5EYGA

Crystal structure of impase/nadp phosphatase complexed with nadp and ca2+
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
265
structure length
256
Chain Sequence
MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
total genus 79
structure length 256
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eygA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eygA02
2WBBA 5EQ9A 4IR8A 4MJOA 3KC1A 5I3SA 1NV5A 2QVVA 4G61A 1NV0A 4GX3A 1NV7A 5ESYA 5LDZA 5IZ3B 2P3NA 1BK4A 1K9ZA 1FPFA 1AWBA 1FPLA 5ET5A 2FHYA 1RDXA 1XI6A 4HE2A 3BIGA 4GX6A 1FPJA 3D1RA 1IMAA 1NUWA 4GWYA 2CZIA 1IMFA 1KZ8A 1YXIA 2HHMA 2OX3A 2OWZA 5EYHA 2FIXA 5IZ1A 5J16A 1EYJA 2Y5KA 3IFCA 4I3EA 2DDKA 1QGXA 5ET6A 1FBPA 5T3JA 1LBWA 3RYDA 5EYGA 5FBPA 2WBDA 3ROJA 1KA1A 1NI9A 5EQ7A 1NUYA 1IMDA 2GQ1A 4I40A 5ET8A 5IZ3A 4O7IA 1FBDA 5F24A 1NV3A 3BIHA 2R8TA 1G0IA 2QFLA 1FPEA 1NV1A 1SPIA 2BJIA 2VT5A 4GX4A 2Y5LA 5ET7A 3LUZA 2Q74A 4HE1A 3KBZA 1LBVA 1FBFA 3IFAA 4KXPA 2P3VA 4HE0A 1RDYA 3T0JA 1LBYA 1FTAA 1NV2A 4GWXA 1IMCA 2WEFA 5EQAA 1VDWA 1FBEA 1FRPA 1YYZA 3B8BA 1DK4A 4GBVA 2F3BA 4I3YA 2FBPA 2QVRA 4GWUA 1IMBA 1IMEA 2FVZA 1EYKA 4GWZA 3RPLA 5DW8A 4N81A 5A5LA 1FSAA 1DBZA 3KC0A 1G0HA 5EQ8A 2CZKA 1DCUA 2PCRA 4GBWA 1EYIA 4H45A 4AS5A 1LBZA 2Q8MA 1FJ6A 3A29A 3FBPA 1D9QA 3RPLB 2F3DA 3LV0A 1FBHA 4PTKA 1FPIA 1FPGA 3QMFA 1NUXA 4AS4A 1LBXA 4H46A 2QVUA 1KA0A 1JP4A 4HXVA 1K9YA 2JJKA 2CZHA 1NV4A 1INPA 1NV6A 1NUZA 4FBPA 1FBCA 4GWSA 1RDZA 1FJ9A 4QXDA 4GWWA 1Q9DA 1YZ0A 1LEVA 2FIEA 1FPBA 1FPKA 1CNQA 1FBGA 1FPDA
chains in the Genus database with same CATH superfamily
3KG2A 5EQ9A 2B4MA 3ODBA 1GGGA 4EDPA 5LDZA 1QKAA 3QIMA 4KCDA 4IB2A 5ISUA 3TCHA 5AA2A 4YKKA 4AB6A 4H6DA 5AE4A 1WVJA 1D3KA 4YKIA 1A99A 4LUBA 5DYHA 2OJTA 3PUWE 3CG1A 1KA1A 3IK6B 3OSQA 2ZYKA 1DPEA 1IZ1A 1B6HA 4JVDA 1MY4A 2P1SA 5ET7A 3LUZA 1UTHB 3IFAA 1CE2A 1N04A 4PFRA 2AL5A 2I49A 2R9JA 1IMCA 5EQAA 2RC9A 3MC2A 2F97A 2ZZWA 2PT2A 1IMBA 2DWAA 5I59B 1SI1A 3PPOA 1MY1A 4LVQA 2Y7PA 3PGFA 1LCTA 1FQBA 3MVYA 2CZKA 3S4UA 4P11A 1D9YA 4RXLA 4AS5A 3K4UA 4C1UA 2Q9TA 1NNPA 3DLNA 4QSCA 4F22A 1FPGA 1LBXA 4H46A 4G77A 1BKAA 4OVQA 3VVFA 4K3FA 1LFIA 5TP9A 3MVZA 4LATA 2VD2A 4ELQA 3FIRA 1N84A 1FPDA 1R1NA 4P1EA 1P1WA 4FIMA 3MZ1A 2F6PA 2XXWA 4OXVA 3G3JA 1US5A 4H5GA 3RT6B 5L8DA 4O3AA 4R73A 3EHUA 3UIFA 4C0RA 4XKQA 3IFCA 4WXJA 1AIVA 1NH8A 3OSRA 3TODA 1R9QA 1AH5A 5EQ7A 2XX8A 5H8HB 4N6DA 3M8UA 5I59A 3KSXA 3IL1B 5CMMA 3VE1B 1TT1A 2O68A 2BJIA 2HEUA 2Q74A 5I2NA 3U94A 3FASA 4JVCA 4EUOA 3FVNA 1IXGA 3T9VA 3TKDA 2ZNUA 5BUUA 1FRPA 2VPOA 1LGBC 3SZPA 1B5JA 2O6AA 4BDNA 2OLBA 2F5XA 4MHFA 3SDFA 2I4CA 1DPPA 4TLMB 3TCGA 1IEJA 2YLNA 4LQ5A 1MXXA 5HPQA 1WODA 4ESXA 4N6KA 4X1DA 2F78A 4POWA 3Q29A 1FBHA 5H8HA 3QMFA 3DP6A 1PC3A 2QVUA 3E3KA 4KYDA 3JZJA 4MNIA 1QUKA 3CHGA 4E0XA 1PEBA 4PF8A 4NQ8A 3U93A 4NF8A 4QSEA 3FV2A 5AA3A 5H8QB 3V8XB 5IZ3B 5J1DA 2ZZXA 1DTGA 1H44A 2I0BA 4N8YA 1GTKA 1XOCA 1USYE 3MVXA 3IB2A 4F2QA 3OO9A 1Q35A 4ZZEA 5M2VA 2ZYMA 3FVOA 3LSWA 3FZVA 3EQ1A 1IXCA 3RLFE 3E4RA 4Q0CA 5AA2D 3PPNA 1MH4A 1Y1ZA 3IOVA 1NUYA 1DSNA 2H99A 1NV3A 2F35A 4NAPA 4G68C 4F31B 4IGRA 4TLLB 1LFHA 1YCJA 4IO2A 1US4A 5I7IA 2Q2CA 3PD9A 3VLWA 4O7MA 5FHMA 1B05A 1SYHA 4M1VA 3UP9A 2A5SA 4ZE9A 1GV8A 4OVPA 4QFNA 3KSJA 5IGAA 3OO8A 2WYKA 2Y7KA 4FORA 5AA2B 2THIA 3BFTA 3K6VA 1B52A 4PGPA 1ZMGA 4OESA 4P0IA 2FYIA 1GR2A 1FPIA 4EQ9A 1P1UA 3FV1A 4YKJA 1KA0A 4KHZE 1Z7ME 3KOSA 3ZKLA 1NV4A 3HO7A 1LBBA 2Z23A 3C36A 4HTGA 1RDZA 3IB0A 3TTRA 1Q9DA 2FIEA 3JV9A 1LBCA 4Q5TA 1FQCA 4MJOA 3FGSA 5TU0A 2NOOA 3R26A 3O6HA 2H4IA 2O7UA 4HS7A 5I56A 4HE2A 1FTKA 1MDQA 3MJNA 3B6TA 3FD3A 3K00A 4ELOA 1VSOA 3LBSA 4LONB 3A3CA 5ET8A 4O7IA 5DTBA 1ATGA 3BIHA 3UA8A 2QFLA 1RYOA 4O3CA 1B32A 2Y5LA 1A55A 2P3VA 3H3GA 4OANA 2AYSA 1FQDA 4F1VA 3QXMA 1Y4TA 4MAGA 3TMGA 4LA9A 2V84A 3KBRA 1QUIA 5EQ8A 1EH3A 1S7YA 2O51A 4OYVA 3VLUA 3MBPA 5JTYB 3A29A 4OA4A 1IUDA 3IR1A 3GBBA 5LTCA 2VD3A 1MXUA 4YZZA 3VLVA 4E0WA 4JB7A 3QSLA 3THIA 1NH7A 5L9MA 1JW4A 1FPBA 4NN3A 1N3XA 2HCAA 1MG1A 3C33A 4YU0A 1LAFE 2P3NA 1AWBA 3K1MA 1TWYA 2E0SA 4DXCA 4OQOA 2I4BA 4KYSA 2ZNSA 4QFLA 1VFEA 1Y3NA 4DE8A 1VFDA 4NTLA 4XEQA 4R2BA 2ZYNA 1P1NA 3PMXA 3MPLA 1URDA 2MKZA 2XXHA 1FPEA 4OETA 4RYAA 3DM0A 1NFTA 4F2OA 1PDAA 4NF6B 5K2XA 