1IMBA

Structural analysis of inositol monophosphatase complexes with substrates
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inositol monophosphatase complexes with substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 88
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imbA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imbA02
1NV4A 1RDXA 3ROJA 2WBDA 1LBVA 4I3EA 3KC0A 1LBXA 4GWWA 1FJ6A 5EYGA 2Q8MA 5LDZA 5F24A 1FPJA 5T3JA 2JJKA 3RPLB 3D1RA 3IFAA 1NUYA 1FBHA 4GWXA 1SPIA 4MJOA 1LBWA 2VT5A 2P3NA 1BK4A 2CZKA 4H45A 2F3DA 1FBFA 1FJ9A 1IMFA 3RPLA 1IMCA 1LBZA 1NV1A 1KZ8A 3LV0A 4GWSA 1KA1A 2WEFA 4GWZA 2QVUA 5EQ7A 1FBPA 1NV5A 2WBBA 1FTAA 1RDZA 2Y5KA 4H46A 1FPDA 2FIXA 3LUZA 1LEVA 2FHYA 1NV0A 2BJIA 1IMDA 5EQAA 2R8TA 2OX3A 2QFLA 3IFCA 4I40A 5ET6A 5A5LA 2F3BA 2QVVA 1FPFA 2CZIA 4KXPA 5ET5A 5IZ3B 1G0HA 1NUZA 1FPGA 1FPKA 2FIEA 1FRPA 4N81A 1VDWA 1DK4A 2OWZA 4GX3A 4O7IA 2GQ1A 1NV6A 4GX4A 5ET8A 1LBYA 1YYZA 2FBPA 4GWUA 5DW8A 3QMFA 1YZ0A 1IMEA 2P3VA 5IZ3A 1NV7A 3KBZA 1YXIA 2PCRA 4AS4A 5ESYA 1JP4A 4HE2A 5I3SA 1NV3A 1DBZA 2DDKA 1NUXA 4FBPA 4AS5A 1FBCA 2FVZA 1DCUA 1FPEA 1FPBA 3KC1A 3RYDA 1EYKA 1INPA 1EYJA 3BIHA 1FBEA 1CNQA 1FBDA 5J16A 4IR8A 1G0IA 4I3YA 1K9YA 1NI9A 3B8BA 3A29A 1K9ZA 2Y5LA 1KA0A 4GX6A 3T0JA 1AWBA 4HE0A 1QGXA 2HHMA 2Q74A 3FBPA 1EYIA 1NUWA 4HE1A 5EYHA 1FSAA 1IMBA 1FPLA 2QVRA 1FBGA 1IMAA 5FBPA 4PTKA 1XI6A 1Q9DA 1D9QA 4GBVA 5EQ8A 4GBWA 5IZ1A 4QXDA 5EQ9A 1FPIA 1NV2A 1RDYA 4GWYA 5ET7A 3BIGA 2CZHA 4G61A 4HXVA
chains in the Genus database with same CATH superfamily
4N6DA 4RNSA 2XXHA 1H44A 1Y3NA 5EYGA 3IO6A 5CI5A 4TOZA 2Q2CA 1GTKA 2ZYKA 4NHBA 1S50A 4RPNA 3HCQA 4MIJA 1FBHA 2XD2A 1LBWA 4YMAA 3N94A 4WEPA 2P3NA 2BJJX 3SZPA 2QPQA 1DOTA 4RJZA 2H98A 4DZ1A 5I5PA 4NGUA 3EHUA 2YJPA 3C31A 4PDDA 4GF8A 1P1OA 1IMDA 1M5BA 5ET6A 2VHAA 4ECFA 5FHNA 4POWA 4MFIA 3CHGA 4H8IA 4FJPA 5I56B 1OLAA 5ET8A 3CG1A 3RT6B 4Q0CA 5I59A 3FJMA 1R9LA 4MLVA 4MHFA 3NOHA 4MNCA 4HE2A 3K6VA 3SETA 5DVJA 4EXKA 3K6XA 3MZBA 3LUYA 3ZSFA 1IUDA 2H4IA 4EF2A 5B7DA 3SKPA 5I58B 1K9YA 4AQ4A 4JXIA 4R9FA 4ONYA 3PD8A 4OZ9A 3T93B 4GX6A 3Q26A 3T9VA 1N04A 3PPRA 1M5DA 3FBPA 1XVYA 3ILTB 4ELRA 4KCDA 3FXUA 3OSQA 3PD9A 5ET7A 4ZS9A 3A3CA 3MPLA 1ZLQA 1RDXA 4N6PA 3PPPA 5DVIA 3LBSA 3OEKA 2B4MA 1OQGA 3N26A 1QULA 2DSFA 4NF8B 1MPCA 3HO7A 3CVGA 3ECRA 1D4NA 2PFZA 4X1BA 4NF5A 4PBQA 4Z7EA 5DTBA 1M5FA 4YICA 4O3AA 4F18A 4JBZA 4DIGA 4GWZA 2KR0A 3QXMA 1DPPA 4G8NA 4BLAA 1LFGA 2ZYNA 3B6QA 3W15C 2V3TA 1JNFA 3H6TA 3C32A 2RF1A 3U72A 2UYEA 1SYHA 3DP8A 1NMUA 2HEUA 4OXVA 2DXRA 5I2KA 3FVNA 3FZVA 5I56A 3SESA 4LZ5A 4IY5A 2RCAA 4K3FA 3UIFA 1WODA 5K2YA 3CR9A 4E0WA 2Z23A 1EH3A 1Y4TA 4DDDA 4AS4A 3QYTA 3OO9A 3RPWA 1OIBA 2FVZA 1LBBA 5J1DA 4E0XA 4OEUA 4YKIA 4H67A 4N15A 4F39A 3B8BA 3O28A 2O51A 3ISPA 4QSDA 4XXUA 4OEVA 4YU0A 1PBPA 1D9QA 4QXDA 1PDAA 3IX1A 2ONSA 1LGBC 1OLCA 4M4GA 3S9LC 4PAIA 4PFIA 1FJ6A 1NH7A 5LDZA 1VR5A 3PGFA 2REJA 1FQFA 3G3KA 3Q25A 1I6QA 4MJOA 2ZYOA 3S2VA 1A40A 1ZMGA 3RNNA 4BDMA 2F3DA 1OVBA 2F7AA 5EHSA 1LBZA 2GFEA 1SW2A 4M1VA 2WEFA 3RTWB 1ANFA 1JEUA 2GHAA 4JDFA 5IZZA 1MS7A 3IJOB 1A7LA 1H3DA 5H8NA 4MBPA 3TAJA 3ILUB 3N5LA 4IO5A 3MWBA 4GWOA 2FIEA 4ELPA 4F22A 1VDWA 4OVPA 1Y3PA 4RY1A 5B70A 4HCWA 1AOVA 3U1OA 2ANJA 3BKIB 4QSEA 1NFTA 4TLLB 5H8HA 4AS5A 1DCUA 2P0SA 4NE4A 2OJTA 3KC1A 1EYJA 1OQHA 2F7CA 1YTVA 4FAJA 3VDFA 4POXA 1CB6A 3O6IA 4GQOA 1AWBA 2HZKA 3M8UA 2D5WA 4MH5A 2ZXTA 3QUJA 3SEUA 5I58A 2XWIA 1LAGE 2Q89A 5I2KB 5A5XA 1SQYA 3QUFA 5EQ9A 2Z22A 3W9VA 1NV4A 3C4MA 4RPOA 1N84A 1J1NA 4GWWA 3GXAA 3FASA 1POTA 4N4UA 1JVYA 1B9JA 3I6VA 4YKKA 1DSNA 3TTNA 2RC7A 3O66A 3FV2A 1B3GA 2DQVA 3K6WA 1H76A 3RTFB 1MM6A 3USDA 3FVGA 3O6HA 1N76A 2XXQA 4OWDA 4PP0A 1GV8A 4H1XA 1LB9A 1SVXB 3K0VA 1NV5A 1VFEA 2Q9TA 4H46A 4UACA 2XXWA 3C35A 3IFCA 4I40A 2XA5A 3TMGA 4XFEA 4Q30B 4KXPA 4BDOA 5H8QA 3CG3A 4GLIA 2DWHA 3IOUA 3MP8A 5IM2A 1NUZA 1LAHE 1N3XA 4G68C 2FA7A 3LSLA 1FQEA 2AL5A 2P3VA 2XXRA 1RYXA 3TQWA 4PC9A 4PFRA 2UYFA 2CEXA 1DBZA 3Q27A 1NUXA 4DXUA 2B65A 3CRBA 1Q35A 5ELVA 4G77A 4NTLA 2CMOA 2HAUA 3O6GA 2F35A 1PB7A 4ELOA 1P1NA 2XXPA 3MBPA 2M8CA 3K00A 3K2DA 1IMAA 1SI0A 2PX1A 1Q9DA 3DM0A 2HCAA 4GD5A 1FTKA 4YB6A 3RY3A 2DXYA 3UK4A 4JSOA 4GL0A 1ZKBA 3PU5A 1PC3A 3D4CA 