5EYGA

Crystal structure of impase/nadp phosphatase complexed with nadp and ca2+
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
265
structure length
256
Chain Sequence
MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 79
structure length 256
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eygA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eygA02
4FBPA 5A5LA 1KA1A 3RPLB 4GX4A 5FBPA 4HXVA 5T3JA 4AS4A 3KC1A 2R8TA 5EQ9A 3LV0A 5ET5A 3BIGA 4GX6A 3ROJA 1YYZA 2P3VA 1AWBA 1CNQA 1SPIA 3IFAA 4HE0A 2PCRA 3A29A 1VDWA 2F3BA 1DCUA 1KA0A 1NUXA 2Q74A 4GWSA 2WBBA 2QFLA 2BJIA 1FJ6A 4GX3A 3BIHA 2Y5LA 1FPEA 3B8BA 1FPDA 1NV0A 5ET7A 2CZHA 1RDZA 4GWZA 1INPA 2CZKA 5ET6A 4G61A 1JP4A 1IMFA 2QVVA 1FBPA 2F3DA 4HE1A 4I3EA 4O7IA 1FSAA 1LBYA 1NV4A 5LDZA 4GBWA 5EQ8A 1YXIA 1EYIA 2OX3A 1FPJA 1DK4A 1FBHA 1FBDA 5I3SA 3RPLA 3RYDA 4PTKA 1FRPA 1IMCA 1G0IA 1LEVA 1KZ8A 2HHMA 3LUZA 5ESYA 4IR8A 1EYJA 1IMEA 1NUYA 1XI6A 5IZ3B 1LBVA 1DBZA 1LBXA 2OWZA 4GBVA 1Q9DA 1D9QA 1G0HA 4MJOA 2JJKA 1LBWA 1NV7A 1QGXA 5EYGA 3QMFA 5EQAA 5J16A 4HE2A 1NV6A 4GWUA 3T0JA 2QVRA 1NI9A 1NV3A 1IMBA 1FPLA 1LBZA 2Y5KA 4GWYA 1NV2A 1FPBA 1FPIA 4H45A 1FPFA 1NUWA 4H46A 1FBCA 2VT5A 4GWXA 4I3YA 1FBGA 3D1RA 5EYHA 2FHYA 4N81A 1K9ZA 2FIXA 1IMDA 1FPKA 3KC0A 1FBFA 1NUZA 5EQ7A 4QXDA 5ET8A 4AS5A 1FPGA 1FJ9A 1RDXA 2GQ1A 1IMAA 5F24A 2WBDA 2Q8MA 2FIEA 2FVZA 1YZ0A 2P3NA 3IFCA 2CZIA 1RDYA 1BK4A 5IZ1A 3KBZA 3FBPA 4GWWA 2QVUA 1NV5A 2WEFA 1NV1A 5DW8A 1EYKA 2FBPA 4KXPA 5IZ3A 2DDKA 4I40A 1FBEA 1K9YA 1FTAA
chains in the Genus database with same CATH superfamily
5AE4A 5A5LA 1PBQA 1FTKA 4X04A 3RQTA 1URGA 3Q27A 3FATA 3KSXA 1KWHA 3QK6A 5JK4A 2Q8JA 3DP6A 5EHSA 1USYH 4QSEA 4NF0A 4GX3A 3MPKA 4GF8A 2KQZA 1SYIA 4Q0CA 1B05A 4F18A 1WODA 4KCDA 5TP9A 5ISUA 5LDZA 5EQ8A 1BKAA 1US4A 1FCKA 4PQJA 1USYE 4EXLA 4RJZA 1FRPA 1NNTA 2A5SA 4QFOA 2OWTA 4RK9A 3MZ9A 1D9QA 4XEQA 1ATGA 2F6PA 2NXOA 4I62A 5ITPA 3C9HA 3FVGA 3L6HA 4IO3A 1GV8A 4O7MA 4ELQA 3OOAA 1Z7ME 4WEDA 1IMAA 3TQLA 1FQFA 2FVZA 1OLCA 2Y7RA 4OFJA 3RNNA 2F35A 5CMMA 1EYKA 4OMBA 2R8TA 2E1SA 1P1WA 3R26A 4P47A 4POWA 4RA1A 2F34A 3IFAA 3V8XB 4N6PA 1LGBC 3SERA 4P3LA 1JEVA 4C0RA 2QFLA 4EF1A 4KYDA 4PCDA 3E3KA 2RC7A 3NOHA 4QFPA 2DSFA 3VV5A 2CZKA 1A54A 4G61A 2RC8A 4F39A 5L8DA 1JVYA 1LLSA 4PFBA 2KR0A 1DK4A 4H8IA 3GZGA 4KPTA 2AIXA 3SEWA 2OBGA 1LBBA 1G0IA 4UABA 4DI4B 4OVSA 4FEDA 2O84X 1NH8A 3SKPA 4OEVA 2O7IA 3HHFA 2G93A 3T0JA 2XWIA 3GLBA 3RT8A 3PUYE 2NVUB 3TTLA 1MH4A 3A3UA 4GWYA 4PFIA 2DVCA 4AQ4A 1FBGA 3D1RA 3MVWA 2FNCA 3OD7A 1B0LA 2XXTA 3A3CA 4OVJA 3EPEA 5I2KB 3FVNA 3K1PA 1FTOA 2B3FA 2XXYA 3OEMA 2ALUA 2F7AA 2Z8DA 4P9KA 1DOTA 1XS5A 5F7VA 5K2XA 5IZ1A 5ICQA 1QUKA 2F97A 4U4XA 2RC9A 4DIGA 4LN5A 1GVCA 5EQ9A 3LUYA 4NF5B 3AXFA 4F1VA 1IXHA 4ESWA 1NMUA 4HE0A 3U8QA 1TFDA 2H99A 3U1OA 3UK4A 4GWSA 4JVDA 1NNPA 1FJ6A 4O3CA 4DE8A 5A5XB 3UN6A 1MQGA 5ET6A 2ZYOA 4R73A 2I58A 3IJOB 4JBZA 5H8FB 1LAHE 4U2RA 4L17A 1QUJA 1OVTA 1IMCA 2HHMA 4XTCQ 4JWYA 5EYFA 1B32A 3MPLA 2P0SA 3CSGA 4HE2A 3O2AA 1NV6A 1NKXA 3CIJA 3JV9A 4PFUA 4H8JA 1FPFA 1Y3QA 2V84A 1MDP1 2DWAA 4PE3A 1MXZA 3Q29A 4H67A 1NUZA 4BLAA 1Y1MA 2HQ0A 3IB1A 3MWBA 4RPNA 3IFCA 4G68B 1SYHA 1B7UA 4TLLB 2XD2A 2DP8A 4MBPA 1LFHA 3KN7A 4E0XA 4G77A 4PDDA 3W15C 2VHAA 1IIWA 3TAJA 4GX4A 4ELRA 3C4MA 3LBSA 2ZNSA 5LOMA 3LV0A 4QFLA 2XXXA 2W7YA 4OVRA 3U65A 5CMBA 1YYZA 3GXAA 1MY3A 3A29A 4G68C 4XKNA 3TZAA 2ZZWA 5I2KA 2Q74A 1MQHA 1SW2A 4MCOA 3RY3A 3BFUA 3A09A 2PYYA 1B7HA 4OHNA 2UVJA 4N6DA 1JP4A 1B3EA 4ZZAA 3E13X 3OMBA 3O28A 3BBRA 3S9MC 3PPNA 4NF5A 3OELA 1NH7A 5H8SA 1D4NA 4NF6B 1B3HA 2PX1A 2NOOA 5I2NB 2OWZA 4GBVA 1DMBA 4NX1A 1Y3PA 3C35A 4FE8A 2PVUA 5J16A 3T66A 4R75A 5IM2A 4XXUA 3KOTA 2CZLA 2OZZA 1FPIA 2F7CA 3CFLA 1TFAA 4OVPA 4LUBA 4IB2A 4OERA 3T93B 4H5FA 2XXPA 2V4CA 5EQ7A 4U1OA 3C34A 1BTJA 2FYIA 1Z7NE 4AS5A 2WX9A 3QXMA 2XD3A 2AL4A 2ZMBA 3OSRA 1RYXA 3I5OA 5H8FA 4P56A 5DVJA 3RT6B 2HCAA 3O97A 3TFLA 2I3VA 4GWWA 1MH3A 4YB5A 2WYPA 2PBWA 1FBEA 4QF9A 1JW1A 1IUDA 3FJMA 1FQAA 2Y7KA 1AOVA 3BIGA 1O63A 4F2QA 2DE4A 1DPEA 2V3UA 2O1LA 3IOUA 2QPQA 4G68A 1H3DA 4N15A 4U1ZA 2F3DA 5CBRA 1QKAA 4THIA 2ZNTA 4H0WA 3USDA 4YKKA 4N07A 1FBDA 4PTKA 4PE5B 1P1UA 3H6WA 5ESYA 2HEUA 1IMEA 1XI6A 4OESA 2JJKA 1N3XA 4ZE9A 4GWUA 