA A;  3EQ1 A;  1A7L A;  3PUZ E;  1B6H A;  1FQB A;  1FBH A;  1QUI A;  1URG A;  3H06 B;  3O6H A;  4LZ8 A;  4U21 A;  4ELR A;  2CEX A;  3VVE A;  5TPA A;  4IO4 A;  3U92 A;  2V3T A;  4MNC A;  4PFU A;  4F3B A;  2QVR A;  4ELO A;  1DK4 A;  3A3U A;  4O7I A;  2X26 A;  3LSF B;  4R9F A;  2WX9 A;  3H3G A;  1USY E;  2GHB A;  4F2Q A;  2FNC A;  1CNQ A;  1MXX A;  1DMB A;  1Y20 A;  1LAX A;  3ROJ A;  4H5F A;  4ZS9 A;  3KOT A;  1P1N A;  4Z7E A;  1MH4 A;  1Q35 A;  3BKI B;  3TCH A;  2OPD A;  3MVZ A;  3TQL A;  1RDX A;  3CHG A;  4PDD A;  1P99 A;  1ZU0 A;  3OD7 A;  4NF6 A;  4OEV A;  3S4U A;  3Q26 A;  1OQH A;  2VPN A;  4HS7 A;  1D9Y A;  2Y7W A;  4JWX A;  3K6X A;  4XIG Q;  1MPB A;  3U65 A;  1OVT A;  2PCR A;  5EQ7 A;  1FTM A;  2ZZW A;  4P0G A;  2OK2 A;  2HEU A;  5AA3 A;  4GOT A;  2RKM A;  1IXI A;  2VOZ A;  2Y7I A;  1RYX A;  1JVX A;  1B3F A;  3JV9 A;  4Q5T A;  3FAS A;  2F35 A;  3LUZ A;  4R6H A;  2KLF A;  4NF8 A;  4IGT A;  2XXQ A;  1ZLQ A;  3RYD A;  3KN8 A;  2QVV A;  2DOJ A;  2DWJ A;  5DVI A;  4GX6 A;  4QRZ A;  5CMM A;  3SER A;  4RNS A;  1R6Z A;  1FBP A;  4DI3 D;  2R6G E;  1MG1 A;  5KZT A;  4MF3 A;  4ZDM A;  2RC9 A;  4POX A;  4KI0 E;  1FBE A;  5DVJ A;  1P1W A;  3K1P A;  5LDZ A;  3PUV E;  1B3G A;  1GR2 A;  1IMD A;  4ECF A;  3MVW A;  4H8J A;  4WKM A;  2OWS A;  2OBG A;  1TWY A;  4HXV A;  1LAF E;  3O28 A;  4FED A;  2Q9T A;  3K1N A;  4PE5 B;  1SVX B;  1B3L A;  2FBP A;  4HTG A;  1MY1 A;  2B4M A;  4JSD A;  1PB7 A;  4GBV A;  3PMW A;  1QW0 A;  3MVX A;  4TQU Q;  4X1B A;  1GGG A;  2F78 A;  5ET6 A;  4M1V A;  2IA4 A;  1UIU A;  2XX7 A;  3HFU A;  1WOD A;  3TEP A;  2UYE A;  5DEX A;  4U1O A;  5FHN A;  4OET A;  1FBF A;  4N91 A;  4N17 A;  2XXU A;  3MP8 A;  2REG A;  4NWD A;  3RUM A;  1QUL A;  4N15 A;  3DM0 A;  1H45 A;  4RK9 A;  3E9X A;  1LFH A;  3GLB A;  1N7W A;  2X7Q A;  4F39 A;  4OVR A;  4PFW A;  4I40 A;  1KA1 A;  1NV0 A;  4QBA A;  4NMY A;  4O8M A;  5F24 A;  4GIZ A;  4YZZ A;  1WDN A;  4AS5 A;  4H6D A;  1B3E A;  1ANF A;  2OJT A;  4JBZ A;  3EHU A;  4H65 A;  1D9Q A;  4ZE8 A;  4MIJ A;  2Y7K A;  5KCJ B;  4P1E A;  2DE2 A;  4DZ1 A;  4I1D A;  4MLV A;  2V4C A;  1N04 A;  4YKP A;  4QXD A;  1IXH A;  4P3L A;  4KXP A;  5F7V A;  3C31 A;  1PBP A;  1LBB A;  1PB8 A;  1Q9D A;  4Q0C A;  2DE3 A;  1ZTY A;  1FTO A;  2DSF A;  1QJM A;  4JVD A;  3TTN A;  4G2Z A;  3MUQ A;  4HCY A;  3H7M A;  5J16 A;  3U8Q A;  1UIV A;  1R9Q A;  3PGF A;  1US5 A;  5CMK A;  1KZ8 A;  2OWZ A;  3Q25 A;  4Q8R A;  