3PPOA 4JVIA 5TU0A 2ZNUA 3IB1A 1XHYA 3MVWA 5LOMA 3QIMA 4NAPA 1JQFA 1MY1A 5FTIA 2XXYA 3LV0A 4HTGA 3Q29A 2I4BA 4N17A 2WBBA 2Y84A 2PBWA 5TP9A 4FE8A 1NV0A 4U1OA 3LSFB 2R8TA 1YAEA 3CIJA 4R74A 4OESA 5EHMA 4LONB 3R6UA 2V3UA 4FEDA 2OWZA 3O97A 5H8NB 4EUOA 1YYZA 2GRVA 3QMFA 3S9EA 4FATA 4EXLA 3PPQA 3KBZA 2OZZA 5ESYA 1JP4A 5TPAB 3CFZA 3CFXA 4O7MA 1VE4A 2QMWA 3IB2A 1IXGA 4LQ2A 2O84X 2CEYA 1XVXA 3CSGA 4F19A 5FHMA 4PQJA 3UN6A 4IO7A 1JW5A 2WKYA 3CFLA 5EYHA 2XD3A 2I3VA 1FQBA 2X7PA 2X26A 4R6HA 3SEYA 4G61A 2Z8EA 3QSLA 4PCDA 1TXFA 1LCFA 3RT8A 4NN3A 2ABHA 4FIMA 3KN7A 1LAXA 3ZKKA 3D4GA 1A54A 4H6DA 3PMXA 4O94A 4OETA 3IO4A 2VT5A 1I6AA 1FQAA 4G68A 1IIWA 4YB7A 3IL1B 3IOVA 1FW0A 3TTRA 4BDRA 1P1UA 1TFDA 2AIXA 3MSTA 5JTYB 2B3BA 1II5A 1MQIA 3KZGA 2H99A 1G0HA 4N81A 4BDLA 4N8GA 1RYOA 1SW5A 2FBPA 3VVDA 1USYE 3EHSA 1MY2A 5I3SA 3R7XA 4ZEFA 4XF5A 1O7TA 3EN3A 4H0WA 5AA2D 1INPA 3HPIA 2DOJA 3KSXA 4JVDA 4F3BA 4QFLA 1DTGA 5CMBA 4IR8A 4I3YA 4ZDMA 2E1SA 5I2NA 3M3KA 1IXHA 4OERA 2G29A 2ALUA 4X1DA 2XXXA 4RK2A 2HHMA 1SW1A 1SW4A 1Y9UA 4H5FA 1IXCA 1PEBA 2DVCA 2FYIA 4QSCA 1L5TA 2DYXA 3MW0A 4GBVA 3E79A 1UTBA 2I3WA 1GGGA 3GYYA 1A99A 1B46A 1VSOA 1AL3A 1LBXA 2OLBA 1N0TA 2JJKA 4RYAA 1O64A 3R26A 3TQLA 1B05A 2VPOA 4NWDA 4OQOA 5DT6A 1QVSA 1FBFA 4LUBA 2D21A 5KDTB 1KZ8A 1NV1A 4GWSA 3VVFA 3VVEA 4OVJA 1OMPA 4GIZA 1MY0A 3MP6A 1JW4A 2FIXA 1B2HA 4G4PA 4R75A 5A5LA 4X48A 5I57A 1B0LA 1IZ1A 2Y7IA 4FORA 1B0HA 1FPKA 4GX3A 1P1WA 1PB9A 1TT1A 3G3JA 5DYHA 4DI3D 4GX4A 2F34A 5DW8A 3LSXA 1IMEA 4QF9A 2F6PA 1XOCA 2DDKA 2P1SA 1ZIUA 1B40A 1TWYA 3SEVA 4X04A 4I9DA 3K01A 5CRYA 2Y7KA 1CNQA 2Y7PA 1B58A 1LBCA 4C1TA 1NNFA 1MXUA 2XXUA 1EYIA 3OELA 4XEQA 1IMBA 5AA4A 4JWYA 1FPIA 3EHTA 3S9MC 3BIGA 1NKXA 3ROJA 4NF6B 2RINA 1QUIA 2G93A 1US5A 5I59B 3MVYA 2WX9A 3T66A 2F6GA 1SPIA 1B1XA 1EZPA 2GHBA 4JVCA 2CZLA 2UXAA 3S9NC 1FJ9A 1Y1ZA 4F1VA 4NMYA 1LFHA 3H6WA 4YKJA 2PMSA 1R9QA 1RDZA 2Y5KA 1MG1A 4DI4B 3W9WA 2DE4A 1O63A 5H8FA 2XXTA 1ELJA 4JB7A 5H8SA 5CBSA 1SI1A 2Q88A 3TZAA 1NV7A 3C33A 4PFTA 4R6KA 4NF0A 1NV3A 1QKAA 1DMBA 3K1MA 1B1HA 5AE4A 2Q8JA 2O1MA 4YB5A 4U1ZA 2V4CA 2VD2A 2XXKA 2O7IA 4OHNA 3TCFA 3OEMA 1G0IA 3MC2A 3FXBA 2QS2A 1LB8A 4MNPA 2Y5LA 3FJ7A 3PMVA 3TCGA 3BFTA 4DLDA 3T22A 3MZ9A 2HAVA 3FIRA 4ZEKA 4GBWA 2CZHA 2Z8FA 1MXXA 4KYDA 4PETA 5ITOA 4P11A 4I3EA 1PB8A 3P7IA 5I84A 1FPJA 4F2OA 4ELQA 4MX6A 3HSTA 4O3BA 3RPLB 1BTJA 1MPBA 4OANA 4EQBA 2QSXA 4NWCA 5HM4B 4GOTA 3RGYA 4ZE9A 3MQ9A 4QFKA 2I48A 5CMKA 3RLFE 4KD5A 4N91A 1SBPA 3FXRA 1B5IA 3TODA 2ZYMA 1JETA 3E3KA 2BJIA 3IR1A 2F3BA 2R6GE 4GVOA 3LSWA 2RKMA 3CSBA 1SYIA 1FRPA 2VPNA 4ZZAA 1MQJA 3O29A 2H9BA 1JW1A 4PE5B 2DE3A 1T0KA 2HFBA 1I69A 4FECA 1GVCA 2R71A 3AXFA 3FV1A 3TYHA 2OPDA 1YCJA 2PCRA 2F8DA 4RK9A 3T1BA 1AMFA 1ZTYA 3PUZE 1B52A 3GBBA 4PBHA 3HV1A 1JVXA 1BLFA 2I49A 1XC1A 3G7WA 4ZZEA 4P8BA 1B5HA 3U65A 5A5XB 4NEDA 2O1LA 1QUJA 2WYKA 3T0JA 1QGXA 4U23A 2H5YA 1NUWA 4LN5A 3JYRA 3KN8A 4LATA 4C0RA 4JWOA 3GLBA 4L17A 3LR1A 1XS5A 3VV5A 4HXVA 4U2RA 3VLUA 3MP1A 1CE2A 5AA4B 2Q8MA 3KBRA 4P56A 3BBRA 4NG7A 4XTCQ 4RXLA 1DPEA 2DWJA 3N6TA 4F2QA 2OPEA 2XHDA 4PE3A 3E4RA 3PUYE 1PBQA 5K2XA 1LLSA 5CMCA 1BP5A 4F3PA 1LEVA 4QRZA 5DEXB 4KQPA 4NF4B 2OK2A 4LZ7A 1Y4CA 4IO4A 4MAGA 1FQCA 3FUZA 5CM6A 2VD3A 2A5TB 3DP4A 1VFDA 4X8RA 3EKIA 1S7YA 3H06B 1IEJA 2XWKA 4OENA 3MYUA 2F36A 3T9UA 2AYSA 1FTLA 2GH9A 1NL5A 2NOOA 3N6UA 4P1EA 3VXCA 5ICQA 1Y20A 3K02A 1MQGA 4G68B 2X7QA 2O69A 3H3GA 1MY4A 3E78A 4IY6A 4YMBA 1MDQA 2HQ0A 2F97A 1GR2A 2QRYA 4F29A 2Q74A 1FSAA 3L6HA 3B7DA 1LAFE 4AB5A 1WDNA 3KG2A 3EQ1A 4XKRA 3RN8A 4U22A 3VE1B 1MRPA 3M3LA 1Q1KA 3DLNA 3V5AA 1B3LA 3D1RA 3HHGA 2NUVA 1M5EA 4NF5B 4PGPA 1H45A 2ZNSA 2O6AA 2D3IA 2KQZA 1ZJLA 3PV0E 4I62A 1HSEA 4H45A 5EYFA 1P1QA 3RPLA 4IO3A 3VXBA 2PVUA 2XXIA 3IOTA 3VFJA 4EQ9A 2H25A 1BIYA 5HPQA 5EQAA 1S9TA 4MMPA 3HHFA 2QS4A 2QVVA 4THIA 2I4CA 2RC9A 3SERA 3OXNA 3MZ1A 2DP8A 4OFOA 1LFIA 4NF8A 2RC8A 4P0GA 4ZEDA 1R1NA 5M2VA 5L9MA 2E0SA 1JEVA 4OVSA 3OOAA 4H65A 4PDHA 5L9SA 3C9HA 1B7UA 4R9GA 1MQHA 1FPBA 3UP9A 2NXOA 2Y7RA 1B7ZA 4QFPA 3B50A 4KR5A 5KDTA 4XIGQ 4U4XA 1K9ZA 3T9HB 4GXSB 3FXQA 4Q8RA 4HE1A 3HFUA 1FBGA 4PF8A 1FCKA 3VLVA 3OO6A 4MCOA 5EQ8A 2HPGA 1IQ7A 4H5GA 4EF1A 4HW8A 4F3SA 4ESXA 4R6YA 2YPNA 4EQ7A 2VP1A 1ZBMA 2QS3A 