5EYGA

Crystal structure of impase/nadp phosphatase complexed with nadp and ca2+
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
265
structure length
256
Chain Sequence
MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 79
structure length 256
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eygA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eygA02
2FHYA 5T3JA 1FPKA 4N81A 5ET6A 5A5LA 1IMCA 5ESYA 1FPLA 1NV7A 4I3EA 2WEFA 4GX3A 2FIXA 3A29A 2F3DA 2HHMA 1FJ9A 3BIHA 2P3NA 2Q8MA 3IFCA 4GBVA 2BJIA 2CZHA 4GWUA 1NUZA 3QMFA 4GWWA 1IMEA 1FPDA 2JJKA 4H46A 5IZ3B 1NV6A 3RPLB 3KC1A 1FBFA 1LBXA 5FBPA 4GWZA 5EQAA 5IZ3A 1Q9DA 2CZIA 1IMAA 1FPIA 2QFLA 3BIGA 1FBEA 2VT5A 5EYHA 1RDXA 2OX3A 2Q74A 1LBZA 2WBDA 4AS4A 1YXIA 2P3VA 1RDZA 1NV4A 1G0HA 1FPJA 1FSAA 3FBPA 3LUZA 1NV2A 1AWBA 1FBCA 1EYKA 4IR8A 4I3YA 5ET7A 5IZ1A 1JP4A 4HE2A 4GWXA 1KA1A 4FBPA 3RYDA 1LBWA 1LBYA 2QVVA 4O7IA 3RPLA 5EYGA 4I40A 1K9YA 4GWYA 1FTAA 3D1RA 2DDKA 1IMDA 1FJ6A 1FBDA 1KZ8A 1FPBA 1NUXA 2OWZA 1IMFA 1D9QA 1FBPA 1RDYA 4HXVA 1XI6A 1K9ZA 1DBZA 2QVRA 5EQ7A 3IFAA 1BK4A 1IMBA 4KXPA 1FRPA 4HE1A 1FBHA 1FBGA 2FBPA 1YZ0A 1NV3A 3KBZA 4HE0A 4G61A 1LBVA 3B8BA 4GBWA 1YYZA 2PCRA 2Y5LA 5EQ9A 2R8TA 3KC0A 5LDZA 4MJOA 2FIEA 1G0IA 1NV5A 5J16A 1CNQA 1NI9A 1NUWA 1NUYA 1QGXA 5ET8A 1NV1A 5EQ8A 4GWSA 1LEVA 1FPFA 5I3SA 1SPIA 2Y5KA 1DCUA 1INPA 2GQ1A 2WBBA 5F24A 5DW8A 2CZKA 3ROJA 4H45A 1VDWA 4GX6A 4PTKA 2FVZA 1FPEA 2QVUA 4QXDA 1KA0A 1DK4A 1EYIA 4AS5A 3LV0A 2F3BA 5ET5A 3T0JA 1EYJA 1NV0A 1FPGA 4GX4A
chains in the Genus database with same CATH superfamily
1MXYA 1TWYA 3A29A 4JSDA 2QPQA 2VPNA 2GRVA 4WXJA 4FJPA 3DP6A 2JJKA 3T96B 4O3AA 5A5XB 3N94A 2OCUA 2REJA 4NF8A 2V93A 4R2BA 1IIWA 5IZ3A 3T9XB 3TFLA 1FQAA 2QFLA 4ESWA 3C4MA 2X26A 4NF4B 4NF6B 5ITOA 2DQVA 4PDDA 2P3VA 1P1NA 4KQPA 5I57A 4IGRA 3H6WA 1SVXB 1Y3QA 4ZE8A 1G0HA 3EF7A 4F1VA 4XFEA 3E78A 4OYVA 4MIJA 2F35A 2V3QA 5CC2A 2OPDA 3EN3A 4N6DA 4BDQA 5H8NB 4IO7A 3QUFA 1D9VA 3MVWA 3ONMA 4PP0A 3D4GA 4F22A 2DWHA 4LQ2A 2UYEA 3V8XB 4YMBA 4G77A 3MP8A 1LFHA 3MVXA 3QSLA 2Y5LA 5KCJA 1FTLA 5AA2A 2YLNA 4GL8A 1B05A 1B1HA 1B7UA 1J1NA 1NI9A 1BLFA 3G3HA 3IORA 2XD3A 2Y5KA 3ZKLA 1PB9A 2VGQA 3G3FA 4EF1A 5BWJA 1N7WA 3PPPA 4KR5A 3RY3A 4RNSA 1UTBA 1FPLA 3LR1A 4K3FA 3O29A 4PFTA 4XIGQ 4U1OA 1URSA 3BBRA 2D3IA 3IO4A 3W15C 1JQFA 2XXUA 2QMWA 2IA4A 2O6AA 4XF5A 5B70A 2AIXA 4PF6A 3SEUA 5EQAA 2I3WA 1SI1A 2VT5A 4NE4A 3G3GA 2QS1A 1NNPA 1QJMA 3U8QA 1DPEA 4NGUA 2KQZA 4IO6A 4NX1A 1XOCA 1MDP1 1EYKA 3IL1B 1MPBA 3MP1A 2ONSA 4KD5A 1S9TA 3H06B 1LBWA 5EYGA 4GVOA 4PFIA 4G68B 1OMPA 3S4UA 5DYHA 3MZ1A 3T66A 4ZECA 4LZ7A 1QVSA 3B50A 3Q29A 3QIMA 1DBZA 1US5A 2ZYNA 2Z8EA 3CSBA 4KCCA 2M8CA 2I58A 4RY1A 1O7TA 3FXQA 3MZ9A 4G4PA 5EQ9A 1A8EA 3FJ7A 2R8TA 3VXCA 5IAIA 3S9MC 1G0IA 3PUZE 5CBSA 3TMGA 2Z8FA 5EQ8A 5I59A 5JTYB 1GR2A 4NF8B 3LBSA 1INPA 1QULA 4TLMB 1B3LA 4QXDA 1DK4A 1ATGA 2RC9A 3LSWA 1FTOA 2DVZA 1LFGA 2F3BA 3H6VA 3K1MA 4O3CA 3OENA 5ET6A 3PPNA 2FIXA 3CG3A 3G7WA 4P1LA 4WEPA 5I2NB 1IMEA 2R71A 4I8CA 4H65A 4NAPA 1LBXA 5CMCA 1A8FA 1Y4TA 4OXVA 1VSOA 1FPIA 1JETA 2OX3A 2UXAA 3PMWA 4UA8A 4ZDMA 2THIA 3RT8A 5H8FA 1SD3A 3MWBA 1SW5A 3K6XA 5LOMA 3E4RA 1JVXA 4Q0CA 5ELVA 4M1VA 3LSLA 2I3VA 3FXRA 2ZYKA 4FBPA 5KCJB 3RPLA 2XXPA 5AA2B 1MPDA 1K9YA 4ISUA 3D1RA 4UACA 3W9VA 1FPBA 1NH7A 2I6EA 4E0XA 4U1ZA 1FQCA 4DDDA 1TFDA 3TTKA 3KJTA 3FVGA 4N17A 3FZVA 1B3GA 5AA2D 1MPCA 4KXPA 5EYFA 3EHUA 2H25A 1MXWA 4X1DA 1UTBB 3QYTA 2PCRA 4GRKA 3PPOA 3VLWA 5L9OA 4MNPA 1PB7A 1POY1 4QSCA 1WVJA 1ZMGA 4EXLA 3T0JA 1D9YA 4RYAA 1NV0A 1SW1A 5ESYA 3THIA 4LN5A 1Y3NA 2YJPA 3K6VA 4F2QA 3L6HA 1OIBA 2XXXA 1M5DA 1N3XA 1MM6A 4GWUA 2F7AA 2V25A 1FTMA 4H46A 1OQHA 3S9NC 5J1DA 1FBFA 4LA9A 3PPRA 3LSFB 1EZ9A 5DTBA 1BIYA 1SW2A 2XWOA 3FIRA 3RGYA 1YCJA 3TPAA 4I1DA 1S7YA 1VFDA 2VHAA 4IY6A 1OQGA 2ABHA 1Z7ME 4LP2B 4N6PA 1HSJA 4RJZA 4XKQA 1A40A 2DXYA 4DXUA 4GQOA 3K1PA 2AL4A 2RCAA 2PT2A 4DE8A 3G3JA 4YKIA 2HFBA 3IOUA 3L6GA 4HCWA 5CM6A 4QRZA 3EHTA 2H98A 3CRBA 4TQUQ 3IFAA 2H9BA 4HE1A 1A99A 4OMBA 4TLLB 1QUKA 4LZ5A 3FASA 3RTWB 5JK4A 1NNFA 2DP8A 4ZE9A 4HCYA 5AA4A 3CSGA 1DCUA 4GIZA 5I58A 1DMBA 4QSEA 4NWCA 4U21A 4XKRA 3LUYA 5H8FB 4N81A 4F1UA 4OETA 3O9PA 3H6UA 4P3LA 3UK4A 4H67A 4OENA 2AYSA 3QXMA 2DVCA 