3UGW A;  3K1M A;  4YIC A;  3OO8 A;  4U4S A;  1TFD A;  5TPA B;  2OLB A;  1R1N A;  2DVZ A;  1PC3 A;  4GXA A;  1LEV A;  4JWO A;  1INP A;  3B6T A;  1JNF A;  4P47 A;  3JYR A;  1IIW A;  1HSJ A;  4DXU A;  3S9L C;  2CZI A;  1PBQ A;  4ISU A;  5JEI A;  1Y3Q A;  3FGS A;  1M5B A;  3CR9 A;  3IO4 A;  3HN0 A;  3S9M C;  4F29 A;  4NGU A;  4P0I A;  4EXL A;  4G77 A;  4PFI A;  1IMC A;  3D1R A;  1MM7 A;  1LB8 A;  2KR0 A;  4H5G A;  5HBC A;  3UOR A;  5AA2 A;  2G29 A;  1A40 A;  5IGA A;  4NF6 B;  3OEM A;  4RYA A;  2Q8M A;  1LBY A;  2FYI A;  4KCC A;  3K01 A;  3L6G A;  1RDY A;  3E79 A;  4PGN A;  2ZYO A;  1B0L A;  1Y4C A;  4R74 A;  2VPO A;  1IIT A;  3S9N C;  3ZKL A;  4O3C A;  3OOA A;  1O64 A;  4G68 A;  1M5F A;  2NUV A;  4F3P A;  4F3G A;  1MQG A;  4MAG A;  2V25 A;  3ECR A;  2RIN A;  5ET8 A;  4NF8 B;  1IMF A;  1MPC A;  5I5P A;  3C33 A;  1AWB A;  5T3J A;  1JW5 A;  1IEJ A;  4PAF A;  1L5T A;  2REJ A;  4XTC Q;  1FRP A;  4EUO A;  3WAE A;  3LBS A;  4WED A;  3PU5 A;  3G3F A;  3CSB A;  4FJP A;  3TTR A;  2Q74 A;  2RF1 A;  3DP4 A;  2XXH A;  3VLU A;  4PFB A;  2ANJ A;  1B58 A;  1A8E A;  3TFL A;  2I58 A;  1H44 A;  4P56 A;  1P1Q A;  3K2D A;  3OO6 A;  4JXI A;  3E13 X;  4POW A;  3AXF A;  3U1O A;  2XWK A;  1B1H A;  4G8M A;  4FAJ A;  3KGC A;  3OO7 A;  5LTC A;  1SYH A;  4F1U A;  4C1T A;  1ZJL A;  3IJO B;  3LSW A;  2H25 A;  1TFA A;  3ILU B;  5CMC A;  3A3C A;  3KC1 A;  1B4Z A;  4MNP A;  3R26 A;  1FJ6 A;  2VT5 A;  1AMF A;  5A5X A;  4XXU A;  3K4U A;  1NUX A;  1SD3 A;  4IO6 A;  3W15 C;  1LST A;  2CMO A;  5DEX B;  4EF2 A;  4I3E A;  4O94 A;  4X48 A;  2GRV A;  1MY2 A;  5IZ1 A;  4NQ8 A;  4R2F A;  3TTM A;  1PB9 A;  1ZBM A;  1NUY A;  5EQ9 A;  1US4 A;  1MQI A;  1NUW A;  3W9W A;  3UN6 A;  4GVO A;  4GWX A;  3N26 A;  4HE2 A;  2P1S A;  4IB2 A;  2OZZ A;  2RCA A;  2XWI A;  4MBP A;  3S9E A;  3MPK A;  3FJM A;  4OXV A;  4OVS A;  1JET A;  5L8D A;  4JSO A;  2DS9 A;  4YAH X;  2ZNS A;  3T93 B;  3UIF A;  2VD2 A;  3RNN A;  5IAI A;  4HE0 A;  3U72 A;  3OO9 A;  2FVZ A;  3MAM A;  1CE2 A;  3KEI A;  2NVU B;  1YXI A;  2H98 A;  4R75 A;  3K00 A;  4PCD A;  1MH3 A;  2I4B A;  3RT8 A;  5I56 A;  1H43 A;  1MXY A;  4LON B;  2ZMB A;  3VFJ A;  2H4I A;  4NF5 A;  4KQP A;  4NF0 A;  3V8X B;  1MXZ A;  1UTB A;  3R6U A;  2O51 A;  3L6H A;  1ATG A;  1B7Z A;  3KSJ A;  4ESX A;  2B4L A;  4AS4 A;  3RTF B;  3N6T A;  5AA2 D;  1NV2 A;  4QFP A;  1Y4T A;  4YMA A;  4QSD A;  4GRK A;  3RPW A;  2DXR A;  4OVJ A;  1N3W A;  3TCG