3U8QA 2I58A 3MPKA 1Y1MA 2F7BA 1IXIA 4PFUA 3EPEA 5F7VA 1FTOA 1IMFA 5JTYA 3MJNA 3IJXB 1I6BA 3O9PA 1MY3A 5EQ7A 4YKPA 4DE8A 3RUMA 2HZLA 4R73A 1XT8A 1FTMA 4ZE8A 3L6GA 3O2AA 4HS7A 5ITPA 1UQWA 2XWOA 5TP9B 4WXJA 4BDNA 3UORA 2PT2A 3ZS6A 5ET5A 2ONRA 2QL3A 1H43A 5DEXA 1NNPA 4O7IA 3K4UA 3OMBA 3TKDA 3TEPA 5CC2A 5IAIA 4Q5TA 2I0BA 5H8HB 4X9TA 5HBCA 3QK6A 1USYH 3RQTA 2QS1A 2DVZA 4F31B 2RCBA 3I5OA 3KEIA 2NVUB 1ZU0A 4LQ5A 1POY1 3H6VA 1MQDA 4DXCA 3K1NA 2R9JA 4MLQA 2MKZA 4YZZA 2IA4A 1UTBB 1B7HA 1FPLA 3PMWA 3E13X 5JEIA 1ATGA 3KFMA 1EZOA 4WKMA 3KC0A 3TCHA 4ND9A 4MEVA 3KOSA 4PGNA 4YAHX 1P99A 2F5XA 1D9VA 4I8CA 4XKQA 1LCTA 4P47A 1MXYA 3B6WA 3BFUA 3E9XA 1IITA 4OTEA 3H7MA 3A09A 1IMCA 3K6UA 3OD7A 2ESNA 4O8MA 4ZECA 1FTAA 1FTJA 1FPDA 4F3GA 2QMXA 1NNTA 2VOZA 4I1DA 3ODBA 2F78A 3TTMA 4PFBA 1M5CA 1B5JA 5IZ3B 3PUVE 1FPGA 3ONMA 2XXVA 2GQ1A 1URDA 4OYVA 3VLWA 1LBYA 2ZNTA 4GWUA 1B3EA 4P0IA 3GBAA 4OMBA 4JWXA 1RKMA 1MPDA 4P1LA 1F9BA 4KCCA 4OA4A 4H8JA 1N7WA 1MXZA 3UGWA 2W7YA 4G8MA 4PAFA 3Q28A 4BDQA 3RYDA 1EYKA 4ZEIA 3T96B 1FBDA 2V84A 1KWHA 2OCUA 5DVFA 3TFLA 2DE2A 5KCJB 4F1YA 3SEWA 3TUSA 4G2ZA 3TTLA 2P2AA 2A5TA 2DS9A 4PTKA 1NNKA 4IO2A 3U93A 3SDFA 5IZ1A 4DXBA 4GWYA 1NV2A 2NWJA 4FEBA 1Y3QA 2UVJA 2XX9A 3KJ7A 2V93A 2UVIA 5CBRA 3IFAA 4DCYA 1URGA 1NUYA 3DP6A 3G3FA 4XKPA 4GXAA 1QKBA 3KJTA 3JZJA 1MH4A 5AA1A 3IOWA 4LZ8A 4GL8A 1B4ZA 1HSJA 1KA1A 1WVJA 4KFQA 3FATA 4UA8A 3OO8A 1FBPA 4GFRA 1A8EA 1QUKA 3H4ZA 3S4UA 3MAMA 4G8HA 5H8FB 2OWTA 4TLMB 4IO6A 1A8FA 2CZIA 3G3GA 1UIVA 5I57B 4KYSA 4NF6A 2UVGA 3GZGA 4IGTA 2IEEA 5H8QB 2ZZWA 3IAZA 3CI8A 1FBCA 1QW0A 1FPEA 3OO7A 2PFYA 1EZ9A 3PTYA 1FBEA 3JV9A 4QBAA 1QJMA 5BWJA 5KCJA 3FVKA 1NI9A 4MF3A 5FHOA 5KZTA 3U92A 3K1PA 1KA0A 1EU8A 1UTHA 3I3VA 4HE0A 5JK4A 1MH3A 2Y7WA 3DELB 1XI6A 1HSLA 4P3LA 4OFLA 2PT1A 2I6EA 3KOTA 1D3KA 5F24A 2QJEA 3MVXA 4O3CA 2DWIA 5TPAA 3C36A 5FTHA 1DTZA 1URSA 3B6TA 2XX8A 1A55A 1BK4A 2CZKA 2REGA 4OVQA 1N7XA 4PFYA 4UABA 2FNCA 2THIA 1TFAA 5AA3A 3G3HA 5IGAA 4JSDA 2O7UA 4RA1A 2ONKE 3TPAA 1B3FA 4QFNA 4LA9A 5CMMA 3KSJA 1MXWA 4DCXA 1N3WA 5L8DA 1B4HA 4N6KA 4KHZE 4R2BA 4IB2A 2ZZXA 4MNIA 4KYEA 5AA2A 3TTKA 3V8XB 3KGCA 1OVTA 3QAXA 5IZ3A 3WAFA 1AIVA 4NQ8A 4N13A 4U4SA 4PAKA 3MVZA 1B3HA 4IGRA 3G3IA 4N8YA 5J16A 5ISUA 4QHQA 2UVHA 3PPNA 4P9KA 1UTHB 1Z7ME 2Z8DA 3IK6B 4R72A 2XWVA 5LTCA 4QFOA 2AL4A 1SDXA 4F1UA 2QVRA 5FBPA 2DWAA 1LSTA 1B51A 3H03A 4AB6A 3H6UA 4U21A 1US4A 1RDYA 2B3FA 3EF7A 4LVQA 4N07A 1MM7A 4LP2B 2WBDA 1LBVA 2V25A 2OBGA 5T3JA 4OVTA 4OFJA 4GWXA 1D9YA 3F11A 3OENA 5I7IA 3A3UA 3PUXE 4TQUQ 5IKBA 2OWSA 2XX7A 3M3FA 3FVOA 3C34A 1B6HA 3TDJA 3WAEA 4WEDA 3FGSA 2QVUA 3FJGA 5ICTA 2ZMBA 2PYYA 4NX1A 5BUUA 1B32A 2KLFA 5I2NB 4ESWA 1UIUA 3LUZA 2A5SA 2FHYA 1SD3A 2OX3A 2QFLA 3HN0A 1FPFA 3PUWE 3SEXA 1BKAA 1MXVA 5L9OA 3ZKLA 2LAOA 2HXRA 2YLNA 5AA2B 3TELA 3UA8A 1DK4A 3IORA 3T9XB 1NV6A 2HXWA 4PFWA 5F1QA 1Z7NE 1YZ0A 3IB0A 4KPTA 4OVRA 1R6ZA 1YXIA 3V89B 4FBPA 4R2FA 2Q2AA 4C1UA 1FQDA 2WYPA 3MUQA 4KI0E 2I0CA 4ZEBA 3LC8A 4Z0IA 3OSRA 3BIHA 2O68A 3V83A 1YPNA 2VGQA 4GRKA 1NH8A 3KN3A 3U94A 4ISUA 1MDP1 3A29A 2B4LA 4XKNA 4PF6A 4EDPA 3THIA 1AH5A 4NF4A 2V3QA 3FD3A 4HCYA 2ZZVA 2L5VA
chains in the Genus database with same CATH topology
1NV4A 4X9TA 1RDXA 3ROJA 4N6DA 3GYYA 4PCDA 3ISPA 4F1UA 2WBDA 1LBVA 4I3EA 2B4MA 4PAIA 3KC0A 4NN3A 3W9VA 1LBXA 4GWWA 1FJ6A 5EYGA 4PFIA 2Q8MA 4JVIA 5LDZA 4P56A 5F24A 1FPJA 5T3JA 4NHBA 2JJKA 4MX6A 4MEVA 3RPLB 3D1RA 4NG7A 4OVTA 3IFAA 2WX9A 4N4UA 4PGNA 4MIJA 2F5XA 4O94A 1NUYA 1FBHA 4GWXA 4OANA 4PGPA 2PFZA 1SPIA 4MJOA 1LBWA 2VT5A 2VPOA 5I7IA 4P47A 2KQZA 4PBQA 4NAPA 2P3NA 4JVCA 1BK4A 2CZKA 4OVQA 4H45A 2F3DA 1FBFA 4YICA 4PETA 1FJ9A 1IMFA 3RPLA 4PE3A 1IMCA 4UABA 3SZPA 1LBZA 1NV1A 1KZ8A 3LV0A 4GWSA 2QPQA 4F18A 4M1VA 1KA1A 2WEFA 4N91A 4O8MA 4GWZA 2QVUA 5EQ7A 4F1VA 2KR0A 4NX1A 1FBPA 5IGAA 5JK4A 2HZLA 1NV5A 4N17A 4NGUA 5I5PA 2WBBA 2Q9TA 1FTAA 1RDZA 2Y5KA 3MSTA 4H46A 4PDDA 1FPDA 2FIXA 3LUZA 5IZZA 1LEVA 2FHYA 1NV0A 2BJIA 4P3LA 1IMDA 5EQAA 2R8TA 4DI4B 2OX3A 2QFLA 3IFCA 4I40A 5ET6A 2XA5A 5A5LA 2F3BA 2XWOA 4MMPA 4XFEA 3W9WA 2DE4A 2QVVA 1FPFA 2CZIA 4KXPA 4PFBA 4MAGA 5CM6A 3CHGA 5ET5A 5IZ3B 4N6KA 1G0HA 5IM2A 1NUZA 1FPGA 1FPKA 2FIEA 1FRPA 4N81A 2HXRA 2VPNA 2ZZXA 1VDWA 4N8GA 4OVPA 1DK4A 