1IMBA

Structural analysis of inositol monophosphatase complexes with substrates
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural analysis of inositol monophosphatase complexes with substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imbA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imbA02
1LBWA 1FPIA 1JP4A 3IFCA 1IMDA 1FJ9A 4GWXA 1FPDA 4GWWA 3RPLB 2P3NA 4G61A 2WBDA 2OX3A 4GBVA 4GWUA 1FBCA 1FPBA 2GQ1A 4GX4A 5IZ1A 1BK4A 3ROJA 1Q9DA 3RYDA 5EQ7A 3LV0A 4HE0A 5EYHA 4I3EA 4AS5A 2FBPA 4MJOA 5F24A 5J16A 1NI9A 3B8BA 3BIGA 2WEFA 1NV1A 4HE1A 1FJ6A 1NV3A 1FSAA 2FHYA 1NV6A 1XI6A 1NUZA 5IZ3A 1NUYA 1NV4A 2Y5LA 2QVUA 3KC1A 1FBFA 1KA0A 1DK4A 1FBGA 2Y5KA 3IFAA 4GWSA 4I40A 4QXDA 1G0IA 4GWZA 3FBPA 1IMAA 1QGXA 1AWBA 3RPLA 1FBPA 3D1RA 1VDWA 1KA1A 4KXPA 1SPIA 1RDZA 2Q8MA 5ET8A 1NV5A 5DW8A 5ESYA 5ET6A 4N81A 1LBXA 1FRPA 1FPKA 1DBZA 1KZ8A 2R8TA 1FPJA 1NV0A 2HHMA 4GX3A 1NV7A 1LBZA 5ET5A 1K9YA 2F3DA 1NUWA 1IMCA 2WBBA 4FBPA 1FPLA 1EYIA 2VT5A 3T0JA 5EYGA 5T3JA 4AS4A 1YYZA 2CZKA 1LEVA 2CZHA 3BIHA 2QFLA 2CZIA 5EQ8A 4IR8A 5A5LA 1IMBA 1D9QA 2BJIA 1INPA 3KBZA 1FPGA 1FPEA 3LUZA 2FIXA 3A29A 2F3BA 2QVVA 5EQAA 1FBEA 3KC0A 4H46A 2JJKA 4O7IA 5LDZA 1FBDA 4HXVA 5I3SA 2QVRA 4H45A 1NUXA 4HE2A 5ET7A 4GWYA 2P3VA 4I3YA 1RDXA 3QMFA 1FPFA 1CNQA 4GBWA 1FBHA 2FIEA 4GX6A 4PTKA 1IMFA 1DCUA 5FBPA 1EYKA 1LBYA 2OWZA 1YXIA 2PCRA 1K9ZA 2DDKA 1EYJA 1LBVA 1FTAA 2FVZA 2Q74A 1RDYA 1YZ0A 1IMEA 5IZ3B 5EQ9A 1G0HA 1NV2A
chains in the Genus database with same CATH superfamily
2DXYA 2LAOA 1JP4A 4OEVA 1MPBA 4XKPA 2D21A 2P2AA 4K3FA 5ITOA 5I5PA 3ROJA 5CBSA 5EYHA 1PDAA 3Q27A 3KGCA 3MUQA 3B8BA 1D3KA 1NV1A 5I7IA 4OESA 3KSXA 3MVWA 4F29A 2QS4A 3EKIA 4FIMA 3IO4A 1QGXA 2I6EA 1FTMA 1JW5A 5FHMA 1PBQA 1ZJLA 4ND9A 2H98A 2Q89A 5FHOA 3SETA 1TFAA 1US5A 5I58B 4RYAA 1AIVA 1B5JA 3G3FA 5LTCA 3HHFA 4PE5B 3O97A 4ZE8A 4F3PA 5L9OA 2OJTA 3M3KA 4DDDA 2ZXTA 1PB9A 1O63A 1IMBA 1D9QA 1D9VA 1JVXA 3I6VA 1Q1KA 3UIFA 2OCUA 4KI0E 4KHZE 2E1SA 2DWIA 3K4UA 3M8UA 3K1PA 4HXVA 2ZMBA 1SQYA 1DOTA 3FVOA 1NUXA 2QS1A 2AL4A 3EF7A 1CNQA 1UQWA 3UK4A 1B3LA 4TOZA 1K9ZA 2F7CA 4GRKA 1IMEA 3THIA 1M5EA 4XEQA 2DS9A 3O6GA 1PEBA 4PBHA 3MVYA 1TT1A 4L17A 4U1OA 2GH9A 3KZGA 4JBZA 1N3XA 2VP1A 4G68A 3K6XA 5ICTA 3MPLA 3K01A 3O29A 4JVCA 1JEUA 4OMBA 4GBVA 5EHSA 2GQ1A 2XXQA 5DVJA 3LV0A 2FA7A 4GLIA 3EPEA 1SW1A 3FXBA 4FE8A 1B4HA 3EHSA 1VR5A 1NV6A 4MLVA 5DYHA 2XXPA 2O1MA 4Q5TA 4PETA 2ONRA 1FBGA 3CRBA 1EU8A 3PUYE 1B5IA 2PT1A 5JTYA 5AA4A 1EZ9A 1XHYA 4BDRA 3IR1A 3PMVA 4ESXA 2KR0A 3H6VA 3FIRA 3IOTA 1O64A 5H8SA 4PFBA 2VD2A 5IKBA 3MC2A 4GFRA 4OVTA 4NAPA 2Q88A 1B52A 1MXYA 1LSTA 5EYGA 1IXIA 2ALUA 2CZHA 4N6PA 3JV9A 4OANA 5CM6A 1IXHA 2O1LA 4LP2B 4F39A 4R6YA 4OERA 3OOAA 1H43A 3S9LC 3VVEA 3UP9A 5ET7A 2HEUA 4PFRA 1B05A 2V84A 1MRPA 3GYYA 5FTHA 4GX6A 4AB6A 3O6HA 1B6HA 2QSXA 1EYJA 2FNCA 5EQ9A 4KYSA 1P1WA 3VLUA 4R72A 4OEUA 5JK4A 2P1SA 3N6UA 4PFWA 2B3BA 2WBDA 1MH4A 4UABA 4IO4A 3RYDA 1LAGE 5KZTA 4AS5A 3T9VA 3QXMA 2RC9A 4F2OA 3BIGA 4P0GA 3WAFA 3CG3A 3KG2A 3HO7A 1T0KA 1NUZA 1Y1ZA 3H03A 1LFIA 4KR5A 2ZYMA 1MPDA 5I57A 4GWZA 3RPLA 3FXQA 3RLFE 5TPAA 3IOUA 3IB0A 4KXPA 2X7QA 3TELA 5KDTA 2OK2A 3U94A 1LBXA 4LATA 4NTLA 2ZZXA 4LA9A 2RKMA 1LFHA 4FBPA 4X1BA 3MW0A 4QF9A 4DLDA 3VLWA 3HSTA 2REGA 4OFJA 4PP0A 2QFLA 4POWA 4IR8A 1N04A 2L5VA 4N6KA 1Y4CA 3KC0A 3G3JA 4GXAA 2XXVA 3RNNA 5I3SA 2WKYA 3CFXA 3O28A 4HE2A 1HSJA 4ISUA 1BTJA 1USYE 4Q8RA 1GR2A 2I3WA 2ANJA 1B51A 3CSBA 4NF4B 2OZZA 3USDA 2DE4A 4X1DA 3OENA 3UN6A 1SDXA 1OIBA 4YZZA 3IORA 4PDDA 3SDFA 3K0VA 3OO9A 1S9TA 3FXUA 5IZ1A 3T66A 3UORA 3ODBA 3KBRA 4PE3A 4N17A 4P8BA 1LBBA 1BKAA 1FJ6A 3RQTA 3ZSFA 3N94A 2DP8A 3RTWB 2RC8A 1KA0A 1LGBC 5M2VA 1F9BA 4DXCA 2RINA 2R9JA 3VXCA 3VFJA 1KA1A 1FW0A 5CBRA 1N3WA 1NV5A 5ESYA 5ET6A 4OVPA 2OPDA 5TP9A 5A5XB 3V5AA 2HZLA 3EHUA 2O6AA 4NF6A 2HHMA 4ZECA 5ET5A 5ISUA 4F1UA 1FQAA 4IY6A 2RC7A 4F1YA 5A5LA 3B6QA 4R6HA 5BWJA 3UA8A 3ILTB 3PMXA 2QPQA 2D3IA 4GOTA 3KOTA 4MFIA 3EQ1A 2JJKA 4IB2A 1QUIA 1Z7ME 1IITA 1NFTA 3H6WA 2P3VA 5L8DA 1P1UA 4H8JA 4EQ9A 4OVQA 4RJZA 2FIEA 2QS2A 3QUJA 2GFEA 3GLBA 1POTA 1AH5A 4HS7A 2ABHA 4OVSA 2ZNTA 1RDYA 1YPNA 4OVRA 1NKXA 4MAGA 2Z8FA 2BJJX 1MY0A 1LB9A 3IX1A 4NWDA 1ZKBA 3S9MC 5AA3A 2PBWA 3C4MA 2OX3A 