5ET5A

Human muscle fructose-1,6-bisphosphatase in active r-state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
324
structure length
282
Chain Sequence
b'TDMLTLTRYVMEELTQLLNSMLTAIKAISSAVRKAVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSIGTIFAIYRSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
molecule tags Hydrolase
source organism Homo sapiens
publication title T-to-R switch of muscle fructose-1,6-bisphosphatase involves fundamental changes of secondary and quaternary structure.
pubmed doi rcsb
total genus 90
structure length 282
sequence length 324
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et5A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et5A02
1XI6A 1FJ9A 4GBVA 4GWYA 2QVUA 4IR8A 2WEFA 1NUWA 1DCUA 1KA1A 1YZ0A 5EYGA 5EQ8A 3LUZA 2FIEA 2F3DA 3RPLA 5EYHA 1DBZA 3BIGA 4HXVA 2Q8MA 1FBHA 1LBXA 1NUYA 2FVZA 1FPGA 3LV0A 4I3EA 2VT5A 1NUZA 4H46A 2OX3A 1KZ8A 1RDXA 2OWZA 1RDZA 1IMFA 1KA0A 2CZIA 4GX3A 2FBPA 4PTKA 5EQ9A 4I3YA 1EYJA 1FBGA 4AS5A 5IZ3A 1SPIA 1DK4A 2PCRA 1LBZA 4MJOA 4QXDA 1FBEA 2Y5LA 1FPBA 2QFLA 4GWSA 5ET6A 3KC0A 1YXIA 1RDYA 1EYIA 3IFAA 1FPLA 2HHMA 5ET8A 2QVRA 1FTAA 5A5LA 5J16A 3BIHA 1IMAA 2F3BA 4GWZA 1LBYA 2P3NA 5I3SA 1NV1A 4I40A 2QVVA 1NUXA 1QGXA 3KC1A 1FPJA 1FBCA 2R8TA 2FHYA 3D1RA 4GWXA 1IMCA 1LBVA 1NV2A 5IZ3B 3ROJA 4GX6A 4HE0A 4GWWA 5EQAA 2WBBA 1G0HA 3FBPA 4KXPA 5FBPA 5ET5A 1K9YA 4HE2A 1NV3A 3A29A 3QMFA 5DW8A 3B8BA 1NV7A 1LEVA 1IMEA 2GQ1A 4H45A 4N81A 1NI9A 1FBFA 1FJ6A 2Q74A 5T3JA 1AWBA 1NV6A 3T0JA 1JP4A 1FPEA 4AS4A 4HE1A 2DDKA 3KBZA 5ET7A 1IMDA 1G0IA 1YYZA 1IMBA 1CNQA 2WBDA 1FBDA 5EQ7A 1FPFA 2FIXA 1NV4A 3IFCA 1FPDA 4O7IA 4FBPA 1FSAA 5ESYA 2JJKA 5LDZA 3RPLB 1Q9DA 1FPIA 1NV0A 5F24A 2P3VA 1EYKA 1K9ZA 1NV5A 2BJIA 2Y5KA 4GWUA 1FRPA 1FPKA 1VDWA 2CZHA 3RYDA 4G61A 2CZKA 4GBWA 1D9QA 5IZ1A 1LBWA 4GX4A 1INPA 1FBPA 1BK4A
chains in the Genus database with same CATH superfamily
2QVUA 3K6UA 2G93A 5KZTA 4UABA 3MYUA 3PUYE 1P1WA 4I3EA 3TTNA 4FEDA 1ELJA 5H8FA 3A09A 3KSJA 3CI8A 5EQ9A 2WKYA 3PUWE 1XC1A 3TELA 4GXAA 3KC0A 4YKPA 2XA5A 4H8JA 4P47A 5ET8A 1FTAA 4RNSA 2UYEA 5ITOA 4ONYA 1ZIUA 4DXCA 2Y7RA 3D4GA 4IO4A 3T9HB 4K3FA 2WBBA 3M3FA 2Q89A 4LQ5A 5I57A 1SW4A 4OETA 2GH9A 1A54A 1NV7A 4PFIA 4N81A 1AWBA 3IK6B 4NTLA 1LB9A 1A8EA 5I7IA 1FBDA 2F5XA 3VLVA 3KN7A 2DXYA 2PFYA 4LZ7A 1JEUA 4F3BA 4FE8A 1JW4A 2XX8A 1MY0A 1PEBA 3U93A 4U4SA 2AL5A 2O51A 3DP6A 3H03A 4NF5B 2F7AA 2QS3A 2R9JA 4KHZE 2XHDA 4G61A 5TPAB 4OVQA 4PP0A 1AIVA 1RKMA 1FJ9A 3N5LA 2Y84A 1QULA 1II5A 5TP9A 4YKKA 3FIRA 1POTA 3VDFA 3SERA 1S9TA 1N3WA 1ZU0A 4QXDA 2NWJA 4GWSA 4O3BA 4G68B 5A5XA 3EF7A 3M3KA 1FTOA 2QMWA 1URDA 4MNPA 3V89B 1SD3A 1NNFA 3TFLA 4OZ9A 4ZE8A 1B5HA 2Z22A 3H6WA 4O7MA 1DPPA 3T1BA 4KI0E 4X8RA 1AOVA 1A99A 3MW0A 4U1OA 2QSXA 4P1LA 2UVGA 4R9FA 5LTCA 1B5IA 1FJ6A 4AS4A 5JTYA 2X7QA 2W7YA 2WBDA 3PMWA 4XKRA 4IGRA 3OELA 5CMCA 2V3UA 1PBQA 5JTYB 1Q9DA 3O6HA 3FVNA 2ANJA 1K9ZA 1NV5A 1MRPA 4TLLB 1XVXA 2GHBA 1PC3A 4RA1A 4NAPA 3RYDA 5F7VA 3B6WA 4OYVA 4YU0A 2HEUA 4OXVA 4P56A 1FBPA 5EYFA 4I1DA 2V25A 4MLVA 3BIGA 3OSQA 2XXIA 1B0LA 3TCFA 1L5TA 2AL4A 1A7LA 1SYIA 4G68A 2HAUA 2FBPA 3MZBA 1BIYA 3VE1B 2O1LA 3VLWA 4KR5A 4OFJA 3WAFA 1YXIA 3CFZA 1FTJA 1QVSA 4EXLA 4OVTA 4N07A 3KZGA 4ISUA 5J16A 1B6HA 1PB8A 2F3BA 5BWJA 3KGCA 3MBPA 3PPOA 1MXUA 2M8CA 4OANA 1NV1A 5TP9B 3KC1A 2FHYA 3E9XA 2DS9A 3H6TA 4GX6A 4M1VA 5HBCA 2NVUB 3QSLA 2VD2A 1PB9A 2XXHA 3BFTA 1S7YA 2PBWA 2ABHA 1NNTA 1JW1A 5FHMA 1CNQA 4XKNA 2I0CA 3GYYA 1UIUA 4PGNA 1GR2A 2E0SA 1FPDA 4O7IA 3A3UA 2PT1A 2ALUA 3LSWA 4P0IA 3HHFA 3H3GA 1IQ7A 1FQFA 3EQ1A 3IB2A 2QS2A 2O69A 1JETA 1TWYA 5KDTB 1UTBB 2QJEA 2Q88A 3RUMA 5IGAA 4H8IA 5H8HA 5CI5A 2DWHA 3CG1A 1Y4CA 3JYRA 1NUYA 5I58B 2P2AA 2RC9A 3FJMA 4QHQA 1EZPA 3MWBA 1M5BA 3RTFB 2HCAA 3W15C 1Z7NE 5DVFA 2NOOA 3IR1A 4IB2A 4QFLA 1J1NA 2ONSA 1JVXA 2PFZA 2F78A 3EHSA 1N3XA 4OWDA 3DM0A 2V93A 4JVCA 3TQLA 2KR0A 3L6HA 1QGXA 2R8TA 3C9HA 3UGWA 2OPDA 3HFUA 3W9VA 4GWWA 4P11A 5ET5A 3MZ9A 1ZKBA 4OQOA 4ZDMA 5DVJA 1H43A 3A29A 2ESNA 2A5TB 2VOZA 4PFBA 5ISUA 1NV6A 3IB1A 2D3IA 4KYDA 1M5EA 3G3JA 1SQYA 3BKIB 2XWKA 1B7UA 4PETA 3TCHA 4IGTA 4DXUA 3FJ7A 2HFBA 2OZZA 4FBPA 5ESYA 3FZVA 2OWSA 4R73A 4BDQA 4KFQA 4HS7A 3HV1A 5IAIA 1OLAA 3HPIA 2CZHA 2KQZA 3TDJA 4DIGA 3F11A 1IXGA 3H6VA 