A;  1MPD A;  1B3H A;  2FA7 A;  3MP6 A;  2CZK A;  2HXR A;  3F11 A;  4YKJ A;  2ABH A;  4OES A;  1XVX A;  4KYE A;  2YJP A;  2HAV A;  1K9Y A;  1FPB A;  2B3B A;  1B52 A;  3FXQ A;  4AQ4 A;  3M3L A;  5BWJ A;  4F3S A;  3ZS6 A;  4GWW A;  2F8D A;  3PUX E;  1OMP A;  1NV6 A;  3C34 A;  3HHF A;  3MYU A;  3T9V A;  2F7A A;  2RC8 A;  1IZ1 A;  4EQB A;  5EHS A;  3C9H A;  2O6A A;  4KHZ E;  1IUD A;  3VE1 B;  2P0S A;  5AA4 A;  4M4G A;  4MH5 A;  2O1L A;  2I6E A;  1B0H A;  2GFE A;  3KOS A;  3IL1 B;  5I84 A;  4NED A;  5I57 A;  2AL4 A;  3RQT A;  4IY5 A;  2ZZX A;  2XD2 A;  3T66 A;  2E1S A;  5AA2 B;  4G61 A;  5B7D A;  4XFE A;  2ZZV A;  1LBW A;  4BDN A;  2ZYN A;  5H8N A;  3FUZ A;  4LZ5 A;  5CMB A;  2UVJ A;  1YAE A;  2Z8F A;  1BK4 A;  4IO5 A;  1AH5 A;  4WXJ A;  3O66 A;  4PF8 A;  1SI0 A;  5ITP A;  3PD9 A;  4BDM A;  1II5 A;  4EDP A;  1S50 A;  4G68 B;  4P11 A;  4DXB A;  2HPG A;  4N81 A;  5I59 B;  1QUJ A;  3R7X A;  5ET5 A;  2F34 A;  3ODB A;  4OWD A;  4OA4 A;  2WBB A;  2NXO A;  4GWY A;  3MC2 A;  2PT1 A;  2XX9 A;  1DTG A;  2QS4 A;  2HQ0 A;  3FIR A;  1KWH A;  3VXB A;  3ISP A;  1UQW A;  2NOO A;  1M5D A;  1XI6 A;  4KFQ A;  5I2K A;  2Y5L A;  4F1Y A;  2BJJ X;  3G7W A;  4H1X A;  4GFR A;  1DBZ A;  3USD A;  2QVU A;  4RK2 A;  3IOU A;  5EHM A;  1B40 A;  3OXN A;  4LVQ A;  4TLM B;  5I58 A;  4THI A;  2XWO A;  4XKP A;  1DPE A;  4PAI A;  3T96 B;  2CEY A;  3FXB A;  3SZP A;  4LA9 A;  3QK6 A;  3MW0 A;  2XXV A;  3H4Z A;  4GL0 A;  1DTZ A;  3I3V A;  2UVG A;  1NV1 A;  3LV0 A;  1BKA A;  1FCK A;  3ZSF A;  3Q29 A;  4ZEC A;  1NNF A;  1BP5 A;  5EQ8 A;  2MKZ A;  1VE4 A;  4F2O A;  3TDJ A;  3N5L A;  4GBW A;  2XXW A;  3PPO A;  3T22 A;  5A5X B;  1MS7 A;  3PMX A;  3EPE A;  3ONM A; 
#chains in the Genus database with same CATH homology
 1NUZ A;  4PFI A;  1IMC A;  4MJO A;  4X04 A;  3D1R A;  2XXK A;  4NAP A;  1FTA A;  1RDZ A;  3NOH A;  2KR0 A;  1FPF A;  4GWS A;  5DW8 A;  2F3D A;  1IMA A;  1FBG A;  5IGA A;  4NX1 A;  2Q8M A;  1LBY A;  2PFY A;  1IME A;  1KA0 A;  3E78 A;  2WYK A;  4OVT A;  1RDY A;  3E79 A;  4PGN A;  2WEF A;  4I3Y A;  4PAK A;  2FIX A;  4MX6 A;  2XA5 A;  2VPO A;  4N8G A;  1FBC A;  4P8B A;  3RPL B;  1K9Z A;  4NN3 A;  4MAG A;  5ET8 A;  1FPL A;  1IMF A;  4H45 A;  4X8R A;  5I5P A;  1AWB A;  5T3J A;  3A29 A;  1NV3 A;  4PAF A;  1QGX A;  1FJ9 A;  1FRP A;  1NV5 A;  3BIG A;  1LBV A;  2Q74 A;  1EYJ A;  4O7M A;  5CM6 A;  4PFB A;  4OVP A;  1DCU A;  3T1B A;  1FSA A;  4P56 A;  4MMP A;  