5ET5A

Human muscle fructose-1,6-bisphosphatase in active r-state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
324
structure length
282
Chain Sequence
TDMLTLTRYVMEELTQLLNSMLTAIKAISSAVRKAVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSIGTIFAIYRSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title T-to-R switch of muscle fructose-1,6-bisphosphatase involves fundamental changes of secondary and quaternary structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 90
structure length 282
sequence length 324
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et5A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et5A02
1LBZA 5ET5A 1FBPA 1BK4A 5LDZA 1KZ8A 2WBBA 1NV4A 3KC1A 5I3SA 1YZ0A 3KC0A 5EYHA 4GX6A 5IZ3A 3RPLA 3IFAA 5IZ3B 2OWZA 3RPLB 1FBGA 2Q74A 5EYGA 1G0HA 2VT5A 1KA0A 4GWZA 2P3NA 2DDKA 4HE1A 2F3DA 4H46A 1LBWA 4GBVA 1EYKA 3KBZA 1FJ6A 1NV7A 2QVVA 5F24A 3BIGA 2BJIA 4I3YA 4GBWA 2QVUA 1FBDA 1FPBA 2WEFA 4GWUA 1IMFA 1FPIA 1FPGA 1NI9A 1QGXA 2WBDA 5EQ9A 1SPIA 1FBFA 5ET7A 5J16A 2FIEA 1VDWA 1K9ZA 4KXPA 5ESYA 4AS4A 2CZHA 5ET6A 4AS5A 1EYJA 1FPLA 1CNQA 2P3VA 4QXDA 3LV0A 4GX4A 1FBEA 1NV3A 1IMCA 2FIXA 2GQ1A 2R8TA 2Y5KA 1FPFA 1LBXA 4GWSA 5FBPA 4I40A 5T3JA 1Q9DA 1YXIA 5EQ7A 3FBPA 2CZKA 4N81A 4FBPA 1EYIA 1DBZA 4O7IA 1LBYA 1K9YA 1FPKA 4H45A 1FBCA 3BIHA 3IFCA 4HE2A 3ROJA 1NV6A 1D9QA 2CZIA 1NUWA 1RDXA 3RYDA 1KA1A 1LEVA 1FPDA 2OX3A 2FBPA 1IMEA 4GWWA 5EQ8A 1FSAA 1YYZA 5EQAA 2JJKA 1FPEA 2QVRA 4GX3A 5IZ1A 1IMAA 2QFLA 1XI6A 4I3EA 1FPJA 5ET8A 2F3BA 4HE0A 4MJOA 1NV5A 4IR8A 1FBHA 1JP4A 1NUZA 5DW8A 1LBVA 4G61A 1RDYA 2FVZA 1INPA 2Q8MA 4GWXA 1FTAA 4GWYA 3D1RA 3A29A 2PCRA 3T0JA 1RDZA 3QMFA 1DCUA 1NV1A 1AWBA 2Y5LA 2FHYA 1DK4A 1NV0A 1NUXA 2HHMA 3LUZA 1NUYA 3B8BA 1G0IA 1IMBA 1FRPA 4PTKA 5A5LA 1NV2A 1IMDA 4HXVA 1FJ9A
chains in the Genus database with same CATH superfamily
3O29A 4FATA 4PAFA 3FASA 1D3KA 3T93B 4F18A 3FATA 5TU0A 3IFAA 5H8SA 1O63A 2O84X 2Z8DA 4MNCA 3RT6B 4GWOA 3TCHA 4MMPA 3FD3A 3IOVA 1PBQA 3MZ1A 1NV7A 1PEBA 2H5YA 4OVPA 4KXPA 1NKXA 2F8DA 1CNQA 4F2QA 4QXDA 1GVCA 4NN3A 5CMBA 3H6WA 1EZOA 2VHAA 3PU5A 2R8TA 3MP8A 4THIA 2PMSA 5FBPA 2ZYMA 2B65A 2F7AA 2ZZXA 2OCUA 3HFUA 4MEVA 1B05A 2ANJA 4OZ9A 3C9HA 3PTYA 1FPKA 3PD9A 3C31A 4KHZE 1QJMA 2PYYA 1KA1A 4U23A 3UK4A 3FVGA 1B3HA 3G3HA 2JJKA 1I6AA 1M5CA 3RN8A 3CFXA 4AQ4A 2H98A 1B0HA 1NV5A 1CE2A 2ZMBA 2ZYOA 3ILTB 5I84A 4QFLA 4P8BA 1S9TA 2DWAA 4RXLA 2FNCA 3LSXA 2DXRA 3PUZE 2AYSA 1HSLA 1IMBA 1IMDA 2F97A 4FEBA 3O9PA 1ZTYA 4OETA 3IOWA 4NG7A 3VDFA 1NH7A 3BFUA 2OZZA 4ND9A 4PGPA 1PB8A 3KJ7A 4N6DA 1EYKA 3KBZA 4GOTA 4NF6B 3C33A 1J1NA 4OQOA 2MKZA 5CI5A 4RPOA 3FXQA 3TELA 1B7ZA 2RC8A 2Z22A 4QFNA 1DPEA 4IO3A 4AS4A 2OBGA 3LUYA 5K2YA 4YAHX 3LV0A 5DT6A 5I59B 5AE4A 1ELJA 3GBBA 2NOOA 4OYVA 1B5JA 4GWSA 1I69A 4GF8A 4WEPA 1LB9A 2PBWA 1QULA 3M3LA 4ZEKA 4FORA 5KCJB 2I3WA 4OHNA 3IFCA 5JTYB 2CZIA 1NUWA 3V83A 3RYDA 1LEVA 1FQAA 4JWYA 4C1TA 1SVXB 3K0VA 2RINA 2ZNSA 3DP6A 1FBHA 3H6VA 3B6WA 5FTHA 4G68C 4R6HA 1LGBC 2ZYNA 3SDFA 1N7WA 4O3BA 4PFYA 2ESNA 1NNFA 4ELOA 4PBHA 3VE1B 2XXIA 3VXCA 3MPLA 2V3UA 4R72A 1NUYA 1G0IA 5CMCA 3TUSA 3PUWE 1A8FA 2XXXA 5ET5A 3T9VA 1S50A 4DCYA 3Q26A 1NMUA 3DLNA 1ZLQA 4GLIA 1G0HA 4BDNA 3ONMA 2XHDA 4DI3D 2QL3A 2D3IA 2DQVA 3L6HA 4X1DA 3C4MA 2ALUA 4GBVA 1FJ6A 2PFYA 2H99A 4PC9A 4GD5A 2XXVA 1B3LA 1K9ZA 3S4UA 4P56A 2V3QA 4DXBA 4XFEA 2P3VA 3RTWB 4F31B 5HBCA 5F7VA 3DP4A 4YICA 1ZMGA 2F34A 3RT8A 3FBPA 4NAPA 1B52A 3IX1A 1DTZA 4QRZA 4NE4A 2ONRA 2D21A 4XKRA 2B4LA 3RGYA 4NWDA 4NWCA 1QKAA 1FSAA 5DEXA 3UORA 2X26A 4H65A 2I3VA 3K1NA 1LFGA 5CMMA 4LVQA 4LN5A 1MXWA 1R9QA 3SESA 4UACA 3PUVE 3W9VA 1H44A 1VFEA 1RDZA 4GRKA 4IY6A 1OLAA 5K2XA 3FXRA 4DIGA 3KSJA 2XD2A 4P0GA 1BP5A 4L17A 1BK4A 5BUUA 3H6UA 1YCJA 1JQFA 5ISUA 5IZ3A 5H8NA 1Z7ME 4RY1A 1UTHB 1UTBA 4OVJA 3SEYA 4H8IA 2RC9A 1AL3A 1FTLA 1P1OA 1RYXA 3MJNA 1FBDA 2ZNTA 3CFLA 2UVIA 2F36A 1SPIA 1FBFA 2H25A 4LA9A 3RNNA 4I8CA 2BJJX 1OVTA 1N3WA 1JNFA 5L9SA 2RF1A 4X8RA 3B6TA 4KCCA 4XIGQ 2I0BA 4ZECA 3S9MC 3CG1A 4NMYA 1PB7A 4YMAA 2DWIA 1P1QA 1B51A 1DMBA 4G68B 2ONKE 1IUDA 1MXYA 3C35A 4IO6A 3GXAA 4HCWA 2REGA 1A8EA 4RPNA 1JW4A 1FQDA 3TQLA 3C36A 1FCKA 3PPNA 3LSLA 1CB6A 3A09A 3OD7A 2VD3A 4MHFA 2GFEA 4DLDA 4GWXA 2CZLA 4XKPA 1A7LA 3T0JA 2X7QA 4NF8B 