3O29A 4OFLA 4ELOA 3RLFE 4XEQA 5AE4A 3KEIA 4YB5A 1N04A 4MX6A 3RN8A 5EYGA 1EU8A 1FTLA 1FQDA 1AH5A 4WEPA 3PPRA 2OJTA 3KSXA 4O3AA 4TLMB 4GOTA 4AB5A 2XD2A 3KOTA 4EUOA 2H4IA 4ZEDA 4MJOA 1B3LA 3OO9A 4ZECA 1IXHA 5ET6A 1LSTA 4JVIA 4F3SA 1MM7A 3S2VA 4Q5TA 1LGBC 3OMBA 4JDFA 5ELVA 4I40A 3KJTA 4GWXA 3K1MA 1N0TA 2B4LA 2CEYA 4G8MA 4DI4B 3M3LA 4HW8A 4R2BA 5DTBA 3QMFA 2GQ1A 2L5VA 3FXBA 2HZKA 1FPEA 1B2HA 3IOVA 3MPKA 3FD3A 1NV4A 2B3FA 2DYXA 2O7IA 4OFOA 4YZZA 2V3TA 1DTZA 3CHGA 2VP1A 4Q8RA 1MXZA 2KLFA 3RY3A 2IEEA 1B3EA 5CRYA 1LBWA 1MH4A 3CSBA 5CM6A 2I48A 1R9QA 3LUYA 1NUWA 1KA1A 1DPEA 5B7DA 1Y1ZA 2VGQA 2Y7PA 2F3DA 2I0BA 1I6AA 3DLNA 1MQJA 3TUSA 3ILUB 1FPGA 3LV0A 1IITA 4C0RA 3SEWA 1RDZA 3LBSA 1VFEA 2A5SA 5IZ3A 1IUDA 2PCRA 3K1PA 3JZJA 2Y5LA 4WKMA 4BDLA 4PFWA 4PAIA 1QUIA 4ZE9A 1FPLA 1B52A 4GRKA 4FEBA 3I6VA 1QKAA 1JW5A 2OBGA 3FGSA 3PU5A 4JWXA 1RYOA 5L8DA 4PE3A 1NV2A 1EZOA 4F29A 3E79A 4KXPA 4H6DA 3R7XA 3MVZA 3MUQA 1NV3A 2D5WA 2GFEA 2F8DA 2OWTA 3JV9A 1O7TA 4EF2A 2PX1A 4QRZA 5AA2B 3TQWA 4GD5A 5M2VA 5T3JA 1JP4A 3PMVA 4MNIA 4PF8A 4N13A 1IMDA 3S9MC 2REGA 2Y7IA 2Z23A 4OENA 4EQBA 1I6BA 3K00A 5K2XA 3VVEA 3R6UA 5LDZA 5BUUA 3K6XA 1VFDA 1NV0A 3C4MA 1P99A 1SW2A 2QPQA 2VHAA 4XKQA 2WYPA 3FXUA 3L6GA 3OD7A 3QXMA 2XXPA 4TOZA 4GX4A 4OVRA 2H99A 1AMFA 1BK4A 4GBVA 4ELPA 2O84X 4QFNA 1YZ0A 3PV0E 4PDHA 1FQEA 4ZEIA 3FVOA 3DP8A 3H6UA 1LAXA 4R75A 2XXVA 1HSLA 2UVJA 4P3LA 3KN3A 4YAHX 3U72A 1NKXA 3C32A 3O6IA 4I3YA 4POXA 4YMAA 4DLDA 2H98A 3E4RA 1LBZA 2Z8EA 2DWIA 3C31A 2PVUA 3G3HA 3OEMA 3N6TA 3U65A 3CFXA 3SDFA 2ZZXA 1B4ZA 3VFJA 4GFRA 2VD3A 3SZPA 1B05A 4N4UA 3G3FA 3T9VA 4PQJA 3S9NC 5IZ3B 3K02A 4F3GA 3D4CA 4E0WA 4FIMA 2X26A 4E0XA 3TEPA 3T96B 4LP2B 3H7MA 4QSEA 2XXTA 2QRYA 4YMBA 1H45A 1FQAA 4C1TA 4RPNA 2XX9A 1MXYA 1ANFA 2DDKA 2QL3A 3IX1A 2RF1A 4GL8A 3MC2A 2XD3A 4ZS9A 4Z7EA 3IB0A 1M5CA 3CFLA 3E78A 1IXCA 4YICA 1JVYA 3FATA 5FTHA 3N6UA 2V4CA 5I2NB 1P1QA 4P8BA 1CB6A 4N6KA 1QUKA 1D3KA 4NF6B 3V83A 2DVCA 2XXQA 1XVYA 5AA4A 3SEVA 2HZLA 5FHOA 5DVIA 1XI6A 1ZBMA 1BLFA 3A3CA 1Y3QA 4JBZA 2IA4A 3QUJA 4HCWA 2Q8MA 4C1UA 1MG1A 4QSDA 3USDA 2OX3A 3HN0A 3IOUA 4NN3A 3MP1A 3IOWA 1DK4A 4RYAA 1XS5A 3DP4A 3CSGA 3VVFA 2QVRA 1QW0A 3MVWA 1HSEA 3K6WA 1LAFE 2ZXTA 5EHMA 3CIJA 3GXAA 1FBCA 4YB7A 1B9JA 5DYHA 4Q0CA 2RCBA 3MP6A 1MPDA 3PTYA 3PUXE 3I5OA 4HTGA 4X48A 5DT6A 2ZNTA 4GIZA 1LFIA 4IO6A 1A8FA 1SYHA 4H45A 1POY1 4BDNA 4PBQA 1ZLQA 2XXWA 4OMBA 5AA2D 3HSTA 2B65A 2O6AA 2LAOA 1FPFA 2ZMBA 4MHFA 1LCTA 1N84A 3ODBA 2XXKA 4IO7A 3QYTA 4MLQA 4LUBA 3LSXA 2CEXA 4IO2A 3MPLA 5AA4B 5H8QA 2GHAA 3NOHA 1MY4A 5IZZA 4H67A 3ZKKA 4PBHA 1LBBA 4QFKA 2AYSA 1TXFA 1BP5A 3RPWA 3TTMA 4XF5A 4DXBA 4KCCA 1FQCA 2PT2A 4N8YA 1VE4A 3OSRA 3VLUA 4ZEBA 4I9DA 3MVXA 3V5AA 1NFTA 2CZLA 1GGGA 3G3KA 4IY6A 1URSA 3H06B 3UORA 2CZIA 1WODA 4O8MA 4OEVA 1AL3A 2ONKE 2QFLA 4FORA 4JWYA 3BIHA 4PAFA 4GWZA 4P9KA 4H0WA 3SEXA 5A5XB 3N94A 5H8QB 2NXOA 2O7UA 1ATGA 2QVVA 5I59B 5I56B 4OEUA 3K6VA 4N8GA 1B46A 4G68C 2O1MA 1KWHA 3MZ1A 1OQGA 1FBFA 3O97A 1QUJA 1FTMA 3Q27A 4RXLA 4NF0A 2D21A 3U94A 2E1SA 2OK2A 1URGA 4H5FA 1TFAA 4F39A 4ELRA 2H5YA 3OENA 1NMUA 4OESA 5F24A 5CMKA 2DVZA 1ZTYA 4F2QA 2OPEA 2OLBA 5H8SA 2CMOA 4PFTA 1IIWA 2B4MA 4EXKA 3K0VA 3O66A 2WYKA 1OIBA 4PCDA 3IO6A 2Y7KA 4NMYA 2WEFA 4BDMA 5L9MA 1LFHA 1H3DA 1DCUA 2OCUA 3PGFA 4YKIA 1B3FA 4R6KA 1LBXA 2I4BA 4PF6A 2I3WA 1NUZA 2OWZA 4LQ2A 4U21A 1P1UA 1FBGA 3G3IA 3I3VA 2I3VA 1FBEA 2F34A 4ESXA 1D4NA 1PBPA 3O6GA 4YKJA 5AA2A 3ILTB 5H8NB 4BDOA 2DE3A 3U8QA 3GBAA 4ESWA 4U23A 2WX9A 3OOAA 4GF8A 3QK6A 2R6GE 2UXAA 1UTHA 3ROJA 1B1XA 1NNKA 2ZNUA 4ECFA 5HPQA 4XFEA 2HXRA 5H8FB 5JK4A 4DZ1A 3OO6A 1MH3A 3T22A 5DW8A 3B8BA 2Q74A 3FV2A 4XTCQ 3OEKA 3KBZA 3RTWB 1YYZA 2YJPA 4DCXA 4PFYA 3IFCA 4RPOA 4P0GA 3MVYA 3Q26A 3PUVE 2FYIA 3RPLB 4G8HA 3ZSFA 4F1UA 1MY2A 4GBWA 1Y20A 1B51A 3ISPA 4NQ8A 4NF8A 4H65A 4X1DA 1OVTA 2F6GA 3WAEA 3VVDA 1M5FA 4OVSA 3EPEA 3Q25A 1JQFA 2XWVA 1FQBA 3CRBA 2UYFA 1BKAA 1MXXA 3KJ7A 2QMXA 1O63A 1KA0A 2XWIA 3TODA 2QS1A 4ZEKA 1B3HA 3P7IA 5J1DA 3ZS6A 3BBRA 1MM6A 4MFIA 1B7ZA 4GQOA 1Q1KA 4POWA 1NH7A 4OVJA 1MQDA 1NUXA 3D1RA 2H25A 2XXUA 1OQHA 3VV5A 4ELQA 1G0HA 1K9YA 5ITPA 1GVCA 3B6TA 5K2YA 2FA7A 1MQHA 4KYEA 3PD9A 5L9SA 4MCOA 4HE1A 2Q8JA 3Q28A 4MMPA 3HHGA 3GBBA 2ZZVA 4UACA 2I58A 3T93B 3FUZA 4EQ9A 1EZ9A 2P3VA 2DWJA 3IJOB 