4NTLA 4YB6A 1YAEA 4PAKA 1H44A 2V93A 4MAGA 3SEYA 2O1MA 1M5BA 1Y9UA 4FORA 1B3FA 3PUVE 3TUSA 4GOTA 1B40A 3CSBA 3TTNA 2GFEA 1B46A 1ZJLA 2REGA 3T9UA 1PDAA 5TPAB 4PAFA 3TKDA 4DDDA 3OEKA 3QAXA 4PBQA 1II5A 4N4UA 3TELA 1MXUA 1IXCA 3U93A 4MNIA 1LB9A 3PUXE 2QVUA 4NF6A 2REJA 3THIA 5L9MA 5I2NA 4XKQA 2Y7WA 4IO7A 5FBPA 3UORA 2L5VA 4N6KA 4BDNA 3G3IA 4Z0IA 3T22A 4F3SA 1IZ1A 4P11A 2PMSA 4LZ8A 5CMKA 3EHTA 1MPBA 4QBAA 1Y4TA 2Y5LA 4FEBA 4OVTA 2XXWA 1ZLQA 1M5DA 5I7IA 1VFDA 1RKMA 2OJTA 3MVXA 3H06B 1IMFA 4GVOA 3G7WA 3R6UA 1NNFA 4OA4A 5DVIA 4Q5TA 5I5PA 1N76A 4JXIA 4DXCA 1EYIA 4P1LA 3PPRA 4MLQA 2VOZA 3MVYA 3CG1A 3M3KA 3MC2A 1OLAA 3PGFA 1QGXA 3TQWA 4ZDMA 1IMBA 3S9NC 1IXGA 1NUWA 3D4CA 1I6AA 2OWSA 4ZS9A 1A40A 1DTGA 4LZ7A 1H76A 1A55A 5ET8A 1MS7A 1US5A 4JWXA 1D9VA 4FATA 5F24A 3K1NA 1UTBB 2OPEA 2PT1A 2FIEA 2DOJA 1A8EA 4QFNA 2XXQA 4X8RA 1NV5A 2RCAA 2FBPA 1MQJA 4KXPA 2XWVA 3F11A 3E9XA 3RLFE 1I6QA 1MXWA 2ONRA 3PD9A 4IGTA 3TTKA 2QSXA 3ECRA 3CI8A 3HCQA 4GIZA 3CG3A 3PUWE 2DE3A 1NNKA 2GHAA 3HV1A 3KJ7A 3HPIA 4NGUA 3FVOA 3G3FA 3FGSA 3QUJA 4F19A 2UXAA 5TPAA 1ZMGA 1IEJA 3K01A 4PFYA 1FPEA 2DYXA 5KCJB 1Y3NA 4U21A 1QULA 3KBRA 3CR9A 3FXUA 4O7IA 3O6HA 1NV4A 1RYOA 4RNSA 3VLUA 1B5HA 2VD3A 4R9GA 3RPWA 1TXFA 1R1NA 1MQIA 1EYJA 1MY0A 2DE2A 5IZ3B 2E0SA 1WVJA 1JW5A 2XX8A 1NV7A 1OMPA 3ODBA 1NI9A 3HFUA 1LFIA 3FJGA 5I57B 3TMGA 1AIVA 3EF7A 5EYHA 4G2ZA 1GTKA 1ZKBA 3PPQA 2Z8FA 4ND9A 5ITOA 2UVHA 1QUIA 1URDA 5H8NB 3OXNA 4HTGA 3O6IA 3IO6A 1GGGA 2A5TB 1SI0A 5TU0A 2OLBA 4FIMA 1N04A 3H03A 4LA9A 3CRBA 4M1VA 1VE4A 4TLMB 3KC1A 1SQYA 2DXRA 2RINA 2B4LA 2I0BA 3L6GA 3EQ1A 3S9EA 4N13A 5HBCA 1NUXA 4OWDA 4F22A 3MVZA 3MZ1A 5ELVA 1UTBA 5AA2D 3H4ZA 5IAIA 2DWJA 2LAOA 4GXAA 3FUZA 3TPAA 2H98A 3TTRA 4PF8A 1VSOA 3N6UA 5B7DA 4G4PA 3C31A 3P7IA 1NFTA 1SW5A 2ZNUA 1LEVA 3PTYA 5DYHA 1LBVA 1OVBA 1B3LA 5F1QA 4P0IA 1SDXA 4QSCA 1EH3A 2V3TA 1LSTA 5I56B 3JYRA 4C1UA 5KCJA 2VT5A 4MIJA 4EUOA 3FXRA 3O29A 2H25A 4F2OA 2WKYA 5FHOA 5FHMA 2Q8MA 4P0GA 2DVZA 3D4GA 4XIGQ 4OVQA 2VP1A 4KFQA 4NWDA 2XXRA 1LCTA 3FXQA 2F78A 5IZ3A 4I40A 4FBPA 1OQHA 4AS4A 2ONKE 3VXBA 5ET5A 4NQ8A 3TCFA 5BWJA 4PBHA 2RF1A 2OPDA 5I57A 1B1XA 1TT1A 2HXRA 4WKMA 3RTFB 1B2HA 4PAIA 4OTEA 4YMAA 3SEXA 3B6TA 3BFTA 3O9PA 4EDPA 2P2AA 4DZ1A 1LAFE 1MM7A 2F6GA 4U23A 4PFRA 1FPDA 3MBPA 5H8NA 3MJNA 4PGNA 1NL5A 4IO6A 1XC1A 2DXYA 2A5TA 2D3IA 4GRKA 4O3BA 4ZEBA 4GBWA 2Q2CA 2Z8EA 4P1EA 4JWOA 3QYTA 4IY6A 3LSXA 4EQ9A 4KHZE 3S2VA 1HSEA 3IJXB 4ELPA 3B6QA 1F9BA 2Q88A 4WXJA 4PP0A 4FECA 3V83A 2DWHA 2Y5KA 3B50A 1FPBA 2F36A 3SZPA 1T0KA 2XWKA 1K9ZA 1SVXB 1FBFA 5FTIA 4OQOA 1M5CA 4PF6A 2XA5A 1FPGA 3N5LA 1URSA 5LTCA 2P1SA 4O94A 1YZ0A 3K4UA 4I8CA 3EN3A 4DLDA 2I6EA 5ICTA 3BKIB 1KA1A 2Q2AA 4KYSA 3V5AA 1S7YA 4DXUA 4F1UA 4Z7EA 5AA2B 5I56A 4GX6A 1N7XA 4YMBA 2XXKA 5DVFA 4NE4A 4EF2A 4DI3D 1FTMA 5L9SA 2QJEA 3K6VA 5I58A 5AA3A 3FIRA 3UP9A 1VR5A 4LQ5A 4NHBA 1YTVA 3KZGA 4X1DA 1PEBA 1PB9A 3LSFB 5H8HB 1O64A 4N8YA 1UIVA 2X7QA 4I3EA 3MUQA 4WEPA 1B1HA 3FASA 1FPJA 1ZTYA 3IO4A 3MP6A 4ECFA 1MM6A 3LUZA 3ZKLA 4R6KA 4UA8A 1DBZA 1LBXA 3GBAA 5CMCA 2OK2A 3H6VA 2X7PA 2QS2A 1UQWA 1BLFA 4GD5A 1FTLA 3VE1B 4NEDA 1FBCA 4GWXA 4R6HA 2FHYA 3G3HA 4N81A 4G8NA 4ZE8A 3ILTB 4MHFA 4H6DA 3K2DA 1N3WA 2I4CA 5DTBA 3OO9A 1B4HA 3TTMA 3ZSFA 4ZEFA 3DLNA 3K6UA 4NAPA 4R74A 3FBPA 1XVXA 4XF5A 1P99A 3IB0A 3SDFA 4QSDA 4UACA 4X1BA 2R71A 4KQPA 2ZZXA 4HCYA 4EQ7A 4TOZA 4HS7A 4DXBA 4MLVA 4F29A 3ROJA 1FQDA 5M2VA 1QW0A 1VDWA 2PT2A 5JEIA 3IOVA 1Q35A 3IOTA 4FJPA 3G3GA 2QS3A 3WAFA 1BIYA 4R72A 4YU0A 3DP8A 1EU8A 2DWIA 3UIFA 3I6VA 3IR1A 4GWZA 3FJ7A 1Y4CA 2QS4A 2Y84A 3ONMA 2QVVA 1PB7A 2VGQA 3KN8A 4R9FA 1FTJA 1XHYA 1LBYA 4H5GA 3LR1A 1TWYA 1MXYA 2O51A 1YXIA 4PC9A 1S9TA 3IX1A 5AA2A 4LZ5A 1PB8A 4E0WA 1QVSA 1A7LA 2H9BA 3C36A 3QIMA 2ESNA 4BDRA 2MKZA 5FTHA 1ELJA 4JSOA 1N84A 3VLVA 4F31B 1NV3A 1LBZA 1JEUA 1NV2A 2I49A 4H45A 1FW0A 1QJMA 2D5WA 4GXSB 5H8HA 2F7BA 5I59A 1IMDA 3KC0A 4YICA 2VPOA 1FQCA 2HPGA 3B6WA 3CFXA 2Y7IA 3VFJA 4F3PA 1RDXA 1P1OA 2XXHA 3DELB 1MY2A 4ZECA 2CZIA 1RDYA 3PD8A 4EQBA 1A8FA 3U72A 1AL3A 4HCWA 4OANA 4G8HA 4ZEKA 3EHSA 5K2YA 1K9YA 2GQ1A 3T96B 4OFLA 1IQ7A 3SEUA 5KDTA 4MNCA 3IORA 2XX7A 2QMWA 3O66A 2B3BA 4ISUA 4O3AA 3VXCA 2ZYKA 4G8MA 3IL1B 3SESA 4QFKA 3VLWA 3B8BA 4F3BA 2GRVA 1NV0A 