2G29A 3OSRA 2O69A 1D9VA 3B8BA 4ISUA 4GFRA 3MC2A 4QSEA 2HXWA 3PPQA 1LAFE 3U94A 4YU0A 3MUQA 3KOSA 5IGAA 3M3FA 1I6QA 3RPLA 1FW0A 3CSGA 1MH4A 3UGWA 5I2KA 3FGSA 1AMFA 1Y1MA 1SDXA 3IB1A 2CEYA 1MDQA 2RKMA 1FPIA 1P1WA 3FUZA 4R75A 3U1OA 2I58A 2OLBA 1EYJA 4R6YA 4GX4A 3OEMA 5EHMA 5ITPA 1NV3A 1AOVA 4Q5TA 1B1HA 4F39A 4YKIA 4QFOA 5IZZA 1OVBA 1LBBA 1BKAA 1Y4CA 1LBYA 3MVXA 1ANFA 4PCDA 1D9YA 4KQPA 3ROJA 3IL1B 1MY0A 2L5VA 2XXRA 2OX3A 3QXMA 2FYIA 1B9JA 5EQAA 4R9FA 4RYAA 4POWA 4F22A 1A40A 2HAVA 4Z0IA 1POY1 1MY3A 3VVFA 1FQCA 1MDP1 3GYYA 2M8CA 2PCRA 3TYHA 3UIFA 4ECFA 4NF4B 3K01A 1URSA 3U65A 4O8MA 2R9JA 4RNSA 1NNPA 3THIA 1QUIA 1MXUA 3O66A 4G77A 5CBRA 1NL5A 5A5LA 4PFRA 3O6GA 4LQ2A 1IXGA 1Y1ZA 3IO6A 2XXQA 4WEDA 5I3SA 3T9XB 3MW0A 3TKDA 2O68A 5ITOA 4JDFA 2OWZA 4PDDA 1A55A 4F3GA 4GXSB 4F1VA 3B6QA 2AL5A 4E0XA 4U21A 2VOZA 2V93A 3U93A 4XEQA 4OESA 4P3LA 4ELPA 2NWJA 4ELRA 4BDLA 3EHSA 1MPCA 1SBPA 1UIVA 4I62A 1US5A 1FPLA 3O2AA 3V89B 3TTNA 4LZ8A 3S9NC 4ZDMA 1N84A 1GR2A 1R1NA 2XXKA 3GBAA 3RTFB 4ZEBA 3WAEA 4FIMA 3G3IA 2RCBA 4ZE9A 1GTKA 2A5TA 1RDXA 1ZKBA 2YJPA 2LAOA 2P2AA 3DP8A 3AXFA 4N13A 1IMAA 2QFLA 5J1DA 4KCDA 4U1ZA 3EKIA 2DWHA 1LAGE 4LONB 4GVOA 2Q89A 2DE2A 2HFBA 5TP9A 3C34A 4U4XA 1JEVA 3FXUA 1MQIA 5A5XA 4X48A 3N5LA 2I49A 4BLAA 1NV1A 1BLFA 1MG1A 1VR5A 1XT8A 3FJ7A 4RJZA 2FHYA 3OENA 2HHMA 2DVZA 3H03A 3Q28A 2W7YA 3MVZA 1RYOA 1US4A 1POTA 4PFUA 3K1PA 5LDZA 2XX7A 4N17A 4QSDA 4XXUA 5I57B 3PUXE 1B4HA 3PMVA 2PX1A 5L8DA 5EYGA 1SD3A 4Q30B 4G2ZA 1H76A 3IB0A 3KGCA 1SW2A 5CM6A 1SW5A 3VLWA 3E3KA 4OERA 2QMXA 4OANA 2VPNA 1ZBMA 4N6PA 5JEIA 1JW5A 3K4UA 1GGGA 4AS5A 4WKMA 5DVJA 3MPKA 3FJGA 2QJEA 4OVTA 2XXHA 3A3CA 2XXTA 3H3GA 5FHOA 4N81A 1EYIA 1ZU0A 3PPOA 1SQYA 5B7DA 1A54A 3MWBA 1RKMA 3BFTA 1SW1A 4MIJA 5CBSA 1O7TA 4F1YA 5L9OA 5ICQA 4PBQA 2FBPA 1MS7A 4N8YA 4MBPA 4GWWA 1LAXA 3UN6A 4YKJA 1XC1A 5ET8A 2F6PA 4N4UA 1LBVA 4G61A 4ELQA 1QVSA 4FJPA 4P47A 1LCFA 2DOJA 4IGRA 3FXBA 1NV0A 3LUZA 2ZXTA 3DM0A 1FRPA 3O6IA 4PTKA 1B1XA 3IK6B 4JB7A 1FBPA 5DVFA 1II5A 1MH3A 2WYPA 4NEDA 1XS5A 3RQTA 4TOZA 1B7HA 4OEUA 1EU8A 3IJOB 4R74A 2ONSA 4H46A 2OWTA 2QS2A 3SEUA 3CVGA 5H8HA 3I5OA 1MXVA 1B3FA 1L5TA 4NF5A 2DYXA 5JTYA 3T9HB 5ET6A 4YMBA 4ONYA 1B3EA 4Z7EA 3L6GA 4HTGA 1Y4TA 4OMBA 5AA1A 1LCTA 3G3JA 2UVJA 4FE8A 1XHYA 1P1NA 4LZ5A 3CRBA 4KYEA 2ZNUA 4JVIA 2CMOA 3MVWA 1D9QA 3TCFA 1Y20A 4LQ5A 1Q35A 3PD8A 1TT1A 2OWSA 3I6VA 5I56A 3H6TA 1MY1A 3C32A 5DEXB 2NVUB 2Y7WA 2DE4A 4MJOA 1B7UA 2A5SA 4DDDA 1NUZA 1RDYA 4P1EA 1T0KA 1MQHA 2XD3A 4GWYA 2V3TA 3KFMA 2KLFA 1MXXA 1B5IA 3VXBA 2I0CA 1O64A 1NUXA 3ISPA 5AA2A 3CSBA 3UA8A 4IO4A 4PGNA 1H3DA 3G3KA 4F3PA 2O6AA 2V4CA 3E13X 3PGFA 3WAFA 2HEUA 1MPDA 4OFLA 3CFZA 5I58A 5CMKA 4YZZA 4EXLA 5BWJA 2WX9A 4YKKA 1ZJLA 3TZAA 5IZ3B 2Q74A 4JBZA 5H8NB 1HSEA 4DCXA 3K6WA 4QFPA 4P0IA 3MBPA 1UTBB 1IZ1A 4OVRA 2HCAA 4G8NA 5F24A 1MY4A 2GH9A 4FEDA 3ZSFA 1IMFA 5EQ9A 2AIXA 1ZIUA 1N76A 3IOTA 4XF5A 1PDAA 4LZ7A 1UIUA 4QF9A 1QUKA 4R2FA 4MLQA 2QS4A 4OTEA 2DXYA 3VV5A 4OENA 2Y7PA 1VFDA 1ATGA 1BTJA 1Y3QA 3TTKA 4BDOA 4HE2A 3W9WA 1NV6A 5F1QA 4MCOA 2XWIA 4KFQA 5DTBA 3E4RA 3TODA 3HCQA 3ILUB 3W15C 2Q2AA 4H0WA 1B3GA 3TAJA 5TPAA 4AB5A 5ELVA 4F1UA 3TCGA 2I6EA 2KQZA 2Y7IA 4ESWA 5DVIA 3TEPA 3LBSA 1SW4A 3H06B 1OLCA 2V84A 2GHAA 4JSDA 4NTLA 3KJTA 3HHGA 1XVXA 4F3BA 1F9BA 3RPLB 1D4NA 4N8GA 1OMPA 3LR1A 4KD5A 4BDMA 3SEVA 3OO7A 4H8JA 1QW0A 3O28A 3QAXA 2QVVA 2QSXA 3QK6A 4GBWA 4ZE8A 3KN7A 1FQFA 3MP6A 5LTCA 4P11A 1QGXA 3PMWA 4MH5A 4KYSA 3TFLA 4TLMB 4BDQA 2NXOA 4G8MA 2AL4A 1P99A 2GRVA 2H9BA 4DI4B 2O1LA 2QS1A 1YXIA 3JZJA 1KWHA 4NF0A 5KDTA 4KI0E 4FBPA 4MFIA 4OXVA 1DBZA 1MM7A 4UABA 2PT2A 1K9YA 4QSCA 3EF7A 3CR9A 3MAMA 3CHGA 3PV0E 5H8FA 3SEWA 4GIZA 3FVKA 3ZKLA 3MP1A 2QMWA 5EHSA 1UQWA 2VPOA 2Z8EA 3EHTA 3IO4A 3MZBA 2Z8FA 2Q8MA 1JW1A 3OO6A 4MNPA 5HM4B 3R7XA 3PPPA 4R6KA 3IB2A 1JETA 1AIVA 1DCUA 4XKNA 2QRYA 4F2OA 3HPIA 3OOAA 1DPPA 2Q8JA 4F3SA 2D5WA 5M2VA 4HXVA 4PFTA 5HPQA 1I6BA 3KC1A 2F7CA 1LFHA 3K6UA 2CEXA 3HN0A 4GQOA 2QS3A 5JK4A 3CIJA 1VSOA 3LC8A 2UXAA 1LBWA 2I48A 4N91A 3BIGA 3GZGA 4M1VA 3EN3A 1Y3PA 2O7IA 2OK2A 4KPTA 4F19A 1LB8A 4MF3A 4QFKA 3E79A 5AA3A 3MSTA 5AA4A 3P7IA 4OWDA 1FQEA 4POXA 2PFZA 1MM6A 4R73A 4AB6A 2FIXA 4JSOA 2HZLA 1B58A 4Q8RA 5I2NA 2F78A 2CZKA 3OMBA 4MAGA 4UA8A 1XVYA 3V5AA 3N6UA 1USYH 