5HM4B 5CM6A 1MS7A 3KJTA 1PB9A 2FBPA 3S9MC 3TTMA 2QRYA 2ANJA 1OVTA 4RY1A 2XX7A 2M8CA 1EZ9A 4Z0IA 3RTFB 1SDXA 2GFEA 3KC0A 1MXZA 3LR1A 4PETA 4KR5A 3RTWB 2RF1A 4GBWA 1LAHE 5CMCA 5ELVA 2Q89A 5TP9B 4JWOA 3RY3A 2A5TB 2XXUA 3RNNA 1FTOA 4KI0E 4DIGA 2OWTA 2R71A 4PAFA 4HXVA 4IY6A 5H8FB 3O29A 5CRYA 3GYYA 1FBCA 2RC8A 3KN7A 4ND9A 4NF6A 3KN8A 3U1OA 1LEVA 1I6AA 1IITA 5KCJA 4P1LA 4LZ8A 4X48A 2O69A 3UORA 2XX9A 4NF5A 1SYIA 3CI8A 4GX3A 4OVJA 1K9ZA 2Q8JA 4FJPA 3KEIA 1NUWA 3B6QA 1B3FA 1VE4A 5EYHA 4P0GA 5IZ1A 1J1NA 5CMBA 2DDKA 1QGXA 5CI5A 1MPDA 4N13A 2GH9A 3CFLA 5IKBA 1MY2A 4G68B 5KDTA 3HV1A 2RKMA 3IJOB 1IMDA 5F24A 1RYXA 2OWSA 2OPDA 1G0IA 2QS4A 3O9PA 3S9LC 3H6VA 5H8NA 3KOTA 1FTMA 5B7DA 2H25A 1YAEA 3UN6A 3B8BA 3HPIA 5I57A 2DQVA 3MP6A 4F29A 1S50A 4G8NA 5EHMA 5JK4A 2KQZA 3MUQA 4I8CA 4PFYA 4RPNA 3CFZA 2PCRA 4H67A 1B3GA 1PBPA 4LZ5A 3K1NA 3MP8A 2DYXA 4QRZA 2V25A 4ZEBA 2F3DA 5LOMA 1ZJLA 4P3LA 1ELJA 3SEUA 3T9UA 4L17A 1K9YA 3G3HA 4ZEIA 3L6GA 1FTLA 4NEDA 4FAJA 1AL3A 2DE4A 4PE5B 4XTCQ 4P9KA 4G68A 5KDTB 4QFPA 2L5VA 2DVZA 4JXIA 4GWYA 5IAIA 4F1YA 2OK2A 2F34A 1EYJA 2V3QA 4G2ZA 2ZNTA 2GHBA 3FATA 3PPQA 3VV5A 4LP2B 2QSXA 2VP1A 3IORA 2B3FA 4F1UA 1NKXA 2GQ1A 5ITPA 4R72A 2XWOA 3EPEA 4YB5A 2R8TA 5FHNA 4WEPA 1N7WA 3K0VA 2PMSA 2NXOA 2Y7WA 1FBFA 2XXYA 4EF1A 3MSTA 4N6PA 4TOZA 3FXBA 4ZEKA 1JVYA 1R9LA 4H65A 3I5OA 3OELA 1B5IA 4TQUQ 3G3FA 2DXYA 1MQGA 2HPGA 5TPAB 1JETA 3KFMA 2VHAA 3C4MA 3C34A 4H45A 1B3LA 4PBQA 4DXBA 1Y3PA 1D9QA 3B6WA 2DVCA 3MVWA 1MXWA 1O7TA 3M3FA 3VFJA 3N5LA 2CZHA 2B4LA 1T0KA 1NV6A 3PMWA 1BP5A 3I3VA 2XHDA 4GOTA 3N94A 5I56B 1JW1A 1XVYA 2REJA 3EF7A 1DOTA 4R74A 2F8DA 3L6HA 3OEMA 4U21A 1B4HA 2I3WA 4GL0A 2X7PA 3B7DA 4DXUA 3PPPA 4QFKA 3GXAA 3OMBA 4ZDMA 2ONSA 4R75A 4U4XA 1MY0A 2DSFA 4PC9A 4QBAA 1BTJA 2H5YA 1SW5A 2Y7RA 3CG3A 3K01A 2UYFA 1SPIA 4POXA 3IJXB 1XHYA 3IOWA 4HE0A 2UXAA 4PAKA 4GQOA 4U4SA 4IO5A 2UVJA 4NX1A 2ONRA 3C31A 3OO7A 2DWIA 2F7AA 3CSGA 4GWZA 1MM6A 4XKPA 4NF5B 3G3KA 3MZBA 3KJ7A 3SETA 1MY3A 4N91A 3OEKA 3CSBA 1UIUA 4JSDA 1SD3A 1NL5A 1PB7A 1M5FA 2QJEA 3UK4A 1MXVA 1MH3A 2DXRA 4AB5A 3U72A 2O84X 3IX1A 1OLAA 4MX6A 4ELPA 1HSJA 4JWXA 4I9DA 3OOAA 1B2HA 4RJZA 2XD3A 3HFUA 2NVUB 4IR8A 4U22A 4DLDA 5F7VA 1MDP1 2QVVA 5ESYA 3K2DA 4KFQA 1N0TA 3W15C 3G7WA 1FPJA 4DZ1A 3MWBA 5CBRA 3ZSFA 1XC1A 4RA1A 2OWZA 2XXKA 3SEYA 5IZZA 1FQAA 2P0SA 4JVIA 4ECFA 4XKRA 3JYRA 1UTBB 4JBZA 4IO6A 5T3JA 4PBHA 3VVEA 5AA4B 4PQJA 2D5WA 4KPTA 1TFAA 3S2VA 2OBGA 3IOUA 3TTNA 4IO3A 1D4NA 2DE3A 4IO4A 1H3DA 3KBZA 1GVCA 1N3WA 1LBVA 4GXAA 3C35A 1HSLA 2WEFA 2PVUA 2Y84A 3E13X 5DVJA 4Q30B 4R9GA 1B7UA 1XT8A 4BDLA 5L9SA 5ICTA 5ITOA 2A5TA 1POY1 2HXRA 4WEDA 4BDQA 3CVGA 4QF9A 4MNPA 5FTHA 4RNSA 3WAEA 3QUJA 3FBPA 4QSDA 4MNCA 3KZGA 3TCFA 4PFTA 4HW8A 5DEXB 4PFBA 5FHOA 2WYPA 1NUZA 4YB7A 4ZEFA 3VXBA 4R6HA 4U2RA 4OZ9A 3W9VA 3B50A 5HBCA 1QKBA 1MPCA 2XXXA 4U23A 1TXFA 4QHQA 3H6TA 5I5PA 3EHSA 3O66A 4IGTA 1LCFA 5AA4A 1NV0A 3IO6A 2X7QA 3E79A 2X26A 2D21A 3D1RA 4XF5A 4GWOA 2FA7A 4UABA 2HHMA 1IXIA 1LSTA 3O28A 3H6WA 2NWJA 1TFDA 4RK9A 4NWDA 1IXHA 2Z8FA 4ISUA 4F18A 2REGA 3PPRA 5IZ3A 4PP0A 3U65A 5TPAA 4X8RA 4OFOA 4N4UA 1VR5A 3LUYA 4DCXA 2F7BA 4N15A 2H9BA 1B3HA 4GX4A 4NF4A 4ZS9A 4YMBA 3T9XB 4P56A 3O2AA 3BKIB 3QAXA 4HCWA 1I6BA 4X9TA 1B7HA 4JDFA 3O97A 3R7XA 3TELA 1P1QA 4H5FA 4OENA 5DEXA 4OEVA 4MLQA 2Q88A 3BBRA 2DWHA 1UQWA 3IB1A 2H98A 4N81A 1M5CA 3HHGA 3T9HB 4PAIA 3D4CA 3U8QA 1OVBA 2O7IA 4OERA 2UVHA 2AL4A 3ILTB 4MMPA 2UVIA 1II5A 2V3TA 3H6UA 2AIXA 4XIGQ 4NF4B 1SI0A 4THIA 3G3GA 4FBPA 1Z7NE 4MIJA 1ZTYA 3FJGA 4RPOA 2XWKA 4GWWA 2DOJA 1BIYA 4JWYA 4MEVA 4LQ2A 2OPEA 5L9OA 2ZXTA 2PFZA 1NV5A 3AXFA 1NV7A 4ZE8A 1ZIUA 2OCUA 1AMFA 3OENA 3PTYA 1NNTA 5I58A 4AQ4A 1D9VA 1USYH 4NMYA 3MP1A 3N6UA 2QL3A 5J16A 2QMWA 4I3EA 1JEVA 4F19A 5I84A 1B3EA 1FQEA 2DP8A 3RYDA 4P47A 4WKMA 3K6WA 5CBSA 1B46A 1SBPA 1SW1A 3A09A 4GFRA 1LFGA 4KD5A 3T93B 3H06B 4ZZAA 5FTIA 3CIJA 4OEUA 1QUJA 3T96B 5KZTA 2VPNA 1F9BA 3PMVA 3E78A 3FJ7A 4OWDA 2HZKA 3PUVE 4GWXA 3H7MA 1VDWA 4GBVA 3IO4A 1IIWA 3N6TA 4DI3D 1DTZA 4IO7A 1LB9A 2CEYA 5A5LA 1JEUA 4O8MA 1BLFA 4OFJA 4BDMA 3MQ9A 4U1ZA 4R6KA 3Q27A 5EYFA 5H8QA 3USDA 1B9JA 2LAOA 2XXPA 1B7ZA 3A3UA 4GWSA 4F3PA 3U92A 1B51A 4XXUA 4MH5A 4NG7A 1EU8A 1FPKA 1CNQA 4H8JA 3VDFA 3MZ9A 5JTYA 