2OWZA 4GX3A 4O7IA 2GQ1A 4MNIA 4PDHA 1NV6A 4GX4A 5ET8A 1LBYA 1YYZA 2DE3A 4X8RA 2FBPA 4HCWA 4GWUA 5DW8A 3QMFA 1YZ0A 3EKIA 1IMEA 2P3VA 2ZZWA 4OVRA 2XWKA 4MHFA 5IZ3A 1NV7A 4P1LA 3KBZA 4PC9A 4OVSA 1YXIA 4PFRA 2PCRA 3NOHA 4AS4A 4MNCA 4OA4A 5ESYA 1JP4A 4HE2A 5I3SA 1NV3A 2CEXA 3MYUA 1DBZA 2DDKA 4NF0A 4NQ8A 4PAKA 1NUXA 4XF5A 4FBPA 4AS5A 2DVZA 1FBCA 2FVZA 1DCUA 4O7MA 4XEQA 1FPEA 4PAFA 2WYPA 4PBHA 1FPBA 3KC1A 5J1DA 4X04A 3RYDA 1EYKA 1INPA 1EYJA 3BIHA 2PFYA 3PTYA 4JVDA 4P1EA 1FBEA 3B50A 4P8BA 2V4CA 1CNQA 4N8YA 1FBDA 5J16A 4QBAA 4IR8A 2XXKA 4N15A 1G0IA 4I3YA 1K9YA 1NI9A 2MKZA 4P9KA 3FXBA 4YZZA 2DE2A 2CEYA 3U65A 3B8BA 4F19A 3A29A 4MNPA 3E78A 1K9ZA 2Y5LA 2B4LA 1KA0A 4GX6A 2XWVA 4PF6A 2WYKA 3T0JA 5LTCA 4DI3D 1AWBA 2HZKA 4HE0A 1QGXA 2HHMA 2Q74A 3FBPA 1EYIA 1NUWA 4HE1A 5EYHA 3HFUA 1FSAA 1IMBA 1FPLA 2QVRA 1FBGA 1IMAA 5FBPA 2V3QA 4LN5A 4PTKA 2XWIA 4HCYA 4PF8A 3T1BA 1XI6A 1Q9DA 2ZZVA 4MCOA 1D9QA 4GBVA 5EQ8A 4GBWA 5IZ1A 4QXDA 5EQ9A 1FPIA 1NV2A 1RDYA 4GWYA 2HPGA 2L5VA 5ET7A 3BIGA 2CZHA 3E79A 4G61A 4HXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV4 A;  1RDX A;  3ROJ A;  2WBD A;  1LBV A;  4I3E A;  3KC0 A;  1LBX A;  4GWW A;  1FJ6 A;  5EYG A;  2Q8M A;  5LDZ A;  5F24 A;  1FPJ A;  5T3J A;  2JJK A;  3RPL B;  3D1R A;  3IFA A;  1NUY A;  1FBH A;  4GWX A;  1SPI A;  4MJO A;  1LBW A;  2VT5 A;  2P3N A;  1BK4 A;  2CZK A;  4H45 A;  2F3D A;  1FBF A;  1FJ9 A;  1IMF A;  3RPL A;  1IMC A;  1LBZ A;  1NV1 A;  1KZ8 A;  3LV0 A;  4GWS A;  1KA1 A;  2WEF A;  4GWZ A;  2QVU A;  5EQ7 A;  1FBP A;  1NV5 A;  2WBB A;  1FTA A;  1RDZ A;  2Y5K A;  4H46 A;  1FPD A;  2FIX A;  3LUZ A;  1LEV A;  2FHY A;  1NV0 A;  2BJI A;  1IMD A;  5EQA A;  2R8T A;  2OX3 A;  2QFL A;  3IFC A;  4I40 A;  5ET6 A;  5A5L A;  2F3B A;  2QVV A;  1FPF A;  2CZI A;  4KXP A;  5ET5 A;  5IZ3 B;  1G0H A;  1NUZ A;  1FPG A;  1FPK A;  2FIE A;  1FRP A;  4N81 A;  1VDW A;  1DK4 A;  2OWZ A;  4GX3 A;  4O7I A;  2GQ1 A;  1NV6 A;  4GX4 A;  5ET8 A;  1LBY A;  1YYZ A;  2FBP A;  4GWU A;  5DW8 A;  3QMF A;  1YZ0 A;  1IME A;  2P3V A;  5IZ3 A;  1NV7 A;  3KBZ A;  1YXI A;  2PCR A;  4AS4 A;  5ESY A;  1JP4 A;  4HE2 A;  5I3S A;  1NV3 A;  1DBZ A;  2DDK A;  1NUX A;  4FBP A;  4AS5 A;  1FBC A;  2FVZ A;  1DCU A;  1FPE A;  1FPB A;  3KC1 A;  3RYD A;  1EYK A;  1INP A;  1EYJ A;  3BIH A;  1FBE A;  1CNQ A;  1FBD A;  5J16 A;  4IR8 A;  1G0I A;  4I3Y A;  1K9Y A;  1NI9 A;  3B8B A;  3A29 A;  1K9Z A;  2Y5L A;  1KA0 A;  4GX6 A;  3T0J A;  1AWB A;  4HE0 A;  1QGX A;  2HHM A;  2Q74 A;  3FBP A;  1EYI A;  1NUW A;  4HE1 A;  5EYH A;  1FSA A;  1IMB A;  1FPL A;  2QVR A;  1FBG A;  1IMA A;  5FBP A;  4PTK A;  1XI6 A;  1Q9D A;  1D9Q A;  4GBV A;  5EQ8 A;  4GBW A;  5IZ1 A;  4QXD A;  5EQ9 A;  1FPI A;  1NV2 A;  1RDY A;  4GWY A;  5ET7 A;  3BIG A;  2CZH A;  4G61 A;  4HXV A; 
#chains in the Genus database with same CATH topology
 4N6D A;  4RNS A;  2XXH A;  1H44 A;  1Y3N A;  5EYG A;  3IO6 A;  5CI5 A;  4TOZ A;  2Q2C A;  1GTK A;  2ZYK A;  4NHB A;  1S50 A;  4RPN A;  3HCQ A;  4MIJ A;  1FBH A;  2XD2 A;  1LBW A;  4YMA A;  3N94 A;  4WEP A;  2P3N A;  2BJJ X;  3SZP A;  2QPQ A;  1DOT A;  4RJZ A;  2H98 A;  4DZ1 A;  5I5P A;  4NGU A;  3EHU A;  2YJP A;  3C31 A;  4PDD A;  4GF8 A;  1P1O A;  1IMD A;  1M5B A;  5ET6 A;  2VHA A;  4ECF A;  5FHN A;  4POW A;  4MFI A;  3CHG A;  4H8I A;  4FJP A;  5I56 B;  1OLA A;  5ET8 A;  3CG1 A;  3RT6 B;  4Q0C A;  5I59 A;  3FJM A;  1R9L A;  4MLV A;  4MHF A;  3NOH A;  4MNC A;  4HE2 A;  3K6V A;  3SET A;  5DVJ A;  4EXK A;  3K6X A;  3MZB A;  3LUY A;  3ZSF A;  1IUD A;  2H4I A;  4EF2 A;  5B7D A;  3SKP A;  5I58 B;  1K9Y A;  4AQ4 A;  4JXI A;  4R9F A;  4ONY A;  3PD8 A;  4OZ9 A;  3T93 B;  4GX6 A;  3Q26 A;  3T9V A;  1N04 A;  3PPR A;  1M5D A;  3FBP A;  1XVY A;  3ILT B;  4ELR A;  4KCD A;  3FXU A;  3OSQ A;  3PD9 A;  5ET7 A;  4ZS9 A;  3A3C A;  3MPL A;  1ZLQ A;  1RDX A;  4N6P A;  3PPP A;  5DVI A;  3LBS A;  3OEK A;  2B4M A;  1OQG A;  3N26 A;  1QUL A;  2DSF A;  4NF8 B;  1MPC A;  3HO7 A;  3CVG A;  3ECR A;  1D4N A;  2PFZ A;  4X1B A;  4NF5 A;  4PBQ A;  4Z7E A;  5DTB A;  1M5F A;  4YIC A;  4O3A A;  4F18 A;  4JBZ A;  4DIG A;  4GWZ A;  2KR0 A;  3QXM A;  1DPP A;  4G8N A;  4BLA A;  1LFG A;  2ZYN A;  3B6Q A;  