4EUOA 1N0TA 2XX9A 2OPEA 1B6HA 3Q27A 4EQ7A 4JWXA 3ODBA 4R9GA 2A5TB 1M5EA 4G4PA 1JEUA 4DXUA 5IZ1A 3S2VA 1LLSA 3RPWA 2F3BA 1Z7NE 5IKBA 1FTAA 1YAEA 4LP2B 5TP9B 3SETA 4IO2A 5B70A 3K1MA 1OQHA 5A5XB 1DSNA 2DP8A 4G8HA 1URDA 1IXHA 5H8QA 2H4IA 3Q25A 4GL0A 2DWJA 4MX6A 1KZ8A 4OFOA 4PF8A 2R71A 3D4GA 5FHNA 3E9XA 5EYHA 4PE5B 4U22A 1PB9A 3CI8A 2XWOA 1KA0A 1Y3NA 5I7IA 2DDKA 5I5PA 2VGQA 3EQ1A 1FTJA 2Y7KA 2BJIA 1HSJA 1NNTA 1GV8A 3U72A 4NGUA 2ZZWA 1NI9A 5ET7A 3RUMA 3FVNA 3VFJA 4H5GA 4IO7A 2B3BA 1IXCA 3KG2A 1XOCA 1WVJA 2HQ0A 3K6XA 1S7YA 2DE3A 4O7IA 1MRPA 1SYIA 3JV9A 4QBAA 2B4MA 4PETA 2F35A 4H45A 1EZPA 3BIHA 4PAIA 1N04A 1LBCA 3TMGA 3IORA 3QSLA 3QUJA 2QVRA 4F29A 1B40A 4X04A 2RCAA 4HE0A 5I57A 2G93A 2UVHA 3SEXA 4ZZEA 4R2BA 5IM2A 5CC2A 3KBRA 3D1RA 3U92A 3FJMA 3QMFA 2WKYA 4PE3A 4PFWA 4FECA 4OEVA 1FJ9A 2HZKA 3KC0A 4GX6A 1EH3A 3HHFA 1FBGA 3G3FA 1TWYA 4EXKA 4LATA 4OVSA 4DXCA 2VP1A 2P3NA 4OVQA 4NF6A 2OPDA 4KYDA 2XWVA 4I3YA 2QPQA 2DS9A 2QVUA 1FPBA 1B5HA 5H8HB 4TQUQ 1USYE 1OQGA 4NF5B 2XXYA 2XXPA 3SERA 5I59A 4P1LA 1PBPA 4RA1A 5FTIA 2GQ1A 3K6VA 1M5FA 2PT1A 2V25A 1N7XA 1Q1KA 3TPAA 1Q9DA 3G7WA 2I4CA 5KCJA 3TTRA 1SI1A 1B4ZA 3D4CA 2WYKA 1FPDA 3OELA 1B32A 3OO8A 4EQ9A 4GX3A 3LSWA 5I56B 4OFJA 3RLFE 4IR8A 2DSFA 5DW8A 1A99A 1YPNA 1WODA 4RK2A 4LUBA 1VE4A 3NOHA 3O97A 4XTCQ 4C0RA 2XX8A 4P9KA 3KN3A 2Y84A 4YB7A 3FV2A 2THIA 3BBRA 5AA2B 2XA5A 1DOTA 4QHQA 4HS7A 4ZZAA 1LBZA 3KSXA 2KR0A 1NNKA 2WBBA 4BDRA 1LSTA 1YZ0A 1QKBA 4EDPA 1MPBA 3RY3A 5I58B 4M4GA 1H43A 1FTOA 1IIWA 1B2HA 3HSTA 4IO5A 4OA4A 4ZEFA 4PF6A 3CG3A 2F3DA 3KEIA 3IR1A 1H45A 3K02A 1SYHA 2Q2CA 3UP9A 4GWUA 4IGTA 3H4ZA 2WBDA 3KOTA 1BIYA 5J16A 2FIEA 5ESYA 3KN8A 2E1SA 4E0WA 3N6TA 3IAZA 2UVGA 3E78A 2E0SA 2P0SA 3OEKA 1NFTA 1LBXA 2IEEA 4K3FA 3DELB 3OO9A 3HV1A 4FAJA 3MZ9A 3FZVA 3FV1A 3QIMA 3S9LC 1AH5A 3IOUA 3TQWA 5L9MA 4O7MA 4PDHA 2O1MA 3VVDA 4O3CA 3N94A 3M8UA 1LAHE 3B50A 4JWOA 3T66A 1R9LA 4NX1A 3TTLA 1JP4A 2VD2A 4JVDA 3A29A 5TPAB 1SI0A 1DTGA 3A3UA 2OJTA 2R6GE 5DYHA 2UYFA 2UYEA 4U1OA 4JVCA 1NV2A 4EF1A 3HO7A 4H6DA 3OSQA 1NV4A 2NUVA 3FIRA 3MVYA 4HW8A 2VT5A 1UTHA 1YTVA 4GWZA 2F6GA 1M5BA 4X9TA 4YB5A 3JYRA 2I4BA 5KZTA 4HE1A 4C1UA 4GXAA 1FTMA 2GHBA 1LFIA 4IB2A 2WEFA 5EYFA 1FPGA 5ICTA 1MQJA 4PAKA 1FQBA 2CZHA 2ZYKA 4DE8A 1MXZA 3G3GA 2YPNA 2FA7A 1IMCA 1FPFA 1R6ZA 3BKIB 1TXFA 4I40A 4NHBA 1QUJA 4TLLB 4MNIA 1MQDA 4H1XA 5EQ7A 3R26A 5I2KB 4YKPA 2XWKA 5KDTB 3ZKKA 3F11A 4G68A 1B46A 4I1DA 1FBCA 3ZS6A 3KZGA 1MY2A 5FHMA 4PFIA 1TFAA 3PUYE 1B0LA 3SZPA 1IEJA 2HPGA 3PPRA 3T22A 5H8FB 5EQ8A 4PFBA 3S9EA 2HAUA 1FPEA 2IA4A 3H7MA 1XI6A 1FPJA 3U8QA 2REJA 3MQ9A 5LOMA 1INPA 3VLUA 4NF8A 4Q0CA 3VLVA 4XKQA 3T96B 2HXRA 4HCYA 1JVYA 2O7UA 3EPEA 3TDJA 1Y9UA 4PP0A 1N3XA 3GLBA 2ZZVA 2ABHA 4JXIA 3K2DA 3R6UA 4MLVA 4IY5A 3PMXA 3IJXB 3T1BA 3M3KA 3T9UA 1TFDA 2YLNA 1EZ9A 3EHUA 1NH8A 4N6KA 2O51A 1IXIA 2XXUA 4N15A 3O6HA 1IITA 4KR5A 4I9DA 2Q9TA 2P1SA 3FVOA 3MYUA 1VDWA 3Q29A 4RK9A 3USDA 5AA2D 1WDNA 5AA4B 1FBEA 2DVCA 5IAIA 2X7PA 2Y7RA 4PQJA 4WXJA 1MQGA 2Y5KA 1PC3A 3LSFB 4ZEDA 4O3AA 4YB6A 1IQ7A 5T3JA 2RC7A 1URGA 4X1BA 5I2NB 4H5FA 3V8XB 4GL8A 4O94A 3N26A 4ESXA 2XXWA 3VVEA 5CRYA 4N07A 4ZS9A 4H67A 3QUFA 4DZ1A 3B7DA 4NQ8A 2F7BA 1IMEA 4ZEIA 3K00A 1YYZA 4I3EA 2Q88A 4U2RA 3I3VA 2PVUA 1M5DA 2FVZA 4NF4A 4EF2A 4EQBA 2B3FA 1AWBA 2Y5LA 1JVXA 1FTKA 1DK4A 3TTMA 3SKPA 2F5XA 1P1UA 2Z23A 3OXNA 4U4SA 3ECRA 3QYTA 5H8QB 1OIBA
chains in the Genus database with same CATH topology
2V4CA 2HZKA 4PAFA 3KC0A 5IGAA 4YZZA 4GX6A 4F18A 3RPLA 2WX9A 3IFAA 5IZ3B 1FBGA 2Q74A 4OVSA 4MNCA 2P3NA 4MMPA 4OVQA 4OVRA 1NV7A 5F24A 2XWVA 4I3YA 2QPQA 2QVUA 1FPBA 2CEYA 1IMFA 1FPIA 5EQ9A 4OVPA 4KXPA 4XF5A 1EYJA 1CNQA 4QXDA 4GX4A 4P1LA 4NN3A 1NV3A 2GQ1A 2R8TA 5FBPA 2ZZXA 1Q9DA 5IZZA 3HFUA 4MEVA 1LBYA 3PTYA 1FPKA 4PCDA 4HE2A 3W9WA 3ROJA 1NV6A 4MCOA 2XWIA 2L5VA 1KA1A 2WYKA 1FPDA 2OX3A 5EQAA 2JJKA 4GX3A 1NV5A 4IR8A 5DW8A 4P8BA 3GYYA 2PCRA 3NOHA 4F1UA 3U65A 4P9KA 4O8MA 2KQZA 1IMBA 5A5LA 2XA5A 1IMDA 4PFRA 1LBZA 2KR0A 2WBBA 5I3SA 1YZ0A 4NG7A 2OWZA 3RPLB 4N8GA 4PDDA 4OA4A 4F1VA 4PF6A 2F3DA 4PGPA 4N6DA 1EYKA 3KBZA 2QVVA 4GBWA 2MKZA 5LTCA 4XEQA 4GWUA 4P3LA 1QGXA 2WBDA 5J16A 2FIEA 5ESYA 4AS4A 3E78A 1FPLA 3LV0A 1LBXA 4DI4B 4GWSA 2XXKA 1YXIA 4NF0A 4FBPA 1DBZA 4UABA 1K9YA 3IFCA 4O7MA 4PDHA 2CZIA 