4F1YA 1JNFA 1I69A 4O94A 3KBRA 1MDP1 3RGYA 4F3PA 4KPTA 2THIA 5IZ1A 3R26A 1CE2A 2R71A 2VPNA 4NF5A 4Z0IA 1LB8A 3RQTA 1JEVA 2G29A 1LAHE 4IR8A 4OHNA 4PDDA 5I59A 4I62A 1OMPA 4U2RA 1SVXB 3LUZA 1M5DA 2DE4A 4N6PA 1DBZA 1LAGE 3PPPA 3U92A 1PDAA 5I57B 3UP9A 1IMFA 5FHNA 2XXRA 1HSJA 4GX3A 4PTKA 1MQIA 1Q35A 1US4A 2FNCA 4RJZA 4N17A 3G7WA 4R72A 4QF9A 3KFMA 4RK9A 1WDNA 2RC7A 3FASA 2REJA 4G77A 4FJPA 5IM2A 3B50A 4DI3D 5AA3A 1TFDA 3IFAA 1SW5A 3SEUA 1Z7ME 3MAMA 1IMAA 1MY3A 3IL1B 4EDPA 4OVPA 2O68A 3TTRA 5I84A 1XOCA 3TPAA 3MP8A 4YB6A 4JVDA 3TYHA 4QFOA 5EQAA 4MBPA 4R6YA 2YPNA 2ZYMA 1YCJA 1B4HA 1B1HA 1IMEA 1N7XA 4X9TA 3IORA 4R9GA 1IMBA 4NGUA 2ZNSA 2PYYA 2RC8A 4U22A 1S50A 3SETA 3FXQA 1XT8A 4XXUA 5TPAA 2F35A 3IAZA 1Y9UA 2JJKA 3RNNA 2MKZA 3PD8A 3GZGA 3MJNA 4GLIA 4P1EA 3E13X 1MQGA 1EYKA 1NNPA 1MXVA 5CMMA 2BJIA 5CBRA 3T9UA 2CZKA 1GTKA 3EN3A 3O28A 1N7WA 1ZMGA 3UA8A 3TZAA 3GLBA 3MQ9A 3QAXA 4F31B 4N6DA 4KD5A 5CBSA 4X04A 1ZJLA 4MF3A 2V84A 2FIEA 1A40A 4UA8A 3RPLA 4OTEA 5I2KB 3E3KA 1B5JA 1P1OA 2VT5A 3AXFA 4H46A 3THIA 2GRVA 1PB7A 4BLAA 4GXSB 4NEDA 1SPIA 4MIJA 3TCGA 2HAVA 1FW0A 4AB6A 2RCAA 3TAJA 2V3QA 4H1XA 5FTIA 1OVBA 1MDQA 4LZ5A 2YLNA 4LA9A 5JEIA 1N76A 1SDXA 1IMCA 4HE0A 3FJGA 4LVQA 4R2FA 3B6QA 3PMXA 1XHYA 4HE2A 4M4GA 4EF1A 5H8NA 1QKBA 4ZZAA 4N15A 2BJJX 3PUZE 4U4XA 5I2KA 1LEVA 1BTJA 3O2AA 1MPCA 2I49A 1Y3NA 3DELB 3O9PA 4QFPA 5EQ7A 2XXYA 5DEXB 4DE8A 3FXRA 4NF4B 4JXIA 3CR9A 3TTKA 4FATA 4WEDA 5KDTA 1MS7A 2RKMA 1B7HA 1H44A 3S9EA 1B58A 2Y5KA 1QJMA 1VDWA 3LSLA 1D9QA 5CC2A 2I4CA 3M8UA 4JSDA 1UTHB 2RINA 4QSCA 2DP8A 3W9WA 3UN6A 4OERA 2F36A 4MNCA 2Z8FA 4HXVA 1USYH 4LZ8A 2Q2CA 1TT1A 1P1NA 2NUVA 1RDXA 3FVKA 4RY1A 5L9OA 2B3BA 5B70A 3C35A 5I56A 3CG3A 3HCQA 1EYJA 4MH5A 2ZZWA 4JB7A 1FPBA 2ZYNA 5F1QA 1UTBA 1RDYA 4G2ZA 1EYIA 3OO7A 2HHMA 3C33A 5A5LA 4MEVA 1LBYA 3N26A 1IEJA 3K01A 1I6QA 2XXXA 1DMBA 1USYE 1FPJA 1US5A 2F7CA 2HXWA 4OA4A 3IO4A 4XIGQ 2I6EA 2X7PA 3FVGA 4DCYA 4MAGA 3UIFA 4DDDA 5ICQA 3RT6B 3EHTA 3SEYA 3TKDA 1G0IA 1IZ1A 2H9BA 1NL5A 4JWOA 4QBAA 2ZYKA 1YPNA 1R1NA 3T66A 3ZKLA 3BFUA 3UK4A 1F9BA 2VPOA 4WXJA 4ZEFA 3IJXB 3CVGA 4O3CA 4F2OA 1FPKA 4IO5A 4GWOA 3G3GA 4R6HA 3RT8A 2UVIA 1R6ZA 3SKPA 3TTLA 2HPGA 4NE4A 5EQ8A 1T0KA 4HCYA 5KCJA 4H5GA 1FBHA 5LOMA 1LCFA 4FECA 2Q9TA 3TMGA 4NWDA 5HM4B 1RYXA 3OXNA 3T9XB 4PFUA 4LATA 2F97A 4XKPA 1FCKA 1DOTA 4N91A 1B3GA 4FAJA 3V8XB 2DXRA 1D9VA 3B7DA 1D9YA 2P1SA 5AA1A 4KQPA 5FBPA 3EHUA 1YTVA 5TU0A 4KYSA 4TQUQ 1H76A 4G8NA 4NHBA 4NF6A 5KCJB 4BDRA 3S9LC 1O64A 3T0JA 2F6PA 1VSOA 5I2NA 2P0SA 2Z8DA 2XX7A 3K4UA 4NF8B 4PAKA 1WVJA 3KOSA 5ICTA 1LLSA 1FSAA 4I8CA 4AQ4A 1SI0A 5CMBA 1B32A 3K2DA 1FPIA 3ECRA 4X1BA 4ZZEA 2AIXA 3LC8A 1DTGA 2DQVA 1SBPA 3OO8A 2HQ0A 3VXCA 3H4ZA 4R74A 1UQWA 1SI1A 4ND9A 3QUFA 4L17A 4F1VA 2DSFA 1INPA 4GWYA 3LR1A 1FTKA 4PE5B 5I5PA 4LN5A 5DEXA 3FV1A 5EYHA 2FVZA 4PC9A 5IKBA 1KZ8A 4JSOA 4LONB 4RK2A 3SESA 4AS5A 1Y3PA 1MPBA 4NX1A 4F19A 1VR5A 2ONRA 3PPQA 4GVOA 4Q30B 3K1NA 1R9LA 3EKIA 2QS4A 3QIMA 3LSFB 3KN8A 4IY5A 1IXIA 2Y7WA 2F7BA 2P3NA 3C34A 4PFRA 3HO7A 5I3SA 1Y1MA 1B40A 2Q2AA 4THIA 3MSTA 1MY1A 5EHSA 1NH8A 1LBVA 1UIVA 3FBPA 1DSNA 4NG7A 1A55A 2PMSA 1MXWA 1NI9A 2ZYOA 4KCDA 3IOTA 4PGPA 1OLCA 5ET7A 3S4UA 4F18A 2UVHA 1YAEA 2DWAA 1GV8A 2FIXA 4G4PA 4GL0A 5I58A 4IO3A 2DE2A 2DOJA 3Q29A 1EH3A 4U1ZA 3U1OA 3PPNA 5H8HB 3VXBA 1LBCA 4NF4A 2XWOA 2A5TA 3C36A 4EQ7A 3ONMA 4GWUA 1FRPA 1B0HA 1LFGA 4NWCA 3KG2A 1Y4TA 4F22A 1SW1A
chains in the Genus database with same CATH topology
1XI6A 4PCDA 1FJ9A 4GBVA 4GWYA 4N6DA 2QVUA 4IR8A 4PDDA 2HPGA 2WEFA 3W9WA 4PE3A 1NUWA 4MX6A 4X04A 1DCUA 1KA1A 5I5PA 4OVSA 1YZ0A 5EYGA 4LN5A 4MNCA 5IGAA 4PDHA 4UABA 5EQ8A 3LUZA 2FIEA 2DE4A 4HCYA 2F3DA 3RPLA 5EYHA 3MYUA 1DBZA 3BIGA 4HXVA 4HCWA 2Q8MA 1FBHA 2XWVA 1LBXA 1NUYA 4PF6A 2FVZA 1FPGA 3LV0A 4I3EA 4PC9A 2VT5A 1NUZA 4H46A 2OX3A 1KZ8A 2Q9TA 1RDXA 2OWZA 1RDZA 4OVTA 1IMFA 4P3LA 1KA0A 2XWIA 4NN3A 2CZIA 4GX3A 2FBPA 4PTKA 5EQ9A 4I3YA 1EYJA 1FBGA 4AS5A 5IZ3A 2ZZWA 1SPIA 1DK4A 2PCRA 1LBZA 4MJOA 4QXDA 4MIJA 4N17A 4O8MA 4NX1A 1FBEA 2Y5LA 1FPBA 2QFLA 4GWSA 4F19A 5ET6A 3KC0A 4PAIA 5J1DA 5IM2A 1YXIA 2XA5A 1RDYA 3B50A 4P47A 4DI3D 3EKIA 4JVIA 1EYIA 3IFAA 1FPLA 2HHMA 2PFZA 5ET8A 4N91A 2QVRA 1FTAA 5A5LA 5J16A 2DE3A 2ZZXA 4MEVA 3BIHA 4PAFA 2V3QA 1IMAA 2F3BA 4GWZA 1LBYA 