4YU0A 5K2YA 3RPLB 4FECA 3FXBA 3I5OA 3ZSFA 3BFTA 5EYHA 4R2FA 4H1XA 2QS3A 2ZNTA 1MXUA 2Q2AA 1VE4A 2HXWA 5DEXA 1FBCA 3TDJA 4G8HA 4XEQA 3K0VA 4BDLA 5KDTB 3H7MA 1I69A 1FBPA 1XVXA 1XI6A 4AB6A 2CMOA 3TEPA 4KYSA 1FBGA 3FGSA 3DP8A 3VXBA 4GBWA 5KZTA 3T9HB 2P1SA 1USYH 5IZZA 3ILUB 4LVQA 4EQ7A 2DE3A 4WKMA 1NV1A 4RK9A 5I3SA 4MF3A 2GQ1A 1R1NA 1B1XA 4TOZA 5FTIA 3Q25A 4H45A 3CFZA 2HEUA 4ZEBA 3ILTB 4YB5A 3MPLA 2XA5A 2UVJA 2I0CA 2H4IA 2RKMA 4EF2A 1NV7A 1LB9A 2F3DA 2P3NA 5DVJA 4IGTA 1H3DA 1OLCA 1SBPA 3S9LC 4IO5A 3U65A 1B5HA 1DOTA 1NV6A 1LBCA 2MKZA 4LZ8A 4NF5A 1N76A 2AL5A 1MY2A 2QS4A 4O8MA 4P56A 1NMUA 4R6YA 3FXUA 4NHBA 4XXUA 1P1UA 3OELA 4PGPA 1UQWA 3LSXA 4GWXA 2R6GE 3RYDA 2F8DA 1LBYA 3PPQA 3IK6B 4I40A 4GWYA 2DDKA 2B4MA 4O94A 4YKJA 2NXOA 2H5YA 1FW0A 1YAEA 4G8NA 3U1OA 5FHMA 4R74A 5I58B 4YAHX 2O1MA 2KLFA 4PF8A 1XVYA 3VLUA 3O2AA 2OPEA 3FVNA 2I0BA 2Q9TA 3EKIA 4HE0A 3SDFA 2DOJA 4G2ZA 1FQFA 1Q35A 4P1EA 2GFEA 3C33A 1R6ZA 1NV5A 1H43A 5ITPA 2OBGA 5ET8A 3ECRA 1MQHA 2Y7RA 4I9DA 5I2KB 1LEVA 3HV1A 3JYRA 4PFRA 4GX6A 4N8YA 3KSJA 1FQDA 3TELA 1MY3A 1IUDA 3OO9A 1BTJA 3U93A 4JBZA 1Y1ZA 3A3CA 5DEXB 2RC7A 3OSQA 2QRYA 4RPNA 5TP9A 1D3KA 4AB5A 3KG2A 2GH9A 1B6HA 3B7DA 1MQIA 3JV9A 3T9VA 3N5LA 3QK6A 3SEXA 1LAXA 2V3UA 3MVZA 2F36A 4ZEKA 1LBZA 2A5TA 4GLIA 2VP1A 2O84X 3M3KA 3KSXA 1NV2A 4BDNA 4FATA 3D4CA 5CI5A 1JEVA 4P47A 3TCFA 2D5WA 1N04A 1NFTA 2OLBA 3OMBA 4P8BA 2OWTA 3FJMA 3TODA 3R6UA 4QSDA 4MNIA 1LAGE 3K6UA 1IMBA 2DS9A 5ISUA 1GVCA 3AXFA 1DSNA 3DLNA 1UTHA 2F97A 1LBVA 3V83A 2PT1A 3H3GA 4H5FA 5LDZA 4JB7A 4MJOA 4PFWA 3MZBA 4OERA 4WEDA 4XKNA 3EQ1A 5F24A 2RCBA 4GL0A 2QVUA 3GLBA 2ZZWA 4AS5A 3Q28A 1ZBMA 5TU0A 5ICQA 3PMXA 3W9WA 4PQJA 4C1UA 4N91A 4BDRA 2Y7PA 4MHFA 4MH5A 4GX3A 3G3KA 3VVEA 3UN6A 1MXVA 2V4CA 2HZLA 5L9MA 3TTNA 1Y20A 5IZ3B 1MY1A 4JSOA 3E3KA 4G8MA 4N07A 1BKAA 4ONYA 5I57B 3TTLA 4P9KA 5AA3A 3FD3A 5I56A 2QS2A 1MY4A 4JWOA 4IR8A 2KR0A 3CG1A 1SQYA 1LCFA 4N4UA 2Z22A 1B7ZA 3VLVA 1LAHE 2O51A 1LFIA 1A7LA 1XHYA 1SW4A 3KN7A 3Q27A 4YMAA 3PUYE 2XWIA 1NV3A 4HS7A 3VE1B 4X04A 1IITA 1B4ZA 1RKMA 3KOSA 3UORA 4PDHA 2RINA 4OVSA 3PU5A 4PFYA 3C31A 4R75A 5TP9B 4DCXA 2UVHA 3EHSA 3MSTA 1S50A 1FPEA 3FJGA 4PETA 4OFJA 2DWAA 1P1WA 1I6BA 1FPGA 4YKPA 1B3HA 2HXRA 3KGCA 4KYDA 3MUQA 4DCYA 4U4XA 2X7QA 3PGFA 1B7HA 1FQEA 2DE4A 1R9QA 2IEEA 3IJOB 3KC1A 4MX6A 4X8RA 5L8DA 2B3FA 2YPNA 3C32A 1RYOA 2F6PA 1ZTYA 4EDPA 1PEBA 4DLDA 2Q74A 1MDQA 1MQJA 2V84A 3TCHA 1JEUA 1JW1A 4DIGA 1D4NA 5EHMA 2HCAA 5ET7A 2LAOA 1KA1A 4ZS9A 2Q88A 4N6KA 3MVYA 3IO6A 1FTAA 1QUIA 2REGA 2R9JA 1ZLQA 1IMDA 2G93A 4FEDA 4P0GA 2GHBA 3SETA 4H8IA 1CB6A 4POXA 3SEWA 1PBQA 1USYE 3DM0A 1URGA 1SDXA 3G3IA 3IR1A 3FV2A 4I62A 1AMFA 1Y4CA 5AA1A 4ELRA 1MQDA 1M5BA 4DZ1A 4F3SA 2Q2CA 5I59B 5J16A 1CNQA 3HHGA 3C35A 3OXNA 3CFXA 1FPFA 5CBRA 1MH3A 3IOWA 2PFYA 2DYXA 1EYIA 1O64A 1MM7A 1F9BA 5JEIA 2O68A 4QFKA 1QUJA 1XS5A 1IMCA 3RUMA 2Y84A 2WEFA 1MS7A 1RYXA 3GBBA 3BIHA 1FJ9A 3B6QA 5CMKA 1XC1A 1B58A 5AE4A 4KHZE 5HPQA 3TQLA 4OANA 1FPDA 3K00A 4BDOA 1LBBA 4IO2A 4JVDA 1B5IA 2HAUA 5A5XA 3PMVA 3RLFE 4M4GA 1DPPA 1M5CA 3E79A 1AL3A 1M5EA 2WBDA 3SEYA 1ZIUA 2ZZXA 2NVUB 3HCQA 1YXIA 4THIA 1RDZA 4NF4A 4PAKA 3KEIA 4QFNA 4R6KA 1N7XA 3HN0A 2VD2A 3B6TA 3H4ZA 4Q8RA 3UA8A 2DSFA 2XXWA 1ELJA 4NMYA 3O6GA 3FV1A 5K2XA 2ZYOA 1NUXA 3CR9A 3OO7A 3GZGA 1D9QA 3CHGA 5H8NA 4EQ9A 2QVRA 3OEMA 1YZ0A 4R6HA 3KN8A 3IOTA 3T9UA 1H44A 2OZZA 4NF0A 2FIEA 3T1BA 2Z8DA 1MXXA 2PFZA 3LC8A 4GFRA 5DT6A 2Y7WA 3K4UA 4F18A 3O28A 3SESA 1H45A 3K2DA 3ZKKA 3SEVA 3TKDA 1KA0A 2W7YA 3PV0E 1TXFA 3H03A 2CEYA 3RQTA 4OHNA 4LONB 2NOOA 5H8HA 4X1BA 5A5LA 2L5VA 4FAJA 4R72A 4I3EA 1OVBA 4F31B 3C9HA 1P1QA 1LSTA 2Q8MA 4OWDA 4POWA 5F7VA 3QMFA 2XXVA 4ECFA 1XT8A 2ZNUA 4PAFA 5FBPA 1IQ7A 1VR5A 4GWZA 1II5A 3A09A 3IB0A 3TZAA 1FBEA 4JXIA 1M5FA 4MEVA 2DWIA 1ANFA 1B3EA 3C36A 4QFOA 1OVTA 1ZU0A 1B5JA 4DXBA 1FSAA 3MPKA 1AWBA 3MC2A 1PBPA 2O69A 3MYUA 4PFUA 1LCTA 2Z23A 4P11A 5CRYA 4ESXA 2DWJA 4OQOA 1B4HA 4RPOA 4HTGA 2I4CA 1Z7NE 3VV5A 2ZXTA 2OWZA 3OSRA 1NNTA 4RK2A 3HHFA 2E0SA 1FRPA 1FTJA 4PC9A 2XXRA 1GTKA 4H6DA 4C0RA 4OZ9A 1NKXA 3B8BA 4KYEA 3U72A 1YYZA 3E9XA 5AA4B 3OO8A 1QW0A 2XHDA 4H5GA 1FCKA 4EQBA 5B7DA 3F11A 3M8UA 1NUWA 3S2VA 3KJ7A 4OVTA 5DVFA 1VDWA 2HZKA 3I3VA 5JTYA 3E13X 4Q30B 1HSLA 