5A5XB 5I3SA 1JVXA 1UTHA 2RCBA 5JEIA 1H45A 2DE2A 3LSLA 4F39A 3M3LA 5CMKA 2XWIA 3C9HA 4I1DA 1SVXB 3RN8A 2QS1A 5AA1A 4PE3A 2V3UA 5DVIA 3EN3A 1OLCA 3FUZA 3O6GA 4FEBA 2WBDA 4LN5A 1Y3QA 3T66A 1H43A 1SW2A 1QW0A 1B0LA 2HZLA 2XXVA 4G8HA 1RKMA 2XXIA 3ISPA 2O1MA 4HE1A 4N07A 2ZYOA 4KXPA 4MFIA 3QYTA 2XXRA 1FTAA 5A5XA 2G93A 1YYZA 1NNFA 3TQWA 1DK4A 4I3YA 2GRVA 4EQ7A 4EQBA 3W9WA 2FNCA 3MAMA 1JW5A 4G8MA 1EYKA 4YMAA 1P1OA 3HHFA 1FSAA 1DBZA 1P99A 1MRPA 4DI4B 3G3IA 2WX9A 1LAGE 1KWHA 2UVGA 2D3IA 1FJ6A 3RPLB 3DELB 2Z22A 4BDRA 5K2YA 1MQHA 4R6YA 1MPBA 3QUFA 4PCDA 2GHAA 3N26A 3QK6A 4H8IA 4KCCA 3Q25A 3S9EA 1LB8A 3PUZE 1UTBA 1FPFA 1FPLA 4O94A 3BIGA 2RC7A 4GX6A 2V93A 3FXUA 3FVKA 2CZIA 2HAVA 3OO6A 3PV0E 3CR9A 2RCAA 2KLFA 2Y5KA 3P7IA 2O1LA 3Q28A 5ET6A 4PGNA 3E9XA 3KGCA 1MM7A 1B5HA 4FE8A 4ELRA 3TYHA 1PBQA 3RGYA 1FBDA 1NV1A 5H8SA 3SERA 4DDDA 1M5DA 4BLAA 2ZMBA 3ECRA 2VGQA 1RDYA 1OQGA 4FEDA 4G4PA 4NGUA 1ZBMA 1NMUA 4NE4A 2F3BA 4YICA 1A54A 1QJMA 2BJJX 2PBWA 5DW8A 3RPWA 3K1PA 3SESA 3ZS6A 3FVGA 3RT8A 4EF2A 1SQYA 1UIVA 1URGA 1QVSA 4U1OA 2Z8DA 4PTKA 3V5AA 1CB6A 3HN0A 3SEVA 1JP4A 2NUVA 3O6IA 1N76A 2YJPA 3TZAA 3TDJA 4QFOA 3TTLA 3GLBA 4PFIA 2KR0A 2CEXA 3KC1A 1WDNA 1FQFA 3TEPA 5I57B 5ET5A 3MW0A 4GD5A 1IMAA 2UYEA 1IMFA 1XVXA 1JQFA 1KZ8A 5CC2A 1ANFA 5I2KA 2FIXA 4GRKA 1B1XA 2P2AA 4R2FA 1I6QA 2F7CA 4LZ7A 5EYGA 5I2NB 3S9NC 4H0WA 4EXKA 2I0CA 4P8BA 2G29A 3PU5A 4PDDA 3RQTA 5IM2A 4ZECA 3OD7A 2VT5A 3D4GA 1M5BA 5KCJB 4PFUA 1PB8A 4BDOA 1IQ7A 2PYYA 3LSFB 3F11A 2ONKE 1HSEA 1URSA 4HCYA 4OVTA 2ALUA 1OIBA 4MCOA 5H8FA 3VXCA 4N8GA 5I2KB 3PD8A 1Y4CA 2IEEA 2XWVA 4MBPA 1N7XA 1ZU0A 3UGWA 2PFYA 2HFBA 1LBZA 4GF8A 3BFUA 3ZKKA 2Y7IA 3LSXA 1OMPA 1MQJA 4KQPA 3LV0A 2XXQA 4AS4A 3H4ZA 1NUXA 3Q26A 4XKNA 4ONYA 2IA4A 3TPAA 3V83A 2QPQA 3I6VA 4GVOA 2F36A 1R6ZA 3C32A 5H8NB 4NF0A 3GZGA 3V89B 3SEWA 1B4ZA 2YPNA 2WBBA 2OZZA 5ICQA 3PUYE 1A7LA 2Z8EA 3M3KA 4GLIA 4JSOA 1A8EA 2ZZVA 3EHTA 2CMOA 1BK4A 4NF8B 4OVRA 4C1TA 1MXYA 1ZKBA 1Y1MA 4RK2A 1YPNA 1FBPA 1LBWA 5FBPA 1NNKA 1Y9UA 1O64A 2WKYA 2CZLA 3KN3A 1JNFA 1NI9A 3ILUB 3K6UA 3MYUA 4OMBA 5BWJA 3MPKA 3HCQA 2VOZA 1B58A 1AOVA 2ESNA 3R6UA 1A8FA 1LBYA 4KYEA 1LAXA 2HAUA 1S9TA 1FBEA 2PX1A 2W7YA 4GWUA 2Q2AA 2I58A 4ZEDA 2FVZA 3FXQA 4YKPA 1ZLQA 1MQDA 1G0HA 3TQLA 1DCUA 3LC8A 3IOTA 4FECA 1EYIA 4Q8RA 3RUMA 2HQ0A 3H03A 3T22A 4YB6A 3ONMA 3SEXA 1O63A 2JJKA 4GIZA 1INPA 4YAHX 1B0HA 4Z7EA 1B40A 1YZ0A 4NHBA 3IAZA 4OVSA 3FJMA 4MF3A 3TTKA 1I69A 2QS3A 4G61A 4EXLA 2I6EA 4F3SA 3NOHA 1B1HA 4M4GA 1SW4A 3HSTA 2B3BA 2FHYA 1RDXA 1XI6A 4PDHA 3CRBA 1MQIA 4GL8A 2R6GE 1YXIA 2OX3A 2PT1A 3TAJA 4F3GA 4XFEA 3VVDA 3FXRA 3TFLA 1POTA 3OXNA 2RINA 1DMBA 2F6GA 3ROJA 4UA8A 1XS5A 2I48A 4I40A 1YTVA 2I3VA 3EKIA 1M5EA 1OQHA 4OHNA 4ESWA 1H76A 4FATA 1QULA 5B70A 3DP8A 5DT6A 2V4CA 3T0JA 4OFLA 4X04A 1NV2A 4X1BA 4DCYA 5I58B 1L5TA 2E1SA 4O3BA 2QVRA 3WAFA 1IMEA 1FTJA 4PFWA 2XXTA 2DS9A 5F1QA 1FW0A 1Q1KA 3RPLA 1A40A 4R9FA 4MLVA 1Y20A 1LLSA 2QMXA 3GBAA 2B65A 5EHSA 4IY5A 3SKPA 3K6XA 5DVFA 4I62A 2XD2A 2Q8MA 4OTEA 1FCKA 1EZOA 3CFXA 2ABHA 2DWJA 4NWCA 4N17A 4GXSB 2QS2A 4F3BA 2XA5A 3DP4A 3K02A 3PUXE 4QXDA 4PF6A 1EZPA 4H1XA 3TUSA 2HXWA 3T1BA 4UACA 1FJ9A 1FBGA
chains in the Genus database with same CATH topology
2WBBA 3HFUA 4NN3A 4PFIA 4P1LA 4P1EA 5EQ9A 2KR0A 4IR8A 2B4MA 4MJOA 2CEXA 3KC1A 5I5PA 4P9KA 5I3SA 2PFZA 1NV5A 2QVVA 4G61A 2L5VA 1NV0A 4GX3A 1NV7A 5ESYA 5LDZA 2DVZA 5IZ3B 2ZZVA 2ZZXA 2DE2A 5J1DA 2P3NA 1BK4A 1K9ZA 4N8YA 1FPFA 1AWBA 3E79A 1FPLA 4O94A 5ET5A 2FHYA 1RDXA 1XI6A 4HE2A 3PTYA 3BIGA 4GX6A 1FPJA 3D1RA 1IMAA 2XWIA 4XF5A 4OVRA 1NUWA 4GWYA 2CZIA 1IMFA 4PDHA 4UABA 1KZ8A 1YXIA 2HHMA 2OX3A 2DE4A 2OWZA 5EYHA 2XXKA 4XFEA 2FIXA 5IZ1A 5IZZA 5J16A 4PE3A 1EYJA 2V3QA 2Y5KA 3IFCA 4JVIA 4I3EA 2DDKA 4F19A 1QGXA 5ET6A 1FBPA 5T3JA 4PBHA 1LBWA 3RYDA 4P47A 4PC9A 4PGNA 3T1BA 5EYGA 5FBPA 4QBAA 4F18A 4YZZA 2WBDA 3ROJA 4LN5A 1KA1A 1NI9A 4P8BA 4XEQA 5EQ7A 4F1UA 1NUYA 1IMDA 2GQ1A 4I40A 5ET8A 5IZ3A 3U65A 2HZLA 4O7IA 3NOHA 4PDDA 1FBDA 5F24A 4N4UA 4X8RA 1NV3A 3BIHA 2XWOA 3MYUA 4N6DA 4JVDA 2R8TA 1G0IA 2QFLA 2MKZA 3EKIA 1FPEA 1NV1A 4N15A 5IM2A 4NAPA 1SPIA 2BJIA 2VT5A 4GX4A 2Y5LA 2DE3A 5ET7A 3ISPA 3LUZA 4P56A 2Q74A 4HE1A 3KBZA 2VPNA 1LBVA 1FBFA 3IFAA 4KXPA 2P3VA 4HE0A 4JVCA 