2P3NA 2WX9A 4MNPA 4P9KA 3SZPA 4JVCA 4OANA 4PFRA 5I3SA 2KR0A 1NV1A 4N4UA 4OVPA 4I40A 2QVVA 1NUXA 1QGXA 3KC1A 1FPJA 1FBCA 2R8TA 2FHYA 3D1RA 4GWXA 3MSTA 3HFUA 1IMCA 1LBVA 1NV2A 5IZ3B 3ROJA 4OA4A 4GX6A 4HE0A 4JVDA 4M1VA 4O7MA 4N8GA 4GWWA 2B4LA 4XFEA 2HXRA 3E79A 3PTYA 5EQAA 3T1BA 2WBBA 5JK4A 1G0HA 3FBPA 4KXPA 5FBPA 5ET5A 2CEYA 4NG7A 4X8RA 1K9YA 4DI4B 4HE2A 4MAGA 1NV3A 3A29A 4N15A 4NHBA 4P1LA 3QMFA 5DW8A 3B8BA 1NV7A 5LTCA 4PFIA 1LEVA 1IMEA 2GQ1A 4H45A 4N81A 2L5VA 1NI9A 3FXBA 1FBFA 1FJ6A 2Q74A 5T3JA 2HZKA 4PBQA 1AWBA 1NV6A 4PFBA 3T0JA 1JP4A 1FPEA 4AS4A 4HE1A 4MCOA 2DDKA 4X9TA 4MNIA 4PGPA 4PF8A 3KBZA 5ET7A 4F18A 1IMDA 1G0IA 1YYZA 1IMBA 1CNQA 4NGUA 2WBDA 5I7IA 2XWKA 4MMPA 4NF0A 1FBDA 5EQ7A 2F5XA 1FPFA 3GYYA 2FIXA 4PETA 1NV4A 3IFCA 2PFYA 4PAKA 4MHFA 4PGNA 4QBAA 1FPDA 4O7IA 2DE2A 4FBPA 1FSAA 5ESYA 2JJKA 2XXKA 3E78A 2ZZVA 2MKZA 5LDZA 3RPLB 4YICA 4YZZA 3CHGA 1Q9DA 1FPIA 1NV0A 3U65A 2V4CA 4P1EA 5F24A 3W9VA 2P3VA 2CEXA 2VPOA 2QPQA 2DVZA 2XWOA 1EYKA 4O94A 1K9ZA 1NV5A 4P8BA 2WYPA 4N6KA 4F1UA 2BJIA 2Y5KA 3NOHA 5IZZA 4GWUA 1FRPA 1FPKA 1VDWA 2CZHA 2KQZA 4NAPA 3RYDA 4G61A 2CZKA 4GBWA 4PBHA 2B4MA 3ISPA 1D9QA 5IZ1A 1LBWA 4GX4A 4NQ8A 4OVRA 4OVQA 4XEQA 4F1VA 2VPNA 2WYKA 4XF5A 4P56A 1INPA 1FBPA 5CM6A 2HZLA 1BK4A 4N8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XI6 A;  1FJ9 A;  4GBV A;  4GWY A;  2QVU A;  4IR8 A;  2WEF A;  1NUW A;  1DCU A;  1KA1 A;  1YZ0 A;  5EYG A;  5EQ8 A;  3LUZ A;  2FIE A;  2F3D A;  3RPL A;  5EYH A;  1DBZ A;  3BIG A;  4HXV A;  2Q8M A;  1FBH A;  1LBX A;  1NUY A;  2FVZ A;  1FPG A;  3LV0 A;  4I3E A;  2VT5 A;  1NUZ A;  4H46 A;  2OX3 A;  1KZ8 A;  1RDX A;  2OWZ A;  1RDZ A;  1IMF A;  1KA0 A;  2CZI A;  4GX3 A;  2FBP A;  4PTK A;  5EQ9 A;  4I3Y A;  1EYJ A;  1FBG A;  4AS5 A;  5IZ3 A;  1SPI A;  1DK4 A;  2PCR A;  1LBZ A;  4MJO A;  4QXD A;  1FBE A;  2Y5L A;  1FPB A;  2QFL A;  4GWS A;  5ET6 A;  3KC0 A;  1YXI A;  1RDY A;  1EYI A;  3IFA A;  1FPL A;  2HHM A;  5ET8 A;  2QVR A;  1FTA A;  5A5L A;  5J16 A;  3BIH A;  1IMA A;  2F3B A;  4GWZ A;  1LBY A;  2P3N A;  5I3S A;  1NV1 A;  4I40 A;  2QVV A;  1NUX A;  1QGX A;  3KC1 A;  1FPJ A;  1FBC A;  2R8T A;  2FHY A;  3D1R A;  4GWX A;  1IMC A;  1LBV A;  1NV2 A;  5IZ3 B;  3ROJ A;  4GX6 A;  4HE0 A;  4GWW A;  5EQA A;  2WBB A;  1G0H A;  3FBP A;  4KXP A;  5FBP A;  5ET5 A;  1K9Y A;  4HE2 A;  1NV3 A;  3A29 A;  3QMF A;  5DW8 A;  3B8B A;  1NV7 A;  1LEV A;  1IME A;  2GQ1 A;  4H45 A;  4N81 A;  1NI9 A;  1FBF A;  1FJ6 A;  2Q74 A;  5T3J A;  1AWB A;  1NV6 A;  3T0J A;  1JP4 A;  1FPE A;  4AS4 A;  4HE1 A;  2DDK A;  3KBZ A;  5ET7 A;  1IMD A;  1G0I A;  1YYZ A;  1IMB A;  1CNQ A;  2WBD A;  1FBD A;  5EQ7 A;  1FPF A;  2FIX A;  1NV4 A;  3IFC A;  1FPD A;  4O7I A;  4FBP A;  1FSA A;  5ESY A;  2JJK A;  5LDZ A;  3RPL B;  1Q9D A;  1FPI A;  1NV0 A;  5F24 A;  2P3V A;  1EYK A;  1K9Z A;  1NV5 A;  2BJI A;  2Y5K A;  4GWU A;  1FRP A;  1FPK A;  1VDW A;  2CZH A;  3RYD A;  4G61 A;  2CZK A;  4GBW A;  1D9Q A;  5IZ1 A;  1LBW A;  4GX4 A;  1INP A;  1FBP A;  1BK4 A; 
#chains in the Genus database with same CATH topology
 2QVU A;  3K6U A;  2G93 A;  5KZT A;  4UAB A;  3MYU A;  3PUY E;  1P1W A;  4I3E A;  3TTN A;  4FED A;  1ELJ A;  5H8F A;  3A09 A;  3KSJ A;  3CI8 A;  5EQ9 A;  2WKY A;  3PUW E;  1XC1 A;  3TEL A;  4GXA A;  3KC0 A;  4YKP A;  2XA5 A;  4H8J A;  4P47 A;  5ET8 A;  1FTA A;  4RNS A;  2UYE A;  5ITO A;  4ONY A;  1ZIU A;  4DXC A;  2Y7R A;  3D4G A;  4IO4 A;  3T9H B;  4K3F A;  2WBB A;  3M3F A;  2Q89 A;  4LQ5 A;  5I57 A;  1SW4 A;  4OET A;  2GH9 A;  1A54 A;  1NV7 A;  4PFI A;  4N81 A;  1AWB A;  3IK6 B;  4NTL A;  1LB9 A;  1A8E A;  5I7I A;  1FBD A;  2F5X A;  3VLV A;  3KN7 A;  2DXY A;  2PFY A;  4LZ7 A;  1JEU A;  4F3B A;  4FE8 A;  1JW4 A;  2XX8 A;  1MY0 A;  1PEB A;  3U93 A;  4U4S A;  2AL5 A;  2O51 A;  3DP6 A;  3H03 A;  4NF5 B;  2F7A A;  2QS3 A;  2R9J A;  4KHZ E;  2XHD A;  4G61 A;  5TPA B;  4OVQ A;  4PP0 A;  1AIV A;  1RKM A;  1FJ9 A;  3N5L A;  2Y84 A;  1QUL A;  1II5 A;  5TP9 A;  4YKK A;  3FIR A;  1POT A;  3VDF A;  3SER A;  1S9T A;  1N3W A;  1ZU0 A;  4QXD A;  2NWJ A;  4GWS A;  4O3B A;  4G68 B;  5A5X A;  3EF7 A;  3M3K A;  1FTO A;  2QMW A;  1URD A;  4MNP A;  3V89 B;  1SD3 A;  1NNF A;  3TFL A;  4OZ9 A;  4ZE8 A;  1B5H A;  2Z22 A;  