3W15 C;  2V3T A;  1JNF A;  3H6T A;  3C32 A;  2RF1 A;  3U72 A;  2UYE A;  1SYH A;  3DP8 A;  1NMU A;  2HEU A;  4OXV A;  2DXR A;  5I2K A;  3FVN A;  3FZV A;  5I56 A;  3SES A;  4LZ5 A;  4IY5 A;  2RCA A;  4K3F A;  3UIF A;  1WOD A;  5K2Y A;  3CR9 A;  4E0W A;  2Z23 A;  1EH3 A;  1Y4T A;  4DDD A;  4AS4 A;  3QYT A;  3OO9 A;  3RPW A;  1OIB A;  2FVZ A;  1LBB A;  5J1D A;  4E0X A;  4OEU A;  4YKI A;  4H67 A;  4N15 A;  4F39 A;  3B8B A;  3O28 A;  2O51 A;  3ISP A;  4QSD A;  4XXU A;  4OEV A;  4YU0 A;  1PBP A;  1D9Q A;  4QXD A;  1PDA A;  3IX1 A;  2ONS A;  1LGB C;  1OLC A;  4M4G A;  3S9L C;  4PAI A;  4PFI A;  1FJ6 A;  1NH7 A;  5LDZ A;  1VR5 A;  3PGF A;  2REJ A;  1FQF A;  3G3K A;  3Q25 A;  1I6Q A;  4MJO A;  2ZYO A;  3S2V A;  1A40 A;  1ZMG A;  3RNN A;  4BDM A;  2F3D A;  1OVB A;  2F7A A;  5EHS A;  1LBZ A;  2GFE A;  1SW2 A;  4M1V A;  2WEF A;  3RTW B;  1ANF A;  1JEU A;  2GHA A;  4JDF A;  5IZZ A;  1MS7 A;  3IJO B;  1A7L A;  1H3D A;  5H8N A;  4MBP A;  3TAJ A;  3ILU B;  3N5L A;  4IO5 A;  3MWB A;  4GWO A;  2FIE A;  4ELP A;  4F22 A;  1VDW A;  4OVP A;  1Y3P A;  4RY1 A;  5B70 A;  4HCW A;  1AOV A;  3U1O A;  2ANJ A;  3BKI B;  4QSE A;  1NFT A;  4TLL B;  5H8H A;  4AS5 A;  1DCU A;  2P0S A;  4NE4 A;  2OJT A;  3KC1 A;  1EYJ A;  1OQH A;  2F7C A;  1YTV A;  4FAJ A;  3VDF A;  4POX A;  1CB6 A;  3O6I A;  4GQO A;  1AWB A;  2HZK A;  3M8U A;  2D5W A;  4MH5 A;  2ZXT A;  3QUJ A;  3SEU A;  5I58 A;  2XWI A;  1LAG E;  2Q89 A;  5I2K B;  5A5X A;  1SQY A;  3QUF A;  5EQ9 A;  2Z22 A;  3W9V A;  1NV4 A;  3C4M A;  4RPO A;  1N84 A;  1J1N A;  4GWW A;  3GXA A;  3FAS A;  1POT A;  4N4U A;  1JVY A;  1B9J A;  3I6V A;  4YKK A;  1DSN A;  3TTN A;  2RC7 A;  3O66 A;  3FV2 A;  1B3G A;  2DQV A;  3K6W A;  1H76 A;  3RTF B;  1MM6 A;  3USD A;  3FVG A;  3O6H A;  1N76 A;  2XXQ A;  4OWD A;  4PP0 A;  1GV8 A;  4H1X A;  1LB9 A;  1SVX B;  3K0V A;  1NV5 A;  1VFE A;  2Q9T A;  4H46 A;  4UAC A;  2XXW A;  3C35 A;  3IFC A;  4I40 A;  2XA5 A;  3TMG A;  4XFE A;  4Q30 B;  4KXP A;  4BDO A;  5H8Q A;  3CG3 A;  4GLI A;  2DWH A;  3IOU A;  3MP8 A;  5IM2 A;  1NUZ A;  1LAH E;  1N3X A;  4G68 C;  2FA7 A;  3LSL A;  1FQE A;  2AL5 A;  2P3V A;  2XXR A;  1RYX A;  3TQW A;  4PC9 A;  4PFR A;  2UYF A;  2CEX A;  1DBZ A;  3Q27 A;  1NUX A;  4DXU A;  2B65 A;  3CRB A;  1Q35 A;  5ELV A;  4G77 A;  4NTL A;  2CMO A;  2HAU A;  3O6G A;  2F35 A;  1PB7 A;  4ELO A;  1P1N A;  2XXP A;  3MBP A;  2M8C A;  3K00 A;  3K2D A;  1IMA A;  1SI0 A;  2PX1 A;  1Q9D A;  3DM0 A;  2HCA A;  4GD5 A;  1FTK A;  4YB6 A;  3RY3 A;  2DXY A;  3UK4 A;  4JSO A;  4GL0 A;  1ZKB A;  3PU5 A;  1PC3 A;  3D4C A;  3PPO A;  4JVI A;  5TU0 A;  2ZNU A;  3IB1 A;  1XHY A;  3MVW A;  5LOM A;  3QIM A;  4NAP A;  1JQF A;  1MY1 A;  5FTI A;  2XXY A;  3LV0 A;  4HTG A;  3Q29 A;  2I4B A;  4N17 A;  2WBB A;  2Y84 A;  2PBW A;  5TP9 A;  4FE8 A;  1NV0 A;  4U1O A;  3LSF B;  2R8T A;  1YAE A;  3CIJ A;  4R74 A;  4OES A;  5EHM A;  4LON B;  3R6U A;  2V3U A;  4FED A;  2OWZ A;  3O97 A;  5H8N B;  4EUO A;  1YYZ A;  2GRV A;  3QMF A;  3S9E A;  4FAT A;  4EXL A;  3PPQ A;  3KBZ A;  2OZZ A;  5ESY A;  1JP4 A;  5TPA B;  3CFZ A;  3CFX A;  4O7M A;  1VE4 A;  2QMW A;  3IB2 A;  1IXG A;  4LQ2 A;  2O84 X;  2CEY A;  1XVX A;  3CSG A;  4F19 A;  5FHM A;  4PQJ A;  3UN6 A;  4IO7 A;  1JW5 A;  2WKY A;  3CFL A;  5EYH A;  2XD3 A;  2I3V A;  1FQB A;  2X7P A;  2X26 A;  4R6H A;  3SEY A;  4G61 A;  2Z8E A;  3QSL A;  4PCD A;  1TXF A;  1LCF A;  3RT8 A;  4NN3 A;  2ABH A;  4FIM A;  3KN7 A;  1LAX A;  3ZKK A;  3D4G A;  1A54 A;  4H6D A;  3PMX A;  4O94 A;  4OET A;  3IO4 A;  2VT5 A;  1I6A A;  1FQA A;  4G68 A;  1IIW A;  4YB7 A;  3IL1 B;  3IOV A;  1FW0 A;  3TTR A;  4BDR A;  1P1U A;  1TFD A;  2AIX A;  3MST A;  5JTY B;  2B3B A;  1II5 A;  1MQI A;  3KZG A;  2H99 A;  1G0H A;  4N81 A;  4BDL A;  4N8G A;  1RYO A;  1SW5 A;  2FBP A;  3VVD A;  1USY E;  3EHS A;  1MY2 A;  5I3S A;  3R7X A;  4ZEF A;  4XF5 A;  1O7T A;  3EN3 A;  4H0W A;  5AA2 D;  1INP A;  3HPI A;  2DOJ A;  3KSX A;  4JVD A;  4F3B A;  4QFL A;  1DTG A;  5CMB A;  4IR8 A;  4I3Y A;  4ZDM A;  2E1S A;  5I2N A;  3M3K A;  1IXH A;  4OER A;  2G29 A;  2ALU A;  4X1D A;  2XXX A;  4RK2 A;  2HHM A;  1SW1 A;  1SW4 A;  1Y9U A;  4H5F A;  1IXC A;  