5ET5A

Human muscle fructose-1,6-bisphosphatase in active r-state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
324
structure length
282
Chain Sequence
b'TDMLTLTRYVMEELTQLLNSMLTAIKAISSAVRKAVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSIGTIFAIYRSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title T-to-R switch of muscle fructose-1,6-bisphosphatase involves fundamental changes of secondary and quaternary structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 90
structure length 282
sequence length 324
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et5A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et5A02
1NV1A 4FBPA 3IFCA 4GX3A 4I3EA 2Y5KA 1D9QA 1DK4A 1IMEA 3BIHA 1FPGA 4GX4A 1YXIA 5I3SA 4HE2A 4I40A 1XI6A 2FVZA 4G61A 4PTKA 2QFLA 5IZ1A 3B8BA 2WBDA 1CNQA 2FBPA 4QXDA 2Q74A 3T0JA 1FBEA 5F24A 1RDXA 5A5LA 2CZIA 2P3NA 4GWWA 1EYJA 1EYKA 1NV0A 1FPLA 4GBVA 2Y5LA 2DDKA 1FJ9A 3D1RA 2GQ1A 1IMFA 1YYZA 1KA1A 1NUXA 3KC0A 1FPKA 1YZ0A 2BJIA 3LUZA 1LBXA 2CZHA 5T3JA 1FPIA 1NV5A 4O7IA 4H45A 4GWXA 4KXPA 1NUWA 2OX3A 1EYIA 1FTAA 1Q9DA 3IFAA 1G0IA 4HE1A 5EQ9A 1RDYA 5EYGA 2WBBA 1FJ6A 2QVVA 3FBPA 3BIGA 2FIXA 1DCUA 5EYHA 3ROJA 1SPIA 1IMDA 4HXVA 1DBZA 2QVUA 5EQAA 3RPLA 1JP4A 4I3YA 1LEVA 1NV4A 3KC1A 5ET5A 1NV3A 1FRPA 2F3DA 1AWBA 1NV6A 1FBHA 1NV7A 2Q8MA 1K9ZA 1NV2A 2R8TA 3KBZA 1FBFA 3RPLB 2CZKA 5DW8A 2WEFA 4AS5A 4GWUA 4GWYA 4GWZA 1FPEA 5ET6A 1IMBA 1FBCA 1FPDA 1FBPA 4IR8A 1RDZA 5EQ7A 5ESYA 5IZ3A 1G0HA 2F3BA 1VDWA 1IMCA 4MJOA 4H46A 1FSAA 1KZ8A 2JJKA 1FBDA 1LBVA 1NUZA 2HHMA 4GWSA 1NUYA 2VT5A 1FPJA 1FPFA 1FPBA 1NI9A 2P3VA 1FBGA 1LBZA 1LBWA 5LDZA 5IZ3B 1K9YA 4HE0A 3LV0A 5ET7A 4GX6A 2PCRA 3RYDA 4AS4A 1KA0A 2OWZA 3A29A 1IMAA 2FIEA 1QGXA 3QMFA 2FHYA 5FBPA 5ET8A 4GBWA 4N81A 5J16A 1BK4A 5EQ8A 1INPA 1LBYA 2QVRA
chains in the Genus database with same CATH superfamily