1LAFE 4I8CA 4GX4A 4OHNA 1BK4A 3Q26A 3U65A 4FORA 5IGAA 2A5TA 3BBRA 2B4MA 4DZ1A 5IZ3A 1NUYA 1NV4A 3E9XA 3HN0A 1NMUA 1QULA 1SBPA 1VSOA 2WYPA 4MHFA 1AWBA 3S4UA 4P0IA 1GVCA 3G3GA 3ONMA 2R6GE 3FJGA 1MG1A 1IZ1A 4NE4A 3BFUA 1XOCA 4R2FA 4QFNA 3A3UA 2ZNUA 4G8NA 3MZBA 1LBZA 3MVXA 4QSEA 3T0JA 4YKJA 3IO6A 3BIHA 4I9DA 1A99A 3PUWE 4N4UA 4H5FA 1ZBMA 4X48A 1TFDA 3TTNA 4PF8A 1UIVA 1ANFA 2XWVA 4G68B 3HFUA 1SD3A 5H8HA 4PGNA 4PDHA 3S2VA 3QMFA 3U93A 1UTHB 3C36A 4FEBA 4Q0CA 4PAKA 1A40A 3JZJA 4O3BA 4IY5A 4C1UA 2PCRA 4U4SA 2G29A 4OWDA 4KYEA 2ZZWA 1II5A 3IFCA 4IGRA 4GWWA 5AA4B 3K1MA 2M8CA 4POXA 4DCYA 3DP8A 1TXFA 2DYXA 3H6UA 2UYFA 3TEPA 3RPWA 3PUZE 5KCJA 4G4PA 2O69A 5AA2A 2ZYKA 3GBAA 4ELOA 1DPPA 2HPGA 3VDFA 1M5FA 1B5HA 3FV2A 4O8MA 5B7DA 2DXRA 1OQGA 1B58A 3C32A 1KZ8A 2R8TA 4N13A 4F3BA 3MPKA 4C0RA 3OELA 3G3KA 3MYUA 1S7YA 4MF3A 2H4IA 5CI5A 3HHGA 1INPA 4MLQA 3ZKKA 1JEVA 3HPIA 3OSQA 4JB7A 1FQCA 4ZEKA 5EQAA 2DWAA 4BDOA 3OO8A 1QW0A 4GF8A 5DVIA 2Y7KA 4X8RA 4NQ8A 2XXIA 1H44A 5TU0A 4FECA 1Y9UA 3KSJA 1FPFA 4ZZEA 3CI8A 4R9GA 3KJ7A 2NUVA 3S9NC 2RF1A 4I62A 1MH3A 1FTAA 2Q74A 3FJMA 4M1VA 3TTMA 4JDFA 1R9LA 3K6VA 3R7XA 3RPLB 4NF8A 3MAMA 1IXCA 2P3NA 4G2ZA 4DI3D 1EH3A 2XXTA 2UXAA 4PFUA 5KDTB 3VLVA 2FYIA 2YJPA 4YMBA 5F24A 5I59A 1OMPA 4NG7A 4HE1A 2XXHA 2VPOA 4IGTA 3P7IA 2Y5LA 4GQOA 4QSDA 3T9UA 2CEYA 2GHBA 2Y5KA 4N07A 3WAEA 4OYVA 1B3EA 5H8NA 4NN3A 2IEEA 3FGSA 1Y4TA 1B4ZA 4N81A 1VE4A 3EHTA 3GZGA 5EHMA 4MNCA 3O9PA 1K9YA 2F3DA 3BKIB 2WBBA 4PF6A 4LUBA 4GXSB 1D9YA 3E3KA 5H8QA 4H0WA 4U4XA 4PQJA 3K1NA 1MXXA 3IOWA 4RY1A 4YB7A 2F6GA 1RKMA 4MMPA 4OQOA 1SW5A 3FASA 3L6HA 1GGGA 4U23A 3E79A 4PTKA 1IMFA 5F7VA 2XD2A 4X04A 3IJOB 3CVGA 3DLNA 2I4CA 2XXKA 1G0HA 3FD3A 1LBWA 4YMAA 4MIJA 3H7MA 1SYIA 3E4RA 3PD9A 4XFEA 5CC2A 3SKPA 4G61A 5CMKA 5IZZA 3TZAA 1P1OA 3ISPA 2F7AA 1MY3A 3L6GA 2VPNA 1JW4A 3NOHA 4QHQA 3RN8A 4MCOA 2F6PA 5J16A 4NF6B 3HCQA 1VFDA 4WXJA 3PGFA 4U22A 4MH5A 1CE2A 2R71A 1MDP1 1UTBA 3DP6A 1N7XA 5ELVA 4GIZA 2ZZVA 1YTVA 1OLCA 1A55A 2VHAA 3TQWA 2X26A 1FQFA 1N84A 3GBBA 2DVZA 4H65A 1MXVA 2Y84A 4PFYA 1LEVA 5JEIA 4XF5A 2O68A 1HSLA 2F8DA 4IO3A 3LUZA 4PBQA 3TYHA 1B7UA 2QVVA 1J1NA 4MEVA 4P1LA 4RPNA 4LZ8A 2HAUA 1URSA 2F7BA 4ZEDA 3VXBA 1WVJA 4YKPA 3D4CA 1YAEA 2QRYA 1D4NA 4ZZAA 2CEXA 4R9FA 3H6TA 1Y3QA 4N15A 5I56B 1NNPA 4PCDA 3IK6B 2DDKA 1IEJA 3A3CA 3RGYA 2FVZA 5IZ3B 2XXRA 5DEXA 1RYXA 3Q29A 3OEKA 4JVDA 5ITPA 4R6KA 1FPDA 3SEUA 3JYRA 4G8HA 1MXZA 3IL1B 3IAZA 4F19A 4HE0A 1LCFA 1SYHA 4NWCA 2WEFA 4OZ9A 1QUKA 4EF1A 2XWKA 3PTYA 5K2YA 5I84A 2F34A 3R6UA 1MPCA 4C1TA 5LOMA 2XA5A 1RDZA 4OVJA 3SEWA 4N8GA 4YB5A 5H8FB 4AQ4A 2Y7WA 3D4GA 3PMWA 4PFIA 2PFYA 5H8HB 1NV7A 4Z0IA 4MBPA 4AS4A 4P3LA 2CZIA 5EQ8A 2I4BA 2V93A 2I0CA 3TQLA 3PPQA 1S50A 4NEDA 3E13X 1NNKA 1MY2A 3O2AA 5LDZA 1WODA 4H45A 2QS3A 3TKDA 3QIMA 2B65A 1XVXA 5I2NB 4ECFA 1EYKA 1LAHE 1LB8A 3QSLA 4NF5B 3TAJA 1OVTA 4QFPA 1YXIA 1PBPA 3KN8A 2WYKA 4QFLA 1YZ0A 2AIXA 2PYYA 1FCKA 3T22A 1SW4A 1KWHA 2O7IA 3SEYA 4FAJA 4DI4B 2DE3A 3GXAA 4BDNA 1IQ7A 2F5XA 1Q9DA 3G3HA 3H4ZA 3TTKA 1NI9A 1MDQA 1DSNA 4QSCA 5DT6A 4H8IA 1L5TA 4LZ7A 2PT2A 1FBFA 1WDNA 1NH7A 4QXDA 1R9QA 4WEDA 3FXRA 3TCFA 1IMAA 4WEPA 3OSRA 3LBSA 5CMMA 1R6ZA 2CZLA 1SPIA 1N7WA 1XVYA 3S9EA 5DW8A 4UACA 4JSOA 1MQJA 1DBZA 1B46A 4QBAA 3KJTA 4MX6A 4GX3A 4N8YA 1JQFA 4IO6A 1POY1 3TTLA 5K2XA 3R26A 2CZKA 2Z8DA 2F36A 1QKAA 3FUZA 2F3BA 4JWXA 2F78A 3IJXB 4YKIA 1H45A 1ELJA 3Q28A 4NF8B 3RTFB 3SEVA 2A5SA 4JWYA 1NNFA 4NMYA 4I3YA 2H99A 2QMWA 4O7MA 3MSTA 2HAVA 2ESNA 5BUUA 3H06B 5I59B 4EQBA 3N6TA 2NOOA 2QMXA 3TMGA 4NF4A 1MXWA 3W15C 3F11A 5ICQA 1H76A 4EXKA 1Z7NE 3IB1A 1MQDA 3CSGA 1Y1MA 5H8NB 3VVDA 2UVHA 3N5LA 3V8XB 4I1DA 2Y7RA 4ESWA 4I3EA 4F1VA 4MJOA 1B3GA 3PUXE 4KYDA 1I6BA 1EZOA 2ONKE 1XI6A 4GVOA 5EYFA 2G93A 4RA1A 3TPAA 3SEXA 4GWOA 4GWSA 1Q35A 5JTYB 3V89B 1Y20A 4DXUA 2H5YA 3Q25A 2NVUB 4ZS9A 1R1NA 2PMSA 4KPTA 1LBCA 4U21A 5A5XA 1FPJA 2XXWA 3OO6A 4TLLB 2UYEA 4EXLA 3FVKA 1FPLA 1EYIA 1URDA 4KD5A 4YICA 4OETA 4QFKA 1B0LA 1TWYA 3LUYA 4LONB 2O7UA 3ILUB 3MP8A 2FIXA 1BLFA 3CR9A 5J1DA 3T93B 3EN3A 4YU0A 1ZU0A 3UGWA 2H25A 4KFQA 3G3IA 2RCBA 4GWYA 3QUFA 4LN5A 1XC1A 4QRZA 3M3LA 4GBWA 4R75A 3B7DA 1DCUA 5FBPA 2XXXA 4XIGQ 4OENA 1B3FA 4N91A 4ZE9A 1LBVA 4BDQA 1UIUA 1NV2A 