3H6W A;  4O7M A;  1DPP A;  3T1B A;  4KI0 E;  4X8R A;  1AOV A;  1A99 A;  3MW0 A;  4U1O A;  2QSX A;  4P1L A;  2UVG A;  4R9F A;  5LTC A;  1B5I A;  1FJ6 A;  4AS4 A;  5JTY A;  2X7Q A;  2W7Y A;  2WBD A;  3PMW A;  4XKR A;  4IGR A;  3OEL A;  5CMC A;  2V3U A;  1PBQ A;  5JTY B;  1Q9D A;  3O6H A;  3FVN A;  2ANJ A;  1K9Z A;  1NV5 A;  1MRP A;  4TLL B;  1XVX A;  2GHB A;  1PC3 A;  4RA1 A;  4NAP A;  3RYD A;  5F7V A;  3B6W A;  4OYV A;  4YU0 A;  2HEU A;  4OXV A;  4P56 A;  1FBP A;  5EYF A;  4I1D A;  2V25 A;  4MLV A;  3BIG A;  3OSQ A;  2XXI A;  1B0L A;  3TCF A;  1L5T A;  2AL4 A;  1A7L A;  1SYI A;  4G68 A;  2HAU A;  2FBP A;  3MZB A;  1BIY A;  3VE1 B;  2O1L A;  3VLW A;  4KR5 A;  4OFJ A;  3WAF A;  1YXI A;  3CFZ A;  1FTJ A;  1QVS A;  4EXL A;  4OVT A;  4N07 A;  3KZG A;  4ISU A;  5J16 A;  1B6H A;  1PB8 A;  2F3B A;  5BWJ A;  3KGC A;  3MBP A;  3PPO A;  1MXU A;  2M8C A;  4OAN A;  1NV1 A;  5TP9 B;  3KC1 A;  2FHY A;  3E9X A;  2DS9 A;  3H6T A;  4GX6 A;  4M1V A;  5HBC A;  2NVU B;  3QSL A;  2VD2 A;  1PB9 A;  2XXH A;  3BFT A;  1S7Y A;  2PBW A;  2ABH A;  1NNT A;  1JW1 A;  5FHM A;  1CNQ A;  4XKN A;  2I0C A;  3GYY A;  1UIU A;  4PGN A;  1GR2 A;  2E0S A;  1FPD A;  4O7I A;  3A3U A;  2PT1 A;  2ALU A;  3LSW A;  4P0I A;  3HHF A;  3H3G A;  1IQ7 A;  1FQF A;  3EQ1 A;  3IB2 A;  2QS2 A;  2O69 A;  1JET A;  1TWY A;  5KDT B;  1UTB B;  2QJE A;  2Q88 A;  3RUM A;  5IGA A;  4H8I A;  5H8H A;  5CI5 A;  2DWH A;  3CG1 A;  1Y4C A;  3JYR A;  1NUY A;  5I58 B;  2P2A A;  2RC9 A;  3FJM A;  4QHQ A;  1EZP A;  3MWB A;  1M5B A;  3RTF B;  2HCA A;  3W15 C;  1Z7N E;  5DVF A;  2NOO A;  3IR1 A;  4IB2 A;  4QFL A;  1J1N A;  2ONS A;  1JVX A;  2PFZ A;  2F78 A;  3EHS A;  1N3X A;  4OWD A;  3DM0 A;  2V93 A;  4JVC A;  3TQL A;  2KR0 A;  3L6H A;  1QGX A;  2R8T A;  3C9H A;  3UGW A;  2OPD A;  3HFU A;  3W9V A;  4GWW A;  4P11 A;  5ET5 A;  3MZ9 A;  1ZKB A;  4OQO A;  4ZDM A;  5DVJ A;  1H43 A;  3A29 A;  2ESN A;  2A5T B;  2VOZ A;  4PFB A;  5ISU A;  1NV6 A;  3IB1 A;  2D3I A;  4KYD A;  1M5E A;  3G3J A;  1SQY A;  3BKI B;  2XWK A;  1B7U A;  4PET A;  3TCH A;  4IGT A;  4DXU A;  3FJ7 A;  2HFB A;  2OZZ A;  4FBP A;  5ESY A;  3FZV A;  2OWS A;  4R73 A;  4BDQ A;  4KFQ A;  4HS7 A;  3HV1 A;  5IAI A;  1OLA A;  3HPI A;  2CZH A;  2KQZ A;  3TDJ A;  4DIG A;  3F11 A;  1IXG A;  3H6V A;  3O29 A;  4OFL A;  4ELO A;  3RLF E;  4XEQ A;  5AE4 A;  3KEI A;  4YB5 A;  1N04 A;  4MX6 A;  3RN8 A;  5EYG A;  1EU8 A;  1FTL A;  1FQD A;  1AH5 A;  4WEP A;  3PPR A;  2OJT A;  3KSX A;  4O3A A;  4TLM B;  4GOT A;  4AB5 A;  2XD2 A;  3KOT A;  4EUO A;  2H4I A;  4ZED A;  4MJO A;  1B3L A;  3OO9 A;  4ZEC A;  1IXH A;  5ET6 A;  1LST A;  4JVI A;  4F3S A;  1MM7 A;  3S2V A;  4Q5T A;  1LGB C;  3OMB A;  4JDF A;  5ELV A;  4I40 A;  3KJT A;  4GWX A;  3K1M A;  1N0T A;  2B4L A;  2CEY A;  4G8M A;  4DI4 B;  3M3L A;  4HW8 A;  4R2B A;  5DTB A;  3QMF A;  2GQ1 A;  2L5V A;  3FXB A;  2HZK A;  1FPE A;  1B2H A;  3IOV A;  3MPK A;  3FD3 A;  1NV4 A;  2B3F A;  2DYX A;  2O7I A;  4OFO A;  4YZZ A;  2V3T A;  1DTZ A;  3CHG A;  2VP1 A;  4Q8R A;  1MXZ A;  2KLF A;  3RY3 A;  2IEE A;  1B3E A;  5CRY A;  1LBW A;  1MH4 A;  3CSB A;  5CM6 A;  2I48 A;  1R9Q A;  3LUY A;  1NUW A;  1KA1 A;  1DPE A;  5B7D A;  1Y1Z A;  2VGQ A;  2Y7P A;  2F3D A;  2I0B A;  1I6A A;  3DLN A;  1MQJ A;  3TUS A;  3ILU B;  1FPG A;  3LV0 A;  1IIT A;  4C0R A;  3SEW A;  1RDZ A;  3LBS A;  1VFE A;  2A5S A;  5IZ3 A;  1IUD A;  2PCR A;  3K1P A;  3JZJ A;  2Y5L A;  4WKM A;  4BDL A;  4PFW A;  4PAI A;  1QUI A;  4ZE9 A;  1FPL A;  1B52 A;  4GRK A;  4FEB A;  3I6V A;  1QKA A;  1JW5 A;  2OBG A;  3FGS A;  3PU5 A;  4JWX A;  1RYO A;  5L8D A;  4PE3 A;  1NV2 A;  1EZO A;  4F29 A;  3E79 A;  4KXP A;  4H6D A;  3R7X A;  3MVZ A;  3MUQ A;  1NV3 A;  2D5W A;  2GFE A;  2F8D A;  2OWT A;  3JV9 A;  1O7T A;  4EF2 A;  2PX1 A;  4QRZ A;  5AA2 B;  3TQW A;  4GD5 A;  5M2V A;  5T3J A;  1JP4 A;  3PMV A;  4MNI A;  4PF8 A;  4N13 A;  1IMD A;  3S9M C;  2REG A;  2Y7I A;  2Z23 A;  4OEN A;  4EQB A;  1I6B A;  3K00 A;  5K2X A;  3VVE A;  3R6U A;  5LDZ A;  5BUU A;  3K6X A;  1VFD A;  1NV0 A;  3C4M A;  1P99 A;  1SW2 A;  2QPQ A;  2VHA A;  4XKQ A;  2WYP A;  3FXU A;  3L6G A;  3OD7 A;  3QXM A;  2XXP A;  4TOZ A;  4GX4 A;  4OVR A;  2H99 A;  1AMF A;  1BK4 A;  