2CZHA 2KLFA 1ZU0A 1EZPA 3I3VA 1RDZA 4N17A 3Q25A 2HZLA 3U92A 4XFEA 3EKIA 4JDFA 5IZZA 2QS1A 1JW4A 4GWOA 2YJPA 3S9LC 5I3SA 4KR5A 5L9OA 1N0TA 2GH9A 3UA8A 5AA4B 1UTHB 3HSTA 3TCGA 3W9VA 2NUVA 5CRYA 3T9HB 4ELOA 1Q9DA 5EYGA 2R9JA 4I1DA 5EQAA 3TODA 5DT6A 1B3GA 1XVYA 3N6TA 4X9TA 2UYFA 4AB6A 1LAXA 3RTWB 1B51A 1Y20A 1JVXA 5IGAA 3W9WA 4JB7A 3OO6A 3KGCA 4GFRA 2PFYA 1S50A 2HXWA 5EHMA 4PDHA 1I6BA 4MF3A 4RY1A 2G29A 2O68A 1QKBA 3ILUB 2WBDA 3MZBA 3OO7A 4YKIA 4ZEDA 3GBBA 2ZYMA 4X48A 4LATA 2WEFA 2UVGA 4RXLA 4H1XA 2Q89A 4ONYA 4MEVA 1M5FA 1R9QA 2HAVA 4OENA 3HHGA 3VVDA 3ISPA 2QRYA 1I69A 2XX9A 3OENA 4IY5A 1DTZA 2B65A 1CNQA 1LFGA 3OSQA 1SI1A 2I3WA 5FHNA 3M8UA 1ZBMA 5KZTA 1PC3A 1KA0A 4GQOA 3OO8A 2WBBA 4IO4A 4OXVA 4RK2A 2XWOA 3KEIA 3T1BA 2Q9TA 1LCFA 3IAZA 4PFTA 3FD3A 1MXXA 1FSAA 1FQEA 1MRPA 4U4SA 5BUUA 4MMPA 3U94A 3IOWA 5H8QB 2AYSA 3RGYA 1G0HA 4MX6A 2Y7PA 1IITA 3PMVA 3CVGA 3T9VA 2OCUA 1B58A 2D21A 4BDQA 3LSLA 4IO5A 3PU5A 1XOCA 1R9LA 1B9JA 1O7TA 2UYEA 5CBSA 1EZ9A 3SETA 1GR2A 2P3NA 1BK4A 2UVIA 5AA4A 1FQBA 1UTHA 1NV1A 4YB7A 2DDKA 4ZZEA 2GHBA 4GL0A 4RYAA 5I58B 4OFOA 1AMFA 3H6TA 2O6AA 1LB8A 3K6WA 2YPNA 2HAUA 2XXVA 3R7XA 1A99A 1MPCA 1AWBA 1SPIA 2THIA 2PCRA 3H3GA 2IEEA 4QRZA 4KI0E 4QHQA 5JTYB 3K6XA 1LAGE 3MSTA 4XKPA 5DEXB 5IKBA 2F3BA 3E78A 4H65A 3FV2A 3TDJA 4O8MA 4YAHX 1LBCA 1INPA 3LC8A 4MFIA 1FBPA 2I48A 3PV0E 4ZEIA 3VVFA 1H45A 3RN8A 4NF8B 4PETA 3H7MA 3FV1A 4JVIA 2R6GE 1FBHA 1CE2A 3HO7A 2AL5A 4LONB 4BDOA 1NUYA 2ONSA 3G3JA 2FA7A 2IA4A 1MDQA 4PGPA 2HZKA 1JNFA 4P8BA 2QVRA 3N26A 3N94A 1P1QA 4DCYA 3RUMA 3IB2A 1B52A 4I3YA 1Q1KA 1FPKA 1MY4A 3C32A 1YPNA 2ZXTA 3FXBA 4DCXA 1J1NA 3TYHA 3UGWA 2ZYNA 5DW8A 4MH5A 4K3FA 5B70A 4RPOA 4IGRA 3KOSA 1DSNA 5CC2A 5H8QA 2ZZVA 4TQUQ 3RPLB 4HXVA 1CB6A 4BDMA 2F8DA 1N7WA 1MPDA 1UIUA 3KG2A 1MG1A 3IK6B 2H4IA 2ANJA 4OETA 3K00A 1EZOA 3MAMA 1DCUA 4NN3A 1H43A 3TEPA 1SBPA 3HN0A 3BIHA 2O69A 1XT8A 1WDNA 4PFWA 4XKRA 1POY1 2M8CA 3QSLA 3FZVA 4JVCA 2I4BA 3PPPA 1BP5A 2OX3A 4JSDA 3DM0A 3KFMA 1B0HA 1B5JA 5A5XA 4NF4B 3CHGA 1KZ8A 3G3KA 3JZJA 1DPPA 3K1MA 4IR8A 3VVEA 3H6UA 2B4MA 4LP2B 5I59B 4FAJA 1LBWA 3KJTA 5JTYA 3FVKA 5DEXA 4R2FA 1FPLA 4N8GA 2H5YA 3KN3A 1OQGA 1MXVA 4GL8A 4OYVA 1ZIUA 4YKJA 3B7DA 1M5EA 2XHDA 4MNPA 4KYEA 5HM4B 1L5TA 1FJ9A 3PPOA 4NF8A 5I84A 3Q26A 4BDLA 5KDTB 4Q8RA 3VDFA 3MYUA 4NWCA 3KBZA 3C33A 5TP9B 3DP4A 2I0CA 2O7UA 1FTAA 1D3KA 3M3LA 5T3JA 1Y1ZA 2Z23A 3CFZA 4Q30B 1JQFA 2RCBA 4C1TA 1B7ZA 2CMOA 2NWJA 3K0VA 5CI5A 4I9DA 4IO2A 2P3VA 4EXKA 1HSLA 3K02A 2PFZA 1ANFA 3PMXA 3Q28A 3KSJA 2DS9A 1B6HA 3M3FA 4KD5A 1JETA 2BJIA 4ESXA 4N91A 1MQDA 4YKPA 5ET7A 3WAEA 3QUFA 3ZS6A 3EHUA 1MY1A 2X26A 2BJJX 4F3GA 4HE1A 2WYKA 2VD2A 4F1YA 2VPNA 1B5IA 5CM6A 4OZ9A 3T9XB 4POXA 1OIBA 4R6YA 3RPLA 3RYDA 3PMWA 1AH5A 1R6ZA 4LQ2A 1D9YA 3ZKKA 3MW0A 3GYYA 5HPQA 4OEUA 4NG7A 5AA1A 1YCJA 3E79A 4MJOA 3QMFA 2CEYA 4R2BA 1P1NA 3TCHA 4AB5A 2XXUA 4GLIA 3MP8A 2QMXA 3LSWA 3MQ9A 2DQVA 1HSJA 2YLNA 1VFEA 4H46A 4LVQA 3S4UA 4NMYA 2RKMA 4KCCA 2HFBA 2FIXA 2F5XA 1IXIA 1PBPA 3SEVA 3O6GA 2QL3A 2V25A 4U22A 4QXDA 2Z22A 2V3QA 1SW1A 1SW4A 3PUZE 3V89B 4YZZA 4HW8A 1POTA 3MP1A 4M4GA 2ABHA 2XXIA 4NF4A 1B4ZA 2CEXA 5J1DA 1SD3A 3E4RA
chains in the Genus database with same CATH topology
4FBPA 5A5LA 4MEVA 4AS4A 3ISPA 4X04A 5ET5A 4NQ8A 4PBHA 3BIGA 1CNQA 2HXRA 4PAIA 5JK4A 2DE4A 1KA0A 2WBBA 4NF0A 4GX3A 4PFRA 2KQZA 2XWOA 1FPDA 2QPQA 3T1BA 2Q9TA 4PGNA 4N15A 4F18A 2F3DA 1FSAA 5LDZA 4GBWA 5EQ8A 4P1EA 1FBDA 4PTKA 1FRPA 5ESYA 1IMEA 1XI6A 4MMPA 1D9QA 4XEQA 1G0HA 2JJKA 4MX6A 4GWUA 2Y5KA 3B50A 4PAKA 1FPBA 4MAGA 3SZPA 2XWKA 1K9ZA 1FBFA 4O7MA 4PAFA 4PF6A 2XA5A 1FPGA 1IMAA 4PBQA 5LTCA 2FVZA 4O94A 1YZ0A 2P3NA 4N4UA 1BK4A 4MNIA 2QVUA 1NV1A 1EYKA 2DDKA 1KA1A 5FBPA 2R8TA 2L5VA 4F1UA 4N6KA 4P47A 4GX6A 1AWBA 1SPIA 2XXKA 3IFAA 2PCRA 4DI3D 4P3LA 3MSTA 2F3BA 3E78A 2QFLA 4QBAA 4NHBA 2Y5LA 4OVTA 4PCDA 5I7IA 4O8MA 3NOHA 1INPA 2CZKA 4G61A 1IMFA 4N8YA 1FBPA 4I3EA 4OA4A 4PETA 4PFBA 2KR0A 5I5PA 1EYIA 4JVIA 4P1LA 1FPJA 1DK4A 1FBHA 1G0IA 4UABA 3LUZA 4DI4B 1NUYA 4OVSA 1DBZA 1LBXA 4PGPA 2HZKA 1QGXA 3T0JA 2QVRA 4P8BA 2XWIA 1IMBA 4GWYA 4PFIA 1NUWA 1FBCA 4GWXA 4I3YA 1FBGA 3D1RA 2FHYA 4N81A 1FPKA 4MHFA 5ET8A 5F24A 3FXBA 2FIEA 4X8RA 4P9KA 4NAPA 5IZ1A 3FBPA 5DW8A 1NV5A 4XF5A 