4IO7A 2HQ0A 3TCHA 2UVGA 1FPIA 5FHNA 2W7YA 4PAFA 1MXUA 4H5GA 1LLSA 4R2BA 1UTBB 3C34A 2I0BA 4GWUA 4F2QA 4P1EA 4KCDA 4EF2A 4PGPA 3DP4A 1EZPA 1NV3A 1FSAA 4O3CA 3TFLA 1I69A 5I57B 4UA8A 2KQZA 3LSXA 5TPAB 3SZPA 1I6AA 3CFLA 3C9HA 1FTLA 4H1XA 2H9BA 3H3GA 2Q8MA 5B70A 3KFMA 3C33A 1B2HA 3T1BA 4LQ5A 1SVXB 4ZDMA 2OBGA 3RY3A 1FRPA 4DE8A 1MS7A 4LZ5A 4OFLA 3MWBA 3TDJA 1IMCA 1XT8A 4ELPA 1DMBA 1NNTA 1OLAA 1YYZA 1HSEA 1CB6A 4FEDA 4PFTA 2BJIA 4F22A 1FQDA 4NGUA 3KBZA 1LCTA 4KQPA 4NHBA 4BDMA 5CMCA 3U72A 1SI0A 1JVYA 5DEXB 2MKZA 3MP1A 2PFZA 4HCYA 2QL3A 4ELQA 2ZNSA 5I2KA 1RDXA 3B6WA 4OFOA 2B3FA 1UTHA 3O6IA 1B40A 4G68C 4N6DA 1LFGA 2XHDA 2YPNA 2Z8EA 1NL5A 3QK6A 2GRVA 1JETA 4GL8A 2DWJA 3VV5A 2Y7PA 2DOJA 1QJMA 5EQ7A 3OEMA 3PPNA 5L9MA 1SW2A 2VD3A 3LR1A 2QVUA 3KC1A 1AMFA 3IB2A 1N76A 4JSDA 2XXYA 4EUOA 2O84X 1BIYA 4HCWA 3D1RA 3G7WA 3TODA 4F31B 2D5WA 3W9VA 1SI1A 5TP9B 3RT6B 4PAIA 3ECRA 4Z7EA 1ZTYA 4YB6A 4DCXA 5AE4A 3M3FA 1ZMGA 3FATA 3K02A 3IOVA 3PPRA 1FPGA 3O66A 4XKNA 2V3TA 1US4A 2DSFA 1FBEA 1MM6A 1MQIA 2X7PA 4O7IA 2Q2AA 4F18A 4H67A 5I58A 5F1QA 2B4LA 1URGA 3KN7A 3K2DA 3DELB 2I48A 2P0SA 3U8QA 4G8MA 1LBYA 2Z23A 1FQBA 3FVGA 2Z22A 3MBPA 4M4GA 2ONSA 3ZKLA 2XD3A 1B0HA 2KLFA 4RXLA 2DVCA 3OMBA 2DE2A 3OO7A 1IMDA 2V3QA 4P47A 1DPEA 2I49A 4RPOA 1FJ9A 1H3DA 1USYH 1A54A 1M5CA 4Q30B 4U2RA 4XKRA 1M5DA 3TCGA 4HTGA 2A5TB 2I58A 4NF0A 4U1ZA 2DWHA 3U1OA 2NXOA 4MNIA 5HPQA 3ZS6A 2E0SA 3TUSA 3KN3A 4LVQA 3IFAA 1G0IA 3CG1A 1FBPA 2V4CA 2HCAA 2VGQA 3E78A 2ZYOA 1PC3A 4GL0A 1FPKA 4BDLA 4F3SA 1NUWA 2HXWA 4YAHX 3HV1A 2VT5A 1ZIUA 5T3JA 3SESA 3KEIA 1GV8A 1P1NA 2XWIA 2F97A 3A29A 5DTBA 3T9HB 4H6DA 4E0WA 2RCAA 1YCJA 4F3GA 3K6WA 4GD5A 3V83A 1XS5A 3DM0A 4ZEFA 1FBHA 4DIGA 2F35A 2ZYNA 1B1HA 3LSLA 4MNPA 4HW8A 1MM7A 3KOSA 3VE1B 3T96B 2OLBA 4XTCQ 5CRYA 4XXUA 4GWXA 4EDPA 4ZEBA 1B7ZA 4G77A 3OD7A 4RK9A 1I6QA 5AA1A 1FBCA 3PD8A 5FTIA 4BLAA 4O94A 5KCJB 2Q2CA 3SERA 1A7LA 2V25A 3OXNA 5AA2B 4TLMB 1N0TA 4PC9A 4KCCA 1B7HA 3LC8A 3PV0E 4JWOA 3FJ7A 4P9KA 4ZEIA 2QJEA 4I40A 1P99A 2HZKA 2XX8A 2GHAA 1FTKA 1VDWA 4FJPA 1AOVA 3MZ1A 3TTRA 4YKKA 4E0XA 4TQUQ 4AB5A 1A8FA 4THIA 1OQHA 1QVSA 2OPEA 1NV0A 1DTGA 4QFOA 2IA4A 3C31A 4JVIA 4RK2A 4ONYA 5IAIA 3CFZA 1MQGA 3MP6A 4IO2A 1JNFA 4O3AA 1B9JA 3BFTA 2V3UA 3I3VA 1JW1A 3LSWA 1FBDA 2O51A 2NWJA 5DVFA 2QVRA 2HXRA 4IO5A 5IM2A 4NX1A 1QUJA 2AL5A 3N26A 3PU5A 1PB8A 2OWTA 3FV1A 2AYSA 5I56A 2YLNA 1AL3A 3B6TA 4LQ2A 4FATA 1A8EA 1BP5A 1IIWA 1O7TA 3CHGA 1Y3PA 2DQVA 1PB7A 1IUDA 3W9WA 3T9XB 1IXGA 1FQEA 4X9TA 4XKQA 1FPBA 3MVZA 2XXUA 3VVFA 2PVUA 3K6UA 2FBPA 1B3HA 4OXVA 3RUMA 3LSFB 4R73A 4OA4A 5CMBA 2FHYA 2WX9A 1OVBA 1FTJA 4WKMA 1DK4A 1ATGA 3MJNA 2UVJA 4ELRA 2UVIA 3FBPA 3RT8A 1B1XA 3I5OA 2VOZA 2I3VA 1FTOA 5ET8A 2OWSA 5HM4B 1GTKA 3FZVA 3PUVE 1MQHA 2THIA 5HBCA 2XWOA 5H8FA 2Q9TA 1VFEA 3QAXA 4OTEA 2REJA 2PX1A 5I2KB 2Q8JA 2XX9A 2Y7IA 1ZLQA 3U92A 5H8QB 4R74A 2XX7A 1B32A 4DXBA 5AA2D 4P11A 1FPEA 3PPOA 2HFBA 1Y3NA 3QYTA 3MQ9A 3A09A 4H46A 4RNSA 5L9SA 3CIJA 4EQ7A 1NH8A 1P1QA 1MY4A 1QKBA 4P56A 5I2NA 3B50A 3PPPA 2OWZA 4JXIA 3C35A 1LAXA 4NF5A 3FVNA 1RYOA 1DTZA 1MY1A 3AXFA 2CMOA 1M5BA 3K00A 3MZ9A
chains in the Genus database with same CATH topology
4MAGA 1JP4A 4JVDA 1FPDA 2OX3A 5I5PA 4GX4A 1BK4A 3ROJA 5EQ7A 4F19A 4HE0A 5EYHA 3U65A 5IGAA 3B8BA 2WEFA 1NV1A 5I7IA 2B4MA 5IZ3A 1NUYA 1NV4A 2QVUA 3KC1A 3EKIA 2XWKA 3PTYA 2WYPA 4MHFA 1QGXA 1AWBA 4HCWA 3D1RA 3W9VA 2XA5A 1RDZA 4N8GA 4PFIA 4PAIA 2PFYA 5LTCA 1NV7A 1LBZA 3T0JA 4AS4A 4P3LA 3BIHA 2CZIA 5EQ8A 1IMBA 1D9QA 1FPGA 4N4UA 1FBEA 4PF8A 4O7IA 4F18A 5LDZA 2XWVA 4HXVA 4H45A 2B4LA 3HFUA 1NUXA 4PGNA 4PDHA 3QMFA 1CNQA 1EYKA 4PAKA 1LBYA 1YXIA 2WYKA 2PCRA 1K9ZA 1YZ0A 1IMEA 4XEQA 2ZZWA 2DE2A 4PBHA 3IFCA 1IMDA 2V3QA 4P47A 1FJ9A 4GWWA 4DI4B 2DE3A 4JVCA 2F5XA 4GBVA 2GQ1A 1Q9DA 3LV0A 3FXBA 4NF0A 1NI9A 4MNIA 1NV6A 1FBFA 4PETA 1FBGA 2HPGA 3IFAA 4QXDA 1G0IA 1IMAA 1FBPA 2V4CA 3E78A 1SPIA 4O8MA 2KR0A 5DW8A 1FPKA 1DBZA 1KZ8A 4PFBA 2R8TA 4QBAA 4OVTA 4MX6A 4NAPA 4GX3A 4N8YA 1NUWA 2VT5A 5EYGA 3MYUA 5T3JA 2CZKA 2CZHA 4OANA 1INPA 5CM6A 2XWIA 3A29A 2F3BA 5EQAA 4X8RA 4NQ8A 5ET7A 4PFRA 4I3YA 1FPFA 4O7MA 3GYYA 1FBHA 4GX6A 3MSTA 4MNPA 1EYJA 1FTAA 2Q74A 4M1VA 5EQ9A 4GWXA 3RPLB 2P3NA 5JK4A 4DI3D 2WBDA 4UABA 1FBCA 4O94A 