4OVSA 1RDYA 4HCWA 3MSTA 2V4CA 3T0JA 4PAKA 3E78A 1LBYA 2HZKA 4OANA 1FTAA 4PFRA 1NV2A 4X04A 4X9TA 3FXBA 4GWXA 4NGUA 5CM6A 4NX1A 5I7IA 1IMCA 2WEFA 5EQAA 4F1VA 1VDWA 1FBEA 1FRPA 1YYZA 2VPOA 3B8BA 1DK4A 4GBVA 2ZZWA 2F3BA 4I3YA 4MAGA 3SZPA 2FBPA 2QVRA 4GWUA 1IMBA 1IMEA 4YICA 3W9WA 2FVZA 4DI3D 1EYKA 4HCYA 4GWZA 4O7MA 4OVTA 3RPLA 5DW8A 4M1VA 2HXRA 4MCOA 2F5XA 4MHFA 4N8GA 5JK4A 2CEYA 2KQZA 4N81A 5A5LA 1FSAA 1DBZA 3KC0A 1G0HA 4MNPA 2XWVA 4OVPA 2HPGA 5EQ8A 4PETA 2CZKA 5IGAA 1DCUA 4O8MA 2PCRA 4GBWA 1EYIA 4DI4B 2WYKA 4H45A 4N91A 4AS5A 4PAIA 2WX9A 4PBQA 2PFYA 4N6KA 1LBZA 2Q8MA 1FJ6A 3A29A 3FBPA 1D9QA 3RPLB 2Q9TA 4MNCA 4OA4A 4PGPA 2F3DA 3LV0A 1FBHA 4PTKA 5LTCA 1FPIA 1FPGA 3QMFA 1NUXA 4AS4A 4PFBA 4P3LA 1LBXA 4H46A 4MMPA 4N17A 2QVUA 1KA0A 4PAFA 2QPQA 1JP4A 4HXVA 1K9YA 2JJKA 2CZHA 2B4LA 1NV4A 2WYPA 4OVQA 1INPA 1NV6A 1NUZA 2XA5A 4MNIA 4MX6A 4FBPA 4MIJA 3GYYA 3CHGA 1FBCA 4GWSA 4NF0A 1RDZA 1FJ9A 4QXDA 4PF6A 3W9VA 2XWKA 4GWWA 3B50A 1Q9DA 1YZ0A 4PCDA 4NG7A 4NHBA 1LEVA 2FIEA 4NQ8A 4PF8A 4MEVA 1FPBA 1FPKA 1CNQA 1FBGA 1FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBB A;  5EQ9 A;  4IR8 A;  4MJO A;  3KC1 A;  5I3S A;  1NV5 A;  2QVV A;  4G61 A;  1NV0 A;  4GX3 A;  1NV7 A;  5ESY A;  5LDZ A;  5IZ3 B;  2P3N A;  1BK4 A;  1K9Z A;  1FPF A;  1AWB A;  1FPL A;  5ET5 A;  2FHY A;  1RDX A;  1XI6 A;  4HE2 A;  3BIG A;  4GX6 A;  1FPJ A;  3D1R A;  1IMA A;  1NUW A;  4GWY A;  2CZI A;  1IMF A;  1KZ8 A;  1YXI A;  2HHM A;  2OX3 A;  2OWZ A;  5EYH A;  2FIX A;  5IZ1 A;  5J16 A;  1EYJ A;  2Y5K A;  3IFC A;  4I3E A;  2DDK A;  1QGX A;  5ET6 A;  1FBP A;  5T3J A;  1LBW A;  3RYD A;  5EYG A;  5FBP A;  2WBD A;  3ROJ A;  1KA1 A;  1NI9 A;  5EQ7 A;  1NUY A;  1IMD A;  2GQ1 A;  4I40 A;  5ET8 A;  5IZ3 A;  4O7I A;  1FBD A;  5F24 A;  1NV3 A;  3BIH A;  2R8T A;  1G0I A;  2QFL A;  1FPE A;  1NV1 A;  1SPI A;  2BJI A;  2VT5 A;  4GX4 A;  2Y5L A;  5ET7 A;  3LUZ A;  2Q74 A;  4HE1 A;  3KBZ A;  1LBV A;  1FBF A;  3IFA A;  4KXP A;  2P3V A;  4HE0 A;  1RDY A;  3T0J A;  1LBY A;  1FTA A;  1NV2 A;  4GWX A;  1IMC A;  2WEF A;  5EQA A;  1VDW A;  1FBE A;  1FRP A;  1YYZ A;  3B8B A;  1DK4 A;  4GBV A;  2F3B A;  4I3Y A;  2FBP A;  2QVR A;  4GWU A;  1IMB A;  1IME A;  2FVZ A;  1EYK A;  4GWZ A;  3RPL A;  5DW8 A;  4N81 A;  5A5L A;  1FSA A;  1DBZ A;  3KC0 A;  1G0H A;  5EQ8 A;  2CZK A;  1DCU A;  2PCR A;  4GBW A;  1EYI A;  4H45 A;  4AS5 A;  1LBZ A;  2Q8M A;  1FJ6 A;  3A29 A;  3FBP A;  1D9Q A;  3RPL B;  2F3D A;  3LV0 A;  1FBH A;  4PTK A;  1FPI A;  1FPG A;  3QMF A;  1NUX A;  4AS4 A;  1LBX A;  4H46 A;  2QVU A;  1KA0 A;  1JP4 A;  4HXV A;  1K9Y A;  2JJK A;  2CZH A;  1NV4 A;  1INP A;  1NV6 A;  1NUZ A;  4FBP A;  1FBC A;  4GWS A;  1RDZ A;  1FJ9 A;  4QXD A;  4GWW A;  1Q9D A;  1YZ0 A;  1LEV A;  2FIE A;  1FPB A;  1FPK A;  1CNQ A;  1FBG A;  1FPD A; 
#chains in the Genus database with same CATH topology
 3KG2 A;  5EQ9 A;  2B4M A;  3ODB A;  1GGG A;  4EDP A;  5LDZ A;  1QKA A;  3QIM A;  4KCD A;  4IB2 A;  5ISU A;  3TCH A;  5AA2 A;  4YKK A;  4AB6 A;  4H6D A;  5AE4 A;  1WVJ A;  1D3K A;  4YKI A;  1A99 A;  4LUB A;  5DYH A;  2OJT A;  3PUW E;  3CG1 A;  1KA1 A;  3IK6 B;  3OSQ A;  2ZYK A;  1DPE A;  1IZ1 A;  1B6H A;  4JVD A;  1MY4 A;  2P1S A;  5ET7 A;  3LUZ A;  1UTH B;  3IFA A;  1CE2 A;  1N04 A;  4PFR A;  2AL5 A;  2I49 A;  2R9J A;  1IMC A;  5EQA A;  2RC9 A;  3MC2 A;  2F97 A;  2ZZW A;  2PT2 A;  1IMB A;  2DWA A;  5I59 B;  1SI1 A;  3PPO A;  1MY1 A;  4LVQ A;  2Y7P A;  3PGF A;  1LCT A;  1FQB A;  3MVY A;  2CZK A;  3S4U A;  4P11 A;  1D9Y A;  4RXL A;  4AS5 A;  3K4U A;  4C1U A;  2Q9T A;  1NNP A;  3DLN A;  4QSC A;  4F22 A;  1FPG A;  1LBX A;  4H46 A;  4G77 A;  1BKA A;  4OVQ A;  3VVF A;  4K3F A;  1LFI A;  5TP9 A;  3MVZ A;  4LAT A;  2VD2 A;  4ELQ A;  3FIR A;  1N84 A;  1FPD A;  1R1N A;  4P1E A;  1P1W A;  4FIM A;  3MZ1 A;  2F6P A;  2XXW A;  4OXV A;  3G3J A;  1US5 A;  4H5G A;  3RT6 B;  5L8D A;  4O3A A;  4R73 A;  3EHU A;  3UIF A;  4C0R A;  4XKQ A;  3IFC A;  4WXJ A;  1AIV A;  1NH8 A;  3OSR A;  3TOD A;  1R9Q A;  1AH5 A;  5EQ7 A;  2XX8 A;  5H8H B;  4N6D A;  3M8U A;  5I59 A;  3KSX A;  3IL1 B;  5CMM A;  3VE1 B;  1TT1 A;  2O68 A;  2BJI A;  2HEU A;  2Q74 A;  5I2N A;  3U94 A;  3FAS A;  