3MAMA 4FIMA 5ET5A 4ZZAA 1MRPA 2O7IA 3SERA 3IB1A 4UABA 3BFUA 4X48A 2HQ0A 2BJIA 2CZHA 4DI4B 1H76A 4GWWA 4Z7EA 1PC3A 2ANJA 1WDNA 1MXZA 5I2NA 4RA1A 1LB8A 1B2HA 1MY0A 2QSXA 5ICTA 2VD3A 3TQWA 3ODBA 1RDXA 2P0SA 1TFAA 2XXTA 2ONKE 4NTLA 3MJNA 3IX1A 2P2AA 3OD7A 4YB6A 2WKYA 3HFUA 4GOTA 3RTFB 1JNFA 3GBAA 1B32A 4FORA 2VOZA 2OK2A 3U94A 1B9JA 4XTCQ 4G68C 4F3PA 3FUZA 1N3WA 1B3FA 5BUUA 3DELB 1MH4A 2PBWA 3K6WA 3C34A 1B46A 4O3BA 1BK4A 4IY5A 1P99A 2FBPA 5H8HB 1B0HA 2UYFA 4KFQA 2OWSA 5IKBA 2CEXA 3CIJA 3DP4A 3KC0A 2B65A 4GXAA 5H8SA 1QGXA 1US4A 1N84A 4R73A 4L17A 1JW5A 2WBBA 4PBQA 2F6GA 2XXYA 2QL3A 1GV8A 3RNNA 3CVGA 3LV0A 5LTCA 3CI8A 2XD2A 1EZOA 4NEDA 2F7CA 4GX4A 2ESNA 5T3JA 1T0KA 1O63A 4LQ5A 2HHMA 3IFCA 4GBVA 3MBPA 2PVUA 3BKIB 4ZZEA 4NF5B 3ZS6A 2XX9A 3Q26A 1EH3A 4QHQA 3TAJA 1POTA 3HPIA 4R9FA 4F19A 1AOVA 2CZLA 4MLQA 4NWDA 5H8QA 4FE8A 3ISPA 4F29A 1LAFE 2X7PA 2XXIA 4LUBA 4OESA 3K01A 3OO6A 1I6QA 1I6AA 4I3YA 2NUVA 3VDFA 2FNCA 5IM2A 4U4SA 2GHAA 1MQGA 3N6UA 3T22A 1KZ8A 1VFEA 2ZNSA 2BJJX 3R7XA 1RDYA 1K9ZA 3PUXE 3O97A 4ELPA 2HAVA 2UVGA 4X9TA 5CMBA 4P0IA 4AQ4A 4OEUA 4ZEFA 3KBZA 3UP9A 1GGGA 3WAEA 5I7IA 4NG7A 1EU8A 3MP6A 2FA7A 2F5XA 1EZPA 1SPIA 3VFJA 2WYPA 4IO3A 2CZKA 3CFLA 4GXSB 1B40A 4GF8A 2XX8A 4LATA 1SI0A 4ZEIA 1EYJA 3KBRA 5FHOA 3MQ9A 3VVDA 4JWXA 3RT6B 2FHYA 2B4LA 3M3LA 3QAXA 4GWOA 4EUOA 3KFMA 5I5PA 4DI3D 4KI0E 4PFBA 1N0TA 2HPGA 4OEVA 1IZ1A 4PCDA 4OFLA 1L5TA 1B51A 4MMPA 4U23A 4YB7A 3BIGA 2A5TB 3NOHA 2F7BA 3P7IA 4AS4A 2Q89A 3KN3A 3SKPA 1AIVA 4KCDA 4OVJA 1NV4A 3FVKA 5TPAA 4F3BA 4Z0IA 1LLSA 4ND9A 2QMXA 4F39A 2ONRA 2PYYA 1NH8A 4NN3A 1JP4A 1IXGA 1DTZA 4YKKA 3V5AA 1BP5A 1UIUA 2PMSA 1JVYA 5HBCA 2D21A 2I4BA 4H0WA 5KDTA 1JW4A 4GD5A 1P1OA 1HSEA 4JWYA 2DE2A 4QBAA 1QKBA 2WX9A 1FBHA 3QUJA 4O7MA 1UTHB 3KZGA 2VPOA 3A3UA 5I84A 2QJEA 1KWHA 2O1LA 4H8JA 3FVOA 1B52A 2B3BA 3OOAA 4IO4A 2XWVA 4XKPA 2XXKA 5DW8A 4OFOA 3UIFA 4E0WA 3U92A 3VVFA 2ALUA 3TTMA 3PTYA 1FQBA 5H8QB 4MNCA 3EPEA 1YTVA 2XXHA 4F1YA 2ZZVA 3TTRA 4U2RA 4ELQA 1FTKA 4BDMA 2H99A 4N8GA 3SZPA 3HO7A 2Y7IA 1IEJA 3WAFA 3PD8A 2XX7A 1Q9DA 3PUVE 4PAIA 2CZIA 2Y7KA 1QKAA 2I48A 1Y3PA 4OVPA 4U22A 3GXAA 1YPNA 4JVCA 5I56B 5F1QA 4F2OA 4YICA 3KOTA 1FPJA 1A54A 2O7UA 3FBPA 1URDA 2F78A 3LUZA 3K02A 1SYHA 4ELOA 5HM4B 1IXIA 2ZYMA 4O7IA 2E1SA 1FJ6A 3T93B 4N15A 4PE3A 3RN8A 1IMFA 1IXCA 1DTGA 2F34A 2WYKA 5FTHA 2FYIA 4NF6A 4JVIA 4N13A 5M2VA 3RPWA 4PGNA 1R9LA 4OTEA 2PX1A 4R9GA 4G61A 2XXQA 3USDA 4OA4A 1AH5A 1LGBC 5IGAA 1ZKBA 1Q1KA 4MBPA 1NUYA 2ZMBA 4OVRA 3B6WA 5CMMA 4GWSA 1UIVA 4PE5B 3HSTA 4PTKA 5I2KA 4KPTA 2DXRA 3N26A 1TT1A 3PD9A 3K1NA 4HW8A 1FPKA 5TPAB 3PUWE 4IB2A 1ZJLA 3N6TA 4EXKA 4ZEDA 3IB2A 3IJXB 1PB8A 1NL5A 3IAZA 3UGWA 1B0LA 1NUZA 1SYIA 2I49A 2V3TA 2RC8A 3S9EA 4DXCA 3I6VA 4C1TA 1IMAA 4MCOA 4F3GA 3TYHA 3M3FA 1IXHA 4MAGA 1OLAA 4QF9A 4Q5TA 1Y1MA 1WODA 2G29A 5EHSA 5DVIA 3JZJA 4MLVA 2RF1A 3O6HA 1A55A 2Q8JA 5IZ1A 4HE2A 2A5SA 3R26A 2UVIA 3TCGA 2QVVA 4RXLA 4MFIA 4QFLA 2NWJA 1FBDA 3GYYA 5FHNA 4PBHA 3O66A 4NQ8A 4HXVA 5L9SA 5EQ7A 3H6TA 2XWKA 3IOVA 3O6IA 2OJTA 3OEKA 1PDAA 1NNKA 1Y9UA 4G68A 3FATA 1MG1A 4JDFA 3MW0A 3V89B 4QFPA 3ROJA 1CE2A 3TUSA 2FVZA 4YZZA 4FEBA 4BLAA 4OVQA
chains in the Genus database with same CATH topology
2HXRA 5T3JA 4N81A 4F1UA 3A29A 4P3LA 2HHMA 2DE4A 3IFCA 4GBVA 2QPQA 2VPNA 2JJKA 3RPLB 3KC1A 4MX6A 3FXBA 4X8RA 5IZ3A 2QFLA 5EYHA 4F19A 2Q74A 4PDDA 2P3VA 3ISPA 1G0HA 4F1VA 4XFEA 1FBCA 4I3YA 5ET7A 1KA1A 3E78A 4XEQA 4MIJA 2V3QA 4N6KA 5IM2A 1FTAA 1IMDA 1KZ8A 4N6DA 1FBPA 1RDYA 1XI6A 1K9ZA 4X9TA 1FBGA 3KBZA 4GBWA 5I7IA 2Y5LA 4NG7A 5IZZA 5J16A 2F5XA 1CNQA 1NI9A 2DE3A 1NV1A 1FPFA 5I3SA 1SPIA 2Y5KA 2GQ1A 2WYPA 2CZKA 4H45A 2PFYA 1EYIA 1EYJA 2XA5A 2FHYA 2B4LA 1IMCA 1FPLA 1NV7A 2WEFA 5I5PA 2F3DA 4DI3D 3BIHA 1FJ9A 2P3NA 4PFBA 2HPGA 4OANA 1FPDA 4PCDA 3U65A 1NV6A 4XF5A 4JVDA 4PF6A 5EQAA 2MKZA 4MMPA 3BIGA 3NOHA 2VT5A 3E79A 2WBDA 2ZZXA 4AS4A 4NGUA 1YXIA 2KQZA 1RDZA 1NV4A 4PAKA 4NX1A 4O8MA 4P56A 4NHBA 1EYKA 4NN3A 1JP4A 4PGPA 4GWXA 3RYDA 1LBWA 1LBYA 5EYGA 4I40A 4GWYA 2DDKA 2B4MA 4PFIA 4O94A 1NUXA 1D9QA 3CHGA 3B50A 4PF8A 1DBZA 2QVRA 2DE2A 4QBAA 2WX9A 1FBHA 4O7MA 2Q9TA 1YZ0A 3EKIA 2VPOA 4HE0A 5EQ9A 2R8TA 4NF0A 2FIEA 4P1EA 3T1BA 1G0IA 1NV5A 2PFZA 5ET8A 5EQ8A 2XWVA 1LEVA 2XXKA 