1PEB A;  2DVC A;  2FYI A;  4QSC A;  1L5T A;  2DYX A;  3MW0 A;  4GBV A;  3E79 A;  1UTB A;  2I3W A;  1GGG A;  3GYY A;  1A99 A;  1B46 A;  1VSO A;  1AL3 A;  1LBX A;  2OLB A;  1N0T A;  2JJK A;  4RYA A;  1O64 A;  3R26 A;  3TQL A;  1B05 A;  2VPO A;  4NWD A;  4OQO A;  5DT6 A;  1QVS A;  1FBF A;  4LUB A;  2D21 A;  5KDT B;  1KZ8 A;  1NV1 A;  4GWS A;  3VVF A;  3VVE A;  4OVJ A;  1OMP A;  4GIZ A;  1MY0 A;  3MP6 A;  1JW4 A;  2FIX A;  1B2H A;  4G4P A;  4R75 A;  5A5L A;  4X48 A;  5I57 A;  1B0L A;  1IZ1 A;  2Y7I A;  4FOR A;  1B0H A;  1FPK A;  4GX3 A;  1P1W A;  1PB9 A;  1TT1 A;  3G3J A;  5DYH A;  4DI3 D;  4GX4 A;  2F34 A;  5DW8 A;  3LSX A;  1IME A;  4QF9 A;  2F6P A;  1XOC A;  2DDK A;  2P1S A;  1ZIU A;  1B40 A;  1TWY A;  3SEV A;  4X04 A;  4I9D A;  3K01 A;  5CRY A;  2Y7K A;  1CNQ A;  2Y7P A;  1B58 A;  1LBC A;  4C1T A;  1NNF A;  1MXU A;  2XXU A;  1EYI A;  3OEL A;  4XEQ A;  1IMB A;  5AA4 A;  4JWY A;  1FPI A;  3EHT A;  3S9M C;  3BIG A;  1NKX A;  3ROJ A;  4NF6 B;  2RIN A;  1QUI A;  2G93 A;  1US5 A;  5I59 B;  3MVY A;  2WX9 A;  3T66 A;  2F6G A;  1SPI A;  1B1X A;  1EZP A;  2GHB A;  4JVC A;  2CZL A;  2UXA A;  3S9N C;  1FJ9 A;  1Y1Z A;  4F1V A;  4NMY A;  1LFH A;  3H6W A;  4YKJ A;  2PMS A;  1R9Q A;  1RDZ A;  2Y5K A;  1MG1 A;  4DI4 B;  3W9W A;  2DE4 A;  1O63 A;  5H8F A;  2XXT A;  1ELJ A;  4JB7 A;  5H8S A;  5CBS A;  1SI1 A;  2Q88 A;  3TZA A;  1NV7 A;  3C33 A;  4PFT A;  4R6K A;  4NF0 A;  1NV3 A;  1QKA A;  1DMB A;  3K1M A;  1B1H A;  5AE4 A;  2Q8J A;  2O1M A;  4YB5 A;  4U1Z A;  2V4C A;  2VD2 A;  2XXK A;  2O7I A;  4OHN A;  3TCF A;  3OEM A;  1G0I A;  3MC2 A;  3FXB A;  2QS2 A;  1LB8 A;  4MNP A;  2Y5L A;  3FJ7 A;  3PMV A;  3TCG A;  3BFT A;  4DLD A;  3T22 A;  3MZ9 A;  2HAV A;  3FIR A;  4ZEK A;  4GBW A;  2CZH A;  2Z8F A;  1MXX A;  4KYD A;  4PET A;  5ITO A;  4P11 A;  4I3E A;  1PB8 A;  3P7I A;  5I84 A;  1FPJ A;  4F2O A;  4ELQ A;  4MX6 A;  3HST A;  4O3B A;  3RPL B;  1BTJ A;  1MPB A;  4OAN A;  4EQB A;  2QSX A;  4NWC A;  5HM4 B;  4GOT A;  3RGY A;  4ZE9 A;  3MQ9 A;  4QFK A;  2I48 A;  5CMK A;  3RLF E;  4KD5 A;  4N91 A;  1SBP A;  3FXR A;  1B5I A;  3TOD A;  2ZYM A;  1JET A;  3E3K A;  2BJI A;  3IR1 A;  2F3B A;  2R6G E;  4GVO A;  3LSW A;  2RKM A;  3CSB A;  1SYI A;  1FRP A;  2VPN A;  4ZZA A;  1MQJ A;  3O29 A;  2H9B A;  1JW1 A;  4PE5 B;  2DE3 A;  1T0K A;  2HFB A;  1I69 A;  4FEC A;  1GVC A;  2R71 A;  3AXF A;  3FV1 A;  3TYH A;  2OPD A;  1YCJ A;  2PCR A;  2F8D A;  4RK9 A;  3T1B A;  1AMF A;  1ZTY A;  3PUZ E;  1B52 A;  3GBB A;  4PBH A;  3HV1 A;  1JVX A;  1BLF A;  2I49 A;  1XC1 A;  3G7W A;  4ZZE A;  4P8B A;  1B5H A;  3U65 A;  5A5X B;  4NED A;  2O1L A;  1QUJ A;  2WYK A;  3T0J A;  1QGX A;  4U23 A;  2H5Y A;  1NUW A;  4LN5 A;  3JYR A;  3KN8 A;  4LAT A;  4C0R A;  4JWO A;  3GLB A;  4L17 A;  3LR1 A;  1XS5 A;  3VV5 A;  4HXV A;  4U2R A;  3VLU A;  3MP1 A;  1CE2 A;  5AA4 B;  2Q8M A;  3KBR A;  4P56 A;  3BBR A;  4NG7 A;  4XTC Q;  4RXL A;  1DPE A;  2DWJ A;  3N6T A;  4F2Q A;  2OPE A;  2XHD A;  4PE3 A;  3E4R A;  3PUY E;  1PBQ A;  5K2X A;  1LLS A;  5CMC A;  1BP5 A;  4F3P A;  1LEV A;  4QRZ A;  5DEX B;  4KQP A;  4NF4 B;  2OK2 A;  4LZ7 A;  1Y4C A;  4IO4 A;  4MAG A;  1FQC A;  3FUZ A;  5CM6 A;  2VD3 A;  2A5T B;  3DP4 A;  1VFD A;  4X8R A;  3EKI A;  1S7Y A;  3H06 B;  1IEJ A;  2XWK A;  4OEN A;  3MYU A;  2F36 A;  3T9U A;  2AYS A;  1FTL A;  2GH9 A;  1NL5 A;  2NOO A;  3N6U A;  4P1E A;  3VXC A;  5ICQ A;  1Y20 A;  3K02 A;  1MQG A;  4G68 B;  2X7Q A;  2O69 A;  3H3G A;  1MY4 A;  3E78 A;  4IY6 A;  4YMB A;  1MDQ A;  2HQ0 A;  2F97 A;  1GR2 A;  2QRY A;  4F29 A;  2Q74 A;  1FSA A;  3L6H A;  3B7D A;  1LAF E;  4AB5 A;  1WDN A;  3KG2 A;  3EQ1 A;  4XKR A;  3RN8 A;  4U22 A;  3VE1 B;  1MRP A;  3M3L A;  1Q1K A;  3DLN A;  3V5A A;  1B3L A;  3D1R A;  3HHG A;  2NUV A;  1M5E A;  4NF5 B;  4PGP A;  1H45 A;  2ZNS A;  2O6A A;  2D3I A;  2KQZ A;  1ZJL A;  3PV0 E;  4I62 A;  1HSE A;  4H45 A;  5EYF A;  1P1Q A;  3RPL A;  4IO3 A;  3VXB A;  2PVU A;  2XXI A;  3IOT A;  3VFJ A;  4EQ9 A;  2H25 A;  1BIY A;  5HPQ A;  5EQA A;  1S9T A;  4MMP A;  3HHF A;  2QS4 A;  2QVV A;  4THI A;  2I4C A;  2RC9 A;  3SER A;  3OXN A;  3MZ1 A;  2DP8 A;  4OFO A;  1LFI A;  4NF8 A;  2RC8 A;  4P0G