1FBH A;  2CEX A;  2XWK A;  4MNC A;  5LTC A;  4F1U A;  4GX4 A;  2QVR A;  1DK4 A;  4O7I A;  2WX9 A;  3KC1 A;  4MNP A;  1FJ6 A;  2VT5 A;  3IFC A;  1CNQ A;  4IR8 A;  1NUX A;  3ROJ A;  1NV4 A;  1LBX A;  2P3N A;  4I3E A;  1IMB A;  4O94 A;  1RDX A;  3FBP A;  2GQ1 A;  3CHG A;  3IFA A;  4PDD A;  5IZ1 A;  4NQ8 A;  2PFZ A;  1NUY A;  5EQ9 A;  2L5V A;  1NUW A;  4OVQ A;  2QFL A;  3W9W A;  2VPN A;  4F1V A;  3U65 A;  4GWX A;  2PCR A;  5EQ7 A;  4HE2 A;  2ZZW A;  2XWI A;  1NV7 A;  4OVS A;  5IZ3 B;  2DDK A;  3B50 A;  1FPK A;  5J1D A;  3RPL A;  4XF5 A;  3LUZ A;  4HE0 A;  5FBP A;  2FVZ A;  2HHM A;  4MNI A;  3T0J A;  3RYD A;  4P1L A;  1YXI A;  2DE4 A;  4PCD A;  2QVV A;  4F19 A;  4JVC A;  4PDH A;  4GX6 A;  3MST A;  1FBP A;  4DI3 D;  4NF0 A;  2FHY A;  1FPD A;  2F5X A;  4MCO A;  3B8B A;  1FBE A;  2B4L A;  4AS4 A;  2OX3 A;  5LDZ A;  1NV2 A;  1YZ0 A;  1EYI A;  1EYK A;  1IMD A;  4GX3 A;  2HZL A;  4HXV A;  2CZK A;  4JVI A;  2HXR A;  2Q9T A;  2FBP A;  2B4M A;  4NG7 A;  4GBV A;  1K9Y A;  1FPB A;  4HE1 A;  5ET6 A;  4M1V A;  2KQZ A;  1FBD A;  4PF6 A;  2V3Q A;  4GWW A;  3HFU A;  1FPJ A;  4LN5 A;  4PE3 A;  1G0H A;  1NV6 A;  2CZH A;  3MYU A;  3KC0 A;  4MEV A;  1FBF A;  4N91 A;  4N17 A;  5A5L A;  5ET7 A;  4HCW A;  5EQA A;  4N15 A;  5EYG A;  1FPI A;  4OVR A;  4PBH A;  4PFR A;  4UAB A;  2ZZX A;  4PBQ A;  4H46 A;  1FPE A;  4G61 A;  4XFE A;  4I40 A;  1KA1 A;  2ZZV A;  1LBZ A;  1LBW A;  1NV0 A;  4N4U A;  4QBA A;  5JK4 A;  5ESY A;  4O8M A;  5IZ3 A;  1BK4 A;  5F24 A;  3PTY A;  4PC9 A;  4F18 A;  4PF8 A;  3KBZ A;  4YZZ A;  2Y5K A;  4AS5 A;  2R8T A;  4GWU A;  1D9Q A;  1VDW A;  4MIJ A;  4P1E A;  2P3V A;  2DE2 A;  2HPG A;  4N81 A;  2V4C A;  2WYP A;  5ET5 A;  4N6K A;  4QXD A;  4P3L A;  1NI9 A;  3GYY A;  4OA4 A;  4KXP A;  2WBB A;  2XWV A;  4OAN A;  3W9V A;  5EYH A;  4GWY A;  1Q9D A;  4MHF A;  2DE3 A;  1FPG A;  3ISP A;  3BIH A;  1XI6 A;  4JVD A;  4PTK A;  4N6D A;  4PGP A;  4DI4 B;  2BJI A;  4N8Y A;  1SPI A;  4HCY A;  2Y5L A;  5J16 A;  5IM2 A;  2FIE A;  2F3B A;  1DBZ A;  4NHB A;  3QMF A;  2HZK A;  2QVU A;  1KZ8 A;  2OWZ A;  4XEQ A;  2XWO A;  4YIC A;  1YYZ A;  4PAI A;  2CEY A;  3FXB A;  3SZP A;  1JP4 A;  4FBP A;  1G0I A;  1NV1 A;  3LV0 A;  2DVZ A;  2JJK A;  4X9T A;  1LEV A;  5IZZ A;  1INP A;  4P47 A;  2CZI A;  2WBD A;  4PET A;  5I7I A;  5EQ8 A;  2MKZ A;  4GWZ A;  5I3S A;  2QPQ A;  4GBW A;  4P9K A;  3EKI A;  4NGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...