4GBV A;  4ELP A;  2O84 X;  4QFN A;  1YZ0 A;  3PV0 E;  4PDH A;  1FQE A;  4ZEI A;  3FVO A;  3DP8 A;  3H6U A;  1LAX A;  4R75 A;  2XXV A;  1HSL A;  2UVJ A;  4P3L A;  3KN3 A;  4YAH X;  3U72 A;  1NKX A;  3C32 A;  3O6I A;  4I3Y A;  4POX A;  4YMA A;  4DLD A;  2H98 A;  3E4R A;  1LBZ A;  2Z8E A;  2DWI A;  3C31 A;  2PVU A;  3G3H A;  3OEM A;  3N6T A;  3U65 A;  3CFX A;  3SDF A;  2ZZX A;  1B4Z A;  3VFJ A;  4GFR A;  2VD3 A;  3SZP A;  1B05 A;  4N4U A;  3G3F A;  3T9V A;  4PQJ A;  3S9N C;  5IZ3 B;  3K02 A;  4F3G A;  3D4C A;  4E0W A;  4FIM A;  2X26 A;  4E0X A;  3TEP A;  3T96 B;  4LP2 B;  3H7M A;  4QSE A;  2XXT A;  2QRY A;  4YMB A;  1H45 A;  1FQA A;  4C1T A;  4RPN A;  2XX9 A;  1MXY A;  1ANF A;  2DDK A;  2QL3 A;  3IX1 A;  2RF1 A;  4GL8 A;  3MC2 A;  2XD3 A;  4ZS9 A;  4Z7E A;  3IB0 A;  1M5C A;  3CFL A;  3E78 A;  1IXC A;  4YIC A;  1JVY A;  3FAT A;  5FTH A;  3N6U A;  2V4C A;  5I2N B;  1P1Q A;  4P8B A;  1CB6 A;  4N6K A;  1QUK A;  1D3K A;  4NF6 B;  3V83 A;  2DVC A;  2XXQ A;  1XVY A;  5AA4 A;  3SEV A;  2HZL A;  5FHO A;  5DVI A;  1XI6 A;  1ZBM A;  1BLF A;  3A3C A;  1Y3Q A;  4JBZ A;  2IA4 A;  3QUJ A;  4HCW A;  2Q8M A;  4C1U A;  1MG1 A;  4QSD A;  3USD A;  2OX3 A;  3HN0 A;  3IOU A;  4NN3 A;  3MP1 A;  3IOW A;  1DK4 A;  4RYA A;  1XS5 A;  3DP4 A;  3CSG A;  3VVF A;  2QVR A;  1QW0 A;  3MVW A;  1HSE A;  3K6W A;  1LAF E;  2ZXT A;  5EHM A;  3CIJ A;  3GXA A;  1FBC A;  4YB7 A;  1B9J A;  5DYH A;  4Q0C A;  2RCB A;  3MP6 A;  1MPD A;  3PTY A;  3PUX E;  3I5O A;  4HTG A;  4X48 A;  5DT6 A;  2ZNT A;  4GIZ A;  1LFI A;  4IO6 A;  1A8F A;  1SYH A;  4H45 A;  1POY 1;  4BDN A;  4PBQ A;  1ZLQ A;  2XXW A;  4OMB A;  5AA2 D;  3HST A;  2B65 A;  2O6A A;  2LAO A;  1FPF A;  2ZMB A;  4MHF A;  1LCT A;  1N84 A;  3ODB A;  2XXK A;  4IO7 A;  3QYT A;  4MLQ A;  4LUB A;  3LSX A;  2CEX A;  4IO2 A;  3MPL A;  5AA4 B;  5H8Q A;  2GHA A;  3NOH A;  1MY4 A;  5IZZ A;  4H67 A;  3ZKK A;  4PBH A;  1LBB A;  4QFK A;  2AYS A;  1TXF A;  1BP5 A;  3RPW A;  3TTM A;  4XF5 A;  4DXB A;  4KCC A;  1FQC A;  2PT2 A;  4N8Y A;  1VE4 A;  3OSR A;  3VLU A;  4ZEB A;  4I9D A;  3MVX A;  3V5A A;  1NFT A;  2CZL A;  1GGG A;  3G3K A;  4IY6 A;  1URS A;  3H06 B;  3UOR A;  2CZI A;  1WOD A;  4O8M A;  4OEV A;  1AL3 A;  2ONK E;  2QFL A;  4FOR A;  4JWY A;  3BIH A;  4PAF A;  4GWZ A;  4P9K A;  4H0W A;  3SEX A;  5A5X B;  3N94 A;  5H8Q B;  2NXO A;  2O7U A;  1ATG A;  2QVV A;  5I59 B;  5I56 B;  4OEU A;  3K6V A;  4N8G A;  1B46 A;  4G68 C;  2O1M A;  1KWH A;  3MZ1 A;  1OQG A;  1FBF A;  3O97 A;  1QUJ A;  1FTM A;  3Q27 A;  4RXL A;  4NF0 A;  2D21 A;  3U94 A;  2E1S A;  2OK2 A;  1URG A;  4H5F A;  1TFA A;  4F39 A;  4ELR A;  2H5Y A;  3OEN A;  1NMU A;  4OES A;  5F24 A;  5CMK A;  2DVZ A;  1ZTY A;  4F2Q A;  2OPE A;  2OLB A;  5H8S A;  2CMO A;  4PFT A;  1IIW A;  2B4M A;  4EXK A;  3K0V A;  3O66 A;  2WYK A;  1OIB A;  4PCD A;  3IO6 A;  2Y7K A;  4NMY A;  2WEF A;  4BDM A;  5L9M A;  1LFH A;  1H3D A;  1DCU A;  2OCU A;  3PGF A;  4YKI A;  1B3F A;  4R6K A;  1LBX A;  2I4B A;  4PF6 A;  2I3W A;  1NUZ A;  2OWZ A;  4LQ2 A;  4U21 A;  1P1U A;  1FBG A;  3G3I A;  3I3V A;  2I3V A;  1FBE A;  2F34 A;  4ESX A;  1D4N A;  1PBP A;  3O6G A;  4YKJ A;  5AA2 A;  3ILT B;  5H8N B;  4BDO A;  2DE3 A;  3U8Q A;  3GBA A;  4ESW A;  4U23 A;  2WX9 A;  3OOA A;  4GF8 A;  3QK6 A;  2R6G E;  2UXA A;  1UTH A;  3ROJ A;  1B1X A;  1NNK A;  2ZNU A;  4ECF A;  5HPQ A;  4XFE A;  2HXR A;  5H8F B;  5JK4 A;  4DZ1 A;  3OO6 A;  1MH3 A;  3T22 A;  5DW8 A;  3B8B A;  2Q74 A;  3FV2 A;  4XTC Q;  3OEK A;  3KBZ A;  3RTW B;  1YYZ A;  2YJP A;  4DCX A;  4PFY A;  3IFC A;  4RPO A;  4P0G A;  3MVY A;  3Q26 A;  3PUV E;  2FYI A;  3RPL B;  4G8H A;  3ZSF A;  4F1U A;  1MY2 A;  4GBW A;  1Y20 A;  1B51 A;  3ISP A;  4NQ8 A;  4NF8 A;  4H65 A;  4X1D A;  1OVT A;  2F6G A;  3WAE A;  3VVD A;  1M5F A;  4OVS A;  3EPE A;  3Q25 A;  1JQF A;  2XWV A;  1FQB A;  3CRB A;  2UYF A;  1BKA A;  1MXX A;  3KJ7 A;  2QMX A;  1O63 A;  1KA0 A;  2XWI A;  3TOD A;  2QS1 A;  4ZEK A;  1B3H A;  3P7I A;  5J1D A;  3ZS6 A;  3BBR A;  1MM6 A;  4MFI A;  1B7Z A;  4GQO A;  1Q1K A;  4POW A;  1NH7 A;  4OVJ A;  1MQD A;  1NUX A;  3D1R A;  2H25 A;  2XXU A;  1OQH A;  3VV5 A;  4ELQ A;  1G0H A;  1K9Y A;  5ITP A;  1GVC A;  3B6T A;  5K2Y A;  2FA7 