1NUWA 3CHGA 1RDXA 3RYDA 1LEVA 3B50A 1IMAA 2QFLA 5J1DA 4NX1A 2VPOA 1FBHA 1JP4A 3EKIA 2Q8MA 2DE2A 4JVDA 4MNPA 3A29A 1DCUA 1NV1A 4PBHA 2FHYA 2HHMA 2DVZA 1NUYA 4JVCA 1G0IA 1NV2A 4HXVA 5ET5A 5LDZA 1NV4A 3KC1A 4N17A 2CEXA 5EYGA 1G0HA 2VT5A 4GWZA 5JK4A 4DI3D 4X9TA 5CM6A 4HE1A 1LBWA 4GBVA 1FJ6A 4N91A 3BIGA 2PFYA 4PC9A 4M1VA 4OANA 2VPNA 2WEFA 1FPGA 4PAKA 4F19A 1K9ZA 2CZHA 3E79A 3MSTA 4P56A 4AS5A 2V3QA 4XFEA 2P3VA 2PFZA 4OVTA 1IMCA 2FIXA 1FPFA 2HZLA 4I40A 4NHBA 4YICA 4MNIA 5EQ7A 3FBPA 4NAPA 2CZKA 4MAGA 4N81A 1EYIA 2XWKA 1FBCA 4MIJA 4PFIA 2B4LA 4PBQA 2FBPA 3SZPA 4N8YA 2HPGA 4GWWA 5EQ8A 1FSAA 4PFBA 1FPEA 5IZ1A 1XI6A 1FPJA 5ET8A 2F3BA 4N4UA 4LN5A 1LBVA 4G61A 3W9VA 1INPA 1FTAA 1RDZA 4P47A 3FXBA 2HXRA 4HCYA 1NV0A 3LUZA 1FRPA 4PTKA 4MX6A 2ZZVA 1FBPA 1BK4A 1KZ8A 4PF8A 2WYPA 5EYHA 5IZ3A 2XWOA 1KA0A 3T1BA 5I7IA 2DDKA 5I5PA 4H46A 2BJIA 4N6KA 1FBDA 4N15A 4NGUA 2ZZWA 1NI9A 1SPIA 2Q9TA 1FBFA 5ET7A 3MYUA 1VDWA 5ET6A 1FBEA 4X8RA 2Y5KA 5T3JA 2DE3A 4O7IA 4QBAA 2B4MA 4PETA 4H45A 4O94A 4JVIA 3BIHA 4PAIA 1D9QA 4NQ8A 1IMEA 4HCWA 1YYZA 2QVRA 4I3EA 4X04A 2DE4A 4HE0A 4MJOA 1NUZA 4MHFA 1RDYA 2FVZA 4P1EA 5IM2A 4GWXA 4GWYA 3D1RA 3T0JA 3QMFA 4PE3A 1AWBA 2Y5LA 1DK4A 1NUXA 3ISPA 2F5XA 3B8BA 4PGNA 1FJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBZ A;  5ET5 A;  1FBP A;  1BK4 A;  5LDZ A;  1KZ8 A;  2WBB A;  1NV4 A;  3KC1 A;  5I3S A;  1YZ0 A;  3KC0 A;  5EYH A;  4GX6 A;  5IZ3 A;  3RPL A;  3IFA A;  5IZ3 B;  2OWZ A;  3RPL B;  1FBG A;  2Q74 A;  5EYG A;  1G0H A;  2VT5 A;  1KA0 A;  4GWZ A;  2P3N A;  2DDK A;  4HE1 A;  2F3D A;  4H46 A;  1LBW A;  4GBV A;  1EYK A;  3KBZ A;  1FJ6 A;  1NV7 A;  2QVV A;  5F24 A;  3BIG A;  2BJI A;  4I3Y A;  4GBW A;  2QVU A;  1FBD A;  1FPB A;  2WEF A;  4GWU A;  1IMF A;  1FPI A;  1FPG A;  1NI9 A;  1QGX A;  2WBD A;  5EQ9 A;  1SPI A;  1FBF A;  5ET7 A;  5J16 A;  2FIE A;  1VDW A;  1K9Z A;  4KXP A;  5ESY A;  4AS4 A;  2CZH A;  5ET6 A;  4AS5 A;  1EYJ A;  1FPL A;  1CNQ A;  2P3V A;  4QXD A;  3LV0 A;  4GX4 A;  1FBE A;  1NV3 A;  1IMC A;  2FIX A;  2GQ1 A;  2R8T A;  2Y5K A;  1FPF A;  1LBX A;  4GWS A;  5FBP A;  4I40 A;  5T3J A;  1Q9D A;  1YXI A;  5EQ7 A;  3FBP A;  2CZK A;  4N81 A;  4FBP A;  1EYI A;  1DBZ A;  4O7I A;  1LBY A;  1K9Y A;  1FPK A;  4H45 A;  1FBC A;  3BIH A;  3IFC A;  4HE2 A;  3ROJ A;  1NV6 A;  1D9Q A;  2CZI A;  1NUW A;  1RDX A;  3RYD A;  1KA1 A;  1LEV A;  1FPD A;  2OX3 A;  2FBP A;  1IME A;  4GWW A;  5EQ8 A;  1FSA A;  1YYZ A;  5EQA A;  2JJK A;  1FPE A;  2QVR A;  4GX3 A;  5IZ1 A;  1IMA A;  2QFL A;  1XI6 A;  4I3E A;  1FPJ A;  5ET8 A;  2F3B A;  4HE0 A;  4MJO A;  1NV5 A;  4IR8 A;  1FBH A;  1JP4 A;  1NUZ A;  5DW8 A;  1LBV A;  4G61 A;  1RDY A;  2FVZ A;  1INP A;  2Q8M A;  4GWX A;  1FTA A;  4GWY A;  3D1R A;  3A29 A;  2PCR A;  3T0J A;  1RDZ A;  3QMF A;  1DCU A;  1NV1 A;  1AWB A;  2Y5L A;  2FHY A;  1DK4 A;  1NV0 A;  1NUX A;  2HHM A;  3LUZ A;  1NUY A;  3B8B A;  1G0I A;  1IMB A;  1FRP A;  4PTK A;  5A5L A;  1NV2 A;  1IMD A;  4HXV A;  1FJ9 A; 
#chains in the Genus database with same CATH topology
 3O29 A;  4FAT A;  4PAF A;  3FAS A;  1D3K A;  3T93 B;  4F18 A;  3FAT A;  5TU0 A;  3IFA A;  5H8S A;  1O63 A;  2O84 X;  2Z8D A;  4MNC A;  3RT6 B;  4GWO A;  3TCH A;  4MMP A;  3FD3 A;  3IOV A;  1PBQ A;  3MZ1 A;  1NV7 A;  1PEB A;  2H5Y A;  4OVP A;  4KXP A;  1NKX A;  2F8D A;  1CNQ A;  4F2Q A;  4QXD A;  1GVC A;  4NN3 A;  5CMB A;  3H6W A;  1EZO A;  2VHA A;  3PU5 A;  2R8T A;  3MP8 A;  4THI A;  2PMS A;  5FBP A;  2ZYM A;  2B65 A;  2F7A A;  2ZZX A;  2OCU A;  3HFU A;  4MEV A;  1B05 A;  2ANJ A;  4OZ9 A;  3C9H A;  3PTY A;  1FPK A;  3PD9 A;  3C31 A;  4KHZ E;  1QJM A;  2PYY A;  1KA1 A;  4U23 A;  3UK4 A;  3FVG A;  1B3H A;  3G3H A;  2JJK A;  1I6A A;  1M5C A;  3RN8 A;  3CFX A;  4AQ4 A;  2H98 A;  1B0H A;  1NV5 A;  1CE2 A;  2ZMB A;  2ZYO A;  3ILT B;  5I84 A;  4QFL A;  4P8B A;  1S9T A;  2DWA A;  4RXL A;  2FNC A;  3LSX A;  2DXR A;  3PUZ E;  2AYS A;  1HSL A;  1IMB A;  1IMD A;  2F97 A;  4FEB A;  3O9P A;  1ZTY A;  4OET A;  3IOW A;  4NG7 A;  3VDF A;  1NH7 A;  3BFU A;  2OZZ A;  4ND9 A;  4PGP A;  1PB8 A;  3KJ7 A;  4N6D A;  1EYK A;  3KBZ A;  4GOT A;  4NF6 B;  3C33 A;  1J1N A;  4OQO A;  2MKZ A;  5CI5 A;  4RPO A;  3FXQ A;  3TEL A;  1B7Z A;  2RC8 A;  2Z22 