3RYDA 4I3EA 4AS5A 4F1VA 4MJOA 5F24A 4NG7A 3BIGA 4HE1A 2VPOA 4PC9A 1XI6A 1NUZA 2Y5LA 4P9KA 2CEYA 2Y5KA 4GWSA 4I40A 2HZKA 4GWZA 3RPLA 1VDWA 4KXPA 4NN3A 4N81A 1LBXA 1FPJA 1NV0A 2ZZXA 4MNCA 1K9YA 2F3DA 4JVIA 2WBBA 4FBPA 1FPLA 1EYIA 4PF6A 4YICA 2QFLA 4IR8A 2L5VA 2FIXA 5J1DA 4N6KA 3KC0A 4MMPA 1FBDA 5I3SA 2QVRA 2HXRA 4HE2A 5IM2A 4NX1A 4GWYA 4LN5A 3E79A 4GBWA 4PTKA 1IMFA 1DCUA 5FBPA 4X04A 4N91A 2XXKA 1LBVA 2DE4A 1G0HA 1NV2A 1LBWA 4YZZA 4MIJA 4PDDA 1FPIA 3CHGA 4PAFA 4XFEA 3W9WA 4G61A 5IZZA 4GWUA 3ISPA 4X9TA 1FPBA 5IZ1A 2VPNA 4P1EA 3NOHA 2FBPA 4PE3A 4MCOA 5J16A 4N17A 4P8BA 4PGPA 4OA4A 1FJ6A 1NV3A 1FSAA 2FHYA 2WX9A 1KA0A 1DK4A 2KQZA 3FBPA 3SZPA 1KA1A 2Q8MA 2ZZVA 5ET8A 1NV5A 3T1BA 5ESYA 5ET6A 2XWOA 4OVPA 1FRPA 2Q9TA 2HZLA 2HHMA 5ET5A 1IMCA 2DVZA 4F1UA 1YYZA 1LEVA 4XF5A 5A5LA 2BJIA 4NGUA 3KBZA 1FPEA 3LUZA 4PBQA 4NHBA 2QVVA 4MEVA 4P1LA 2QPQA 2MKZA 4H46A 2JJKA 2PFZA 4HCYA 2P3VA 1RDXA 4OVQA 2CEXA 2FIEA 4P56A 4N15A 3B50A 2OWZA 4PCDA 2DDKA 4N6DA 4OVSA 2FVZA 1RDYA 5IZ3B 4OVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBW A;  1FPI A;  1JP4 A;  3IFC A;  1IMD A;  1FJ9 A;  4GWX A;  1FPD A;  4GWW A;  3RPL B;  2P3N A;  4G61 A;  2WBD A;  2OX3 A;  4GBV A;  4GWU A;  1FBC A;  1FPB A;  2GQ1 A;  4GX4 A;  5IZ1 A;  1BK4 A;  3ROJ A;  1Q9D A;  3RYD A;  5EQ7 A;  3LV0 A;  4HE0 A;  5EYH A;  4I3E A;  4AS5 A;  2FBP A;  4MJO A;  5F24 A;  5J16 A;  1NI9 A;  3B8B A;  3BIG A;  2WEF A;  1NV1 A;  4HE1 A;  1FJ6 A;  1NV3 A;  1FSA A;  2FHY A;  1NV6 A;  1XI6 A;  1NUZ A;  5IZ3 A;  1NUY A;  1NV4 A;  2Y5L A;  2QVU A;  3KC1 A;  1FBF A;  1KA0 A;  1DK4 A;  1FBG A;  2Y5K A;  3IFA A;  4GWS A;  4I40 A;  4QXD A;  1G0I A;  4GWZ A;  3FBP A;  1IMA A;  1QGX A;  1AWB A;  3RPL A;  1FBP A;  3D1R A;  1VDW A;  1KA1 A;  4KXP A;  1SPI A;  1RDZ A;  2Q8M A;  5ET8 A;  1NV5 A;  5DW8 A;  5ESY A;  5ET6 A;  4N81 A;  1LBX A;  1FRP A;  1FPK A;  1DBZ A;  1KZ8 A;  2R8T A;  1FPJ A;  1NV0 A;  2HHM A;  4GX3 A;  1NV7 A;  1LBZ A;  5ET5 A;  1K9Y A;  2F3D A;  1NUW A;  1IMC A;  2WBB A;  4FBP A;  1FPL A;  1EYI A;  2VT5 A;  3T0J A;  5EYG A;  5T3J A;  4AS4 A;  1YYZ A;  2CZK A;  1LEV A;  2CZH A;  3BIH A;  2QFL A;  2CZI A;  5EQ8 A;  4IR8 A;  5A5L A;  1IMB A;  1D9Q A;  2BJI A;  1INP A;  3KBZ A;  1FPG A;  1FPE A;  3LUZ A;  2FIX A;  3A29 A;  2F3B A;  2QVV A;  5EQA A;  1FBE A;  3KC0 A;  4H46 A;  2JJK A;  4O7I A;  5LDZ A;  1FBD A;  4HXV A;  5I3S A;  2QVR A;  4H45 A;  1NUX A;  4HE2 A;  5ET7 A;  4GWY A;  2P3V A;  4I3Y A;  1RDX A;  3QMF A;  1FPF A;  1CNQ A;  4GBW A;  1FBH A;  2FIE A;  4GX6 A;  4PTK A;  1IMF A;  1DCU A;  5FBP A;  1EYK A;  1LBY A;  2OWZ A;  1YXI A;  2PCR A;  1K9Z A;  2DDK A;  1EYJ A;  1LBV A;  1FTA A;  2FVZ A;  2Q74 A;  1RDY A;  1YZ0 A;  1IME A;  5IZ3 B;  5EQ9 A;  1G0H A;  1NV2 A; 
#chains in the Genus database with same CATH topology
 2DXY A;  2LAO A;  1JP4 A;  4OEV A;  1MPB A;  4XKP A;  2D21 A;  2P2A A;  4K3F A;  5ITO A;  5I5P A;  3ROJ A;  5CBS A;  5EYH A;  1PDA A;  3Q27 A;  3KGC A;  3MUQ A;  3B8B A;  1D3K A;  1NV1 A;  5I7I A;  4OES A;  3KSX A;  3MVW A;  4F29 A;  2QS4 A;  3EKI A;  4FIM A;  3IO4 A;  1QGX A;  2I6E A;  1FTM A;  1JW5 A;  5FHM A;  1PBQ A;  1ZJL A;  4ND9 A;  2H98 A;  2Q89 A;  5FHO A;  3SET A;  1TFA A;  1US5 A;  5I58 B;  4RYA A;  1AIV A;  1B5J A;  3G3F A;  5LTC A;  3HHF A;  4PE5 B;  3O97 A;  4ZE8 A;  4F3P A;  5L9O A;  2OJT A;  3M3K A;  4DDD A;  2ZXT A;  1PB9 A;  1O63 A;  1IMB A;  1D9Q A;  1D9V A;  1JVX A;  3I6V A;  1Q1K A;  3UIF A;  2OCU A;  4KI0 E;  4KHZ E;  2E1S A;  2DWI A;  3K4U A;  3M8U A;  3K1P A;  4HXV A;  2ZMB A;  1SQY A;  1DOT A;  3FVO A;  1NUX A;  2QS1 A;  2AL4 A;  3EF7 A;  1CNQ A;  1UQW A;  3UK4 A;  1B3L A;  4TOZ A;  1K9Z A;  2F7C A;  4GRK A;  1IME A;  3THI A;  1M5E A;  4XEQ A;  2DS9 A;  3O6G A;  1PEB A;  4PBH A;  3MVY A;  1TT1 A;  4L17 A;  4U1O A;  2GH9 A;  3KZG A;  4JBZ A;  1N3X A;  2VP1 A;  4G68 A;  3K6X A;  5ICT A;  3MPL A;  3K01 A;  3O29 A;  4JVC A;  1JEU A;  4OMB A;  4GBV A;  5EHS A;  2GQ1 A;  2XXQ A;  5DVJ A;  3LV0 A;  2FA7 A;  4GLI A;  3EPE A;  1SW1 A;  3FXB A;  4FE8 A;  1B4H A;  3EHS A;  1VR5 A;  1NV6 A;  4MLV A;  5DYH A;  2XXP A;  2O1M A;  4Q5T A;  4PET A;  2ONR A;  1FBG A;  3CRB A;  