4JVC A;  4EUO A;  3FVN A;  1IXG A;  3T9V A;  3TKD A;  2ZNU A;  5BUU A;  1FRP A;  2VPO A;  1LGB C;  3SZP A;  1B5J A;  2O6A A;  4BDN A;  2OLB A;  2F5X A;  4MHF A;  3SDF A;  2I4C A;  1DPP A;  4TLM B;  3TCG A;  1IEJ A;  2YLN A;  4LQ5 A;  1MXX A;  5HPQ A;  1WOD A;  4ESX A;  4N6K A;  4X1D A;  2F78 A;  4POW A;  3Q29 A;  1FBH A;  5H8H A;  3QMF A;  3DP6 A;  1PC3 A;  2QVU A;  3E3K A;  4KYD A;  3JZJ A;  4MNI A;  1QUK A;  3CHG A;  4E0X A;  1PEB A;  4PF8 A;  4NQ8 A;  3U93 A;  4NF8 A;  4QSE A;  3FV2 A;  5AA3 A;  5H8Q B;  3V8X B;  5IZ3 B;  5J1D A;  2ZZX A;  1DTG A;  1H44 A;  2I0B A;  4N8Y A;  1GTK A;  1XOC A;  1USY E;  3MVX A;  3IB2 A;  4F2Q A;  3OO9 A;  1Q35 A;  4ZZE A;  5M2V A;  2ZYM A;  3FVO A;  3LSW A;  3FZV A;  3EQ1 A;  1IXC A;  3RLF E;  3E4R A;  4Q0C A;  5AA2 D;  3PPN A;  1MH4 A;  1Y1Z A;  3IOV A;  1NUY A;  1DSN A;  2H99 A;  1NV3 A;  2F35 A;  4NAP A;  4G68 C;  4F31 B;  4IGR A;  4TLL B;  1LFH A;  1YCJ A;  4IO2 A;  1US4 A;  5I7I A;  2Q2C A;  3PD9 A;  3VLW A;  4O7M A;  5FHM A;  1B05 A;  1SYH A;  4M1V A;  3UP9 A;  2A5S A;  4ZE9 A;  1GV8 A;  4OVP A;  4QFN A;  3KSJ A;  5IGA A;  3OO8 A;  2WYK A;  2Y7K A;  4FOR A;  5AA2 B;  2THI A;  3BFT A;  3K6V A;  1B52 A;  4PGP A;  1ZMG A;  4OES A;  4P0I A;  2FYI A;  1GR2 A;  1FPI A;  4EQ9 A;  1P1U A;  3FV1 A;  4YKJ A;  1KA0 A;  4KHZ E;  1Z7M E;  3KOS A;  3ZKL A;  1NV4 A;  3HO7 A;  1LBB A;  2Z23 A;  3C36 A;  4HTG A;  1RDZ A;  3IB0 A;  3TTR A;  1Q9D A;  2FIE A;  3JV9 A;  1LBC A;  4Q5T A;  1FQC A;  4MJO A;  3FGS A;  5TU0 A;  2NOO A;  3R26 A;  3O6H A;  2H4I A;  2O7U A;  4HS7 A;  5I56 A;  4HE2 A;  1FTK A;  1MDQ A;  3MJN A;  3B6T A;  3FD3 A;  3K00 A;  4ELO A;  1VSO A;  3LBS A;  4LON B;  3A3C A;  5ET8 A;  4O7I A;  5DTB A;  1ATG A;  3BIH A;  3UA8 A;  2QFL A;  1RYO A;  4O3C A;  1B32 A;  2Y5L A;  1A55 A;  2P3V A;  3H3G A;  4OAN A;  2AYS A;  1FQD A;  4F1V A;  3QXM A;  1Y4T A;  4MAG A;  3TMG A;  4LA9 A;  2V84 A;  3KBR A;  1QUI A;  5EQ8 A;  1EH3 A;  1S7Y A;  2O51 A;  4OYV A;  3VLU A;  3MBP A;  5JTY B;  3A29 A;  4OA4 A;  1IUD A;  3IR1 A;  3GBB A;  5LTC A;  2VD3 A;  1MXU A;  4YZZ A;  3VLV A;  4E0W A;  4JB7 A;  3QSL A;  3THI A;  1NH7 A;  5L9M A;  1JW4 A;  1FPB A;  4NN3 A;  1N3X A;  2HCA A;  1MG1 A;  3C33 A;  4YU0 A;  1LAF E;  2P3N A;  1AWB A;  3K1M A;  1TWY A;  2E0S A;  4DXC A;  4OQO A;  2I4B A;  4KYS A;  2ZNS A;  4QFL A;  1VFE A;  1Y3N A;  4DE8 A;  1VFD A;  4NTL A;  4XEQ A;  4R2B A;  2ZYN A;  1P1N A;  3PMX A;  3MPL A;  1URD A;  2MKZ A;  2XXH A;  1FPE A;  4OET A;  4RYA A;  3DM0 A;  1NFT A;  4F2O A;  1PDA A;  4NF6 B;  5K2X A;  5HM4 B;  5CM6 A;  1MS7 A;  3KJT A;  1PB9 A;  2FBP A;  3S9M C;  3TTM A;  2QRY A;  2ANJ A;  1OVT A;  4RY1 A;  2XX7 A;  2M8C A;  1EZ9 A;  4Z0I A;  3RTF B;  1SDX A;  2GFE A;  3KC0 A;  1MXZ A;  3LR1 A;  4PET A;  4KR5 A;  3RTW B;  2RF1 A;  4GBW A;  1LAH E;  5CMC A;  5ELV A;  2Q89 A;  5TP9 B;  4JWO A;  3RY3 A;  2A5T B;  2XXU A;  3RNN A;  1FTO A;  4KI0 E;  4DIG A;  2OWT A;  2R71 A;  4PAF A;  4HXV A;  4IY6 A;  5H8F B;  3O29 A;  5CRY A;  3GYY A;  1FBC A;  2RC8 A;  3KN7 A;  4ND9 A;  4NF6 A;  3KN8 A;  3U1O A;  1LEV A;  1I6A A;  1IIT A;  5KCJ A;  4P1L A;  4LZ8 A;  4X48 A;  2O69 A;  3UOR A;  2XX9 A;  4NF5 A;  1SYI A;  3CI8 A;  4GX3 A;  4OVJ A;  1K9Z A;  2Q8J A;  4FJP A;  3KEI A;  1NUW A;  3B6Q A;  1B3F A;  1VE4 A;  5EYH A;  4P0G A;  5IZ1 A;  1J1N A;  5CMB A;  2DDK A;  1QGX A;  5CI5 A;  1MPD A;  4N13 A;  2GH9 A;  3CFL A;  5IKB A;  1MY2 A;  4G68 B;  5KDT A;  3HV1 A;  2RKM A;  3IJO B;  1IMD A;  5F24 A;  1RYX A;  2OWS A;  2OPD A;  1G0I A;  2QS4 A;  3O9P A;  3S9L C;  3H6V A;  5H8N A;  3KOT A;  1FTM A;  5B7D A;  2H25 A;  1YAE A;  3UN6 A;  3B8B A;  3HPI A;  5I57 A;  2DQV A;  3MP6 A;  4F29 A;  1S50 A;  4G8N A;  5EHM A;  5JK4 A;  2KQZ A;  3MUQ A;  4I8C A;  4PFY A;  4RPN A;  3CFZ A;  2PCR A;  4H67 A;  1B3G A;  1PBP A;  4LZ5 A;  3K1N A;  3MP8 A;  2DYX A;  4QRZ A;  2V25 A;  4ZEB A;  2F3D A;  5LOM A;  1ZJL A;  4P3L A;  1ELJ A;  3SEU A;  3T9U A;  4L17 A;  1K9Y A;  3G3H A;  4ZEI A;  3L6G A;  1FTL A;  4NED A;  4FAJ A;  1AL3 A;  2DE4 A;  4PE5 B;  4XTC Q;  4P9K A;  4G68 A;  5KDT B;  4QFP A;  2L5V A;  2DVZ A;  4JXI A;  4GWY A;  5IAI A;  4F1Y A;  2OK2 A;  