1INPA 4F18A 5DW8A 4PFRA 4GX6A 4N8YA 4QXDA 1KA0A 1DK4A 2DVZA 2F3BA 2CEYA 3PTYA 4MNCA 5A5LA 5ET6A 2L5VA 4I3EA 2ZZVA 2FIXA 2Q8MA 4P1LA 4N8GA 3QMFA 3SZPA 1IMEA 4NAPA 4PAFA 1LBXA 5FBPA 4GWZA 4PAIA 1Q9DA 2CZIA 1FPIA 1FBEA 4MEVA 2OX3A 1LBZA 4OVPA 4JVCA 4YICA 1FPJA 1FSAA 3FBPA 3LUZA 1NV2A 1AWBA 3MYUA 4M1VA 4P47A 4FBPA 4O7IA 3RPLA 1K9YA 3D1RA 1FJ6A 3W9VA 1FPBA 4N15A 2OWZA 4PE3A 1IMFA 4P8BA 2WYKA 4MNIA 4JVIA 4N17A 4PGNA 1IMBA 4KXPA 1FRPA 4PC9A 4G61A 1LBVA 3B8BA 1YYZA 2PCRA 4OA4A 5LDZA 4MJOA 5IGAA 1NUWA 1NUYA 4MNPA 4OVRA 4GWSA 5F24A 4OVTA 1VDWA 4PTKA 2HZKA 2QVUA 2ZZWA 4AS5A 5ET5A 3T0JA 1NV0A 3W9WA 5ESYA 1FPKA 4N91A 4LN5A 4MHFA 4GX3A 4UABA 2BJIA 2CZHA 2V4CA 4DI4B 4GWUA 2HZLA 1NUZA 4GWWA 4H46A 5IZ3B 5J1DA 1FBFA 1IMAA 4MCOA 1RDXA 2XWOA 4MAGA 4P9KA 3HFUA 4IR8A 2KR0A 5IZ1A 4HE2A 4N4UA 2QVVA 1FBDA 3GYYA 4PBHA 4HCWA 5CM6A 4NQ8A 4HXVA 5EQ7A 3IFAA 1BK4A 4HE1A 2FBPA 2XWKA 2XWIA 1NV3A 4X04A 2CEXA 5JK4A 4PDHA 4OVSA 3KC0A 4HCYA 1QGXA 1DCUA 2WBBA 4PBQA 3ROJA 3MSTA 2FVZA 1FPEA 4PETA 4YZZA 4OVQA 3LV0A 5LTCA 1FPGA 4GX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHY A;  5T3J A;  1FPK A;  4N81 A;  5ET6 A;  5A5L A;  1IMC A;  5ESY A;  1FPL A;  1NV7 A;  4I3E A;  2WEF A;  4GX3 A;  2FIX A;  3A29 A;  2F3D A;  2HHM A;  1FJ9 A;  3BIH A;  2P3N A;  2Q8M A;  3IFC A;  4GBV A;  2BJI A;  2CZH A;  4GWU A;  1NUZ A;  3QMF A;  4GWW A;  1IME A;  1FPD A;  2JJK A;  4H46 A;  5IZ3 B;  1NV6 A;  3RPL B;  3KC1 A;  1FBF A;  1LBX A;  5FBP A;  4GWZ A;  5EQA A;  5IZ3 A;  1Q9D A;  2CZI A;  1IMA A;  1FPI A;  2QFL A;  3BIG A;  1FBE A;  2VT5 A;  5EYH A;  1RDX A;  2OX3 A;  2Q74 A;  1LBZ A;  2WBD A;  4AS4 A;  1YXI A;  2P3V A;  1RDZ A;  1NV4 A;  1G0H A;  1FPJ A;  1FSA A;  3FBP A;  3LUZ A;  1NV2 A;  1AWB A;  1FBC A;  1EYK A;  4IR8 A;  4I3Y A;  5ET7 A;  5IZ1 A;  1JP4 A;  4HE2 A;  4GWX A;  1KA1 A;  4FBP A;  3RYD A;  1LBW A;  1LBY A;  2QVV A;  4O7I A;  3RPL A;  5EYG A;  4I40 A;  1K9Y A;  4GWY A;  1FTA A;  3D1R A;  2DDK A;  1IMD A;  1FJ6 A;  1FBD A;  1KZ8 A;  1FPB A;  1NUX A;  2OWZ A;  1IMF A;  1D9Q A;  1FBP A;  1RDY A;  4HXV A;  1XI6 A;  1K9Z A;  1DBZ A;  2QVR A;  5EQ7 A;  3IFA A;  1BK4 A;  1IMB A;  4KXP A;  1FRP A;  4HE1 A;  1FBH A;  1FBG A;  2FBP A;  1YZ0 A;  1NV3 A;  3KBZ A;  4HE0 A;  4G61 A;  1LBV A;  3B8B A;  4GBW A;  1YYZ A;  2PCR A;  2Y5L A;  5EQ9 A;  2R8T A;  3KC0 A;  5LDZ A;  4MJO A;  2FIE A;  1G0I A;  1NV5 A;  5J16 A;  1CNQ A;  1NI9 A;  1NUW A;  1NUY A;  1QGX A;  5ET8 A;  1NV1 A;  5EQ8 A;  4GWS A;  1LEV A;  1FPF A;  5I3S A;  1SPI A;  2Y5K A;  1DCU A;  1INP A;  2GQ1 A;  2WBB A;  5F24 A;  5DW8 A;  2CZK A;  3ROJ A;  4H45 A;  1VDW A;  4GX6 A;  4PTK A;  2FVZ A;  1FPE A;  2QVU A;  4QXD A;  1KA0 A;  1DK4 A;  1EYI A;  4AS5 A;  3LV0 A;  2F3B A;  5ET5 A;  3T0J A;  1EYJ A;  1NV0 A;  1FPG A;  4GX4 A; 
#chains in the Genus database with same CATH topology
 1MXY A;  1TWY A;  3A29 A;  4JSD A;  2QPQ A;  2VPN A;  2GRV A;  4WXJ A;  4FJP A;  3DP6 A;  2JJK A;  3T96 B;  4O3A A;  5A5X B;  3N94 A;  2OCU A;  2REJ A;  4NF8 A;  2V93 A;  4R2B A;  1IIW A;  5IZ3 A;  3T9X B;  3TFL A;  1FQA A;  2QFL A;  4ESW A;  3C4M A;  2X26 A;  4NF4 B;  4NF6 B;  5ITO A;  2DQV A;  4PDD A;  2P3V A;  1P1N A;  4KQP A;  5I57 A;  4IGR A;  3H6W A;  1SVX B;  1Y3Q A;  4ZE8 A;  1G0H A;  3EF7 A;  4F1V A;  4XFE A;  3E78 A;  4OYV A;  4MIJ A;  2F35 A;  2V3Q A;  5CC2 A;  2OPD A;  3EN3 A;  4N6D A;  4BDQ A;  5H8N B;  4IO7 A;  3QUF A;  1D9V A;  3MVW A;  3ONM A;  4PP0 A;  3D4G A;  4F22 A;  2DWH A;  4LQ2 A;  2UYE A;  3V8X B;  4YMB A;  4G77 A;  3MP8 A;  1LFH A;  3MVX A;  3QSL A;  2Y5L A;  5KCJ A;  1FTL A;  5AA2 A;  2YLN A;  4GL8 A;  1B05 A;  1B1H A;  1B7U A;  1J1N A;  1NI9 A;  1BLF A;  3G3H A;  3IOR A;  2XD3 A;  2Y5K A;  3ZKL A;  1PB9 A;  2VGQ A;  3G3F A;  4EF1 A;  5BWJ A;  1N7W A;  3PPP A;  4KR5 A;  3RY3 A;  4RNS A;  1UTB A;  1FPL A;  3LR1 A;  4K3F A;  3O29 A;  4PFT A;  4XIG Q;  4U1O A;  1URS A;  3BBR A;  2D3I A;  3IO4 A;  3W15 C;  1JQF A;  2XXU A;  2QMW A;  2IA4 A;  2O6A A;  4XF5 A;  5B70 A;  2AIX A;  4PF6 A;  3SEU A;  5EQA A;  2I3W A;  1SI1 A;  2VT5 A;  4NE4 A;  3G3G A;  2QS1 A;  1NNP A;  1QJM A;  3U8Q A;  1DPE A;  4NGU A;  2KQZ A;  4IO6 A;  4NX1 A;  1XOC A;  