1EU8 A;  3PUY E;  1B5I A;  2PT1 A;  5JTY A;  5AA4 A;  1EZ9 A;  1XHY A;  4BDR A;  3IR1 A;  3PMV A;  4ESX A;  2KR0 A;  3H6V A;  3FIR A;  3IOT A;  1O64 A;  5H8S A;  4PFB A;  2VD2 A;  5IKB A;  3MC2 A;  4GFR A;  4OVT A;  4NAP A;  2Q88 A;  1B52 A;  1MXY A;  1LST A;  5EYG A;  1IXI A;  2ALU A;  2CZH A;  4N6P A;  3JV9 A;  4OAN A;  5CM6 A;  1IXH A;  2O1L A;  4LP2 B;  4F39 A;  4R6Y A;  4OER A;  3OOA A;  1H43 A;  3S9L C;  3VVE A;  3UP9 A;  5ET7 A;  2HEU A;  4PFR A;  1B05 A;  2V84 A;  1MRP A;  3GYY A;  5FTH A;  4GX6 A;  4AB6 A;  3O6H A;  1B6H A;  2QSX A;  1EYJ A;  2FNC A;  5EQ9 A;  4KYS A;  1P1W A;  3VLU A;  4R72 A;  4OEU A;  5JK4 A;  2P1S A;  3N6U A;  4PFW A;  2B3B A;  2WBD A;  1MH4 A;  4UAB A;  4IO4 A;  3RYD A;  1LAG E;  5KZT A;  4AS5 A;  3T9V A;  3QXM A;  2RC9 A;  4F2O A;  3BIG A;  4P0G A;  3WAF A;  3CG3 A;  3KG2 A;  3HO7 A;  1T0K A;  1NUZ A;  1Y1Z A;  3H03 A;  1LFI A;  4KR5 A;  2ZYM A;  1MPD A;  5I57 A;  4GWZ A;  3RPL A;  3FXQ A;  3RLF E;  5TPA A;  3IOU A;  3IB0 A;  4KXP A;  2X7Q A;  3TEL A;  5KDT A;  2OK2 A;  3U94 A;  1LBX A;  4LAT A;  4NTL A;  2ZZX A;  4LA9 A;  2RKM A;  1LFH A;  4FBP A;  4X1B A;  3MW0 A;  4QF9 A;  4DLD A;  3VLW A;  3HST A;  2REG A;  4OFJ A;  4PP0 A;  2QFL A;  4POW A;  4IR8 A;  1N04 A;  2L5V A;  4N6K A;  1Y4C A;  3KC0 A;  3G3J A;  4GXA A;  2XXV A;  3RNN A;  5I3S A;  2WKY A;  3CFX A;  3O28 A;  4HE2 A;  1HSJ A;  4ISU A;  1BTJ A;  1USY E;  4Q8R A;  1GR2 A;  2I3W A;  2ANJ A;  1B51 A;  3CSB A;  4NF4 B;  2OZZ A;  3USD A;  2DE4 A;  4X1D A;  3OEN A;  3UN6 A;  1SDX A;  1OIB A;  4YZZ A;  3IOR A;  4PDD A;  3SDF A;  3K0V A;  3OO9 A;  1S9T A;  3FXU A;  5IZ1 A;  3T66 A;  3UOR A;  3ODB A;  3KBR A;  4PE3 A;  4N17 A;  4P8B A;  1LBB A;  1BKA A;  1FJ6 A;  3RQT A;  3ZSF A;  3N94 A;  2DP8 A;  3RTW B;  2RC8 A;  1KA0 A;  1LGB C;  5M2V A;  1F9B A;  4DXC A;  2RIN A;  2R9J A;  3VXC A;  3VFJ A;  1KA1 A;  1FW0 A;  5CBR A;  1N3W A;  1NV5 A;  5ESY A;  5ET6 A;  4OVP A;  2OPD A;  5TP9 A;  5A5X B;  3V5A A;  2HZL A;  3EHU A;  2O6A A;  4NF6 A;  2HHM A;  4ZEC A;  5ET5 A;  5ISU A;  4F1U A;  1FQA A;  4IY6 A;  2RC7 A;  4F1Y A;  5A5L A;  3B6Q A;  4R6H A;  5BWJ A;  3UA8 A;  3ILT B;  3PMX A;  2QPQ A;  2D3I A;  4GOT A;  3KOT A;  4MFI A;  3EQ1 A;  2JJK A;  4IB2 A;  1QUI A;  1Z7M E;  1IIT A;  1NFT A;  3H6W A;  2P3V A;  5L8D A;  1P1U A;  4H8J A;  4EQ9 A;  4OVQ A;  4RJZ A;  2FIE A;  2QS2 A;  3QUJ A;  2GFE A;  3GLB A;  1POT A;  1AH5 A;  4HS7 A;  2ABH A;  4OVS A;  2ZNT A;  1RDY A;  1YPN A;  4OVR A;  1NKX A;  4MAG A;  2Z8F A;  2BJJ X;  1MY0 A;  1LB9 A;  3IX1 A;  4NWD A;  1ZKB A;  3S9M C;  5AA3 A;  2PBW A;  3C4M A;  2OX3 A;  1LAF E;  4I8C A;  4GX4 A;  4OHN A;  1BK4 A;  3Q26 A;  3U65 A;  4FOR A;  5IGA A;  2A5T A;  3BBR A;  2B4M A;  4DZ1 A;  5IZ3 A;  1NUY A;  1NV4 A;  3E9X A;  3HN0 A;  1NMU A;  1QUL A;  1SBP A;  1VSO A;  2WYP A;  4MHF A;  1AWB A;  3S4U A;  4P0I A;  1GVC A;  3G3G A;  3ONM A;  2R6G E;  3FJG A;  1MG1 A;  1IZ1 A;  4NE4 A;  3BFU A;  1XOC A;  4R2F A;  4QFN A;  3A3U A;  2ZNU A;  4G8N A;  3MZB A;  1LBZ A;  3MVX A;  4QSE A;  3T0J A;  4YKJ A;  3IO6 A;  3BIH A;  4I9D A;  1A99 A;  3PUW E;  4N4U A;  4H5F A;  1ZBM A;  4X48 A;  1TFD A;  3TTN A;  4PF8 A;  1UIV A;  1ANF A;  2XWV A;  4G68 B;  3HFU A;  1SD3 A;  5H8H A;  4PGN A;  4PDH A;  3S2V A;  3QMF A;  3U93 A;  1UTH B;  3C36 A;  4FEB A;  4Q0C A;  4PAK A;  1A40 A;  3JZJ A;  4O3B A;  4IY5 A;  4C1U A;  2PCR A;  4U4S A;  2G29 A;  4OWD A;  4KYE A;  2ZZW A;  1II5 A;  3IFC A;  4IGR A;  4GWW A;  5AA4 B;  3K1M A;  2M8C A;  4POX A;  4DCY A;  3DP8 A;  1TXF A;  2DYX A;  3H6U A;  2UYF A;  3TEP A;  3RPW A;  3PUZ E;  5KCJ A;  4G4P A;  2O69 A;  5AA2 A;  2ZYK A;  3GBA A;  4ELO A;  1DPP A;  2HPG A;  3VDF A;  1M5F A;  1B5H A;  3FV2 A;  4O8M A;  5B7D A;  2DXR A;  1OQG A;  1B58 A;  3C32 A;  1KZ8 A;  2R8T A;  4N13 A;  4F3B A;  3MPK A;  4C0R A;  3OEL A;  3G3K A;  3MYU A;  1S7Y A;  4MF3 A;  2H4I A;  5CI5 A;  3HHG A;  1INP A;  4MLQ A;  3ZKK A;  1JEV A;  3HPI A;  3OSQ A;  4JB7 A;  1FQC A;  4ZEK A;  5EQA A;  2DWA A;  4BDO A;  3OO8 A;  1QW0 A;  4GF8 A;  5DVI A;  2Y7K A;  4X8R A;  4NQ8 A;  2XXI A;  1H44 A;  5TU0 A;  4FEC A;  1Y9U A;  3KSJ A;  1FPF A;  4ZZE A;  