2FBPA 4KXPA 2XWVA 4LN5A 5EQ9A 2ZZVA 3RPLB 4HXVA 4F1VA 2ZZXA 4HCYA 3ROJA 4HE0A 2DE3A 4NGUA 1VDWA 1DCUA 4F19A 4GWSA 4JVDA 4NN3A 1FJ6A 3BIHA 1FPEA 4GWZA 5ET6A 2QVVA 4O7IA 4JVCA 1LBYA 1NV4A 1YXIA 2OX3A 4PC9A 1IMCA 2HHMA 1KZ8A 3CHGA 4IR8A 1EYJA 2DE2A 5IZ3B 2MKZA 2B4MA 1LBWA 1NV7A 4HE2A 1NV6A 1NI9A 1NV3A 1FPLA 1LBZA 3HFUA 4N8GA 1NV2A 4H45A 1FPFA 5EYHA 4PE3A 4MNPA 1IMDA 3KC0A 1NUZA 4YICA 2VPOA 2HPGA 1FJ9A 1RDXA 3IFCA 2CZIA 1RDYA 3MYUA 3KBZA 4HCWA 4OANA 4PDDA 4M1VA 1K9YA 2GQ1A 1FTAA 4GX4A 5T3JA 3KC1A 3LV0A 4MNCA 4OVRA 3U65A 1YYZA 2P3VA 2B4LA 3A29A 2PFZA 1NUXA 2ZZWA 2Q74A 4MCOA 2BJIA 4N91A 3B8BA 1NV0A 5ET7A 2CZHA 1RDZA 4N17A 4N6DA 1JP4A 2HZLA 4HE1A 2WYKA 4XFEA 4PF8A 3EKIA 2VPNA 5IZZA 5CM6A 5I3SA 3RPLA 3RYDA 1LEVA 3PTYA 3W9VA 3GYYA 1LBVA 4NG7A 2OWZA 4GBVA 1Q9DA 4NX1A 3E79A 4MJOA 5EYGA 3QMFA 5EQAA 5J16A 2CEYA 5IM2A 4X9TA 1FPIA 4OVPA 4H46A 2VT5A 4MIJA 5IGAA 3W9WA 2FIXA 2F5XA 2PFYA 2V4CA 5EQ7A 4PDHA 4QXDA 4AS5A 2WX9A 2V3QA 4YZZA 2WBDA 2Q8MA 4P56A 2DVZA 4OVQA 4GWWA 2WEFA 2WYPA 2CEXA 5J1DA 5IZ3A 4I40A 1FBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBP A;  5A5L A;  1KA1 A;  3RPL B;  4GX4 A;  5FBP A;  4HXV A;  5T3J A;  4AS4 A;  3KC1 A;  2R8T A;  5EQ9 A;  3LV0 A;  5ET5 A;  3BIG A;  4GX6 A;  3ROJ A;  1YYZ A;  2P3V A;  1AWB A;  1CNQ A;  1SPI A;  3IFA A;  4HE0 A;  2PCR A;  3A29 A;  1VDW A;  2F3B A;  1DCU A;  1KA0 A;  1NUX A;  2Q74 A;  4GWS A;  2WBB A;  2QFL A;  2BJI A;  1FJ6 A;  4GX3 A;  3BIH A;  2Y5L A;  1FPE A;  3B8B A;  1FPD A;  1NV0 A;  5ET7 A;  2CZH A;  1RDZ A;  4GWZ A;  1INP A;  2CZK A;  5ET6 A;  4G61 A;  1JP4 A;  1IMF A;  2QVV A;  1FBP A;  2F3D A;  4HE1 A;  4I3E A;  4O7I A;  1FSA A;  1LBY A;  1NV4 A;  5LDZ A;  4GBW A;  5EQ8 A;  1YXI A;  1EYI A;  2OX3 A;  1FPJ A;  1DK4 A;  1FBH A;  1FBD A;  5I3S A;  3RPL A;  3RYD A;  4PTK A;  1FRP A;  1IMC A;  1G0I A;  1LEV A;  1KZ8 A;  2HHM A;  3LUZ A;  5ESY A;  4IR8 A;  1EYJ A;  1IME A;  1NUY A;  1XI6 A;  5IZ3 B;  1LBV A;  1DBZ A;  1LBX A;  2OWZ A;  4GBV A;  1Q9D A;  1D9Q A;  1G0H A;  4MJO A;  2JJK A;  1LBW A;  1NV7 A;  1QGX A;  5EYG A;  3QMF A;  5EQA A;  5J16 A;  4HE2 A;  1NV6 A;  4GWU A;  3T0J A;  2QVR A;  1NI9 A;  1NV3 A;  1IMB A;  1FPL A;  1LBZ A;  2Y5K A;  4GWY A;  1NV2 A;  1FPB A;  1FPI A;  4H45 A;  1FPF A;  1NUW A;  4H46 A;  1FBC A;  2VT5 A;  4GWX A;  4I3Y A;  1FBG A;  3D1R A;  5EYH A;  2FHY A;  4N81 A;  1K9Z A;  2FIX A;  1IMD A;  1FPK A;  3KC0 A;  1FBF A;  1NUZ A;  5EQ7 A;  4QXD A;  5ET8 A;  4AS5 A;  1FPG A;  1FJ9 A;  1RDX A;  2GQ1 A;  1IMA A;  5F24 A;  2WBD A;  2Q8M A;  2FIE A;  2FVZ A;  1YZ0 A;  2P3N A;  3IFC A;  2CZI A;  1RDY A;  1BK4 A;  5IZ1 A;  3KBZ A;  3FBP A;  4GWW A;  2QVU A;  1NV5 A;  2WEF A;  1NV1 A;  5DW8 A;  1EYK A;  2FBP A;  4KXP A;  5IZ3 A;  2DDK A;  4I40 A;  1FBE A;  1K9Y A;  1FTA A; 
#chains in the Genus database with same CATH topology
 5AE4 A;  5A5L A;  1PBQ A;  1FTK A;  4X04 A;  3RQT A;  1URG A;  3Q27 A;  3FAT A;  3KSX A;  1KWH A;  3QK6 A;  5JK4 A;  2Q8J A;  3DP6 A;  5EHS A;  1USY H;  4QSE A;  4NF0 A;  4GX3 A;  3MPK A;  4GF8 A;  2KQZ A;  1SYI A;  4Q0C A;  1B05 A;  4F18 A;  1WOD A;  4KCD A;  5TP9 A;  5ISU A;  5LDZ A;  5EQ8 A;  1BKA A;  1US4 A;  1FCK A;  4PQJ A;  1USY E;  4EXL A;  4RJZ A;  1FRP A;  1NNT A;  2A5S A;  4QFO A;  2OWT A;  4RK9 A;  3MZ9 A;  1D9Q A;  4XEQ A;  1ATG A;  2F6P A;  2NXO A;  4I62 A;  5ITP A;  3C9H A;  3FVG A;  3L6H A;  4IO3 A;  1GV8 A;  4O7M A;  4ELQ A;  3OOA A;  1Z7M E;  4WED A;  1IMA A;  3TQL A;  1FQF A;  2FVZ A;  1OLC A;  2Y7R A;  4OFJ A;  3RNN A;  2F35 A;  5CMM A;  1EYK A;  4OMB A;  2R8T A;  2E1S A;  1P1W A;  3R26 A;  4P47 A;  4POW A;  4RA1 A;  2F34 A;  3IFA A;  3V8X B;  4N6P A;  1LGB C;  3SER A;  4P3L A;  1JEV A;  4C0R A;  2QFL A;  4EF1 A;  4KYD A;  4PCD A;  3E3K A;  2RC7 A;  3NOH A;  4QFP A;  2DSF A;  3VV5 A;  2CZK A;  1A54 A;  4G61 A;  2RC8 A;  4F39 A;  5L8D A;  1JVY A;  1LLS A;  4PFB A;  2KR0 A;  1DK4 A;  4H8I A;  3GZG A;  4KPT A;  2AIX A;  3SEW A;  2OBG A;  1LBB A;  1G0I A;  4UAB A;  4DI4 B;  4OVS A;  4FED A;  2O84 X;  1NH8 A;  3SKP A;  4OEV A;  2O7I A;  3HHF A;  2G93 A;  3T0J A;  2XWI A;  3GLB A;  3RT8 A;  3PUY E;  2NVU B;  3TTL A;  1MH4 A;  3A3U A;  4GWY A;  