1MDP 1;  1EYK A;  3IL1 B;  1MPB A;  3MP1 A;  2ONS A;  4KD5 A;  1S9T A;  3H06 B;  1LBW A;  5EYG A;  4GVO A;  4PFI A;  4G68 B;  1OMP A;  3S4U A;  5DYH A;  3MZ1 A;  3T66 A;  4ZEC A;  4LZ7 A;  1QVS A;  3B50 A;  3Q29 A;  3QIM A;  1DBZ A;  1US5 A;  2ZYN A;  2Z8E A;  3CSB A;  4KCC A;  2M8C A;  2I58 A;  4RY1 A;  1O7T A;  3FXQ A;  3MZ9 A;  4G4P A;  5EQ9 A;  1A8E A;  3FJ7 A;  2R8T A;  3VXC A;  5IAI A;  3S9M C;  1G0I A;  3PUZ E;  5CBS A;  3TMG A;  2Z8F A;  5EQ8 A;  5I59 A;  5JTY B;  1GR2 A;  4NF8 B;  3LBS A;  1INP A;  1QUL A;  4TLM B;  1B3L A;  4QXD A;  1DK4 A;  1ATG A;  2RC9 A;  3LSW A;  1FTO A;  2DVZ A;  1LFG A;  2F3B A;  3H6V A;  3K1M A;  4O3C A;  3OEN A;  5ET6 A;  3PPN A;  2FIX A;  3CG3 A;  3G7W A;  4P1L A;  4WEP A;  5I2N B;  1IME A;  2R71 A;  4I8C A;  4H65 A;  4NAP A;  1LBX A;  5CMC A;  1A8F A;  1Y4T A;  4OXV A;  1VSO A;  1FPI A;  1JET A;  2OX3 A;  2UXA A;  3PMW A;  4UA8 A;  4ZDM A;  2THI A;  3RT8 A;  5H8F A;  1SD3 A;  3MWB A;  1SW5 A;  3K6X A;  5LOM A;  3E4R A;  1JVX A;  4Q0C A;  5ELV A;  4M1V A;  3LSL A;  2I3V A;  3FXR A;  2ZYK A;  4FBP A;  5KCJ B;  3RPL A;  2XXP A;  5AA2 B;  1MPD A;  1K9Y A;  4ISU A;  3D1R A;  4UAC A;  3W9V A;  1FPB A;  1NH7 A;  2I6E A;  4E0X A;  4U1Z A;  1FQC A;  4DDD A;  1TFD A;  3TTK A;  3KJT A;  3FVG A;  4N17 A;  3FZV A;  1B3G A;  5AA2 D;  1MPC A;  4KXP A;  5EYF A;  3EHU A;  2H25 A;  1MXW A;  4X1D A;  1UTB B;  3QYT A;  2PCR A;  4GRK A;  3PPO A;  3VLW A;  5L9O A;  4MNP A;  1PB7 A;  1POY 1;  4QSC A;  1WVJ A;  1ZMG A;  4EXL A;  3T0J A;  1D9Y A;  4RYA A;  1NV0 A;  1SW1 A;  5ESY A;  3THI A;  4LN5 A;  1Y3N A;  2YJP A;  3K6V A;  4F2Q A;  3L6H A;  1OIB A;  2XXX A;  1M5D A;  1N3X A;  1MM6 A;  4GWU A;  2F7A A;  2V25 A;  1FTM A;  4H46 A;  1OQH A;  3S9N C;  5J1D A;  1FBF A;  4LA9 A;  3PPR A;  3LSF B;  1EZ9 A;  5DTB A;  1BIY A;  1SW2 A;  2XWO A;  3FIR A;  3RGY A;  1YCJ A;  3TPA A;  4I1D A;  1S7Y A;  1VFD A;  2VHA A;  4IY6 A;  1OQG A;  2ABH A;  1Z7M E;  4LP2 B;  4N6P A;  1HSJ A;  4RJZ A;  4XKQ A;  1A40 A;  2DXY A;  4DXU A;  4GQO A;  3K1P A;  2AL4 A;  2RCA A;  2PT2 A;  4DE8 A;  3G3J A;  4YKI A;  2HFB A;  3IOU A;  3L6G A;  4HCW A;  5CM6 A;  4QRZ A;  3EHT A;  2H98 A;  3CRB A;  4TQU Q;  3IFA A;  2H9B A;  4HE1 A;  1A99 A;  4OMB A;  4TLL B;  1QUK A;  4LZ5 A;  3FAS A;  3RTW B;  5JK4 A;  1NNF A;  2DP8 A;  4ZE9 A;  4HCY A;  5AA4 A;  3CSG A;  1DCU A;  4GIZ A;  5I58 A;  1DMB A;  4QSE A;  4NWC A;  4U21 A;  4XKR A;  3LUY A;  5H8F B;  4N81 A;  4F1U A;  4OET A;  3O9P A;  3H6U A;  4P3L A;  3UK4 A;  4H67 A;  4OEN A;  2AYS A;  3QXM A;  2DVC A;  4YU0 A;  5K2Y A;  3RPL B;  4FEC A;  3FXB A;  3I5O A;  3ZSF A;  3BFT A;  5EYH A;  4R2F A;  4H1X A;  2QS3 A;  2ZNT A;  1MXU A;  2Q2A A;  1VE4 A;  2HXW A;  5DEX A;  1FBC A;  3TDJ A;  4G8H A;  4XEQ A;  3K0V A;  4BDL A;  5KDT B;  3H7M A;  1I69 A;  1FBP A;  1XVX A;  1XI6 A;  4AB6 A;  2CMO A;  3TEP A;  4KYS A;  1FBG A;  3FGS A;  3DP8 A;  3VXB A;  4GBW A;  5KZT A;  3T9H B;  2P1S A;  1USY H;  5IZZ A;  3ILU B;  4LVQ A;  4EQ7 A;  2DE3 A;  4WKM A;  1NV1 A;  4RK9 A;  5I3S A;  4MF3 A;  2GQ1 A;  1R1N A;  1B1X A;  4TOZ A;  5FTI A;  3Q25 A;  4H45 A;  3CFZ A;  2HEU A;  4ZEB A;  3ILT B;  4YB5 A;  3MPL A;  2XA5 A;  2UVJ A;  2I0C A;  2H4I A;  2RKM A;  4EF2 A;  1NV7 A;  1LB9 A;  2F3D A;  2P3N A;  5DVJ A;  4IGT A;  1H3D A;  1OLC A;  1SBP A;  3S9L C;  4IO5 A;  3U65 A;  1B5H A;  1DOT A;  1NV6 A;  1LBC A;  2MKZ A;  4LZ8 A;  4NF5 A;  1N76 A;  2AL5 A;  1MY2 A;  2QS4 A;  4O8M A;  4P56 A;  1NMU A;  4R6Y A;  3FXU A;  4NHB A;  4XXU A;  1P1U A;  3OEL A;  4PGP A;  1UQW A;  3LSX A;  4GWX A;  2R6G E;  3RYD A;  2F8D A;  1LBY A;  3PPQ A;  3IK6 B;  4I40 A;  4GWY A;  2DDK A;  2B4M A;  4O94 A;  4YKJ A;  2NXO A;  2H5Y A;  1FW0 A;  1YAE A;  4G8N A;  3U1O A;  5FHM A;  4R74 A;  5I58 B;  4YAH X;  2O1M A;  2KLF A;  4PF8 A;  1XVY A;  3VLU A;  3O2A A;  2OPE A;  3FVN A;  2I0B A;  2Q9T A;  3EKI A;  4HE0 A;  3SDF A;  2DOJ A;  4G2Z A;  1FQF A;  1Q35 A;  4P1E A;  2GFE A;  3C33 A;  1R6Z A;  1NV5 A;  1H43 A;  5ITP A;  2OBG A;  5ET8 A;  3ECR A;  1MQH A;  2Y7R A;  4I9D A;  5I2K B;  1LEV A;  3HV1 A;  3JYR A;  4PFR A;  4GX6 A;  4N8Y A;  3KSJ A;  1FQD A;  3TEL A;  1MY3 A;  1IUD