2F34 A;  1EYJ A;  2V3Q A;  4G2Z A;  2ZNT A;  2GHB A;  3FAT A;  3PPQ A;  3VV5 A;  4LP2 B;  2QSX A;  2VP1 A;  3IOR A;  2B3F A;  4F1U A;  1NKX A;  2GQ1 A;  5ITP A;  4R72 A;  2XWO A;  3EPE A;  4YB5 A;  2R8T A;  5FHN A;  4WEP A;  1N7W A;  3K0V A;  2PMS A;  2NXO A;  2Y7W A;  1FBF A;  2XXY A;  4EF1 A;  3MST A;  4N6P A;  4TOZ A;  3FXB A;  4ZEK A;  1JVY A;  1R9L A;  4H65 A;  3I5O A;  3OEL A;  1B5I A;  4TQU Q;  3G3F A;  2DXY A;  1MQG A;  2HPG A;  5TPA B;  1JET A;  3KFM A;  2VHA A;  3C4M A;  3C34 A;  4H45 A;  1B3L A;  4PBQ A;  4DXB A;  1Y3P A;  1D9Q A;  3B6W A;  2DVC A;  3MVW A;  1MXW A;  1O7T A;  3M3F A;  3VFJ A;  3N5L A;  2CZH A;  2B4L A;  1T0K A;  1NV6 A;  3PMW A;  1BP5 A;  3I3V A;  2XHD A;  4GOT A;  3N94 A;  5I56 B;  1JW1 A;  1XVY A;  2REJ A;  3EF7 A;  1DOT A;  4R74 A;  2F8D A;  3L6H A;  3OEM A;  4U21 A;  1B4H A;  2I3W A;  4GL0 A;  2X7P A;  3B7D A;  4DXU A;  3PPP A;  4QFK A;  3GXA A;  3OMB A;  4ZDM A;  2ONS A;  4R75 A;  4U4X A;  1MY0 A;  2DSF A;  4PC9 A;  4QBA A;  1BTJ A;  2H5Y A;  1SW5 A;  2Y7R A;  3CG3 A;  3K01 A;  2UYF A;  1SPI A;  4POX A;  3IJX B;  1XHY A;  3IOW A;  4HE0 A;  2UXA A;  4PAK A;  4GQO A;  4U4S A;  4IO5 A;  2UVJ A;  4NX1 A;  2ONR A;  3C31 A;  3OO7 A;  2DWI A;  2F7A A;  3CSG A;  4GWZ A;  1MM6 A;  4XKP A;  4NF5 B;  3G3K A;  3MZB A;  3KJ7 A;  3SET A;  1MY3 A;  4N91 A;  3OEK A;  3CSB A;  1UIU A;  4JSD A;  1SD3 A;  1NL5 A;  1PB7 A;  1M5F A;  2QJE A;  3UK4 A;  1MXV A;  1MH3 A;  2DXR A;  4AB5 A;  3U72 A;  2O84 X;  3IX1 A;  1OLA A;  4MX6 A;  4ELP A;  1HSJ A;  4JWX A;  4I9D A;  3OOA A;  1B2H A;  4RJZ A;  2XD3 A;  3HFU A;  2NVU B;  4IR8 A;  4U22 A;  4DLD A;  5F7V A;  1MDP 1;  2QVV A;  5ESY A;  3K2D A;  4KFQ A;  1N0T A;  3W15 C;  3G7W A;  1FPJ A;  4DZ1 A;  3MWB A;  5CBR A;  3ZSF A;  1XC1 A;  4RA1 A;  2OWZ A;  2XXK A;  3SEY A;  5IZZ A;  1FQA A;  2P0S A;  4JVI A;  4ECF A;  4XKR A;  3JYR A;  1UTB B;  4JBZ A;  4IO6 A;  5T3J A;  4PBH A;  3VVE A;  5AA4 B;  4PQJ A;  2D5W A;  4KPT A;  1TFA A;  3S2V A;  2OBG A;  3IOU A;  3TTN A;  4IO3 A;  1D4N A;  2DE3 A;  4IO4 A;  1H3D A;  3KBZ A;  1GVC A;  1N3W A;  1LBV A;  4GXA A;  3C35 A;  1HSL A;  2WEF A;  2PVU A;  2Y84 A;  3E13 X;  5DVJ A;  4Q30 B;  4R9G A;  1B7U A;  1XT8 A;  4BDL A;  5L9S A;  5ICT A;  5ITO A;  2A5T A;  1POY 1;  2HXR A;  4WED A;  4BDQ A;  3CVG A;  4QF9 A;  4MNP A;  5FTH A;  4RNS A;  3WAE A;  3QUJ A;  3FBP A;  4QSD A;  4MNC A;  3KZG A;  3TCF A;  4PFT A;  4HW8 A;  5DEX B;  4PFB A;  5FHO A;  2WYP A;  1NUZ A;  4YB7 A;  4ZEF A;  3VXB A;  4R6H A;  4U2R A;  4OZ9 A;  3W9V A;  3B50 A;  5HBC A;  1QKB A;  1MPC A;  2XXX A;  4U23 A;  1TXF A;  4QHQ A;  3H6T A;  5I5P A;  3EHS A;  3O66 A;  4IGT A;  1LCF A;  5AA4 A;  1NV0 A;  3IO6 A;  2X7Q A;  3E79 A;  2X26 A;  2D21 A;  3D1R A;  4XF5 A;  4GWO A;  2FA7 A;  4UAB A;  2HHM A;  1IXI A;  1LST A;  3O28 A;  3H6W A;  2NWJ A;  1TFD A;  4RK9 A;  4NWD A;  1IXH A;  2Z8F A;  4ISU A;  4F18 A;  2REG A;  3PPR A;  5IZ3 A;  4PP0 A;  3U65 A;  5TPA A;  4X8R A;  4OFO A;  4N4U A;  1VR5 A;  3LUY A;  4DCX A;  2F7B A;  4N15 A;  2H9B A;  1B3H A;  4GX4 A;  4NF4 A;  4ZS9 A;  4YMB A;  3T9X B;  4P56 A;  3O2A A;  3BKI B;  3QAX A;  4HCW A;  1I6B A;  4X9T A;  1B7H A;  4JDF A;  3O97 A;  3R7X A;  3TEL A;  1P1Q A;  4H5F A;  4OEN A;  5DEX A;  4OEV A;  4MLQ A;  2Q88 A;  3BBR A;  2DWH A;  1UQW A;  3IB1 A;  2H98 A;  4N81 A;  1M5C A;  3HHG A;  3T9H B;  4PAI A;  3D4C A;  3U8Q A;  1OVB A;  2O7I A;  4OER A;  2UVH A;  2AL4 A;  3ILT B;  4MMP A;  2UVI A;  1II5 A;  2V3T A;  3H6U A;  2AIX A;  4XIG Q;  4NF4 B;  1SI0 A;  4THI A;  3G3G A;  4FBP A;  1Z7N E;  4MIJ A;  1ZTY A;  3FJG A;  4RPO A;  2XWK A;  4GWW A;  2DOJ A;  1BIY A;  4JWY A;  4MEV A;  4LQ2 A;  2OPE A;  5L9O A;  2ZXT A;  2PFZ A;  1NV5 A;  3AXF A;  1NV7 A;  4ZE8 A;  1ZIU A;  2OCU A;  1AMF A;  3OEN A;  3PTY A;  1NNT A;  5I58 A;  4AQ4 A;  1D9V A;  1USY H;  4NMY A;  3MP1 A;  3N6U A;  2QL3 A;  5J16 A;  2QMW A;  4I3E A;  1JEV A;  4F19 A;  5I84 A;  1B3E A;  1FQE A;  2DP8 A;  3RYD A;  4P47 A;  4WKM A;  3K6W A;  5CBS A;  1B46 A;  1SBP A;  1SW1 A;  3A09 A;  4GFR A;  1LFG A;  4KD5 A;  3T93 B;  3H06 B;  4ZZA A;  5FTI A;  3CIJ A;  4OEU A;  1QUJ A;  3T96 B;  5KZT A;  2VPN