A;  4QFN A;  1DPE A;  4IO3 A;  4AS4 A;  2OBG A;  3LUY A;  5K2Y A;  4YAH X;  3LV0 A;  5DT6 A;  5I59 B;  5AE4 A;  1ELJ A;  3GBB A;  2NOO A;  4OYV A;  1B5J A;  4GWS A;  1I69 A;  4GF8 A;  4WEP A;  1LB9 A;  2PBW A;  1QUL A;  3M3L A;  4ZEK A;  4FOR A;  5KCJ B;  2I3W A;  4OHN A;  3IFC A;  5JTY B;  2CZI A;  1NUW A;  3V83 A;  3RYD A;  1LEV A;  1FQA A;  4JWY A;  4C1T A;  1SVX B;  3K0V A;  2RIN A;  2ZNS A;  3DP6 A;  1FBH A;  3H6V A;  3B6W A;  5FTH A;  4G68 C;  4R6H A;  1LGB C;  2ZYN A;  3SDF A;  1N7W A;  4O3B A;  4PFY A;  2ESN A;  1NNF A;  4ELO A;  4PBH A;  3VE1 B;  2XXI A;  3VXC A;  3MPL A;  2V3U A;  4R72 A;  1NUY A;  1G0I A;  5CMC A;  3TUS A;  3PUW E;  1A8F A;  2XXX A;  5ET5 A;  3T9V A;  1S50 A;  4DCY A;  3Q26 A;  1NMU A;  3DLN A;  1ZLQ A;  4GLI A;  1G0H A;  4BDN A;  3ONM A;  2XHD A;  4DI3 D;  2QL3 A;  2D3I A;  2DQV A;  3L6H A;  4X1D A;  3C4M A;  2ALU A;  4GBV A;  1FJ6 A;  2PFY A;  2H99 A;  4PC9 A;  4GD5 A;  2XXV A;  1B3L A;  1K9Z A;  3S4U A;  4P56 A;  2V3Q A;  4DXB A;  4XFE A;  2P3V A;  3RTW B;  4F31 B;  5HBC A;  5F7V A;  3DP4 A;  4YIC A;  1ZMG A;  2F34 A;  3RT8 A;  3FBP A;  4NAP A;  1B52 A;  3IX1 A;  1DTZ A;  4QRZ A;  4NE4 A;  2ONR A;  2D21 A;  4XKR A;  2B4L A;  3RGY A;  4NWD A;  4NWC A;  1QKA A;  1FSA A;  5DEX A;  3UOR A;  2X26 A;  4H65 A;  2I3V A;  3K1N A;  1LFG A;  5CMM A;  4LVQ A;  4LN5 A;  1MXW A;  1R9Q A;  3SES A;  4UAC A;  3PUV E;  3W9V A;  1H44 A;  1VFE A;  1RDZ A;  4GRK A;  4IY6 A;  1OLA A;  5K2X A;  3FXR A;  4DIG A;  3KSJ A;  2XD2 A;  4P0G A;  1BP5 A;  4L17 A;  1BK4 A;  5BUU A;  3H6U A;  1YCJ A;  1JQF A;  5ISU A;  5IZ3 A;  5H8N A;  1Z7M E;  4RY1 A;  1UTH B;  1UTB A;  4OVJ A;  3SEY A;  4H8I A;  2RC9 A;  1AL3 A;  1FTL A;  1P1O A;  1RYX A;  3MJN A;  1FBD A;  2ZNT A;  3CFL A;  2UVI A;  2F36 A;  1SPI A;  1FBF A;  2H25 A;  4LA9 A;  3RNN A;  4I8C A;  2BJJ X;  1OVT A;  1N3W A;  1JNF A;  5L9S A;  2RF1 A;  4X8R A;  3B6T A;  4KCC A;  4XIG Q;  2I0B A;  4ZEC A;  3S9M C;  3CG1 A;  4NMY A;  1PB7 A;  4YMA A;  2DWI A;  1P1Q A;  1B51 A;  1DMB A;  4G68 B;  2ONK E;  1IUD A;  1MXY A;  3C35 A;  4IO6 A;  3GXA A;  4HCW A;  2REG A;  1A8E A;  4RPN A;  1JW4 A;  1FQD A;  3TQL A;  3C36 A;  1FCK A;  3PPN A;  3LSL A;  1CB6 A;  3A09 A;  3OD7 A;  2VD3 A;  4MHF A;  2GFE A;  4DLD A;  4GWX A;  2CZL A;  4XKP A;  1A7L A;  3T0J A;  2X7Q A;  4NF8 B;  2G29 A;  3OSR A;  2O69 A;  1D9V A;  3B8B A;  4ISU A;  4GFR A;  3MC2 A;  4QSE A;  2HXW A;  3PPQ A;  1LAF E;  3U94 A;  4YU0 A;  3MUQ A;  3KOS A;  5IGA A;  3M3F A;  1I6Q A;  3RPL A;  1FW0 A;  3CSG A;  1MH4 A;  3UGW A;  5I2K A;  3FGS A;  1AMF A;  1Y1M A;  1SDX A;  3IB1 A;  2CEY A;  1MDQ A;  2RKM A;  1FPI A;  1P1W A;  3FUZ A;  4R75 A;  3U1O A;  2I58 A;  2OLB A;  1EYJ A;  4R6Y A;  4GX4 A;  3OEM A;  5EHM A;  5ITP A;  1NV3 A;  1AOV A;  4Q5T A;  1B1H A;  4F39 A;  4YKI A;  4QFO A;  5IZZ A;  1OVB A;  1LBB A;  1BKA A;  1Y4C A;  1LBY A;  3MVX A;  1ANF A;  4PCD A;  1D9Y A;  4KQP A;  3ROJ A;  3IL1 B;  1MY0 A;  2L5V A;  2XXR A;  2OX3 A;  3QXM A;  2FYI A;  1B9J A;  5EQA A;  4R9F A;  4RYA A;  4POW A;  4F22 A;  1A40 A;  2HAV A;  4Z0I A;  1POY 1;  1MY3 A;  3VVF A;  1FQC A;  1MDP 1;  3GYY A;  2M8C A;  2PCR A;  3TYH A;  3UIF A;  4ECF A;  4NF4 B;  3K01 A;  1URS A;  3U65 A;  4O8M A;  2R9J A;  4RNS A;  1NNP A;  3THI A;  1QUI A;  1MXU A;  3O66 A;  4G77 A;  5CBR A;  1NL5 A;  5A5L A;  4PFR A;  3O6G A;  4LQ2 A;  1IXG A;  1Y1Z A;  3IO6 A;  2XXQ A;  4WED A;  5I3S A;  3T9X B;  3MW0 A;  3TKD A;  2O68 A;  5ITO A;  4JDF A;  2OWZ A;  4PDD A;  1A55 A;  4F3G A;  4GXS B;  4F1V A;  3B6Q A;  2AL5 A;  4E0X A;  4U21 A;  2VOZ A;  2V93 A;  3U93 A;  4XEQ A;  4OES A;  4P3L A;  4ELP A;  2NWJ A;  4ELR A;  4BDL A;  3EHS A;  1MPC A;  1SBP A;  1UIV A;  4I62 A;  1US5 A;  1FPL A;  3O2A A;  3V89 B;  3TTN A;  4LZ8 A;  3S9N C;  4ZDM A;  1N84 A;  1GR2 A;  1R1N A;  2XXK A;  3GBA A;  3RTF B;  4ZEB A;  3WAE A;  4FIM A;  3G3I A;  2RCB A;  4ZE9 A;  1GTK A;  2A5T A;  1RDX A;  1ZKB A;  2YJP A;  2LAO A;  2P2A A;  3DP8 A;  3AXF A;  4N13 A;  1IMA A;  2QFL A;  5J1D A;  4KCD A;  4U1Z A;  3EKI A;  2DWH A;  1LAG E;  4LON B;  4GVO A;  2Q89 A;  2DE2 A;  2HFB A;  5TP9 A;  3C34 A;  4U4X A;  1JEV A;  3FXU A;  1MQI A;  5A5X A;  4X48 A;  3N5L A;  