A;  3OO9 A;  1BTJ A;  3U93 A;  4JBZ A;  1Y1Z A;  3A3C A;  5DEX B;  2RC7 A;  3OSQ A;  2QRY A;  4RPN A;  5TP9 A;  1D3K A;  4AB5 A;  3KG2 A;  2GH9 A;  1B6H A;  3B7D A;  1MQI A;  3JV9 A;  3T9V A;  3N5L A;  3QK6 A;  3SEX A;  1LAX A;  2V3U A;  3MVZ A;  2F36 A;  4ZEK A;  1LBZ A;  2A5T A;  4GLI A;  2VP1 A;  2O84 X;  3M3K A;  3KSX A;  1NV2 A;  4BDN A;  4FAT A;  3D4C A;  5CI5 A;  1JEV A;  4P47 A;  3TCF A;  2D5W A;  1N04 A;  1NFT A;  2OLB A;  3OMB A;  4P8B A;  2OWT A;  3FJM A;  3TOD A;  3R6U A;  4QSD A;  4MNI A;  1LAG E;  3K6U A;  1IMB A;  2DS9 A;  5ISU A;  1GVC A;  3AXF A;  1DSN A;  3DLN A;  1UTH A;  2F97 A;  1LBV A;  3V83 A;  2PT1 A;  3H3G A;  4H5F A;  5LDZ A;  4JB7 A;  4MJO A;  4PFW A;  3MZB A;  4OER A;  4WED A;  4XKN A;  3EQ1 A;  5F24 A;  2RCB A;  4GL0 A;  2QVU A;  3GLB A;  2ZZW A;  4AS5 A;  3Q28 A;  1ZBM A;  5TU0 A;  5ICQ A;  3PMX A;  3W9W A;  4PQJ A;  4C1U A;  4N91 A;  4BDR A;  2Y7P A;  4MHF A;  4MH5 A;  4GX3 A;  3G3K A;  3VVE A;  3UN6 A;  1MXV A;  2V4C A;  2HZL A;  5L9M A;  3TTN A;  1Y20 A;  5IZ3 B;  1MY1 A;  4JSO A;  3E3K A;  4G8M A;  4N07 A;  1BKA A;  4ONY A;  5I57 B;  3TTL A;  4P9K A;  5AA3 A;  3FD3 A;  5I56 A;  2QS2 A;  1MY4 A;  4JWO A;  4IR8 A;  2KR0 A;  3CG1 A;  1SQY A;  1LCF A;  4N4U A;  2Z22 A;  1B7Z A;  3VLV A;  1LAH E;  2O51 A;  1LFI A;  1A7L A;  1XHY A;  1SW4 A;  3KN7 A;  3Q27 A;  4YMA A;  3PUY E;  2XWI A;  1NV3 A;  4HS7 A;  3VE1 B;  4X04 A;  1IIT A;  1B4Z A;  1RKM A;  3KOS A;  3UOR A;  4PDH A;  2RIN A;  4OVS A;  3PU5 A;  4PFY A;  3C31 A;  4R75 A;  5TP9 B;  4DCX A;  2UVH A;  3EHS A;  3MST A;  1S50 A;  1FPE A;  3FJG A;  4PET A;  4OFJ A;  2DWA A;  1P1W A;  1I6B A;  1FPG A;  4YKP A;  1B3H A;  2HXR A;  3KGC A;  4KYD A;  3MUQ A;  4DCY A;  4U4X A;  2X7Q A;  3PGF A;  1B7H A;  1FQE A;  2DE4 A;  1R9Q A;  2IEE A;  3IJO B;  3KC1 A;  4MX6 A;  4X8R A;  5L8D A;  2B3F A;  2YPN A;  3C32 A;  1RYO A;  2F6P A;  1ZTY A;  4EDP A;  1PEB A;  4DLD A;  2Q74 A;  1MDQ A;  1MQJ A;  2V84 A;  3TCH A;  1JEU A;  1JW1 A;  4DIG A;  1D4N A;  5EHM A;  2HCA A;  5ET7 A;  2LAO A;  1KA1 A;  4ZS9 A;  2Q88 A;  4N6K A;  3MVY A;  3IO6 A;  1FTA A;  1QUI A;  2REG A;  2R9J A;  1ZLQ A;  1IMD A;  2G93 A;  4FED A;  4P0G A;  2GHB A;  3SET A;  4H8I A;  1CB6 A;  4POX A;  3SEW A;  1PBQ A;  1USY E;  3DM0 A;  1URG A;  1SDX A;  3G3I A;  3IR1 A;  3FV2 A;  4I62 A;  1AMF A;  1Y4C A;  5AA1 A;  4ELR A;  1MQD A;  1M5B A;  4DZ1 A;  4F3S A;  2Q2C A;  5I59 B;  5J16 A;  1CNQ A;  3HHG A;  3C35 A;  3OXN A;  3CFX A;  1FPF A;  5CBR A;  1MH3 A;  3IOW A;  2PFY A;  2DYX A;  1EYI A;  1O64 A;  1MM7 A;  1F9B A;  5JEI A;  2O68 A;  4QFK A;  1QUJ A;  1XS5 A;  1IMC A;  3RUM A;  2Y84 A;  2WEF A;  1MS7 A;  1RYX A;  3GBB A;  3BIH A;  1FJ9 A;  3B6Q A;  5CMK A;  1XC1 A;  1B58 A;  5AE4 A;  4KHZ E;  5HPQ A;  3TQL A;  4OAN A;  1FPD A;  3K00 A;  4BDO A;  1LBB A;  4IO2 A;  4JVD A;  1B5I A;  2HAU A;  5A5X A;  3PMV A;  3RLF E;  4M4G A;  1DPP A;  1M5C A;  3E79 A;  1AL3 A;  1M5E A;  2WBD A;  3SEY A;  1ZIU A;  2ZZX A;  2NVU B;  3HCQ A;  1YXI A;  4THI A;  1RDZ A;  4NF4 A;  4PAK A;  3KEI A;  4QFN A;  4R6K A;  1N7X A;  3HN0 A;  2VD2 A;  3B6T A;  3H4Z A;  4Q8R A;  3UA8 A;  2DSF A;  2XXW A;  1ELJ A;  4NMY A;  3O6G A;  3FV1 A;  5K2X A;  2ZYO A;  1NUX A;  3CR9 A;  3OO7 A;  3GZG A;  1D9Q A;  3CHG A;  5H8N A;  4EQ9 A;  2QVR A;  3OEM A;  1YZ0 A;  4R6H A;  3KN8 A;  3IOT A;  3T9U A;  1H44 A;  2OZZ A;  4NF0 A;  2FIE A;  3T1B A;  2Z8D A;  1MXX A;  2PFZ A;  3LC8 A;  4GFR A;  5DT6 A;  2Y7W A;  3K4U A;  4F18 A;  3O28 A;  3SES A;  1H45 A;  3K2D A;  3ZKK A;  3SEV A;  3TKD A;  1KA0 A;  2W7Y A;  3PV0 E;  1TXF A;  3H03 A;  2CEY A;  3RQT A;  4OHN A;  4LON B;  2NOO A;  5H8H A;  4X1B A;  5A5L A;  2L5V A;  4FAJ A;  4R72 A;  4I3E A;  1OVB A;  4F31 B;  3C9H A;  1P1Q A;  1LST A;  2Q8M A;  4OWD A;  4POW A;  5F7V A;  3QMF A;  2XXV A;  4ECF A;  1XT8 A;  2ZNU A;  4PAF A;  5FBP A;  1IQ7 A;  1VR5 A;  4GWZ A;  1II5 A;  3A09 A;  3IB0 A;  3TZA A;  1FBE A;  4JXI A;  1M5F A;  4MEV A;  2DWI A;  1ANF A;  1B3E A;  3C36 A;  4QFO A;  1OVT A;  1ZU0 A;  1B5J A;  4DXB A;  1FSA A;  3MPK A;  1AWB A;  3MC2 A;  1PBP A;  2O69 A;  3MYU A;  4PFU A;  1LCT A;  2Z23 A;  4P11 A;  5CRY A;  