2Q88A 4R6HA 1UTBB 4PETA 1JW5A 3V8XB 3MAMA 4DLDA 4OEUA 1I6QA 2R9JA 3PUZE 4PDHA 5ITPA 1B4HA 3SERA 2WBDA 4ONYA 3M8UA 3MZ1A 1J1NA 4IO3A 1PB7A 2XX8A 4LN5A 4R75A 1DPPA 1MRPA 4I8CA 4GWWA 1NV0A 4LONB 5TP9A 1FTLA 4KCCA 5K2YA 4F29A 2WBBA 2O1LA 2XWKA 1JVXA 4R74A 2H4IA 2DOJA 3MVZA 3TTLA 2MKZA 3MPKA 1MG1A 4KYEA 4OVQA 3FXUA 4C0RA 1FCKA 2PT1A 2YPNA 2V3QA 3G3JA 4KYDA 1FBFA 4KQPA 4PC9A 3K01A 2V84A 4O94A 3SKPA 1IQ7A 2F8DA 4N13A 3BKIB 1FBCA 4H1XA 1VSOA 2OK2A 2DXYA 3IK6B 3MUQA 1OVBA 4NWCA 2VD2A 1VFDA 2VOZA 4NF0A 3WAFA 3D4CA 4XTCQ 1ZIUA 2B4MA 2PCRA 5IZZA 4DXUA 4MNIA 5I59A 5DVFA 3MBPA 1NNPA 3E3KA 1INPA 2OWSA 3TYHA 3M3LA 3MYUA 3EHTA 5JEIA 2AYSA 3EKIA 5I3SA 3K02A 3FATA 5IZ1A 1AOVA 4ZECA 4NHBA 2P0SA 3IB1A 1ZKBA 2GH9A 3E4RA 1LFGA 2AL4A 2RC7A 2X7PA 1IIWA 2DP8A 5LOMA 2XXPA 3TQLA 4XEQA 4KXPA 1OVTA 4F2QA 2D3IA 1LFHA 5EYHA 3KSXA 3DLNA 3FXRA 3GZGA 3H03A 5B70A 1P1NA 3T9XB 4I3YA 4R9FA 3JV9A 2O68A 2QMXA 1SI1A 2XXUA 4GWUA 2VD3A 1IMBA 3OD7A 3QIMA 5DT6A 4OESA 5BWJA 3IOVA 4NF8A 4ZDMA 1NI9A 2H99A 4YKJA 5I59B 1AIVA 1MXWA 1N04A 5ELVA 4O7MA 4XIGQ 4Z0IA 3PU5A 2Q2CA 3TCGA 1VE4A 4R72A 5I7IA 3W9WA 3KJTA 3C31A 4PQJA 3K4UA 4FIMA 1B5HA 4GOTA 2I4CA 4LQ2A 1UTHB 1DSNA 2NVUB 3PUYE 4H0WA 3G3IA 3B50A 3UIFA 4FECA 4KR5A 4I3EA 4O3CA 4G2ZA 3VV5A 2ALUA 1FTJA 2OLBA 3OEMA 5L9OA 2FVZA 5KCJB 3TMGA 2QL3A 3CHGA 1RDXA 2CZIA 2OZZA 4THIA 1B1HA 2A5TA 4POXA 4RPOA 3KN3A 1M5BA 1KA1A 1YZ0A 1A99A 3EPEA 4OMBA 1B32A 4BLAA 4ELPA 4P8BA 1FJ6A 3FBPA 5H8HA 4HW8A 5AA2B 5LTCA 3MVYA 3MPLA 1AL3A 4GL0A 1XS5A 1NNFA 3LC8A 2ANJA 3C34A 1F9BA 5TPAA 2IA4A 4PFRA 5I58A 2PVUA 2OPEA 1LB9A 4PDDA 1JVYA 3CG3A 3L6GA 2ZYNA 2OPDA 4F2OA 1FSAA 2ONSA 5CBSA 4U2RA 2UVHA 3RNNA 2I0CA 5M2VA 1DPEA 3DP4A 3KOSA 3A29A 3CSGA 2QMWA 1A55A 4GD5A 3RN8A 2WYPA 2Y7RA 3FGSA 4AB6A 5F1QA 5EHSA 2B4LA 1Q35A 3QUFA 4QFLA 1P1QA 2DWJA 3VFJA 3QAXA 4GLIA 2QVRA 4IY6A 2Q8JA 3MJNA 1OQGA 4X9TA 2XXVA 3K1NA 1DTGA 2R6GE 4U22A 1LBBA 1D9VA 5I57B 1MQGA 5FHNA 1L5TA 2QRYA 3T96B 3DELB 4IB2A 4RY1A 1POTA 3LUYA 1H76A 2NOOA 5IAIA 4GXSB 2H5YA 2P2AA 1YYZA 1IEJA 1R9QA 3KEIA 1H44A 2XWVA 1FTAA 1Q9DA 1QKBA 4F1UA 1LFIA 1ATGA 5I2NA 1Z7ME 3MW0A 3I5OA 4ZE8A 1Y4CA 3HV1A 4QF9A 2F35A 2F3DA 3G3GA 4G68A 4PE5B 1FBHA 2XD2A 1NV2A 2ZYMA 3RPLB 4QFPA 3KN8A 1LGBC 1JNFA 3O2AA 4GWZA 5AA4B 5IZ3A 4KPTA 4GVOA 4XF5A 4XKQA 1FTKA 3FJ7A 3SETA 4ND9A 1FPFA 2P3VA 3C32A 1RYXA 1B7ZA 1K9YA 4JWYA 3LV0A 3FVOA 5ET7A 