2I49 A;  4BLA A;  1NV1 A;  1BLF A;  1MG1 A;  1VR5 A;  1XT8 A;  3FJ7 A;  4RJZ A;  2FHY A;  3OEN A;  2HHM A;  2DVZ A;  3H03 A;  3Q28 A;  2W7Y A;  3MVZ A;  1RYO A;  1US4 A;  1POT A;  4PFU A;  3K1P A;  5LDZ A;  2XX7 A;  4N17 A;  4QSD A;  4XXU A;  5I57 B;  3PUX E;  1B4H A;  3PMV A;  2PX1 A;  5L8D A;  5EYG A;  1SD3 A;  4Q30 B;  4G2Z A;  1H76 A;  3IB0 A;  3KGC A;  1SW2 A;  5CM6 A;  1SW5 A;  3VLW A;  3E3K A;  4OER A;  2QMX A;  4OAN A;  2VPN A;  1ZBM A;  4N6P A;  5JEI A;  1JW5 A;  3K4U A;  1GGG A;  4AS5 A;  4WKM A;  5DVJ A;  3MPK A;  3FJG A;  2QJE A;  4OVT A;  2XXH A;  3A3C A;  2XXT A;  3H3G A;  5FHO A;  4N81 A;  1EYI A;  1ZU0 A;  3PPO A;  1SQY A;  5B7D A;  1A54 A;  3MWB A;  1RKM A;  3BFT A;  1SW1 A;  4MIJ A;  5CBS A;  1O7T A;  4F1Y A;  5L9O A;  5ICQ A;  4PBQ A;  2FBP A;  1MS7 A;  4N8Y A;  4MBP A;  4GWW A;  1LAX A;  3UN6 A;  4YKJ A;  1XC1 A;  5ET8 A;  2F6P A;  4N4U A;  1LBV A;  4G61 A;  4ELQ A;  1QVS A;  4FJP A;  4P47 A;  1LCF A;  2DOJ A;  4IGR A;  3FXB A;  1NV0 A;  3LUZ A;  2ZXT A;  3DM0 A;  1FRP A;  3O6I A;  4PTK A;  1B1X A;  3IK6 B;  4JB7 A;  1FBP A;  5DVF A;  1II5 A;  1MH3 A;  2WYP A;  4NED A;  1XS5 A;  3RQT A;  4TOZ A;  1B7H A;  4OEU A;  1EU8 A;  3IJO B;  4R74 A;  2ONS A;  4H46 A;  2OWT A;  2QS2 A;  3SEU A;  3CVG A;  5H8H A;  3I5O A;  1MXV A;  1B3F A;  1L5T A;  4NF5 A;  2DYX A;  5JTY A;  3T9H B;  5ET6 A;  4YMB A;  4ONY A;  1B3E A;  4Z7E A;  3L6G A;  4HTG A;  1Y4T A;  4OMB A;  5AA1 A;  1LCT A;  3G3J A;  2UVJ A;  4FE8 A;  1XHY A;  1P1N A;  4LZ5 A;  3CRB A;  4KYE A;  2ZNU A;  4JVI A;  2CMO A;  3MVW A;  1D9Q A;  3TCF A;  1Y20 A;  4LQ5 A;  1Q35 A;  3PD8 A;  1TT1 A;  2OWS A;  3I6V A;  5I56 A;  3H6T A;  1MY1 A;  3C32 A;  5DEX B;  2NVU B;  2Y7W A;  2DE4 A;  4MJO A;  1B7U A;  2A5S A;  4DDD A;  1NUZ A;  1RDY A;  4P1E A;  1T0K A;  1MQH A;  2XD3 A;  4GWY A;  2V3T A;  3KFM A;  2KLF A;  1MXX A;  1B5I A;  3VXB A;  2I0C A;  1O64 A;  1NUX A;  3ISP A;  5AA2 A;  3CSB A;  3UA8 A;  4IO4 A;  4PGN A;  1H3D A;  3G3K A;  4F3P A;  2O6A A;  2V4C A;  3E13 X;  3PGF A;  3WAF A;  2HEU A;  1MPD A;  4OFL A;  3CFZ A;  5I58 A;  5CMK A;  4YZZ A;  4EXL A;  5BWJ A;  2WX9 A;  4YKK A;  1ZJL A;  3TZA A;  5IZ3 B;  2Q74 A;  4JBZ A;  5H8N B;  1HSE A;  4DCX A;  3K6W A;  4QFP A;  4P0I A;  3MBP A;  1UTB B;  1IZ1 A;  4OVR A;  2HCA A;  4G8N A;  5F24 A;  1MY4 A;  2GH9 A;  4FED A;  3ZSF A;  1IMF A;  5EQ9 A;  2AIX A;  1ZIU A;  1N76 A;  3IOT A;  4XF5 A;  1PDA A;  4LZ7 A;  1UIU A;  4QF9 A;  1QUK A;  4R2F A;  4MLQ A;  2QS4 A;  4OTE A;  2DXY A;  3VV5 A;  4OEN A;  2Y7P A;  1VFD A;  1ATG A;  1BTJ A;  1Y3Q A;  3TTK A;  4BDO A;  4HE2 A;  3W9W A;  1NV6 A;  5F1Q A;  4MCO A;  2XWI A;  4KFQ A;  5DTB A;  3E4R A;  3TOD A;  3HCQ A;  3ILU B;  3W15 C;  2Q2A A;  4H0W A;  1B3G A;  3TAJ A;  5TPA A;  4AB5 A;  5ELV A;  4F1U A;  3TCG A;  2I6E A;  2KQZ A;  2Y7I A;  4ESW A;  5DVI A;  3TEP A;  3LBS A;  1SW4 A;  3H06 B;  1OLC A;  2V84 A;  2GHA A;  4JSD A;  4NTL A;  3KJT A;  3HHG A;  1XVX A;  4F3B A;  1F9B A;  3RPL B;  1D4N A;  4N8G A;  1OMP A;  3LR1 A;  4KD5 A;  4BDM A;  3SEV A;  3OO7 A;  4H8J A;  1QW0 A;  3O28 A;  3QAX A;  2QVV A;  2QSX A;  3QK6 A;  4GBW A;  4ZE8 A;  3KN7 A;  1FQF A;  3MP6 A;  5LTC A;  4P11 A;  1QGX A;  3PMW A;  4MH5 A;  4KYS A;  3TFL A;  4TLM B;  4BDQ A;  2NXO A;  4G8M A;  2AL4 A;  1P99 A;  2GRV A;  2H9B A;  4DI4 B;  2O1L A;  2QS1 A;  1YXI A;  3JZJ A;  1KWH A;  4NF0 A;  5KDT A;  4KI0 E;  4FBP A;  4MFI A;  4OXV A;  1DBZ A;  1MM7 A;  4UAB A;  2PT2 A;  1K9Y A;  4QSC A;  3EF7 A;  3CR9 A;  3MAM A;  3CHG A;  3PV0 E;  5H8F A;  3SEW A;  4GIZ A;  3FVK A;  3ZKL A;  3MP1 A;  2QMW A;  5EHS A;  1UQW A;  2VPO A;  2Z8E A;  3EHT A;  3IO4 A;  3MZB A;  2Z8F A;  2Q8M A;  1JW1 A;  3OO6 A;  4MNP A;  5HM4 B;  3R7X A;  3PPP A;  4R6K A;  3IB2 A;  1JET A;  1AIV A;  1DCU A;  4XKN A;  2QRY A;  4F2O A;  3HPI A;  3OOA A;  1DPP A;  2Q8J A;  4F3S A;  2D5W A;  5M2V A;  4HXV A;  4PFT A;  5HPQ A;  1I6B A;  3KC1 A;  2F7C A;  1LFH A;  3K6U A;  2CEX A;  3HN0 A;  4GQO A;  2QS3 A;  5JK4 A;  3CIJ A;  1VSO A;  3LC8 A;  2UXA A;  1LBW A;  2I48 A;  4N91 A;  3BIG A;  3GZG A;  4M1V A;  3EN3 A;  1Y3P A;  2O7I A;  2OK2 A;  4KPT A;  4F19 A;  1LB8 A;  4MF3 A;  4QFK A;  3E79 A;  5AA3 A;  