A;  1MQH A;  4KYE A;  3PD9 A;  5L9S A;  4MCO A;  4HE1 A;  2Q8J A;  3Q28 A;  4MMP A;  3HHG A;  3GBB A;  2ZZV A;  4UAC A;  2I58 A;  3T93 B;  3FUZ A;  4EQ9 A;  1EZ9 A;  2P3V A;  2DWJ A;  3IJO B;  4F1Y A;  1JNF A;  1I69 A;  4O94 A;  3KBR A;  1MDP 1;  3RGY A;  4F3P A;  4KPT A;  2THI A;  5IZ1 A;  3R26 A;  1CE2 A;  2R71 A;  2VPN A;  4NF5 A;  4Z0I A;  1LB8 A;  3RQT A;  1JEV A;  2G29 A;  1LAH E;  4IR8 A;  4OHN A;  4PDD A;  5I59 A;  4I62 A;  1OMP A;  4U2R A;  1SVX B;  3LUZ A;  1M5D A;  2DE4 A;  4N6P A;  1DBZ A;  1LAG E;  3PPP A;  3U92 A;  1PDA A;  5I57 B;  3UP9 A;  1IMF A;  5FHN A;  2XXR A;  1HSJ A;  4GX3 A;  4PTK A;  1MQI A;  1Q35 A;  1US4 A;  2FNC A;  4RJZ A;  4N17 A;  3G7W A;  4R72 A;  4QF9 A;  3KFM A;  4RK9 A;  1WDN A;  2RC7 A;  3FAS A;  2REJ A;  4G77 A;  4FJP A;  5IM2 A;  3B50 A;  4DI3 D;  5AA3 A;  1TFD A;  3IFA A;  1SW5 A;  3SEU A;  1Z7M E;  3MAM A;  1IMA A;  1MY3 A;  3IL1 B;  4EDP A;  4OVP A;  2O68 A;  3TTR A;  5I84 A;  1XOC A;  3TPA A;  3MP8 A;  4YB6 A;  4JVD A;  3TYH A;  4QFO A;  5EQA A;  4MBP A;  4R6Y A;  2YPN A;  2ZYM A;  1YCJ A;  1B4H A;  1B1H A;  1IME A;  1N7X A;  4X9T A;  3IOR A;  4R9G A;  1IMB A;  4NGU A;  2ZNS A;  2PYY A;  2RC8 A;  4U22 A;  1S50 A;  3SET A;  3FXQ A;  1XT8 A;  4XXU A;  5TPA A;  2F35 A;  3IAZ A;  1Y9U A;  2JJK A;  3RNN A;  2MKZ A;  3PD8 A;  3GZG A;  3MJN A;  4GLI A;  4P1E A;  3E13 X;  1MQG A;  1EYK A;  1NNP A;  1MXV A;  5CMM A;  2BJI A;  5CBR A;  3T9U A;  2CZK A;  1GTK A;  3EN3 A;  3O28 A;  1N7W A;  1ZMG A;  3UA8 A;  3TZA A;  3GLB A;  3MQ9 A;  3QAX A;  4F31 B;  4N6D A;  4KD5 A;  5CBS A;  4X04 A;  1ZJL A;  4MF3 A;  2V84 A;  2FIE A;  1A40 A;  4UA8 A;  3RPL A;  4OTE A;  5I2K B;  3E3K A;  1B5J A;  1P1O A;  2VT5 A;  3AXF A;  4H46 A;  3THI A;  2GRV A;  1PB7 A;  4BLA A;  4GXS B;  4NED A;  1SPI A;  4MIJ A;  3TCG A;  2HAV A;  1FW0 A;  4AB6 A;  2RCA A;  3TAJ A;  2V3Q A;  4H1X A;  5FTI A;  1OVB A;  1MDQ A;  4LZ5 A;  2YLN A;  4LA9 A;  5JEI A;  1N76 A;  1SDX A;  1IMC A;  4HE0 A;  3FJG A;  4LVQ A;  4R2F A;  3B6Q A;  3PMX A;  1XHY A;  4HE2 A;  4M4G A;  4EF1 A;  5H8N A;  1QKB A;  4ZZA A;  4N15 A;  2BJJ X;  3PUZ E;  4U4X A;  5I2K A;  1LEV A;  1BTJ A;  3O2A A;  1MPC A;  2I49 A;  1Y3N A;  3DEL B;  3O9P A;  4QFP A;  5EQ7 A;  2XXY A;  5DEX B;  4DE8 A;  3FXR A;  4NF4 B;  4JXI A;  3CR9 A;  3TTK A;  4FAT A;  4WED A;  5KDT A;  1MS7 A;  2RKM A;  1B7H A;  1H44 A;  3S9E A;  1B58 A;  2Y5K A;  1QJM A;  1VDW A;  3LSL A;  1D9Q A;  5CC2 A;  2I4C A;  3M8U A;  4JSD A;  1UTH B;  2RIN A;  4QSC A;  2DP8 A;  3W9W A;  3UN6 A;  4OER A;  2F36 A;  4MNC A;  2Z8F A;  4HXV A;  1USY H;  4LZ8 A;  2Q2C A;  1TT1 A;  1P1N A;  2NUV A;  1RDX A;  3FVK A;  4RY1 A;  5L9O A;  2B3B A;  5B70 A;  3C35 A;  5I56 A;  3CG3 A;  3HCQ A;  1EYJ A;  4MH5 A;  2ZZW A;  4JB7 A;  1FPB A;  2ZYN A;  5F1Q A;  1UTB A;  1RDY A;  4G2Z A;  1EYI A;  3OO7 A;  2HHM A;  3C33 A;  5A5L A;  4MEV A;  1LBY A;  3N26 A;  1IEJ A;  3K01 A;  1I6Q A;  2XXX A;  1DMB A;  1USY E;  1FPJ A;  1US5 A;  2F7C A;  2HXW A;  4OA4 A;  3IO4 A;  4XIG Q;  2I6E A;  2X7P A;  3FVG A;  4DCY A;  4MAG A;  3UIF A;  4DDD A;  5ICQ A;  3RT6 B;  3EHT A;  3SEY A;  3TKD A;  1G0I A;  1IZ1 A;  2H9B A;  1NL5 A;  4JWO A;  4QBA A;  2ZYK A;  1YPN A;  1R1N A;  3T66 A;  3ZKL A;  3BFU A;  3UK4 A;  1F9B A;  2VPO A;  4WXJ A;  4ZEF A;  3IJX B;  3CVG A;  4O3C A;  4F2O A;  1FPK A;  4IO5 A;  4GWO A;  3G3G A;  4R6H A;  3RT8 A;  2UVI A;  1R6Z A;  3SKP A;  3TTL A;  2HPG A;  4NE4 A;  5EQ8 A;  1T0K A;  4HCY A;  5KCJ A;  4H5G A;  1FBH A;  5LOM A;  1LCF A;  4FEC A;  2Q9T A;  3TMG A;  4NWD A;  5HM4 B;  1RYX A;  3OXN A;  3T9X B;  4PFU A;  4LAT A;  2F97 A;  4XKP A;  1FCK A;  1DOT A;  4N91 A;  1B3G A;  4FAJ A;  3V8X B;  2DXR A;  1D9V A;  3B7D A;  1D9Y A;  2P1S A;  5AA1 A;  4KQP A;  5FBP A;  3EHU A;  1YTV A;  5TU0 A;  4KYS A;  4TQU Q;  1H76 A;  4G8N A;  4NHB A;  4NF6 A;  5KCJ B;  4BDR A;  3S9L C;  1O64 A;  3T0J A;  2F6P A;  1VSO A;  5I2N A;  2P0S A;  2Z8D A;  2XX7 A;  3K4U A;  4NF8 B;  4PAK A;  1WVJ A;  3KOS A;  5ICT A;  1LLS A;  1FSA A;  4I8C A;  4AQ4 A;  1SI0 A;  5CMB A;  1B32 A;  3K2D A;  1FPI A;  3ECR A;  4X1B A;  4ZZE A;  2AIX A;  3LC8 A;  1DTG A;  2DQV A;  1SBP A;  3OO8 A;  2HQ0 A;  3VXC A;  3H4Z A;  4R74 A;  1UQW A;  1SI1 A;  4ND9 A;  3QUF A;  4L17 A;  4F1V A;  2DSF A;  1INP A;  4GWY A;  3LR1 A;  1FTK A;  4PE5 B;  5I5P A;  4LN5 A;  5DEX A;  3FV1 A;  5EYH A;  2FVZ A;  4PC9 A;  5IKB A;  1KZ8 A;  4JSO A;  4LON B;  4RK2 A;  3SES A;  4AS5 A;  1Y3P A;  1MPB A;  4NX1 A;  4F19 A;  1VR5 A;  2ONR A;  3PPQ A;  4GVO A;  4Q30 B;  3K1N A;  1R9L A;  3EKI A;  2QS4 A;  3QIM A;  3LSF B;  3KN8 A;  4IY5 A;  1IXI A;  2Y7W A;  2F7B A;  2P3N A;  3C34 A;  4PFR A;  3HO7 A;  5I3S A;  1Y1M A;  1B40 A;  2Q2A A;  4THI A;  3MST A;  1MY1 A;  5EHS A;  1NH8 A;  1LBV A;  1UIV A;  3FBP A;  1DSN A;  4NG7 A;  1A55 A;  2PMS A;  1MXW A;  1NI9 A;  2ZYO A;  4KCD A;  3IOT A;  4PGP A;  1OLC A;  5ET7 A;  3S4U A;  4F18 A;  2UVH A;  1YAE A;  2DWA A;  1GV8 A;  2FIX A;  4G4P A;  4GL0 A;  5I58 A;  4IO3 A;  2DE2 A;  2DOJ A;  3Q29 A;  1EH3 A;  4U1Z A;  3U1O A;  3PPN A;  5H8H B;  3VXB A;  1LBC A;  4NF4 A;  2XWO A;  2A5T A;  3C36 A;  4EQ7 A;  3ONM A;  4GWU A;  1FRP A;  1B0H A;  1LFG A;  4NWC A;  3KG2 A;  1Y4T A;  4F22 A;  1SW1 A; 
#chains in the Genus database with same CATH homology
 1XI6 A;  4PCD A;  1FJ9 A;  4GBV A;  4GWY A;  4N6D A;  2QVU A;  4IR8 A;  4PDD A;  2HPG A;  2WEF A;  3W9W A;  4PE3 A;  1NUW A;  4MX6 A;  4X04 A;  1DCU A;  1KA1 A;  5I5P A;  4OVS A;  1YZ0 A;  5EYG A;  4LN5 A;  4MNC A;  5IGA A;  4PDH A;  4UAB A;  5EQ8 A;  3LUZ A;  2FIE A;  2DE4 A;  4HCY A;  2F3D A;  3RPL A;  5EYH A;  3MYU A;  1DBZ A;  3BIG A;  4HXV A;  4HCW A;  2Q8M A;  1FBH A;  2XWV A;  1LBX A;  1NUY A;  4PF6 A;  2FVZ A;  1FPG A;  3LV0 A;  4I3E A;  4PC9 A;  2VT5 A;  1NUZ A;  4H46 A;  2OX3 A;  1KZ8 A;  2Q9T A;  1RDX A;  2OWZ A;  1RDZ A;  4OVT A;  1IMF A;  4P3L A;  1KA0 A;  2XWI A;  4NN3 A;  2CZI A;  4GX3 A;  2FBP A;  4PTK A;  5EQ9 A;  4I3Y A;  1EYJ A;  1FBG A;  4AS5 A;  5IZ3 A;  2ZZW A;  1SPI A;  1DK4 A;  2PCR A;  1LBZ A;  4MJO A;  4QXD A;  4MIJ A;  4N17 A;  4O8M A;  4NX1 A;  1FBE A;  2Y5L A;  1FPB A;  2QFL A;  4GWS A;  4F19 A;  5ET6 A;  3KC0 A;  4PAI A;  5J1D A;  5IM2 A;  1YXI A;  2XA5 A;  1RDY A;  3B50 A;  4P47 A;  4DI3 D;  3EKI A;  4JVI A;  1EYI A;  3IFA A;  1FPL A;  2HHM A;  2PFZ A;  5ET8 A;  4N91 A;  2QVR A;  1FTA A;  5A5L A;  5J16 A;  2DE3 A;  2ZZX A;  4MEV A;  3BIH A;  4PAF A;  2V3Q A;  1IMA A;  2F3B A;  4GWZ A;  1LBY A;  2P3N A;  2WX9 A;  4MNP A;  4P9K A;  3SZP A;  4JVC A;  4OAN A;  4PFR A;  5I3S A;  2KR0 A;  1NV1 A;  4N4U A;  4OVP A;  4I40 A;  2QVV A;  1NUX A;  1QGX A;  3KC1 A;  1FPJ A;  1FBC A;  2R8T A;  2FHY A;  3D1R A;  4GWX A;  3MST A;  3HFU A;  1IMC A;  1LBV A;  1NV2 A;  5IZ3 B;  3ROJ A;  4OA4 A;  4GX6 A;  4HE0 A;  4JVD A;  4M1V A;  4O7M A;  4N8G A;  4GWW A;  2B4L A;  4XFE A;  2HXR A;  3E79 A;  3PTY A;  5EQA A;  3T1B A;  2WBB A;  5JK4 A;  1G0H A;  3FBP A;  4KXP A;  5FBP A;  5ET5 A;  2CEY A;  4NG7 A;  4X8R A;  1K9Y A;  4DI4 B;  4HE2 A;  4MAG A;  1NV3 A;  3A29 A;  4N15 A;  4NHB A;  4P1L A;  3QMF A;  5DW8 A;  3B8B A;  1NV7 A;  5LTC A;  4PFI A;  1LEV A;  1IME A;  2GQ1 A;  4H45 A;  4N81 A;  2L5V A;  1NI9 A;  3FXB A;  1FBF A;  1FJ6 A;  2Q74 A;  5T3J A;  2HZK A;  4PBQ A;  1AWB A;  1NV6 A;  4PFB A;  3T0J A;  1JP4 A;  1FPE A;  4AS4 A;  4HE1 A;  4MCO A;  2DDK A;  4X9T A;  4MNI A;  4PGP A;  4PF8 A;  3KBZ A;  5ET7 A;  4F18 A;  1IMD A;  1G0I A;  1YYZ A;  1IMB A;  1CNQ A;  4NGU A;  2WBD A;  5I7I A;  2XWK A;  4MMP A;  4NF0 A;  1FBD A;  5EQ7 A;  2F5X A;  1FPF A;  3GYY A;  2FIX A;  4PET A;  1NV4 A;  3IFC A;  2PFY A;  4PAK A;  4MHF A;  4PGN A;  4QBA A;  1FPD A;  4O7I A;  2DE2 A;  4FBP A;  1FSA A;  5ESY A;  2JJK A;  2XXK A;  3E78 A;  2ZZV A;  2MKZ A;  5LDZ A;  3RPL B;  4YIC A;  4YZZ A;  3CHG A;  1Q9D A;  1FPI A;  1NV0 A;  3U65 A;  2V4C A;  4P1E A;  5F24 A;  3W9V A;  2P3V A;  2CEX A;  2VPO A;  2QPQ A;  2DVZ A;  2XWO A;  1EYK A;  4O94 A;  1K9Z A;  1NV5 A;  4P8B A;  2WYP A;  4N6K A;  4F1U A;  2BJI A;  2Y5K A;  3NOH A;  5IZZ A;  4GWU A;  1FRP A;  1FPK A;  1VDW A;  2CZH A;  2KQZ A;  4NAP A;  3RYD A;  4G61 A;  2CZK A;  4GBW A;  4PBH A;  2B4M A;  3ISP A;  1D9Q A;  5IZ1 A;  1LBW A;  4GX4 A;  4NQ8 A;  4OVR A;  4OVQ A;  4XEQ A;  4F1V A;  2VPN A;  2WYK A;  4XF5 A;  4P56 A;  1INP A;  1FBP A;  5CM6 A;  2HZL A;  1BK4 A;  4N8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...