A;  4ZED A;  1R1N A;  5M2V A;  5L9M A;  2E0S A;  1JEV A;  4OVS A;  3OOA A;  4H65 A;  4PDH A;  5L9S A;  3C9H A;  1B7U A;  4R9G A;  1MQH A;  1FPB A;  3UP9 A;  2NXO A;  2Y7R A;  1B7Z A;  4QFP A;  3B50 A;  4KR5 A;  5KDT A;  4XIG Q;  4U4X A;  1K9Z A;  3T9H B;  4GXS B;  3FXQ A;  4Q8R A;  4HE1 A;  3HFU A;  1FBG A;  4PF8 A;  1FCK A;  3VLV A;  3OO6 A;  4MCO A;  5EQ8 A;  2HPG A;  1IQ7 A;  4H5G A;  4EF1 A;  4HW8 A;  4F3S A;  4ESX A;  4R6Y A;  2YPN A;  4EQ7 A;  2VP1 A;  1ZBM A;  2QS3 A;  3U8Q A;  2I58 A;  3MPK A;  1Y1M A;  2F7B A;  1IXI A;  4PFU A;  3EPE A;  5F7V A;  1FTO A;  1IMF A;  5JTY A;  3MJN A;  3IJX B;  1I6B A;  3O9P A;  1MY3 A;  5EQ7 A;  4YKP A;  4DE8 A;  3RUM A;  2HZL A;  4R73 A;  1XT8 A;  1FTM A;  4ZE8 A;  3L6G A;  3O2A A;  4HS7 A;  5ITP A;  1UQW A;  2XWO A;  5TP9 B;  4WXJ A;  4BDN A;  3UOR A;  2PT2 A;  3ZS6 A;  5ET5 A;  2ONR A;  2QL3 A;  1H43 A;  5DEX A;  1NNP A;  4O7I A;  3K4U A;  3OMB A;  3TKD A;  3TEP A;  5CC2 A;  5IAI A;  4Q5T A;  2I0B A;  5H8H B;  4X9T A;  5HBC A;  3QK6 A;  1USY H;  3RQT A;  2QS1 A;  2DVZ A;  4F31 B;  2RCB A;  3I5O A;  3KEI A;  2NVU B;  1ZU0 A;  4LQ5 A;  1POY 1;  3H6V A;  1MQD A;  4DXC A;  3K1N A;  2R9J A;  4MLQ A;  2MKZ A;  4YZZ A;  2IA4 A;  1UTB B;  1B7H A;  1FPL A;  3PMW A;  3E13 X;  5JEI A;  1ATG A;  3KFM A;  1EZO A;  4WKM A;  3KC0 A;  3TCH A;  4ND9 A;  4MEV A;  3KOS A;  4PGN A;  4YAH X;  1P99 A;  2F5X A;  1D9V A;  4I8C A;  4XKQ A;  1LCT A;  4P47 A;  1MXY A;  3B6W A;  3BFU A;  3E9X A;  1IIT A;  4OTE A;  3H7M A;  3A09 A;  1IMC A;  3K6U A;  3OD7 A;  2ESN A;  4O8M A;  4ZEC A;  1FTA A;  1FTJ A;  1FPD A;  4F3G A;  2QMX A;  1NNT A;  2VOZ A;  4I1D A;  3ODB A;  2F78 A;  3TTM A;  4PFB A;  1M5C A;  1B5J A;  5IZ3 B;  3PUV E;  1FPG A;  3ONM A;  2XXV A;  2GQ1 A;  1URD A;  4OYV A;  3VLW A;  1LBY A;  2ZNT A;  4GWU A;  1B3E A;  4P0I A;  3GBA A;  4OMB A;  4JWX A;  1RKM A;  1MPD A;  4P1L A;  1F9B A;  4KCC A;  4OA4 A;  4H8J A;  1N7W A;  1MXZ A;  3UGW A;  2W7Y A;  4G8M A;  4PAF A;  3Q28 A;  4BDQ A;  3RYD A;  1EYK A;  4ZEI A;  3T96 B;  1FBD A;  2V84 A;  1KWH A;  2OCU A;  5DVF A;  3TFL A;  2DE2 A;  5KCJ B;  4F1Y A;  3SEW A;  3TUS A;  4G2Z A;  3TTL A;  2P2A A;  2A5T A;  2DS9 A;  4PTK A;  1NNK A;  4IO2 A;  3U93 A;  3SDF A;  5IZ1 A;  4DXB A;  4GWY A;  1NV2 A;  2NWJ A;  4FEB A;  1Y3Q A;  2UVJ A;  2XX9 A;  3KJ7 A;  2V93 A;  2UVI A;  5CBR A;  3IFA A;  4DCY A;  1URG A;  1NUY A;  3DP6 A;  3G3F A;  4XKP A;  4GXA A;  1QKB A;  3KJT A;  3JZJ A;  1MH4 A;  5AA1 A;  3IOW A;  4LZ8 A;  4GL8 A;  1B4Z A;  1HSJ A;  1KA1 A;  1WVJ A;  4KFQ A;  3FAT A;  4UA8 A;  3OO8 A;  1FBP A;  4GFR A;  1A8E A;  1QUK A;  3H4Z A;  3S4U A;  3MAM A;  4G8H A;  5H8F B;  2OWT A;  4TLM B;  4IO6 A;  1A8F A;  2CZI A;  3G3G A;  1UIV A;  5I57 B;  4KYS A;  4NF6 A;  2UVG A;  3GZG A;  4IGT A;  2IEE A;  5H8Q B;  2ZZW A;  3IAZ A;  3CI8 A;  1FBC A;  1QW0 A;  1FPE A;  3OO7 A;  2PFY A;  1EZ9 A;  3PTY A;  1FBE A;  3JV9 A;  4QBA A;  1QJM A;  5BWJ A;  5KCJ A;  3FVK A;  1NI9 A;  4MF3 A;  5FHO A;  5KZT A;  3U92 A;  3K1P A;  1KA0 A;  1EU8 A;  1UTH A;  3I3V A;  4HE0 A;  5JK4 A;  1MH3 A;  2Y7W A;  3DEL B;  1XI6 A;  1HSL A;  4P3L A;  4OFL A;  2PT1 A;  2I6E A;  3KOT A;  1D3K A;  5F24 A;  2QJE A;  3MVX A;  4O3C A;  2DWI A;  5TPA A;  3C36 A;  5FTH A;  1DTZ A;  1URS A;  3B6T A;  2XX8 A;  1A55 A;  1BK4 A;  2CZK A;  2REG A;  4OVQ A;  1N7X A;  4PFY A;  4UAB A;  2FNC A;  2THI A;  1TFA A;  5AA3 A;  3G3H A;  5IGA A;  4JSD A;  2O7U A;  4RA1 A;  2ONK E;  3TPA A;  1B3F A;  4QFN A;  4LA9 A;  5CMM A;  3KSJ A;  1MXW A;  4DCX A;  1N3W A;  5L8D A;  1B4H A;  4N6K A;  4KHZ E;  4R2B A;  4IB2 A;  2ZZX A;  4MNI A;  4KYE A;  5AA2 A;  3TTK A;  3V8X B;  3KGC A;  1OVT A;  3QAX A;  5IZ3 A;  3WAF A;  1AIV A;  4NQ8 A;  4N13 A;  4U4S A;  4PAK A;  3MVZ A;  1B3H A;  4IGR A;  3G3I A;  4N8Y A;  5J16 A;  5ISU A;  4QHQ A;  2UVH A;  3PPN A;  4P9K A;  1UTH B;  1Z7M E;  2Z8D A;  3IK6 B;  4R72 A;  2XWV A;  5LTC A;  4QFO A;  2AL4 A;  1SDX A;  4F1U A;  2QVR A;  5FBP A;  2DWA A;  1LST A;  1B51 A;  3H03 A;  4AB6 A;  3H6U A;  4U21 A;  1US4 A;  1RDY A;  2B3F A;  3EF7 A;  4LVQ A;  4N07 A;  1MM7 A;  4LP2 B;  2WBD A;  1LBV A;  2V25 A;  2OBG A;  5T3J