4PFI A;  2DVC A;  4AQ4 A;  1FBG A;  3D1R A;  3MVW A;  2FNC A;  3OD7 A;  1B0L A;  2XXT A;  3A3C A;  4OVJ A;  3EPE A;  5I2K B;  3FVN A;  3K1P A;  1FTO A;  2B3F A;  2XXY A;  3OEM A;  2ALU A;  2F7A A;  2Z8D A;  4P9K A;  1DOT A;  1XS5 A;  5F7V A;  5K2X A;  5IZ1 A;  5ICQ A;  1QUK A;  2F97 A;  4U4X A;  2RC9 A;  4DIG A;  4LN5 A;  1GVC A;  5EQ9 A;  3LUY A;  4NF5 B;  3AXF A;  4F1V A;  1IXH A;  4ESW A;  1NMU A;  4HE0 A;  3U8Q A;  1TFD A;  2H99 A;  3U1O A;  3UK4 A;  4GWS A;  4JVD A;  1NNP A;  1FJ6 A;  4O3C A;  4DE8 A;  5A5X B;  3UN6 A;  1MQG A;  5ET6 A;  2ZYO A;  4R73 A;  2I58 A;  3IJO B;  4JBZ A;  5H8F B;  1LAH E;  4U2R A;  4L17 A;  1QUJ A;  1OVT A;  1IMC A;  2HHM A;  4XTC Q;  4JWY A;  5EYF A;  1B32 A;  3MPL A;  2P0S A;  3CSG A;  4HE2 A;  3O2A A;  1NV6 A;  1NKX A;  3CIJ A;  3JV9 A;  4PFU A;  4H8J A;  1FPF A;  1Y3Q A;  2V84 A;  1MDP 1;  2DWA A;  4PE3 A;  1MXZ A;  3Q29 A;  4H67 A;  1NUZ A;  4BLA A;  1Y1M A;  2HQ0 A;  3IB1 A;  3MWB A;  4RPN A;  3IFC A;  4G68 B;  1SYH A;  1B7U A;  4TLL B;  2XD2 A;  2DP8 A;  4MBP A;  1LFH A;  3KN7 A;  4E0X A;  4G77 A;  4PDD A;  3W15 C;  2VHA A;  1IIW A;  3TAJ A;  4GX4 A;  4ELR A;  3C4M A;  3LBS A;  2ZNS A;  5LOM A;  3LV0 A;  4QFL A;  2XXX A;  2W7Y A;  4OVR A;  3U65 A;  5CMB A;  1YYZ A;  3GXA A;  1MY3 A;  3A29 A;  4G68 C;  4XKN A;  3TZA A;  2ZZW A;  5I2K A;  2Q74 A;  1MQH A;  1SW2 A;  4MCO A;  3RY3 A;  3BFU A;  3A09 A;  2PYY A;  1B7H A;  4OHN A;  2UVJ A;  4N6D A;  1JP4 A;  1B3E A;  4ZZA A;  3E13 X;  3OMB A;  3O28 A;  3BBR A;  3S9M C;  3PPN A;  4NF5 A;  3OEL A;  1NH7 A;  5H8S A;  1D4N A;  4NF6 B;  1B3H A;  2PX1 A;  2NOO A;  5I2N B;  2OWZ A;  4GBV A;  1DMB A;  4NX1 A;  1Y3P A;  3C35 A;  4FE8 A;  2PVU A;  5J16 A;  3T66 A;  4R75 A;  5IM2 A;  4XXU A;  3KOT A;  2CZL A;  2OZZ A;  1FPI A;  2F7C A;  3CFL A;  1TFA A;  4OVP A;  4LUB A;  4IB2 A;  4OER A;  3T93 B;  4H5F A;  2XXP A;  2V4C A;  5EQ7 A;  4U1O A;  3C34 A;  1BTJ A;  2FYI A;  1Z7N E;  4AS5 A;  2WX9 A;  3QXM A;  2XD3 A;  2AL4 A;  2ZMB A;  3OSR A;  1RYX A;  3I5O A;  5H8F A;  4P56 A;  5DVJ A;  3RT6 B;  2HCA A;  3O97 A;  3TFL A;  2I3V A;  4GWW A;  1MH3 A;  4YB5 A;  2WYP A;  2PBW A;  1FBE A;  4QF9 A;  1JW1 A;  1IUD A;  3FJM A;  1FQA A;  2Y7K A;  1AOV A;  3BIG A;  1O63 A;  4F2Q A;  2DE4 A;  1DPE A;  2V3U A;  2O1L A;  3IOU A;  2QPQ A;  4G68 A;  1H3D A;  4N15 A;  4U1Z A;  2F3D A;  5CBR A;  1QKA A;  4THI A;  2ZNT A;  4H0W A;  3USD A;  4YKK A;  4N07 A;  1FBD A;  4PTK A;  4PE5 B;  1P1U A;  3H6W A;  5ESY A;  2HEU A;  1IME A;  1XI6 A;  4OES A;  2JJK A;  1N3X A;  4ZE9 A;  4GWU A;  4NTL A;  4YB6 A;  1YAE A;  4PAK A;  1H44 A;  2V93 A;  4MAG A;  3SEY A;  2O1M A;  1M5B A;  1Y9U A;  4FOR A;  1B3F A;  3PUV E;  3TUS A;  4GOT A;  1B40 A;  3CSB A;  3TTN A;  2GFE A;  1B46 A;  1ZJL A;  2REG A;  3T9U A;  1PDA A;  5TPA B;  4PAF A;  3TKD A;  4DDD A;  3OEK A;  3QAX A;  4PBQ A;  1II5 A;  4N4U A;  3TEL A;  1MXU A;  1IXC A;  3U93 A;  4MNI A;  1LB9 A;  3PUX E;  2QVU A;  4NF6 A;  2REJ A;  3THI A;  5L9M A;  5I2N A;  4XKQ A;  2Y7W A;  4IO7 A;  5FBP A;  3UOR A;  2L5V A;  4N6K A;  4BDN A;  3G3I A;  4Z0I A;  3T22 A;  4F3S A;  1IZ1 A;  4P11 A;  2PMS A;  4LZ8 A;  5CMK A;  3EHT A;  1MPB A;  4QBA A;  1Y4T A;  2Y5L A;  4FEB A;  4OVT A;  2XXW A;  1ZLQ A;  1M5D A;  5I7I A;  1VFD A;  1RKM A;  2OJT A;  3MVX A;  3H06 B;  1IMF A;  4GVO A;  3G7W A;  3R6U A;  1NNF A;  4OA4 A;  5DVI A;  4Q5T A;  5I5P A;  1N76 A;  4JXI A;  4DXC A;  1EYI A;  4P1L A;  3PPR A;  4MLQ A;  2VOZ A;  3MVY A;  3CG1 A;  3M3K A;  3MC2 A;  1OLA A;  3PGF A;  1QGX A;  3TQW A;  4ZDM A;  1IMB A;  3S9N C;  1IXG A;  1NUW A;  3D4C A;  1I6A A;  2OWS A;  4ZS9 A;  1A40 A;  1DTG A;  4LZ7 A;  1H76 A;  1A55 A;  5ET8 A;  1MS7 A;  1US5 A;  4JWX A;  1D9V A;  4FAT A;  5F24 A;  3K1N A;  1UTB B;  2OPE A;  2PT1 A;  2FIE A;  2DOJ A;  1A8E A;  4QFN A;  2XXQ A;  4X8R A;  1NV5 A;  2RCA A;  2FBP A;  1MQJ A;  4KXP A;  2XWV A;  3F11 A;  3E9X A;  3RLF E;  1I6Q A;  1MXW A;  2ONR A;  3PD9 A;  4IGT A;  3TTK A;  2QSX A;  3ECR A;  3CI8 A;  3HCQ A;  4GIZ A;  3CG3 A;  3PUW E;  2DE3 A;  1NNK A;  2GHA A;  3HV1 A;  3KJ7 A;  3HPI A;  4NGU A;  3FVO A;  3G3F A;  3FGS A;  3QUJ A;  4F19 A;  2UXA A;  5TPA