A;  1F9B A;  3PMV A;  3E78 A;  3FJ7 A;  4OWD A;  2HZK A;  3PUV E;  4GWX A;  3H7M A;  1VDW A;  4GBV A;  3IO4 A;  1IIW A;  3N6T A;  4DI3 D;  1DTZ A;  4IO7 A;  1LB9 A;  2CEY A;  5A5L A;  1JEU A;  4O8M A;  1BLF A;  4OFJ A;  4BDM A;  3MQ9 A;  4U1Z A;  4R6K A;  3Q27 A;  5EYF A;  5H8Q A;  3USD A;  1B9J A;  2LAO A;  2XXP A;  1B7Z A;  3A3U A;  4GWS A;  4F3P A;  3U92 A;  1B51 A;  4XXU A;  4MH5 A;  4NG7 A;  1EU8 A;  1FPK A;  1CNQ A;  4H8J A;  3VDF A;  3MZ9 A;  5JTY A;  5A5X B;  5I3S A;  1JVX A;  1UTH A;  2RCB A;  5JEI A;  1H45 A;  2DE2 A;  3LSL A;  4F39 A;  3M3L A;  5CMK A;  2XWI A;  3C9H A;  4I1D A;  1SVX B;  3RN8 A;  2QS1 A;  5AA1 A;  4PE3 A;  2V3U A;  5DVI A;  3EN3 A;  1OLC A;  3FUZ A;  3O6G A;  4FEB A;  2WBD A;  4LN5 A;  1Y3Q A;  3T66 A;  1H43 A;  1SW2 A;  1QW0 A;  1B0L A;  2HZL A;  2XXV A;  4G8H A;  1RKM A;  2XXI A;  3ISP A;  2O1M A;  4HE1 A;  4N07 A;  2ZYO A;  4KXP A;  4MFI A;  3QYT A;  2XXR A;  1FTA A;  5A5X A;  2G93 A;  1YYZ A;  1NNF A;  3TQW A;  1DK4 A;  4I3Y A;  2GRV A;  4EQ7 A;  4EQB A;  3W9W A;  2FNC A;  3MAM A;  1JW5 A;  4G8M A;  1EYK A;  4YMA A;  1P1O A;  3HHF A;  1FSA A;  1DBZ A;  1P99 A;  1MRP A;  4DI4 B;  3G3I A;  2WX9 A;  1LAG E;  1KWH A;  2UVG A;  2D3I A;  1FJ6 A;  3RPL B;  3DEL B;  2Z22 A;  4BDR A;  5K2Y A;  1MQH A;  4R6Y A;  1MPB A;  3QUF A;  4PCD A;  2GHA A;  3N26 A;  3QK6 A;  4H8I A;  4KCC A;  3Q25 A;  3S9E A;  1LB8 A;  3PUZ E;  1UTB A;  1FPF A;  1FPL A;  4O94 A;  3BIG A;  2RC7 A;  4GX6 A;  2V93 A;  3FXU A;  3FVK A;  2CZI A;  2HAV A;  3OO6 A;  3PV0 E;  3CR9 A;  2RCA A;  2KLF A;  2Y5K A;  3P7I A;  2O1L A;  3Q28 A;  5ET6 A;  4PGN A;  3E9X A;  3KGC A;  1MM7 A;  1B5H A;  4FE8 A;  4ELR A;  3TYH A;  1PBQ A;  3RGY A;  1FBD A;  1NV1 A;  5H8S A;  3SER A;  4DDD A;  1M5D A;  4BLA A;  2ZMB A;  3ECR A;  2VGQ A;  1RDY A;  1OQG A;  4FED A;  4G4P A;  4NGU A;  1ZBM A;  1NMU A;  4NE4 A;  2F3B A;  4YIC A;  1A54 A;  1QJM A;  2BJJ X;  2PBW A;  5DW8 A;  3RPW A;  3K1P A;  3SES A;  3ZS6 A;  3FVG A;  3RT8 A;  4EF2 A;  1SQY A;  1UIV A;  1URG A;  1QVS A;  4U1O A;  2Z8D A;  4PTK A;  3V5A A;  1CB6 A;  3HN0 A;  3SEV A;  1JP4 A;  2NUV A;  3O6I A;  1N76 A;  2YJP A;  3TZA A;  3TDJ A;  4QFO A;  3TTL A;  3GLB A;  4PFI A;  2KR0 A;  2CEX A;  3KC1 A;  1WDN A;  1FQF A;  3TEP A;  5I57 B;  5ET5 A;  3MW0 A;  4GD5 A;  1IMA A;  2UYE A;  1IMF A;  1XVX A;  1JQF A;  1KZ8 A;  5CC2 A;  1ANF A;  5I2K A;  2FIX A;  4GRK A;  1B1X A;  2P2A A;  4R2F A;  1I6Q A;  2F7C A;  4LZ7 A;  5EYG A;  5I2N B;  3S9N C;  4H0W A;  4EXK A;  2I0C A;  4P8B A;  2G29 A;  3PU5 A;  4PDD A;  3RQT A;  5IM2 A;  4ZEC A;  3OD7 A;  2VT5 A;  3D4G A;  1M5B A;  5KCJ B;  4PFU A;  1PB8 A;  4BDO A;  1IQ7 A;  2PYY A;  3LSF B;  3F11 A;  2ONK E;  1HSE A;  1URS A;  4HCY A;  4OVT A;  2ALU A;  1OIB A;  4MCO A;  5H8F A;  3VXC A;  4N8G A;  5I2K B;  3PD8 A;  1Y4C A;  2IEE A;  2XWV A;  4MBP A;  1N7X A;  1ZU0 A;  3UGW A;  2PFY A;  2HFB A;  1LBZ A;  4GF8 A;  3BFU A;  3ZKK A;  2Y7I A;  3LSX A;  1OMP A;  1MQJ A;  4KQP A;  3LV0 A;  2XXQ A;  4AS4 A;  3H4Z A;  1NUX A;  3Q26 A;  4XKN A;  4ONY A;  2IA4 A;  3TPA A;  3V83 A;  2QPQ A;  3I6V A;  4GVO A;  2F36 A;  1R6Z A;  3C32 A;  5H8N B;  4NF0 A;  3GZG A;  3V89 B;  3SEW A;  1B4Z A;  2YPN A;  2WBB A;  2OZZ A;  5ICQ A;  3PUY E;  1A7L A;  2Z8E A;  3M3K A;  4GLI A;  4JSO A;  1A8E A;  2ZZV A;  3EHT A;  2CMO A;  1BK4 A;  4NF8 B;  4OVR A;  4C1T A;  1MXY A;  1ZKB A;  1Y1M A;  4RK2 A;  1YPN A;  1FBP A;  1LBW A;  5FBP A;  1NNK A;  1Y9U A;  1O64 A;  2WKY A;  2CZL A;  3KN3 A;  1JNF A;  1NI9 A;  3ILU B;  3K6U A;  3MYU A;  4OMB A;  5BWJ A;  3MPK A;  3HCQ A;  2VOZ A;  1B58 A;  1AOV A;  2ESN A;  3R6U A;  1A8F A;  1LBY A;  4KYE A;  1LAX A;  2HAU A;  1S9T A;  1FBE A;  2PX1 A;  2W7Y A;  4GWU A;  2Q2A A;  2I58 A;  4ZED A;  2FVZ A;  3FXQ A;  4YKP A;  1ZLQ A;  1MQD A;  1G0H A;  3TQL A;  1DCU A;  3LC8 A;  3IOT A;  4FEC A;  1EYI A;  4Q8R A;  3RUM A;  2HQ0 A;  3H03 A;  3T22 A;  4YB6 A;  3ONM A;  3SEX A;  1O63 A;  2JJK A;  4GIZ A;  1INP A;  4YAH X;  1B0H A;  4Z7E A;  1B40 A;  1YZ0 A;  4NHB A;  3IAZ A;  4OVS A;  3FJM A;  4MF3 A;  3TTK A;  1I69 A;  2QS3 A;  4G61 A;  4EXL A;  2I6E A;  4F3S A;  3NOH A;  1B1H A;  4M4G A;  