4ESX A;  2DWJ A;  4OQO A;  1B4H A;  4RPO A;  4HTG A;  2I4C A;  1Z7N E;  3VV5 A;  2ZXT A;  2OWZ A;  3OSR A;  1NNT A;  4RK2 A;  3HHF A;  2E0S A;  1FRP A;  1FTJ A;  4PC9 A;  2XXR A;  1GTK A;  4H6D A;  4C0R A;  4OZ9 A;  1NKX A;  3B8B A;  4KYE A;  3U72 A;  1YYZ A;  3E9X A;  5AA4 B;  3OO8 A;  1QW0 A;  2XHD A;  4H5G A;  1FCK A;  4EQB A;  5B7D A;  3F11 A;  3M8U A;  1NUW A;  3S2V A;  3KJ7 A;  4OVT A;  5DVF A;  1VDW A;  2HZK A;  3I3V A;  5JTY A;  3E13 X;  4Q30 B;  1HSL A;  3MAM A;  4FIM A;  5ET5 A;  4ZZA A;  1MRP A;  2O7I A;  3SER A;  3IB1 A;  4UAB A;  3BFU A;  4X48 A;  2HQ0 A;  2BJI A;  2CZH A;  4DI4 B;  1H76 A;  4GWW A;  4Z7E A;  1PC3 A;  2ANJ A;  1WDN A;  1MXZ A;  5I2N A;  4RA1 A;  1LB8 A;  1B2H A;  1MY0 A;  2QSX A;  5ICT A;  2VD3 A;  3TQW A;  3ODB A;  1RDX A;  2P0S A;  1TFA A;  2XXT A;  2ONK E;  4NTL A;  3MJN A;  3IX1 A;  2P2A A;  3OD7 A;  4YB6 A;  2WKY A;  3HFU A;  4GOT A;  3RTF B;  1JNF A;  3GBA A;  1B32 A;  4FOR A;  2VOZ A;  2OK2 A;  3U94 A;  1B9J A;  4XTC Q;  4G68 C;  4F3P A;  3FUZ A;  1N3W A;  1B3F A;  5BUU A;  3DEL B;  1MH4 A;  2PBW A;  3K6W A;  3C34 A;  1B46 A;  4O3B A;  1BK4 A;  4IY5 A;  1P99 A;  2FBP A;  5H8H B;  1B0H A;  2UYF A;  4KFQ A;  2OWS A;  5IKB A;  2CEX A;  3CIJ A;  3DP4 A;  3KC0 A;  2B65 A;  4GXA A;  5H8S A;  1QGX A;  1US4 A;  1N84 A;  4R73 A;  4L17 A;  1JW5 A;  2WBB A;  4PBQ A;  2F6G A;  2XXY A;  2QL3 A;  1GV8 A;  3RNN A;  3CVG A;  3LV0 A;  5LTC A;  3CI8 A;  2XD2 A;  1EZO A;  4NED A;  2F7C A;  4GX4 A;  2ESN A;  5T3J A;  1T0K A;  1O63 A;  4LQ5 A;  2HHM A;  3IFC A;  4GBV A;  3MBP A;  2PVU A;  3BKI B;  4ZZE A;  4NF5 B;  3ZS6 A;  2XX9 A;  3Q26 A;  1EH3 A;  4QHQ A;  3TAJ A;  1POT A;  3HPI A;  4R9F A;  4F19 A;  1AOV A;  2CZL A;  4MLQ A;  4NWD A;  5H8Q A;  4FE8 A;  3ISP A;  4F29 A;  1LAF E;  2X7P A;  2XXI A;  4LUB A;  4OES A;  3K01 A;  3OO6 A;  1I6Q A;  1I6A A;  4I3Y A;  2NUV A;  3VDF A;  2FNC A;  5IM2 A;  4U4S A;  2GHA A;  1MQG A;  3N6U A;  3T22 A;  1KZ8 A;  1VFE A;  2ZNS A;  2BJJ X;  3R7X A;  1RDY A;  1K9Z A;  3PUX E;  3O97 A;  4ELP A;  2HAV A;  2UVG A;  4X9T A;  5CMB A;  4P0I A;  4AQ4 A;  4OEU A;  4ZEF A;  3KBZ A;  3UP9 A;  1GGG A;  3WAE A;  5I7I A;  4NG7 A;  1EU8 A;  3MP6 A;  2FA7 A;  2F5X A;  1EZP A;  1SPI A;  3VFJ A;  2WYP A;  4IO3 A;  2CZK A;  3CFL A;  4GXS B;  1B40 A;  4GF8 A;  2XX8 A;  4LAT A;  1SI0 A;  4ZEI A;  1EYJ A;  3KBR A;  5FHO A;  3MQ9 A;  3VVD A;  4JWX A;  3RT6 B;  2FHY A;  2B4L A;  3M3L A;  3QAX A;  4GWO A;  4EUO A;  3KFM A;  5I5P A;  4DI3 D;  4KI0 E;  4PFB A;  1N0T A;  2HPG A;  4OEV A;  1IZ1 A;  4PCD A;  4OFL A;  1L5T A;  1B51 A;  4MMP A;  4U23 A;  4YB7 A;  3BIG A;  2A5T B;  3NOH A;  2F7B A;  3P7I A;  4AS4 A;  2Q89 A;  3KN3 A;  3SKP A;  1AIV A;  4KCD A;  4OVJ A;  1NV4 A;  3FVK A;  5TPA A;  4F3B A;  4Z0I A;  1LLS A;  4ND9 A;  2QMX A;  4F39 A;  2ONR A;  2PYY A;  1NH8 A;  4NN3 A;  1JP4 A;  1IXG A;  1DTZ A;  4YKK A;  3V5A A;  1BP5 A;  1UIU A;  2PMS A;  1JVY A;  5HBC A;  2D21 A;  2I4B A;  4H0W A;  5KDT A;  1JW4 A;  4GD5 A;  1P1O A;  1HSE A;  4JWY A;  2DE2 A;  4QBA A;  1QKB A;  2WX9 A;  1FBH A;  3QUJ A;  4O7M A;  1UTH B;  3KZG A;  2VPO A;  3A3U A;  5I84 A;  2QJE A;  1KWH A;  2O1L A;  4H8J A;  3FVO A;  1B52 A;  2B3B A;  3OOA A;  4IO4 A;  2XWV A;  4XKP A;  2XXK A;  5DW8 A;  4OFO A;  3UIF A;  4E0W A;  3U92 A;  3VVF A;  2ALU A;  3TTM A;  3PTY A;  1FQB A;  5H8Q B;  4MNC A;  3EPE A;  1YTV A;  2XXH A;  4F1Y A;  2ZZV A;  3TTR A;  4U2R A;  4ELQ A;  1FTK A;  4BDM A;  2H99 A;  4N8G A;  3SZP A;  3HO7 A;  2Y7I A;  1IEJ A;  3WAF A;  3PD8 A;  2XX7 A;  1Q9D A;  3PUV E;  4PAI A;  2CZI A;  2Y7K A;  1QKA A;  2I48 A;  1Y3P A;  4OVP A;  4U22 A;  3GXA A;  1YPN A;  4JVC A;  5I56 B;  5F1Q A;  4F2O A;  4YIC A;  3KOT A;  1FPJ A;  1A54 A;  2O7U A;  3FBP A;  1URD A;  2F78 A;  3LUZ A;  3K02 A;  1SYH A;  4ELO A;  5HM4 B;  1IXI A;  2ZYM A;  4O7I A;  2E1S A;  1FJ6 A;  3T93 B;  4N15 A;  4PE3 A;  3RN8 A;  1IMF A;  1IXC A;  1DTG A;  2F34 A;  2WYK A;  5FTH A;  2FYI A;  4NF6 A;  4JVI A;  4N13 A;  5M2V A;  3RPW A;  4PGN A;  1R9L A;  4OTE A;  2PX1 A;  4R9G A;  4G61 A;  2XXQ A;  3USD A;  4OA4 A;  1AH5 A;  1LGB C;  5IGA A;  1ZKB A;  1Q1K A;  4MBP A;  1NUY A;  