3CI8 A;  4R9G A;  3KJ7 A;  2NUV A;  3S9N C;  2RF1 A;  4I62 A;  1MH3 A;  1FTA A;  2Q74 A;  3FJM A;  4M1V A;  3TTM A;  4JDF A;  1R9L A;  3K6V A;  3R7X A;  3RPL B;  4NF8 A;  3MAM A;  1IXC A;  2P3N A;  4G2Z A;  4DI3 D;  1EH3 A;  2XXT A;  2UXA A;  4PFU A;  5KDT B;  3VLV A;  2FYI A;  2YJP A;  4YMB A;  5F24 A;  5I59 A;  1OMP A;  4NG7 A;  4HE1 A;  2XXH A;  2VPO A;  4IGT A;  3P7I A;  2Y5L A;  4GQO A;  4QSD A;  3T9U A;  2CEY A;  2GHB A;  2Y5K A;  4N07 A;  3WAE A;  4OYV A;  1B3E A;  5H8N A;  4NN3 A;  2IEE A;  3FGS A;  1Y4T A;  1B4Z A;  4N81 A;  1VE4 A;  3EHT A;  3GZG A;  5EHM A;  4MNC A;  3O9P A;  1K9Y A;  2F3D A;  3BKI B;  2WBB A;  4PF6 A;  4LUB A;  4GXS B;  1D9Y A;  3E3K A;  5H8Q A;  4H0W A;  4U4X A;  4PQJ A;  3K1N A;  1MXX A;  3IOW A;  4RY1 A;  4YB7 A;  2F6G A;  1RKM A;  4MMP A;  4OQO A;  1SW5 A;  3FAS A;  3L6H A;  1GGG A;  4U23 A;  3E79 A;  4PTK A;  1IMF A;  5F7V A;  2XD2 A;  4X04 A;  3IJO B;  3CVG A;  3DLN A;  2I4C A;  2XXK A;  1G0H A;  3FD3 A;  1LBW A;  4YMA A;  4MIJ A;  3H7M A;  1SYI A;  3E4R A;  3PD9 A;  4XFE A;  5CC2 A;  3SKP A;  4G61 A;  5CMK A;  5IZZ A;  3TZA A;  1P1O A;  3ISP A;  2F7A A;  1MY3 A;  3L6G A;  2VPN A;  1JW4 A;  3NOH A;  4QHQ A;  3RN8 A;  4MCO A;  2F6P A;  5J16 A;  4NF6 B;  3HCQ A;  1VFD A;  4WXJ A;  3PGF A;  4U22 A;  4MH5 A;  1CE2 A;  2R71 A;  1MDP 1;  1UTB A;  3DP6 A;  1N7X A;  5ELV A;  4GIZ A;  2ZZV A;  1YTV A;  1OLC A;  1A55 A;  2VHA A;  3TQW A;  2X26 A;  1FQF A;  1N84 A;  3GBB A;  2DVZ A;  4H65 A;  1MXV A;  2Y84 A;  4PFY A;  1LEV A;  5JEI A;  4XF5 A;  2O68 A;  1HSL A;  2F8D A;  4IO3 A;  3LUZ A;  4PBQ A;  3TYH A;  1B7U A;  2QVV A;  1J1N A;  4MEV A;  4P1L A;  4RPN A;  4LZ8 A;  2HAU A;  1URS A;  2F7B A;  4ZED A;  3VXB A;  1WVJ A;  4YKP A;  3D4C A;  1YAE A;  2QRY A;  1D4N A;  4ZZA A;  2CEX A;  4R9F A;  3H6T A;  1Y3Q A;  4N15 A;  5I56 B;  1NNP A;  4PCD A;  3IK6 B;  2DDK A;  1IEJ A;  3A3C A;  3RGY A;  2FVZ A;  5IZ3 B;  2XXR A;  5DEX A;  1RYX A;  3Q29 A;  3OEK A;  4JVD A;  5ITP A;  4R6K A;  1FPD A;  3SEU A;  3JYR A;  4G8H A;  1MXZ A;  3IL1 B;  3IAZ A;  4F19 A;  4HE0 A;  1LCF A;  1SYH A;  4NWC A;  2WEF A;  4OZ9 A;  1QUK A;  4EF1 A;  2XWK A;  3PTY A;  5K2Y A;  5I84 A;  2F34 A;  3R6U A;  1MPC A;  4C1T A;  5LOM A;  2XA5 A;  1RDZ A;  4OVJ A;  3SEW A;  4N8G A;  4YB5 A;  5H8F B;  4AQ4 A;  2Y7W A;  3D4G A;  3PMW A;  4PFI A;  2PFY A;  5H8H B;  1NV7 A;  4Z0I A;  4MBP A;  4AS4 A;  4P3L A;  2CZI A;  5EQ8 A;  2I4B A;  2V93 A;  2I0C A;  3TQL A;  3PPQ A;  1S50 A;  4NED A;  3E13 X;  1NNK A;  1MY2 A;  3O2A A;  5LDZ A;  1WOD A;  4H45 A;  2QS3 A;  3TKD A;  3QIM A;  2B65 A;  1XVX A;  5I2N B;  4ECF A;  1EYK A;  1LAH E;  1LB8 A;  3QSL A;  4NF5 B;  3TAJ A;  1OVT A;  4QFP A;  1YXI A;  1PBP A;  3KN8 A;  2WYK A;  4QFL A;  1YZ0 A;  2AIX A;  2PYY A;  1FCK A;  3T22 A;  1SW4 A;  1KWH A;  2O7I A;  3SEY A;  4FAJ A;  4DI4 B;  2DE3 A;  3GXA A;  4BDN A;  1IQ7 A;  2F5X A;  1Q9D A;  3G3H A;  3H4Z A;  3TTK A;  1NI9 A;  1MDQ A;  1DSN A;  4QSC A;  5DT6 A;  4H8I A;  1L5T A;  4LZ7 A;  2PT2 A;  1FBF A;  1WDN A;  1NH7 A;  4QXD A;  1R9Q A;  4WED A;  3FXR A;  3TCF A;  1IMA A;  4WEP A;  3OSR A;  3LBS A;  5CMM A;  1R6Z A;  2CZL A;  1SPI A;  1N7W A;  1XVY A;  3S9E A;  5DW8 A;  4UAC A;  4JSO A;  1MQJ A;  1DBZ A;  1B46 A;  4QBA A;  3KJT A;  4MX6 A;  4GX3 A;  4N8Y A;  1JQF A;  4IO6 A;  1POY 1;  3TTL A;  5K2X A;  3R26 A;  2CZK A;  2Z8D A;  2F36 A;  1QKA A;  3FUZ A;  2F3B A;  4JWX A;  2F78 A;  3IJX B;  4YKI A;  1H45 A;  1ELJ A;  3Q28 A;  4NF8 B;  3RTF B;  3SEV A;  2A5S A;  4JWY A;  1NNF A;  4NMY A;  4I3Y A;  2H99 A;  2QMW A;  4O7M A;  3MST A;  2HAV A;  2ESN A;  5BUU A;  3H06 B;  5I59 B;  4EQB A;  3N6T A;  2NOO A;  2QMX A;  3TMG A;  4NF4 A;  1MXW A;  3W15 C;  3F11 A;  5ICQ A;  1H76 A;  4EXK A;  1Z7N E;  3IB1 A;  1MQD A;  3CSG A;  1Y1M A;  5H8N B;  3VVD A;  2UVH A;  3N5L A;  3V8X B;  4I1D A;  2Y7R A;  4ESW A;  4I3E A;  4F1V A;  4MJO A;  1B3G A;  3PUX E;  4KYD A;  1I6B A;  1EZO A;  2ONK E;  1XI6 A;  4GVO A;  5EYF A;  2G93 A;  4RA1 A;  3TPA A;  3SEX A;  4GWO A;  4GWS A;  1Q35 A;  5JTY B;  3V89 B;  1Y20 A;  4DXU A;  2H5Y A;  3Q25 A;  2NVU B;  4ZS9 A;  1R1N A;  2PMS A;  4KPT A;  1LBC