1SW4 A;  3HST A;  2B3B A;  2FHY A;  1RDX A;  1XI6 A;  4PDH A;  3CRB A;  1MQI A;  4GL8 A;  2R6G E;  1YXI A;  2OX3 A;  2PT1 A;  3TAJ A;  4F3G A;  4XFE A;  3VVD A;  3FXR A;  3TFL A;  1POT A;  3OXN A;  2RIN A;  1DMB A;  2F6G A;  3ROJ A;  4UA8 A;  1XS5 A;  2I48 A;  4I40 A;  1YTV A;  2I3V A;  3EKI A;  1M5E A;  1OQH A;  4OHN A;  4ESW A;  1H76 A;  4FAT A;  1QUL A;  5B70 A;  3DP8 A;  5DT6 A;  2V4C A;  3T0J A;  4OFL A;  4X04 A;  1NV2 A;  4X1B A;  4DCY A;  5I58 B;  1L5T A;  2E1S A;  4O3B A;  2QVR A;  3WAF A;  1IME A;  1FTJ A;  4PFW A;  2XXT A;  2DS9 A;  5F1Q A;  1FW0 A;  1Q1K A;  3RPL A;  1A40 A;  4R9F A;  4MLV A;  1Y20 A;  1LLS A;  2QMX A;  3GBA A;  2B65 A;  5EHS A;  4IY5 A;  3SKP A;  3K6X A;  5DVF A;  4I62 A;  2XD2 A;  2Q8M A;  4OTE A;  1FCK A;  1EZO A;  3CFX A;  2ABH A;  2DWJ A;  4NWC A;  4N17 A;  4GXS B;  2QS2 A;  4F3B A;  2XA5 A;  3DP4 A;  3K02 A;  3PUX E;  4QXD A;  4PF6 A;  1EZP A;  4H1X A;  3TUS A;  2HXW A;  3T1B A;  4UAC A;  1FJ9 A;  1FBG A; 
#chains in the Genus database with same CATH homology
 2WBB A;  3HFU A;  4NN3 A;  4PFI A;  4P1L A;  4P1E A;  5EQ9 A;  2KR0 A;  4IR8 A;  2B4M A;  4MJO A;  2CEX A;  3KC1 A;  5I5P A;  4P9K A;  5I3S A;  2PFZ A;  1NV5 A;  2QVV A;  4G61 A;  2L5V A;  1NV0 A;  4GX3 A;  1NV7 A;  5ESY A;  5LDZ A;  2DVZ A;  5IZ3 B;  2ZZV A;  2ZZX A;  2DE2 A;  5J1D A;  2P3N A;  1BK4 A;  1K9Z A;  4N8Y A;  1FPF A;  1AWB A;  3E79 A;  1FPL A;  4O94 A;  5ET5 A;  2FHY A;  1RDX A;  1XI6 A;  4HE2 A;  3PTY A;  3BIG A;  4GX6 A;  1FPJ A;  3D1R A;  1IMA A;  2XWI A;  4XF5 A;  4OVR A;  1NUW A;  4GWY A;  2CZI A;  1IMF A;  4PDH A;  4UAB A;  1KZ8 A;  1YXI A;  2HHM A;  2OX3 A;  2DE4 A;  2OWZ A;  5EYH A;  2XXK A;  4XFE A;  2FIX A;  5IZ1 A;  5IZZ A;  5J16 A;  4PE3 A;  1EYJ A;  2V3Q A;  2Y5K A;  3IFC A;  4JVI A;  4I3E A;  2DDK A;  4F19 A;  1QGX A;  5ET6 A;  1FBP A;  5T3J A;  4PBH A;  1LBW A;  3RYD A;  4P47 A;  4PC9 A;  4PGN A;  3T1B A;  5EYG A;  5FBP A;  4QBA A;  4F18 A;  4YZZ A;  2WBD A;  3ROJ A;  4LN5 A;  1KA1 A;  1NI9 A;  4P8B A;  4XEQ A;  5EQ7 A;  4F1U A;  1NUY A;  1IMD A;  2GQ1 A;  4I40 A;  5ET8 A;  5IZ3 A;  3U65 A;  2HZL A;  4O7I A;  3NOH A;  4PDD A;  1FBD A;  5F24 A;  4N4U A;  4X8R A;  1NV3 A;  3BIH A;  2XWO A;  3MYU A;  4N6D A;  4JVD A;  2R8T A;  1G0I A;  2QFL A;  2MKZ A;  3EKI A;  1FPE A;  1NV1 A;  4N15 A;  5IM2 A;  4NAP A;  1SPI A;  2BJI A;  2VT5 A;  4GX4 A;  2Y5L A;  2DE3 A;  5ET7 A;  3ISP A;  3LUZ A;  4P56 A;  2Q74 A;  4HE1 A;  3KBZ A;  2VPN A;  1LBV A;  1FBF A;  3IFA A;  4KXP A;  2P3V A;  4HE0 A;  4JVC A;  4OVS A;  1RDY A;  4HCW A;  3MST A;  2V4C A;  3T0J A;  4PAK A;  3E78 A;  1LBY A;  2HZK A;  4OAN A;  1FTA A;  4PFR A;  1NV2 A;  4X04 A;  4X9T A;  3FXB A;  4GWX A;  4NGU A;  5CM6 A;  4NX1 A;  5I7I A;  1IMC A;  2WEF A;  5EQA A;  4F1V A;  1VDW A;  1FBE A;  1FRP A;  1YYZ A;  2VPO A;  3B8B A;  1DK4 A;  4GBV A;  2ZZW A;  2F3B A;  4I3Y A;  4MAG A;  3SZP A;  2FBP A;  2QVR A;  4GWU A;  1IMB A;  1IME A;  4YIC A;  3W9W A;  2FVZ A;  4DI3 D;  1EYK A;  4HCY A;  4GWZ A;  4O7M A;  4OVT A;  3RPL A;  5DW8 A;  4M1V A;  2HXR A;  4MCO A;  2F5X A;  4MHF A;  4N8G A;  5JK4 A;  2CEY A;  2KQZ A;  4N81 A;  5A5L A;  1FSA A;  1DBZ A;  3KC0 A;  1G0H A;  4MNP A;  2XWV A;  4OVP A;  2HPG A;  5EQ8 A;  4PET A;  2CZK A;  5IGA A;  1DCU A;  4O8M A;  2PCR A;  4GBW A;  1EYI A;  4DI4 B;  2WYK A;  4H45 A;  4N91 A;  4AS5 A;  4PAI A;  2WX9 A;  4PBQ A;  2PFY A;  4N6K A;  1LBZ A;  2Q8M A;  1FJ6 A;  3A29 A;  3FBP A;  1D9Q A;  3RPL B;  2Q9T A;  4MNC A;  4OA4 A;  4PGP A;  2F3D A;  3LV0 A;  1FBH A;  4PTK A;  5LTC A;  1FPI A;  1FPG A;  3QMF A;  1NUX A;  4AS4 A;  4PFB A;  4P3L A;  1LBX A;  4H46 A;  4MMP A;  4N17 A;  2QVU A;  1KA0 A;  4PAF A;  2QPQ A;  1JP4 A;  4HXV A;  1K9Y A;  2JJK A;  2CZH A;  2B4L A;  1NV4 A;  2WYP A;  4OVQ A;  1INP A;  1NV6 A;  1NUZ A;  2XA5 A;  4MNI A;  4MX6 A;  4FBP A;  4MIJ A;  3GYY A;  3CHG A;  1FBC A;  4GWS A;  4NF0 A;  1RDZ A;  1FJ9 A;  4QXD A;  4PF6 A;  3W9V A;  2XWK A;  4GWW A;  3B50 A;  1Q9D A;  1YZ0 A;  4PCD A;  4NG7 A;  4NHB A;  1LEV A;  2FIE A;  4NQ8 A;  4PF8 A;  4MEV A;  1FPB A;  1FPK A;  1CNQ A;  1FBG A;  1FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...