2ZMB A;  4OVR A;  3B6W A;  5CMM A;  4GWS A;  1UIV A;  4PE5 B;  3HST A;  4PTK A;  5I2K A;  4KPT A;  2DXR A;  3N26 A;  1TT1 A;  3PD9 A;  3K1N A;  4HW8 A;  1FPK A;  5TPA B;  3PUW E;  4IB2 A;  1ZJL A;  3N6T A;  4EXK A;  4ZED A;  3IB2 A;  3IJX B;  1PB8 A;  1NL5 A;  3IAZ A;  3UGW A;  1B0L A;  1NUZ A;  1SYI A;  2I49 A;  2V3T A;  2RC8 A;  3S9E A;  4DXC A;  3I6V A;  4C1T A;  1IMA A;  4MCO A;  4F3G A;  3TYH A;  3M3F A;  1IXH A;  4MAG A;  1OLA A;  4QF9 A;  4Q5T A;  1Y1M A;  1WOD A;  2G29 A;  5EHS A;  5DVI A;  3JZJ A;  4MLV A;  2RF1 A;  3O6H A;  1A55 A;  2Q8J A;  5IZ1 A;  4HE2 A;  2A5S A;  3R26 A;  2UVI A;  3TCG A;  2QVV A;  4RXL A;  4MFI A;  4QFL A;  2NWJ A;  1FBD A;  3GYY A;  5FHN A;  4PBH A;  3O66 A;  4NQ8 A;  4HXV A;  5L9S A;  5EQ7 A;  3H6T A;  2XWK A;  3IOV A;  3O6I A;  2OJT A;  3OEK A;  1PDA A;  1NNK A;  1Y9U A;  4G68 A;  3FAT A;  1MG1 A;  4JDF A;  3MW0 A;  3V89 B;  4QFP A;  3ROJ A;  1CE2 A;  3TUS A;  2FVZ A;  4YZZ A;  4FEB A;  4BLA A;  4OVQ A; 
#chains in the Genus database with same CATH homology
 2HXR A;  5T3J A;  4N81 A;  4F1U A;  3A29 A;  4P3L A;  2HHM A;  2DE4 A;  3IFC A;  4GBV A;  2QPQ A;  2VPN A;  2JJK A;  3RPL B;  3KC1 A;  4MX6 A;  3FXB A;  4X8R A;  5IZ3 A;  2QFL A;  5EYH A;  4F19 A;  2Q74 A;  4PDD A;  2P3V A;  3ISP A;  1G0H A;  4F1V A;  4XFE A;  1FBC A;  4I3Y A;  5ET7 A;  1KA1 A;  3E78 A;  4XEQ A;  4MIJ A;  2V3Q A;  4N6K A;  5IM2 A;  1FTA A;  1IMD A;  1KZ8 A;  4N6D A;  1FBP A;  1RDY A;  1XI6 A;  1K9Z A;  4X9T A;  1FBG A;  3KBZ A;  4GBW A;  5I7I A;  2Y5L A;  4NG7 A;  5IZZ A;  5J16 A;  2F5X A;  1CNQ A;  1NI9 A;  2DE3 A;  1NV1 A;  1FPF A;  5I3S A;  1SPI A;  2Y5K A;  2GQ1 A;  2WYP A;  2CZK A;  4H45 A;  2PFY A;  1EYI A;  1EYJ A;  2XA5 A;  2FHY A;  2B4L A;  1IMC A;  1FPL A;  1NV7 A;  2WEF A;  5I5P A;  2F3D A;  4DI3 D;  3BIH A;  1FJ9 A;  2P3N A;  4PFB A;  2HPG A;  4OAN A;  1FPD A;  4PCD A;  3U65 A;  1NV6 A;  4XF5 A;  4JVD A;  4PF6 A;  5EQA A;  2MKZ A;  4MMP A;  3BIG A;  3NOH A;  2VT5 A;  3E79 A;  2WBD A;  2ZZX A;  4AS4 A;  4NGU A;  1YXI A;  2KQZ A;  1RDZ A;  1NV4 A;  4PAK A;  4NX1 A;  4O8M A;  4P56 A;  4NHB A;  1EYK A;  4NN3 A;  1JP4 A;  4PGP A;  4GWX A;  3RYD A;  1LBW A;  1LBY A;  5EYG A;  4I40 A;  4GWY A;  2DDK A;  2B4M A;  4PFI A;  4O94 A;  1NUX A;  1D9Q A;  3CHG A;  3B50 A;  4PF8 A;  1DBZ A;  2QVR A;  2DE2 A;  4QBA A;  2WX9 A;  1FBH A;  4O7M A;  2Q9T A;  1YZ0 A;  3EKI A;  2VPO A;  4HE0 A;  5EQ9 A;  2R8T A;  4NF0 A;  2FIE A;  4P1E A;  3T1B A;  1G0I A;  1NV5 A;  2PFZ A;  5ET8 A;  5EQ8 A;  2XWV A;  1LEV A;  2XXK A;  1INP A;  4F18 A;  5DW8 A;  4PFR A;  4GX6 A;  4N8Y A;  4QXD A;  1KA0 A;  1DK4 A;  2DVZ A;  2F3B A;  2CEY A;  3PTY A;  4MNC A;  5A5L A;  5ET6 A;  2L5V A;  4I3E A;  2ZZV A;  2FIX A;  2Q8M A;  4P1L A;  4N8G A;  3QMF A;  3SZP A;  1IME A;  4NAP A;  4PAF A;  1LBX A;  5FBP A;  4GWZ A;  4PAI A;  1Q9D A;  2CZI A;  1FPI A;  1FBE A;  4MEV A;  2OX3 A;  1LBZ A;  4OVP A;  4JVC A;  4YIC A;  1FPJ A;  1FSA A;  3FBP A;  3LUZ A;  1NV2 A;  1AWB A;  3MYU A;  4M1V A;  4P47 A;  4FBP A;  4O7I A;  3RPL A;  1K9Y A;  3D1R A;  1FJ6 A;  3W9V A;  1FPB A;  4N15 A;  2OWZ A;  4PE3 A;  1IMF A;  4P8B A;  2WYK A;  4MNI A;  4JVI A;  4N17 A;  4PGN A;  1IMB A;  4KXP A;  1FRP A;  4PC9 A;  4G61 A;  1LBV A;  3B8B A;  1YYZ A;  2PCR A;  4OA4 A;  5LDZ A;  4MJO A;  5IGA A;  1NUW A;  1NUY A;  4MNP A;  4OVR A;  4GWS A;  5F24 A;  4OVT A;  1VDW A;  4PTK A;  2HZK A;  2QVU A;  2ZZW A;  4AS5 A;  5ET5 A;  3T0J A;  1NV0 A;  3W9W A;  5ESY A;  1FPK A;  4N91 A;  4LN5 A;  4MHF A;  4GX3 A;  4UAB A;  2BJI A;  2CZH A;  2V4C A;  4DI4 B;  4GWU A;  2HZL A;  1NUZ A;  4GWW A;  4H46 A;  5IZ3 B;  5J1D A;  1FBF A;  1IMA A;  4MCO A;  1RDX A;  2XWO A;  4MAG A;  4P9K A;  3HFU A;  4IR8 A;  2KR0 A;  5IZ1 A;  4HE2 A;  4N4U A;  2QVV A;  1FBD A;  3GYY A;  4PBH A;  4HCW A;  5CM6 A;  4NQ8 A;  4HXV A;  5EQ7 A;  3IFA A;  1BK4 A;  4HE1 A;  2FBP A;  2XWK A;  2XWI A;  1NV3 A;  4X04 A;  2CEX A;  5JK4 A;  4PDH A;  4OVS A;  3KC0 A;  4HCY A;  1QGX A;  1DCU A;  2WBB A;  4PBQ A;  3ROJ A;  3MST A;  2FVZ A;  1FPE A;  4PET A;  4YZZ A;  4OVQ A;  3LV0 A;  5LTC A;  1FPG A;  4GX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...