3MST A;  5AA4 A;  3P7I A;  4OWD A;  1FQE A;  4POX A;  2PFZ A;  1MM6 A;  4R73 A;  4AB6 A;  2FIX A;  4JSO A;  2HZL A;  1B58 A;  4Q8R A;  5I2N A;  2F78 A;  2CZK A;  3OMB A;  4MAG A;  4UA8 A;  1XVY A;  3V5A A;  3N6U A;  1USY H;  4EUO A;  1N0T A;  2XX9 A;  2OPE A;  1B6H A;  3Q27 A;  4EQ7 A;  4JWX A;  3ODB A;  4R9G A;  2A5T B;  1M5E A;  4G4P A;  1JEU A;  4DXU A;  5IZ1 A;  3S2V A;  1LLS A;  3RPW A;  2F3B A;  1Z7N E;  5IKB A;  1FTA A;  1YAE A;  4LP2 B;  5TP9 B;  3SET A;  4IO2 A;  5B70 A;  3K1M A;  1OQH A;  5A5X B;  1DSN A;  2DP8 A;  4G8H A;  1URD A;  1IXH A;  5H8Q A;  2H4I A;  3Q25 A;  4GL0 A;  2DWJ A;  4MX6 A;  1KZ8 A;  4OFO A;  4PF8 A;  2R71 A;  3D4G A;  5FHN A;  3E9X A;  5EYH A;  4PE5 B;  4U22 A;  1PB9 A;  3CI8 A;  2XWO A;  1KA0 A;  1Y3N A;  5I7I A;  2DDK A;  5I5P A;  2VGQ A;  3EQ1 A;  1FTJ A;  2Y7K A;  2BJI A;  1HSJ A;  1NNT A;  1GV8 A;  3U72 A;  4NGU A;  2ZZW A;  1NI9 A;  5ET7 A;  3RUM A;  3FVN A;  3VFJ A;  4H5G A;  4IO7 A;  2B3B A;  1IXC A;  3KG2 A;  1XOC A;  1WVJ A;  2HQ0 A;  3K6X A;  1S7Y A;  2DE3 A;  4O7I A;  1MRP A;  1SYI A;  3JV9 A;  4QBA A;  2B4M A;  4PET A;  2F35 A;  4H45 A;  1EZP A;  3BIH A;  4PAI A;  1N04 A;  1LBC A;  3TMG A;  3IOR A;  3QSL A;  3QUJ A;  2QVR A;  4F29 A;  1B40 A;  4X04 A;  2RCA A;  4HE0 A;  5I57 A;  2G93 A;  2UVH A;  3SEX A;  4ZZE A;  4R2B A;  5IM2 A;  5CC2 A;  3KBR A;  3D1R A;  3U92 A;  3FJM A;  3QMF A;  2WKY A;  4PE3 A;  4PFW A;  4FEC A;  4OEV A;  1FJ9 A;  2HZK A;  3KC0 A;  4GX6 A;  1EH3 A;  3HHF A;  1FBG A;  3G3F A;  1TWY A;  4EXK A;  4LAT A;  4OVS A;  4DXC A;  2VP1 A;  2P3N A;  4OVQ A;  4NF6 A;  2OPD A;  4KYD A;  2XWV A;  4I3Y A;  2QPQ A;  2DS9 A;  2QVU A;  1FPB A;  1B5H A;  5H8H B;  4TQU Q;  1USY E;  1OQG A;  4NF5 B;  2XXY A;  2XXP A;  3SER A;  5I59 A;  4P1L A;  1PBP A;  4RA1 A;  5FTI A;  2GQ1 A;  3K6V A;  1M5F A;  2PT1 A;  2V25 A;  1N7X A;  1Q1K A;  3TPA A;  1Q9D A;  3G7W A;  2I4C A;  5KCJ A;  3TTR A;  1SI1 A;  1B4Z A;  3D4C A;  2WYK A;  1FPD A;  3OEL A;  1B32 A;  3OO8 A;  4EQ9 A;  4GX3 A;  3LSW A;  5I56 B;  4OFJ A;  3RLF E;  4IR8 A;  2DSF A;  5DW8 A;  1A99 A;  1YPN A;  1WOD A;  4RK2 A;  4LUB A;  1VE4 A;  3NOH A;  3O97 A;  4XTC Q;  4C0R A;  2XX8 A;  4P9K A;  3KN3 A;  2Y84 A;  4YB7 A;  3FV2 A;  2THI A;  3BBR A;  5AA2 B;  2XA5 A;  1DOT A;  4QHQ A;  4HS7 A;  4ZZA A;  1LBZ A;  3KSX A;  2KR0 A;  1NNK A;  2WBB A;  4BDR A;  1LST A;  1YZ0 A;  1QKB A;  4EDP A;  1MPB A;  3RY3 A;  5I58 B;  4M4G A;  1H43 A;  1FTO A;  1IIW A;  1B2H A;  3HST A;  4IO5 A;  4OA4 A;  4ZEF A;  4PF6 A;  3CG3 A;  2F3D A;  3KEI A;  3IR1 A;  1H45 A;  3K02 A;  1SYH A;  2Q2C A;  3UP9 A;  4GWU A;  4IGT A;  3H4Z A;  2WBD A;  3KOT A;  1BIY A;  5J16 A;  2FIE A;  5ESY A;  3KN8 A;  2E1S A;  4E0W A;  3N6T A;  3IAZ A;  2UVG A;  3E78 A;  2E0S A;  2P0S A;  3OEK A;  1NFT A;  1LBX A;  2IEE A;  4K3F A;  3DEL B;  3OO9 A;  3HV1 A;  4FAJ A;  3MZ9 A;  3FZV A;  3FV1 A;  3QIM A;  3S9L C;  1AH5 A;  3IOU A;  3TQW A;  5L9M A;  4O7M A;  4PDH A;  2O1M A;  3VVD A;  4O3C A;  3N94 A;  3M8U A;  1LAH E;  3B50 A;  4JWO A;  3T66 A;  1R9L A;  4NX1 A;  3TTL A;  1JP4 A;  2VD2 A;  4JVD A;  3A29 A;  5TPA B;  1SI0 A;  1DTG A;  3A3U A;  2OJT A;  2R6G E;  5DYH A;  2UYF A;  2UYE A;  4U1O A;  4JVC A;  1NV2 A;  4EF1 A;  3HO7 A;  4H6D A;  3OSQ A;  1NV4 A;  2NUV A;  3FIR A;  3MVY A;  4HW8 A;  2VT5 A;  1UTH A;  1YTV A;  4GWZ A;  2F6G A;  1M5B A;  4X9T A;  4YB5 A;  3JYR A;  2I4B A;  5KZT A;  4HE1 A;  4C1U A;  4GXA A;  1FTM A;  2GHB A;  1LFI A;  4IB2 A;  2WEF A;  5EYF A;  1FPG A;  5ICT A;  1MQJ A;  4PAK A;  1FQB A;  2CZH A;  2ZYK A;  4DE8 A;  1MXZ A;  3G3G A;  2YPN A;  2FA7 A;  1IMC A;  1FPF A;  1R6Z A;  3BKI B;  1TXF A;  4I40 A;  4NHB A;  1QUJ A;  4TLL B;  4MNI A;  1MQD A;  4H1X A;  5EQ7 A;  3R26 A;  5I2K B;  4YKP A;  2XWK A;  5KDT B;  3ZKK A;  3F11 A;  4G68 A;  1B46 A;  4I1D A;  1FBC A;  3ZS6 A;  3KZG A;  1MY2 A;  5FHM A;  4PFI A;  1TFA A;  3PUY E;  1B0L A;  3SZP A;  1IEJ A;  2HPG A;  3PPR A;  3T22 A;  5H8F B;  5EQ8 A;  4PFB A;  3S9E A;  2HAU A;  1FPE A;  2IA4 A;  3H7M A;  1XI6 A;  1FPJ A;  3U8Q A;  2REJ A;  3MQ9 A;  5LOM A;  1INP A;  3VLU A;  4NF8 A;  4Q0C A;  3VLV A;  4XKQ A;  3T96 B;  2HXR A;  4HCY A;  1JVY A;  2O7U A;  3EPE A;  3TDJ A;  1Y9U A;  4PP0 A;  1N3X A;  3GLB A;  2ZZV A;  2ABH A;  4JXI A;  3K2D A;  3R6U A;  4MLV A;  4IY5 A;  3PMX A;  3IJX B;  3T1B A;  3M3K A;  3T9U A;  1TFD A;  2YLN A;  1EZ9 A;  3EHU A;  1NH8 A;  4N6K A;  2O51 A;  1IXI A;  2XXU A;  4N15 A;  3O6H A;  1IIT A;  4KR5 A;  4I9D A;  2Q9T A;  2P1S A;  3FVO A;  3MYU A;  1VDW A;  3Q29 A;  4RK9 A;  3USD A;  5AA2 D;  1WDN A;  5AA4 B;  1FBE A;  2DVC A;  5IAI A;  2X7P A;  2Y7R A;  4PQJ A;  4WXJ A;  1MQG A;  2Y5K A;  1PC3 A;  3LSF B;  4ZED A;  4O3A A;  4YB6 A;  1IQ7 A;  5T3J A;  2RC7 A;  1URG A;  4X1B A;  5I2N B;  4H5F A;  3V8X B;  4GL8 A;  4O94 A;  3N26 A;  4ESX A;  2XXW A;  3VVE A;  5CRY A;  4N07 A;  4ZS9 A;  4H67 A;  3QUF A;  4DZ1 A;  3B7D A;  4NQ8 A;  2F7B A;  1IME A;  4ZEI A;  3K00 A;  1YYZ A;  4I3E A;  2Q88 A;  4U2R A;  3I3V A;  2PVU A;  1M5D A;  2FVZ A;  4NF4 A;  4EF2 A;  4EQB A;  2B3F A;  1AWB A;  2Y5L A;  1JVX A;  1FTK A;  1DK4 A;  3TTM A;  3SKP A;  2F5X A;  1P1U A;  2Z23 A;  3OXN A;  4U4S A;  3ECR A;  3QYT A;  5H8Q B;  1OIB A; 
#chains in the Genus database with same CATH homology
 2V4C A;  2HZK A;  4PAF A;  3KC0 A;  5IGA A;  4YZZ A;  4GX6 A;  4F18 A;  3RPL A;  2WX9 A;  3IFA A;  5IZ3 B;  1FBG A;  2Q74 A;  4OVS A;  4MNC A;  2P3N A;  4MMP A;  4OVQ A;  4OVR A;  1NV7 A;  5F24 A;  2XWV A;  4I3Y A;  2QPQ A;  2QVU A;  1FPB A;  2CEY A;  1IMF A;  1FPI A;  5EQ9 A;  4OVP A;  4KXP A;  4XF5 A;  1EYJ A;  1CNQ A;  4QXD A;  4GX4 A;  4P1L A;  4NN3 A;  1NV3 A;  2GQ1 A;  2R8T A;  5FBP A;  2ZZX A;  1Q9D A;  5IZZ A;  3HFU A;  4MEV A;  1LBY A;  3PTY A;  1FPK A;  4PCD A;  4HE2 A;  3W9W A;  3ROJ A;  1NV6 A;  4MCO A;  2XWI A;  2L5V A;  1KA1 A;  2WYK A;  1FPD A;  2OX3 A;  5EQA A;  2JJK A;  4GX3 A;  1NV5 A;  4IR8 A;  5DW8 A;  4P8B A;  3GYY A;  2PCR A;  3NOH A;  4F1U A;  3U65 A;  4P9K A;  4O8M A;  2KQZ A;  1IMB A;  5A5L A;  2XA5 A;  1IMD A;  4PFR A;  1LBZ A;  2KR0 A;  2WBB A;  5I3S A;  1YZ0 A;  4NG7 A;  2OWZ A;  3RPL B;  4N8G A;  4PDD A;  4OA4 A;  4F1V A;  4PF6 A;  2F3D A;  4PGP A;  4N6D A;  1EYK A;  3KBZ A;  2QVV A;  4GBW A;  2MKZ A;  5LTC A;  4XEQ A;  4GWU A;  4P3L A;  1QGX A;  2WBD A;  5J16 A;  2FIE A;  5ESY A;  4AS4 A;  3E78 A;  1FPL A;  3LV0 A;  1LBX A;  4DI4 B;  4GWS A;  2XXK A;  1YXI A;  4NF0 A;  4FBP A;  1DBZ A;  4UAB A;  1K9Y A;  3IFC A;  4O7M A;  4PDH A;  2CZI A;  1NUW A;  3CHG A;  1RDX A;  3RYD A;  1LEV A;  3B50 A;  1IMA A;  2QFL A;  5J1D A;  4NX1 A;  2VPO A;  1FBH A;  1JP4 A;  3EKI A;  2Q8M A;  2DE2 A;  4JVD A;  4MNP A;  3A29 A;  1DCU A;  1NV1 A;  4PBH A;  2FHY A;  2HHM A;  2DVZ A;  1NUY A;  4JVC A;  1G0I A;  1NV2 A;  4HXV A;  5ET5 A;  5LDZ A;  1NV4 A;  3KC1 A;  4N17 A;  2CEX A;  5EYG A;  1G0H A;  2VT5 A;  4GWZ A;  5JK4 A;  4DI3 D;  4X9T A;  5CM6 A;  4HE1 A;  1LBW A;  4GBV A;  1FJ6 A;  4N91 A;  3BIG A;  2PFY A;  4PC9 A;  4M1V A;  4OAN A;  2VPN A;  2WEF A;  1FPG A;  4PAK A;  4F19 A;  1K9Z A;  2CZH A;  3E79 A;  3MST A;  4P56 A;  4AS5 A;  2V3Q A;  4XFE A;  2P3V A;  2PFZ A;  4OVT A;  1IMC A;  2FIX A;  1FPF A;  2HZL A;  4I40 A;  4NHB A;  4YIC A;  4MNI A;  5EQ7 A;  3FBP A;  4NAP A;  2CZK A;  4MAG A;  4N81 A;  1EYI A;  2XWK A;  1FBC A;  4MIJ A;  4PFI A;  2B4L A;  4PBQ A;  2FBP A;  3SZP A;  4N8Y A;  2HPG A;  4GWW A;  5EQ8 A;  1FSA A;  4PFB A;  1FPE A;  5IZ1 A;  1XI6 A;  1FPJ A;  5ET8 A;  2F3B A;  4N4U A;  4LN5 A;  1LBV A;  4G61 A;  3W9V A;  1INP A;  1FTA A;  1RDZ A;  4P47 A;  3FXB A;  2HXR A;  4HCY A;  1NV0 A;  3LUZ A;  1FRP A;  4PTK A;  4MX6 A;  2ZZV A;  1FBP A;  1BK4 A;  1KZ8 A;  4PF8 A;  2WYP A;  5EYH A;  5IZ3 A;  2XWO A;  1KA0 A;  3T1B A;  5I7I A;  2DDK A;  5I5P A;  4H46 A;  2BJI A;  4N6K A;  1FBD A;  4N15 A;  4NGU A;  2ZZW A;  1NI9 A;  1SPI A;  2Q9T A;  1FBF A;  5ET7 A;  3MYU A;  1VDW A;  5ET6 A;  1FBE A;  4X8R A;  2Y5K A;  5T3J A;  2DE3 A;  4O7I A;  4QBA A;  2B4M A;  4PET A;  4H45 A;  4O94 A;  4JVI A;  3BIH A;  4PAI A;  1D9Q A;  4NQ8 A;  1IME A;  4HCW A;  1YYZ A;  2QVR A;  4I3E A;  4X04 A;  2DE4 A;  4HE0 A;  4MJO A;  1NUZ A;  4MHF A;  1RDY A;  2FVZ A;  4P1E A;  5IM2 A;  4GWX A;  4GWY A;  3D1R A;  3T0J A;  3QMF A;  4PE3 A;  1AWB A;  2Y5L A;  1DK4 A;  1NUX A;  3ISP A;  2F5X A;  3B8B A;  4PGN A;  1FJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...