A;  4U21 A;  5A5X A;  1FPJ A;  2XXW A;  3OO6 A;  4TLL B;  2UYE A;  4EXL A;  3FVK A;  1FPL A;  1EYI A;  1URD A;  4KD5 A;  4YIC A;  4OET A;  4QFK A;  1B0L A;  1TWY A;  3LUY A;  4LON B;  2O7U A;  3ILU B;  3MP8 A;  2FIX A;  1BLF A;  3CR9 A;  5J1D A;  3T93 B;  3EN3 A;  4YU0 A;  1ZU0 A;  3UGW A;  2H25 A;  4KFQ A;  3G3I A;  2RCB A;  4GWY A;  3QUF A;  4LN5 A;  1XC1 A;  4QRZ A;  3M3L A;  4GBW A;  4R75 A;  3B7D A;  1DCU A;  5FBP A;  2XXX A;  4XIG Q;  4OEN A;  1B3F A;  4N91 A;  4ZE9 A;  1LBV A;  4BDQ A;  1UIU A;  1NV2 A;  4IO7 A;  2HQ0 A;  3TCH A;  2UVG A;  1FPI A;  5FHN A;  2W7Y A;  4PAF A;  1MXU A;  4H5G A;  1LLS A;  4R2B A;  1UTB B;  3C34 A;  2I0B A;  4GWU A;  4F2Q A;  4P1E A;  4KCD A;  4EF2 A;  4PGP A;  3DP4 A;  1EZP A;  1NV3 A;  1FSA A;  4O3C A;  3TFL A;  1I69 A;  5I57 B;  4UA8 A;  2KQZ A;  3LSX A;  5TPA B;  3SZP A;  1I6A A;  3CFL A;  3C9H A;  1FTL A;  4H1X A;  2H9B A;  3H3G A;  2Q8M A;  5B70 A;  3KFM A;  3C33 A;  1B2H A;  3T1B A;  4LQ5 A;  1SVX B;  4ZDM A;  2OBG A;  3RY3 A;  1FRP A;  4DE8 A;  1MS7 A;  4LZ5 A;  4OFL A;  3MWB A;  3TDJ A;  1IMC A;  1XT8 A;  4ELP A;  1DMB A;  1NNT A;  1OLA A;  1YYZ A;  1HSE A;  1CB6 A;  4FED A;  4PFT A;  2BJI A;  4F22 A;  1FQD A;  4NGU A;  3KBZ A;  1LCT A;  4KQP A;  4NHB A;  4BDM A;  5CMC A;  3U72 A;  1SI0 A;  1JVY A;  5DEX B;  2MKZ A;  3MP1 A;  2PFZ A;  4HCY A;  2QL3 A;  4ELQ A;  2ZNS A;  5I2K A;  1RDX A;  3B6W A;  4OFO A;  2B3F A;  1UTH A;  3O6I A;  1B40 A;  4G68 C;  4N6D A;  1LFG A;  2XHD A;  2YPN A;  2Z8E A;  1NL5 A;  3QK6 A;  2GRV A;  1JET A;  4GL8 A;  2DWJ A;  3VV5 A;  2Y7P A;  2DOJ A;  1QJM A;  5EQ7 A;  3OEM A;  3PPN A;  5L9M A;  1SW2 A;  2VD3 A;  3LR1 A;  2QVU A;  3KC1 A;  1AMF A;  3IB2 A;  1N76 A;  4JSD A;  2XXY A;  4EUO A;  2O84 X;  1BIY A;  4HCW A;  3D1R A;  3G7W A;  3TOD A;  4F31 B;  2D5W A;  3W9V A;  1SI1 A;  5TP9 B;  3RT6 B;  4PAI A;  3ECR A;  4Z7E A;  1ZTY A;  4YB6 A;  4DCX A;  5AE4 A;  3M3F A;  1ZMG A;  3FAT A;  3K02 A;  3IOV A;  3PPR A;  1FPG A;  3O66 A;  4XKN A;  2V3T A;  1US4 A;  2DSF A;  1FBE A;  1MM6 A;  1MQI A;  2X7P A;  4O7I A;  2Q2A A;  4F18 A;  4H67 A;  5I58 A;  5F1Q A;  2B4L A;  1URG A;  3KN7 A;  3K2D A;  3DEL B;  2I48 A;  2P0S A;  3U8Q A;  4G8M A;  1LBY A;  2Z23 A;  1FQB A;  3FVG A;  2Z22 A;  3MBP A;  4M4G A;  2ONS A;  3ZKL A;  2XD3 A;  1B0H A;  2KLF A;  4RXL A;  2DVC A;  3OMB A;  2DE2 A;  3OO7 A;  1IMD A;  2V3Q A;  4P47 A;  1DPE A;  2I49 A;  4RPO A;  1FJ9 A;  1H3D A;  1USY H;  1A54 A;  1M5C A;  4Q30 B;  4U2R A;  4XKR A;  1M5D A;  3TCG A;  4HTG A;  2A5T B;  2I58 A;  4NF0 A;  4U1Z A;  2DWH A;  3U1O A;  2NXO A;  4MNI A;  5HPQ A;  3ZS6 A;  2E0S A;  3TUS A;  3KN3 A;  4LVQ A;  3IFA A;  1G0I A;  3CG1 A;  1FBP A;  2V4C A;  2HCA A;  2VGQ A;  3E78 A;  2ZYO A;  1PC3 A;  4GL0 A;  1FPK A;  4BDL A;  4F3S A;  1NUW A;  2HXW A;  4YAH X;  3HV1 A;  2VT5 A;  1ZIU A;  5T3J A;  3SES A;  3KEI A;  1GV8 A;  1P1N A;  2XWI A;  2F97 A;  3A29 A;  5DTB A;  3T9H B;  4H6D A;  4E0W A;  2RCA A;  1YCJ A;  4F3G A;  3K6W A;  4GD5 A;  3V83 A;  1XS5 A;  3DM0 A;  4ZEF A;  1FBH A;  4DIG A;  2F35 A;  2ZYN A;  1B1H A;  3LSL A;  4MNP A;  4HW8 A;  1MM7 A;  3KOS A;  3VE1 B;  3T96 B;  2OLB A;  4XTC Q;  5CRY A;  4XXU A;  4GWX A;  4EDP A;  4ZEB A;  1B7Z A;  4G77 A;  3OD7 A;  4RK9 A;  1I6Q A;  5AA1 A;  1FBC A;  3PD8 A;  5FTI A;  4BLA A;  4O94 A;  5KCJ B;  2Q2C A;  3SER A;  1A7L A;  2V25 A;  3OXN A;  5AA2 B;  4TLM B;  1N0T A;  4PC9 A;  4KCC A;  1B7H A;  3LC8 A;  3PV0 E;  4JWO A;  3FJ7 A;  4P9K A;  4ZEI A;  2QJE A;  4I40 A;  1P99 A;  2HZK A;  2XX8 A;  2GHA A;  1FTK A;  1VDW A;  4FJP A;  1AOV A;  3MZ1 A;  3TTR A;  4YKK A;  4E0X A;  4TQU Q;  4AB5 A;  1A8F A;  4THI A;  1OQH A;  1QVS A;  2OPE A;  1NV0 A;  1DTG A;  4QFO A;  2IA4 A;  3C31 A;  4JVI A;  4RK2 A;  4ONY A;  5IAI A;  3CFZ A;  1MQG A;  3MP6 A;  4IO2 A;  1JNF A;  4O3A A;  1B9J A;  3BFT A;  2V3U A;  3I3V A;  1JW1 A;  3LSW A;  1FBD A;  2O51 A;  2NWJ A;  5DVF A;  2QVR A;  2HXR A;  4IO5 A;  5IM2 A;  4NX1 A;  1QUJ A;  2AL5 A;  3N26 A;  3PU5 A;  1PB8 A;  2OWT A;  3FV1 A;  2AYS A;  5I56 A;  2YLN A;  1AL3 A;  3B6T A;  4LQ2 A;  4FAT A;  1A8E A;  1BP5 A;  1IIW A;  1O7T A;  3CHG A;  1Y3P A;  