A;  1ZMG A;  1IEJ A;  3K01 A;  4PFY A;  1FPE A;  2DYX A;  5KCJ B;  1Y3N A;  4U21 A;  1QUL A;  3KBR A;  3CR9 A;  3FXU A;  4O7I A;  3O6H A;  1NV4 A;  1RYO A;  4RNS A;  3VLU A;  1B5H A;  2VD3 A;  4R9G A;  3RPW A;  1TXF A;  1R1N A;  1MQI A;  1EYJ A;  1MY0 A;  2DE2 A;  5IZ3 B;  2E0S A;  1WVJ A;  1JW5 A;  2XX8 A;  1NV7 A;  1OMP A;  3ODB A;  1NI9 A;  3HFU A;  1LFI A;  3FJG A;  5I57 B;  3TMG A;  1AIV A;  3EF7 A;  5EYH A;  4G2Z A;  1GTK A;  1ZKB A;  3PPQ A;  2Z8F A;  4ND9 A;  5ITO A;  2UVH A;  1QUI A;  1URD A;  5H8N B;  3OXN A;  4HTG A;  3O6I A;  3IO6 A;  1GGG A;  2A5T B;  1SI0 A;  5TU0 A;  2OLB A;  4FIM A;  1N04 A;  3H03 A;  4LA9 A;  3CRB A;  4M1V A;  1VE4 A;  4TLM B;  3KC1 A;  1SQY A;  2DXR A;  2RIN A;  2B4L A;  2I0B A;  3L6G A;  3EQ1 A;  3S9E A;  4N13 A;  5HBC A;  1NUX A;  4OWD A;  4F22 A;  3MVZ A;  3MZ1 A;  5ELV A;  1UTB A;  5AA2 D;  3H4Z A;  5IAI A;  2DWJ A;  2LAO A;  4GXA A;  3FUZ A;  3TPA A;  2H98 A;  3TTR A;  4PF8 A;  1VSO A;  3N6U A;  5B7D A;  4G4P A;  3C31 A;  3P7I A;  1NFT A;  1SW5 A;  2ZNU A;  1LEV A;  3PTY A;  5DYH A;  1LBV A;  1OVB A;  1B3L A;  5F1Q A;  4P0I A;  1SDX A;  4QSC A;  1EH3 A;  2V3T A;  1LST A;  5I56 B;  3JYR A;  4C1U A;  5KCJ A;  2VT5 A;  4MIJ A;  4EUO A;  3FXR A;  3O29 A;  2H25 A;  4F2O A;  2WKY A;  5FHO A;  5FHM A;  2Q8M A;  4P0G A;  2DVZ A;  3D4G A;  4XIG Q;  4OVQ A;  2VP1 A;  4KFQ A;  4NWD A;  2XXR A;  1LCT A;  3FXQ A;  2F78 A;  5IZ3 A;  4I40 A;  4FBP A;  1OQH A;  4AS4 A;  2ONK E;  3VXB A;  5ET5 A;  4NQ8 A;  3TCF A;  5BWJ A;  4PBH A;  2RF1 A;  2OPD A;  5I57 A;  1B1X A;  1TT1 A;  2HXR A;  4WKM A;  3RTF B;  1B2H A;  4PAI A;  4OTE A;  4YMA A;  3SEX A;  3B6T A;  3BFT A;  3O9P A;  4EDP A;  2P2A A;  4DZ1 A;  1LAF E;  1MM7 A;  2F6G A;  4U23 A;  4PFR A;  1FPD A;  3MBP A;  5H8N A;  3MJN A;  4PGN A;  1NL5 A;  4IO6 A;  1XC1 A;  2DXY A;  2A5T A;  2D3I A;  4GRK A;  4O3B A;  4ZEB A;  4GBW A;  2Q2C A;  2Z8E A;  4P1E A;  4JWO A;  3QYT A;  4IY6 A;  3LSX A;  4EQ9 A;  4KHZ E;  3S2V A;  1HSE A;  3IJX B;  4ELP A;  3B6Q A;  1F9B A;  2Q88 A;  4WXJ A;  4PP0 A;  4FEC A;  3V83 A;  2DWH A;  2Y5K A;  3B50 A;  1FPB A;  2F36 A;  3SZP A;  1T0K A;  2XWK A;  1K9Z A;  1SVX B;  1FBF A;  5FTI A;  4OQO A;  1M5C A;  4PF6 A;  2XA5 A;  1FPG A;  3N5L A;  1URS A;  5LTC A;  2P1S A;  4O94 A;  1YZ0 A;  3K4U A;  4I8C A;  3EN3 A;  4DLD A;  2I6E A;  5ICT A;  3BKI B;  1KA1 A;  2Q2A A;  4KYS A;  3V5A A;  1S7Y A;  4DXU A;  4F1U A;  4Z7E A;  5AA2 B;  5I56 A;  4GX6 A;  1N7X A;  4YMB A;  2XXK A;  5DVF A;  4NE4 A;  4EF2 A;  4DI3 D;  1FTM A;  5L9S A;  2QJE A;  3K6V A;  5I58 A;  5AA3 A;  3FIR A;  3UP9 A;  1VR5 A;  4LQ5 A;  4NHB A;  1YTV A;  3KZG A;  4X1D A;  1PEB A;  1PB9 A;  3LSF B;  5H8H B;  1O64 A;  4N8Y A;  1UIV A;  2X7Q A;  4I3E A;  3MUQ A;  4WEP A;  1B1H A;  3FAS A;  1FPJ A;  1ZTY A;  3IO4 A;  3MP6 A;  4ECF A;  1MM6 A;  3LUZ A;  3ZKL A;  4R6K A;  4UA8 A;  1DBZ A;  1LBX A;  3GBA A;  5CMC A;  2OK2 A;  3H6V A;  2X7P A;  2QS2 A;  1UQW A;  1BLF A;  4GD5 A;  1FTL A;  3VE1 B;  4NED A;  1FBC A;  4GWX A;  4R6H A;  2FHY A;  3G3H A;  4N81 A;  4G8N A;  4ZE8 A;  3ILT B;  4MHF A;  4H6D A;  3K2D A;  1N3W A;  2I4C A;  5DTB A;  3OO9 A;  1B4H A;  3TTM A;  3ZSF A;  4ZEF A;  3DLN A;  3K6U A;  4NAP A;  4R74 A;  3FBP A;  1XVX A;  4XF5 A;  1P99 A;  3IB0 A;  3SDF A;  4QSD A;  4UAC A;  4X1B A;  2R71 A;  4KQP A;  2ZZX A;  4HCY A;  4EQ7 A;  4TOZ A;  4HS7 A;  4DXB A;  4MLV A;  4F29 A;  3ROJ A;  1FQD A;  5M2V A;  1QW0 A;  1VDW A;  2PT2 A;  5JEI A;  3IOV A;  1Q35 A;  3IOT A;  4FJP A;  3G3G A;  2QS3 A;  3WAF A;  1BIY A;  4R72 A;  4YU0 A;  3DP8 A;  1EU8 A;  2DWI A;  3UIF A;  3I6V A;  3IR1 A;  4GWZ A;  3FJ7 A;  1Y4C A;  2QS4 A;  2Y84 A;  3ONM A;  2QVV A;  1PB7 A;  2VGQ A;  3KN8 A;  4R9F A;  1FTJ A;  1XHY A;  1LBY A;  4H5G A;  3LR1 A;  1TWY A;  1MXY A;  2O51 A;  1YXI A;  4PC9 A;  1S9T A;  3IX1 A;  5AA2 A;  4LZ5 A;  1PB8 A;  4E0W A;  1QVS A;  1A7L A;  2H9B A;  3C36 A;  3QIM A;  2ESN A;  4BDR A;  2MKZ A;  5FTH A;  1ELJ A;  4JSO A;  1N84 A;  3VLV A;  4F31 B;  1NV3 A;  1LBZ A;  1JEU A;  1NV2 A;  2I49 A;  4H45 A;  1FW0 A;  1QJM A;  2D5W A;  4GXS B;  5H8H A;  2F7B A;  5I59 A;  1IMD A;  3KC0 A;  4YIC A;  2VPO A;  