A;  4OVT A;  4OFJ A;  4GWX A;  1D9Y A;  3F11 A;  3OEN A;  5I7I A;  3A3U A;  3PUX E;  4TQU Q;  5IKB A;  2OWS A;  2XX7 A;  3M3F A;  3FVO A;  3C34 A;  1B6H A;  3TDJ A;  3WAE A;  4WED A;  3FGS A;  2QVU A;  3FJG A;  5ICT A;  2ZMB A;  2PYY A;  4NX1 A;  5BUU A;  1B32 A;  2KLF A;  5I2N B;  4ESW A;  1UIU A;  3LUZ A;  2A5S A;  2FHY A;  1SD3 A;  2OX3 A;  2QFL A;  3HN0 A;  1FPF A;  3PUW E;  3SEX A;  1BKA A;  1MXV A;  5L9O A;  3ZKL A;  2LAO A;  2HXR A;  2YLN A;  5AA2 B;  3TEL A;  3UA8 A;  1DK4 A;  3IOR A;  3T9X B;  1NV6 A;  2HXW A;  4PFW A;  5F1Q A;  1Z7N E;  1YZ0 A;  3IB0 A;  4KPT A;  4OVR A;  1R6Z A;  1YXI A;  3V89 B;  4FBP A;  4R2F A;  2Q2A A;  4C1U A;  1FQD A;  2WYP A;  3MUQ A;  4KI0 E;  2I0C A;  4ZEB A;  3LC8 A;  4Z0I A;  3OSR A;  3BIH A;  2O68 A;  3V83 A;  1YPN A;  2VGQ A;  4GRK A;  1NH8 A;  3KN3 A;  3U94 A;  4ISU A;  1MDP 1;  3A29 A;  2B4L A;  4XKN A;  4PF6 A;  4EDP A;  3THI A;  1AH5 A;  4NF4 A;  2V3Q A;  3FD3 A;  4HCY A;  2ZZV A;  2L5V A; 
#chains in the Genus database with same CATH homology
 1NV4 A;  4X9T A;  1RDX A;  3ROJ A;  4N6D A;  3GYY A;  4PCD A;  3ISP A;  4F1U A;  2WBD A;  1LBV A;  4I3E A;  2B4M A;  4PAI A;  3KC0 A;  4NN3 A;  3W9V A;  1LBX A;  4GWW A;  1FJ6 A;  5EYG A;  4PFI A;  2Q8M A;  4JVI A;  5LDZ A;  4P56 A;  5F24 A;  1FPJ A;  5T3J A;  4NHB A;  2JJK A;  4MX6 A;  4MEV A;  3RPL B;  3D1R A;  4NG7 A;  4OVT A;  3IFA A;  2WX9 A;  4N4U A;  4PGN A;  4MIJ A;  2F5X A;  4O94 A;  1NUY A;  1FBH A;  4GWX A;  4OAN A;  4PGP A;  2PFZ A;  1SPI A;  4MJO A;  1LBW A;  2VT5 A;  2VPO A;  5I7I A;  4P47 A;  2KQZ A;  4PBQ A;  4NAP A;  2P3N A;  4JVC A;  1BK4 A;  2CZK A;  4OVQ A;  4H45 A;  2F3D A;  1FBF A;  4YIC A;  4PET A;  1FJ9 A;  1IMF A;  3RPL A;  4PE3 A;  1IMC A;  4UAB A;  3SZP A;  1LBZ A;  1NV1 A;  1KZ8 A;  3LV0 A;  4GWS A;  2QPQ A;  4F18 A;  4M1V A;  1KA1 A;  2WEF A;  4N91 A;  4O8M A;  4GWZ A;  2QVU A;  5EQ7 A;  4F1V A;  2KR0 A;  4NX1 A;  1FBP A;  5IGA A;  5JK4 A;  2HZL A;  1NV5 A;  4N17 A;  4NGU A;  5I5P A;  2WBB A;  2Q9T A;  1FTA A;  1RDZ A;  2Y5K A;  3MST A;  4H46 A;  4PDD A;  1FPD A;  2FIX A;  3LUZ A;  5IZZ A;  1LEV A;  2FHY A;  1NV0 A;  2BJI A;  4P3L A;  1IMD A;  5EQA A;  2R8T A;  4DI4 B;  2OX3 A;  2QFL A;  3IFC A;  4I40 A;  5ET6 A;  2XA5 A;  5A5L A;  2F3B A;  2XWO A;  4MMP A;  4XFE A;  3W9W A;  2DE4 A;  2QVV A;  1FPF A;  2CZI A;  4KXP A;  4PFB A;  4MAG A;  5CM6 A;  3CHG A;  5ET5 A;  5IZ3 B;  4N6K A;  1G0H A;  5IM2 A;  1NUZ A;  1FPG A;  1FPK A;  2FIE A;  1FRP A;  4N81 A;  2HXR A;  2VPN A;  2ZZX A;  1VDW A;  4N8G A;  4OVP A;  1DK4 A;  2OWZ A;  4GX3 A;  4O7I A;  2GQ1 A;  4MNI A;  4PDH A;  1NV6 A;  4GX4 A;  5ET8 A;  1LBY A;  1YYZ A;  2DE3 A;  4X8R A;  2FBP A;  4HCW A;  4GWU A;  5DW8 A;  3QMF A;  1YZ0 A;  3EKI A;  1IME A;  2P3V A;  2ZZW A;  4OVR A;  2XWK A;  4MHF A;  5IZ3 A;  1NV7 A;  4P1L A;  3KBZ A;  4PC9 A;  4OVS A;  1YXI A;  4PFR A;  2PCR A;  3NOH A;  4AS4 A;  4MNC A;  4OA4 A;  5ESY A;  1JP4 A;  4HE2 A;  5I3S A;  1NV3 A;  2CEX A;  3MYU A;  1DBZ A;  2DDK A;  4NF0 A;  4NQ8 A;  4PAK A;  1NUX A;  4XF5 A;  4FBP A;  4AS5 A;  2DVZ A;  1FBC A;  2FVZ A;  1DCU A;  4O7M A;  4XEQ A;  1FPE A;  4PAF A;  2WYP A;  4PBH A;  1FPB A;  3KC1 A;  5J1D A;  4X04 A;  3RYD A;  1EYK A;  1INP A;  1EYJ A;  3BIH A;  2PFY A;  3PTY A;  4JVD A;  4P1E A;  1FBE A;  3B50 A;  4P8B A;  2V4C A;  1CNQ A;  4N8Y A;  1FBD A;  5J16 A;  4QBA A;  4IR8 A;  2XXK A;  4N15 A;  1G0I A;  4I3Y A;  1K9Y A;  1NI9 A;  2MKZ A;  4P9K A;  3FXB A;  4YZZ A;  2DE2 A;  2CEY A;  3U65 A;  3B8B A;  4F19 A;  3A29 A;  4MNP A;  3E78 A;  1K9Z A;  2Y5L A;  2B4L A;  1KA0 A;  4GX6 A;  2XWV A;  4PF6 A;  2WYK A;  3T0J A;  5LTC A;  4DI3 D;  1AWB A;  2HZK A;  4HE0 A;  1QGX A;  2HHM A;  2Q74 A;  3FBP A;  1EYI A;  1NUW A;  4HE1 A;  5EYH A;  3HFU A;  1FSA A;  1IMB A;  1FPL A;  2QVR A;  1FBG A;  1IMA A;  5FBP A;  2V3Q A;  4LN5 A;  4PTK A;  2XWI A;  4HCY A;  4PF8 A;  3T1B A;  1XI6 A;  1Q9D A;  2ZZV A;  4MCO A;  1D9Q A;  4GBV A;  5EQ8 A;  4GBW A;  5IZ1 A;  4QXD A;  5EQ9 A;  1FPI A;  1NV2 A;  1RDY A;  4GWY A;  2HPG A;  2L5V A;  5ET7 A;  3BIG A;  2CZH A;  3E79 A;  4G61 A;  4HXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...