2DQV A;  1PB7 A;  1IUD A;  3W9W A;  3T9X B;  1IXG A;  1FQE A;  4X9T A;  4XKQ A;  1FPB A;  3MVZ A;  2XXU A;  3VVF A;  2PVU A;  3K6U A;  2FBP A;  1B3H A;  4OXV A;  3RUM A;  3LSF B;  4R73 A;  4OA4 A;  5CMB A;  2FHY A;  2WX9 A;  1OVB A;  1FTJ A;  4WKM A;  1DK4 A;  1ATG A;  3MJN A;  2UVJ A;  4ELR A;  2UVI A;  3FBP A;  3RT8 A;  1B1X A;  3I5O A;  2VOZ A;  2I3V A;  1FTO A;  5ET8 A;  2OWS A;  5HM4 B;  1GTK A;  3FZV A;  3PUV E;  1MQH A;  2THI A;  5HBC A;  2XWO A;  5H8F A;  2Q9T A;  1VFE A;  3QAX A;  4OTE A;  2REJ A;  2PX1 A;  5I2K B;  2Q8J A;  2XX9 A;  2Y7I A;  1ZLQ A;  3U92 A;  5H8Q B;  4R74 A;  2XX7 A;  1B32 A;  4DXB A;  5AA2 D;  4P11 A;  1FPE A;  3PPO A;  2HFB A;  1Y3N A;  3QYT A;  3MQ9 A;  3A09 A;  4H46 A;  4RNS A;  5L9S A;  3CIJ A;  4EQ7 A;  1NH8 A;  1P1Q A;  1MY4 A;  1QKB A;  4P56 A;  5I2N A;  3B50 A;  3PPP A;  2OWZ A;  4JXI A;  3C35 A;  1LAX A;  4NF5 A;  3FVN A;  1RYO A;  1DTZ A;  1MY1 A;  3AXF A;  2CMO A;  1M5B A;  3K00 A;  3MZ9 A; 
#chains in the Genus database with same CATH homology
 4MAG A;  1JP4 A;  4JVD A;  1FPD A;  2OX3 A;  5I5P A;  4GX4 A;  1BK4 A;  3ROJ A;  5EQ7 A;  4F19 A;  4HE0 A;  5EYH A;  3U65 A;  5IGA A;  3B8B A;  2WEF A;  1NV1 A;  5I7I A;  2B4M A;  5IZ3 A;  1NUY A;  1NV4 A;  2QVU A;  3KC1 A;  3EKI A;  2XWK A;  3PTY A;  2WYP A;  4MHF A;  1QGX A;  1AWB A;  4HCW A;  3D1R A;  3W9V A;  2XA5 A;  1RDZ A;  4N8G A;  4PFI A;  4PAI A;  2PFY A;  5LTC A;  1NV7 A;  1LBZ A;  3T0J A;  4AS4 A;  4P3L A;  3BIH A;  2CZI A;  5EQ8 A;  1IMB A;  1D9Q A;  1FPG A;  4N4U A;  1FBE A;  4PF8 A;  4O7I A;  4F18 A;  5LDZ A;  2XWV A;  4HXV A;  4H45 A;  2B4L A;  3HFU A;  1NUX A;  4PGN A;  4PDH A;  3QMF A;  1CNQ A;  1EYK A;  4PAK A;  1LBY A;  1YXI A;  2WYK A;  2PCR A;  1K9Z A;  1YZ0 A;  1IME A;  4XEQ A;  2ZZW A;  2DE2 A;  4PBH A;  3IFC A;  1IMD A;  2V3Q A;  4P47 A;  1FJ9 A;  4GWW A;  4DI4 B;  2DE3 A;  4JVC A;  2F5X A;  4GBV A;  2GQ1 A;  1Q9D A;  3LV0 A;  3FXB A;  4NF0 A;  1NI9 A;  4MNI A;  1NV6 A;  1FBF A;  4PET A;  1FBG A;  2HPG A;  3IFA A;  4QXD A;  1G0I A;  1IMA A;  1FBP A;  2V4C A;  3E78 A;  1SPI A;  4O8M A;  2KR0 A;  5DW8 A;  1FPK A;  1DBZ A;  1KZ8 A;  4PFB A;  2R8T A;  4QBA A;  4OVT A;  4MX6 A;  4NAP A;  4GX3 A;  4N8Y A;  1NUW A;  2VT5 A;  5EYG A;  3MYU A;  5T3J A;  2CZK A;  2CZH A;  4OAN A;  1INP A;  5CM6 A;  2XWI A;  3A29 A;  2F3B A;  5EQA A;  4X8R A;  4NQ8 A;  5ET7 A;  4PFR A;  4I3Y A;  1FPF A;  4O7M A;  3GYY A;  1FBH A;  4GX6 A;  3MST A;  4MNP A;  1EYJ A;  1FTA A;  2Q74 A;  4M1V A;  5EQ9 A;  4GWX A;  3RPL B;  2P3N A;  5JK4 A;  4DI3 D;  2WBD A;  4UAB A;  1FBC A;  4O94 A;  3RYD A;  4I3E A;  4AS5 A;  4F1V A;  4MJO A;  5F24 A;  4NG7 A;  3BIG A;  4HE1 A;  2VPO A;  4PC9 A;  1XI6 A;  1NUZ A;  2Y5L A;  4P9K A;  2CEY A;  2Y5K A;  4GWS A;  4I40 A;  2HZK A;  4GWZ A;  3RPL A;  1VDW A;  4KXP A;  4NN3 A;  4N81 A;  1LBX A;  1FPJ A;  1NV0 A;  2ZZX A;  4MNC A;  1K9Y A;  2F3D A;  4JVI A;  2WBB A;  4FBP A;  1FPL A;  1EYI A;  4PF6 A;  4YIC A;  2QFL A;  4IR8 A;  2L5V A;  2FIX A;  5J1D A;  4N6K A;  3KC0 A;  4MMP A;  1FBD A;  5I3S A;  2QVR A;  2HXR A;  4HE2 A;  5IM2 A;  4NX1 A;  4GWY A;  4LN5 A;  3E79 A;  4GBW A;  4PTK A;  1IMF A;  1DCU A;  5FBP A;  4X04 A;  4N91 A;  2XXK A;  1LBV A;  2DE4 A;  1G0H A;  1NV2 A;  1LBW A;  4YZZ A;  4MIJ A;  4PDD A;  1FPI A;  3CHG A;  4PAF A;  4XFE A;  3W9W A;  4G61 A;  5IZZ A;  4GWU A;  3ISP A;  4X9T A;  1FPB A;  5IZ1 A;  2VPN A;  4P1E A;  3NOH A;  2FBP A;  4PE3 A;  4MCO A;  5J16 A;  4N17 A;  4P8B A;  4PGP A;  4OA4 A;  1FJ6 A;  1NV3 A;  1FSA A;  2FHY A;  2WX9 A;  1KA0 A;  1DK4 A;  2KQZ A;  3FBP A;  3SZP A;  1KA1 A;  2Q8M A;  2ZZV A;  5ET8 A;  1NV5 A;  3T1B A;  5ESY A;  5ET6 A;  2XWO A;  4OVP A;  1FRP A;  2Q9T A;  2HZL A;  2HHM A;  5ET5 A;  1IMC A;  2DVZ A;  4F1U A;  1YYZ A;  1LEV A;  4XF5 A;  5A5L A;  2BJI A;  4NGU A;  3KBZ A;  1FPE A;  3LUZ A;  4PBQ A;  4NHB A;  2QVV A;  4MEV A;  4P1L A;  2QPQ A;  2MKZ A;  4H46 A;  2JJK A;  2PFZ A;  4HCY A;  2P3V A;  1RDX A;  4OVQ A;  2CEX A;  2FIE A;  4P56 A;  4N15 A;  3B50 A;  2OWZ A;  4PCD A;  2DDK A;  4N6D A;  4OVS A;  2FVZ A;  1RDY A;  5IZ3 B;  4OVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...