1FQC A;  2HPG A;  3B6W A;  3CFX A;  2Y7I A;  3VFJ A;  4F3P A;  1RDX A;  1P1O A;  2XXH A;  3DEL B;  1MY2 A;  4ZEC A;  2CZI A;  1RDY A;  3PD8 A;  4EQB A;  1A8F A;  3U72 A;  1AL3 A;  4HCW A;  4OAN A;  4G8H A;  4ZEK A;  3EHS A;  5K2Y A;  1K9Y A;  2GQ1 A;  3T96 B;  4OFL A;  1IQ7 A;  3SEU A;  5KDT A;  4MNC A;  3IOR A;  2XX7 A;  2QMW A;  3O66 A;  2B3B A;  4ISU A;  4O3A A;  3VXC A;  2ZYK A;  4G8M A;  3IL1 B;  3SES A;  4QFK A;  3VLW A;  3B8B A;  4F3B A;  2GRV A;  1NV0 A;  2CZH A;  2KLF A;  1ZU0 A;  1EZP A;  3I3V A;  1RDZ A;  4N17 A;  3Q25 A;  2HZL A;  3U92 A;  4XFE A;  3EKI A;  4JDF A;  5IZZ A;  2QS1 A;  1JW4 A;  4GWO A;  2YJP A;  3S9L C;  5I3S A;  4KR5 A;  5L9O A;  1N0T A;  2GH9 A;  3UA8 A;  5AA4 B;  1UTH B;  3HST A;  3TCG A;  3W9V A;  2NUV A;  5CRY A;  3T9H B;  4ELO A;  1Q9D A;  5EYG A;  2R9J A;  4I1D A;  5EQA A;  3TOD A;  5DT6 A;  1B3G A;  1XVY A;  3N6T A;  4X9T A;  2UYF A;  4AB6 A;  1LAX A;  3RTW B;  1B51 A;  1Y20 A;  1JVX A;  5IGA A;  3W9W A;  4JB7 A;  3OO6 A;  3KGC A;  4GFR A;  2PFY A;  1S50 A;  2HXW A;  5EHM A;  4PDH A;  1I6B A;  4MF3 A;  4RY1 A;  2G29 A;  2O68 A;  1QKB A;  3ILU B;  2WBD A;  3MZB A;  3OO7 A;  4YKI A;  4ZED A;  3GBB A;  2ZYM A;  4X48 A;  4LAT A;  2WEF A;  2UVG A;  4RXL A;  4H1X A;  2Q89 A;  4ONY A;  4MEV A;  1M5F A;  1R9Q A;  2HAV A;  4OEN A;  3HHG A;  3VVD A;  3ISP A;  2QRY A;  1I69 A;  2XX9 A;  3OEN A;  4IY5 A;  1DTZ A;  2B65 A;  1CNQ A;  1LFG A;  3OSQ A;  1SI1 A;  2I3W A;  5FHN A;  3M8U A;  1ZBM A;  5KZT A;  1PC3 A;  1KA0 A;  4GQO A;  3OO8 A;  2WBB A;  4IO4 A;  4OXV A;  4RK2 A;  2XWO A;  3KEI A;  3T1B A;  2Q9T A;  1LCF A;  3IAZ A;  4PFT A;  3FD3 A;  1MXX A;  1FSA A;  1FQE A;  1MRP A;  4U4S A;  5BUU A;  4MMP A;  3U94 A;  3IOW A;  5H8Q B;  2AYS A;  3RGY A;  1G0H A;  4MX6 A;  2Y7P A;  1IIT A;  3PMV A;  3CVG A;  3T9V A;  2OCU A;  1B58 A;  2D21 A;  4BDQ A;  3LSL A;  4IO5 A;  3PU5 A;  1XOC A;  1R9L A;  1B9J A;  1O7T A;  2UYE A;  5CBS A;  1EZ9 A;  3SET A;  1GR2 A;  2P3N A;  1BK4 A;  2UVI A;  5AA4 A;  1FQB A;  1UTH A;  1NV1 A;  4YB7 A;  2DDK A;  4ZZE A;  2GHB A;  4GL0 A;  4RYA A;  5I58 B;  4OFO A;  1AMF A;  3H6T A;  2O6A A;  1LB8 A;  3K6W A;  2YPN A;  2HAU A;  2XXV A;  3R7X A;  1A99 A;  1MPC A;  1AWB A;  1SPI A;  2THI A;  2PCR A;  3H3G A;  2IEE A;  4QRZ A;  4KI0 E;  4QHQ A;  5JTY B;  3K6X A;  1LAG E;  3MST A;  4XKP A;  5DEX B;  5IKB A;  2F3B A;  3E78 A;  4H65 A;  3FV2 A;  3TDJ A;  4O8M A;  4YAH X;  1LBC A;  1INP A;  3LC8 A;  4MFI A;  1FBP A;  2I48 A;  3PV0 E;  4ZEI A;  3VVF A;  1H45 A;  3RN8 A;  4NF8 B;  4PET A;  3H7M A;  3FV1 A;  4JVI A;  2R6G E;  1FBH A;  1CE2 A;  3HO7 A;  2AL5 A;  4LON B;  4BDO A;  1NUY A;  2ONS A;  3G3J A;  2FA7 A;  2IA4 A;  1MDQ A;  4PGP A;  2HZK A;  1JNF A;  4P8B A;  2QVR A;  3N26 A;  3N94 A;  1P1Q A;  4DCY A;  3RUM A;  3IB2 A;  1B52 A;  4I3Y A;  1Q1K A;  1FPK A;  1MY4 A;  3C32 A;  1YPN A;  2ZXT A;  3FXB A;  4DCX A;  1J1N A;  3TYH A;  3UGW A;  2ZYN A;  5DW8 A;  4MH5 A;  4K3F A;  5B70 A;  4RPO A;  4IGR A;  3KOS A;  1DSN A;  5CC2 A;  5H8Q A;  2ZZV A;  4TQU Q;  3RPL B;  4HXV A;  1CB6 A;  4BDM A;  2F8D A;  1N7W A;  1MPD A;  1UIU A;  3KG2 A;  1MG1 A;  3IK6 B;  2H4I A;  2ANJ A;  4OET A;  3K00 A;  1EZO A;  3MAM A;  1DCU A;  4NN3 A;  1H43 A;  3TEP A;  1SBP A;  3HN0 A;  3BIH A;  2O69 A;  1XT8 A;  1WDN A;  4PFW A;  4XKR A;  1POY 1;  2M8C A;  3QSL A;  3FZV A;  4JVC A;  2I4B A;  3PPP A;  1BP5 A;  2OX3 A;  4JSD A;  3DM0 A;  3KFM A;  1B0H A;  1B5J A;  5A5X A;  4NF4 B;  3CHG A;  1KZ8 A;  3G3K A;  3JZJ A;  1DPP A;  3K1M A;  4IR8 A;  3VVE A;  3H6U A;  2B4M A;  4LP2 B;  5I59 B;  4FAJ A;  1LBW A;  3KJT A;  5JTY A;  3FVK A;  5DEX A;  4R2F A;  1FPL A;  4N8G A;  2H5Y A;  3KN3 A;  1OQG A;  1MXV A;  4GL8 A;  4OYV A;  1ZIU A;  4YKJ A;  3B7D A;  1M5E A;  2XHD A;  4MNP A;  4KYE A;  5HM4 B;  1L5T A;  1FJ9 A;  3PPO A;  4NF8 A;  5I84 A;  3Q26 A;  4BDL A;  5KDT B;  4Q8R A;  3VDF A;  3MYU A;  4NWC A;  3KBZ A;  3C33 A;  5TP9 B;  3DP4 A;  2I0C A;  2O7U A;  1FTA A;  1D3K A;  3M3L A;  5T3J A;  1Y1Z A;  2Z23 A;  3CFZ A;  4Q30 B;  1JQF A;  2RCB A;  4C1T A;  1B7Z A;  2CMO A;  2NWJ A;  3K0V A;  5CI5 A;  4I9D A;  4IO2 A;  2P3V A;  4EXK A;  1HSL A;  3K02 A;  2PFZ A;  1ANF A;  3PMX A;  3Q28 A;  3KSJ A;  2DS9 A;  1B6H A;  3M3F A;  4KD5 A;  1JET A;  2BJI A;  4ESX A;  4N91 A;  1MQD A;  4YKP A;  5ET7 A;  3WAE A;  3QUF A;  3ZS6 A;  3EHU A;  1MY1 A;  2X26 A;  2BJJ X;  4F3G A;  4HE1 A;  2WYK A;  2VD2 A;  4F1Y A;  2VPN A;  1B5I A;  5CM6 A;  4OZ9 A;  3T9X B;  4POX A;  1OIB A;  4R6Y A;  3RPL A;  3RYD A;  3PMW A;  1AH5 A;  1R6Z A;  4LQ2 A;  1D9Y A;  3ZKK A;  3MW0 A;  3GYY A;  5HPQ A;  4OEU A;  4NG7 A;  5AA1 A;  1YCJ A;  3E79 A;  4MJO A;  3QMF A;  2CEY A;  4R2B A;  1P1N A;  3TCH A;  4AB5 A;  2XXU A;  4GLI A;  3MP8 A;  2QMX A;  3LSW A;  3MQ9 A;  2DQV A;  1HSJ A;  2YLN A;  1VFE A;  4H46 A;  4LVQ A;  3S4U A;  4NMY A;  2RKM A;  4KCC A;  2HFB A;  2FIX A;  2F5X A;  1IXI A;  1PBP A;  3SEV A;  3O6G A;  2QL3 A;  2V25 A;  4U22 A;  4QXD A;  2Z22 A;  2V3Q A;  1SW1 A;  1SW4 A;  3PUZ E;  3V89 B;  4YZZ A;  4HW8 A;  1POT A;  3MP1 A;  4M4G A;  2ABH A;  2XXI A;  4NF4 A;  1B4Z A;  2CEX A;  5J1D A;  1SD3 A;  3E4R A; 
#chains in the Genus database with same CATH homology
 4FBP A;  5A5L A;  4MEV A;  4AS4 A;  3ISP A;  4X04 A;  5ET5 A;  4NQ8 A;  4PBH A;  3BIG A;  1CNQ A;  2HXR A;  4PAI A;  5JK4 A;  2DE4 A;  1KA0 A;  2WBB A;  4NF0 A;  4GX3 A;  4PFR A;  2KQZ A;  2XWO A;  1FPD A;  2QPQ A;  3T1B A;  2Q9T A;  4PGN A;  4N15 A;  4F18 A;  2F3D A;  1FSA A;  5LDZ A;  4GBW A;  5EQ8 A;  4P1E A;  1FBD A;  4PTK A;  1FRP A;  5ESY A;  1IME A;  1XI6 A;  4MMP A;  1D9Q A;  4XEQ A;  1G0H A;  2JJK A;  4MX6 A;  4GWU A;  2Y5K A;  3B50 A;  4PAK A;  1FPB A;  4MAG A;  3SZP A;  2XWK A;  1K9Z A;  1FBF A;  4O7M A;  4PAF A;  4PF6 A;  2XA5 A;  1FPG A;  1IMA A;  4PBQ A;  5LTC A;  2FVZ A;  4O94 A;  1YZ0 A;  2P3N A;  4N4U A;  1BK4 A;  4MNI A;  2QVU A;  1NV1 A;  1EYK A;  2DDK A;  1KA1 A;  5FBP A;  2R8T A;  2L5V A;  4F1U A;  4N6K A;  4P47 A;  4GX6 A;  1AWB A;  1SPI A;  2XXK A;  3IFA A;  2PCR A;  4DI3 D;  4P3L A;  3MST A;  2F3B A;  3E78 A;  2QFL A;  4QBA A;  4NHB A;  2Y5L A;  4OVT A;  4PCD A;  5I7I A;  4O8M A;  3NOH A;  1INP A;  2CZK A;  4G61 A;  1IMF A;  4N8Y A;  1FBP A;  4I3E A;  4OA4 A;  4PET A;  4PFB A;  2KR0 A;  5I5P A;  1EYI A;  4JVI A;  4P1L A;  1FPJ A;  1DK4 A;  1FBH A;  1G0I A;  4UAB A;  3LUZ A;  4DI4 B;  1NUY A;  4OVS A;  1DBZ A;  1LBX A;  4PGP A;  2HZK A;  1QGX A;  3T0J A;  2QVR A;  4P8B A;  2XWI A;  1IMB A;  4GWY A;  4PFI A;  1NUW A;  1FBC A;  4GWX A;  4I3Y A;  1FBG A;  3D1R A;  2FHY A;  4N81 A;  1FPK A;  4MHF A;  5ET8 A;  5F24 A;  3FXB A;  2FIE A;  4X8R A;  4P9K A;  4NAP A;  5IZ1 A;  3FBP A;  5DW8 A;  1NV5 A;  4XF5 A;  2FBP A;  4KXP A;  2XWV A;  4LN5 A;  5EQ9 A;  2ZZV A;  3RPL B;  4HXV A;  4F1V A;  2ZZX A;  4HCY A;  3ROJ A;  4HE0 A;  2DE3 A;  4NGU A;  1VDW A;  1DCU A;  4F19 A;  4GWS A;  4JVD A;  4NN3 A;  1FJ6 A;  3BIH A;  1FPE A;  4GWZ A;  5ET6 A;  2QVV A;  4O7I A;  4JVC A;  1LBY A;  1NV4 A;  1YXI A;  2OX3 A;  4PC9 A;  1IMC A;  2HHM A;  1KZ8 A;  3CHG A;  4IR8 A;  1EYJ A;  2DE2 A;  5IZ3 B;  2MKZ A;  2B4M A;  1LBW A;  1NV7 A;  4HE2 A;  1NV6 A;  1NI9 A;  1NV3 A;  1FPL A;  1LBZ A;  3HFU A;  4N8G A;  1NV2 A;  4H45 A;  1FPF A;  5EYH A;  4PE3 A;  4MNP A;  1IMD A;  3KC0 A;  1NUZ A;  4YIC A;  2VPO A;  2HPG A;  1FJ9 A;  1RDX A;  3IFC A;  2CZI A;  1RDY A;  3MYU A;  3KBZ A;  4HCW A;  4OAN A;  4PDD A;  4M1V A;  1K9Y A;  2GQ1 A;  1FTA A;  4GX4 A;  5T3J A;  3KC1 A;  3LV0 A;  4MNC A;  4OVR A;  3U65 A;  1YYZ A;  2P3V A;  2B4L A;  3A29 A;  2PFZ A;  1NUX A;  2ZZW A;  2Q74 A;  4MCO A;  2BJI A;  4N91 A;  3B8B A;  1NV0 A;  5ET7 A;  2CZH A;  1RDZ A;  4N17 A;  4N6D A;  1JP4 A;  2HZL A;  4HE1 A;  2WYK A;  4XFE A;  4PF8 A;  3EKI A;  2VPN A;  5IZZ A;  5CM6 A;  5I3S A;  3RPL A;  3RYD A;  1LEV A;  3PTY A;  3W9V A;  3GYY A;  1LBV A;  4NG7 A;  2OWZ A;  4GBV A;  1Q9D A;  4NX1 A;  3E79 A;  4MJO A;  5EYG A;  3QMF A;  5EQA A;  5J16 A;  2CEY A;  5IM2 A;  4X9T A;  1FPI A;  4OVP A;  4H46 A;  2VT5 A;  4MIJ A;  5IGA A;  3W9W A;  2FIX A;  2F5X A;  2PFY A;  2V4C A;  5EQ7 A;  4PDH A;  4QXD A;  4AS5 A;  2WX9 A;  2V3Q A;  4YZZ A;  2WBD A;  2Q8M A;  4P56 A;  2DVZ A;  4OVQ A;  4GWW A;  2WEF A;  2WYP A;  2CEX A;  5J1D A;  5IZ3 A;  4I40 A;  1FBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...