3SEVA 1QGXA 3MSTA 3HSTA 3C9HA 3TELA 2ONRA 2ZXTA 2RCBA 3IJOB 5FBPA 1FQFA 2ZNUA 4F3GA 4RNSA 4PAKA 3MP8A 3ZKKA 4L17A 3OOAA 1GGGA 4N6DA 3LSFB 4F19A 4PE3A 2ZZXA 3GLBA 2AL5A 2I6EA 1N7WA 4F1YA 3HHGA 3R26A 4EF2A 4QFOA 2UYFA 4R6KA 1LAXA 2G29A 4ZEKA 3FVKA 4YICA 4TLLB 2H25A 4QSDA 1PC3A 1DMBA 1YTVA 5B7DA 3DM0A 4ELRA 4EUOA 3MC2A 4IY5A 3TUSA 2PMSA 4HE1A 3KGCA 2REGA 3HN0A 3BIGA 4DI3D 2Z8EA 1IMDA 4EQ9A 1DBZA 5EQAA 3ONMA 1HSEA 3B6TA 1NL5A 4OEVA 1NV4A 1MPBA 1Y1MA 3U8QA 3USDA 4JSDA 2ZMBA 1OLAA 1FQCA 3TQWA 4I62A 4E0WA 2RKMA 4NF6A 2D5WA 1B46A 1B3GA 2QJEA 2O51A 4GWSA 4F31B 5DTBA 1DOTA 1JQFA 4YKIA 4NTLA 5H8FA 4HE0A 1N0TA 4G77A 4KHZE 3TTNA 4FAJA 1I69A 2Y7IA 4F18A 3TZAA 3PMWA 5DYHA 4OHNA 4GBWA 1QKAA 4N81A 4JB7A 5H8QB 5J16A 1FW0A 4GWYA 2ZNTA 1A40A 2XXKA 4RK9A 5CRYA 1ZTYA 1H45A 4U23A 3EN3A 1D9QA 3O28A 1DK4A 4NF5A 2G93A 3FXQA 1CNQA 2FBPA 4O3BA 3T0JA 4PF6A 4OWDA 3RTWB 3LSXA 4P11A 1PB9A 1B40A 1POY1 1NV5A 3OO9A 1XC1A 2I3WA 5FTHA 2RF1A 5CMKA 2QSXA 2O6AA 1LEVA 3G3HA 5CBRA 1S50A 2ZYOA 2XA5A 4MAGA 2RCAA 5H8NA 3F11A 1NV6A 1B7UA 3FASA 4F3PA 3H6VA 3QSLA 5K2XA 3GBAA 4ZZEA 4N8YA 1JEUA 2V93A 2XXYA 1VDWA 3TEPA 2R71A 2Z8FA 2GHBA 2DE3A 1VFEA 5LDZA 4K3FA 2NXOA 3KFMA 4MNPA 4LQ5A 2FIEA 1QULA 2FHYA 4MX6A 4F22A 3ILUB 1B0LA 3SEYA 3VXBA 4DCXA 4LVQA 3RQTA 3IFCA 3BFUA 3S9EA 4N6PA 4F1VA 1FBEA 3ZSFA 2DSFA 4IO6A 3PPNA 1MDQA 3D1RA 3RY3A 3LSLA 1IXHA 2OBGA 3OELA 3SEWA 3ZS6A 4OENA 1SYHA 1MDP1 3PV0E 1FQDA 3SZPA 5H8NB 5TP9B 3ROJA 4LZ5A 2QVUA 3H6TA 3K0VA 1MM6A 4MHFA 1HSJA 1NV3A 4JWOA 1NV7A 1BP5A 4ESXA 4YB5A 1H43A 3RTFB 2HAUA 3MP1A 5FTIA 1SD3A 4YZZA 3GBBA 4C1TA 4MFIA 4QFKA 4ELOA 3VLUA 1RDZA 1MXXA 3PPQA 5KDTA 4ZEIA 2F3BA 5I2KA 2KR0A 1MH3A 1FBGA 1LBZA 4FATA 3H3GA 1ZBMA 3O29A 4X04A 2X26A 1KA0A 1NMUA 2QS2A 3FJGA 1IMAA 4U4XA 1Y3PA 1SQYA 1NNKA 3PD9A 3QMFA 4GIZA 3CFXA 3P7IA 4JXIA 1B5JA 3N5LA 2REJA 4P3LA 3IORA 1NV1A 4GX3A 2CZLA 2X7QA 5EYFA 2CMOA 3KSJA 2QFLA 1OLCA 3BFTA 2O84X 2Q74A 3DP6A 4OTEA 5CI5A 3EQ1A 4H67A 3T9HB 1B3HA 3RPWA 3G7WA 1YAEA 5HPQA 4H45A 4KI0E 4MLVA 2NUVA 1Y20A 3SESA 4TQUQ 2WX9A 1TFDA 2QPQA 4HXVA 3I3VA 4G8MA 2Y7PA 3PGFA 4XFEA 4JSOA 3TCHA 4OXVA 1FRPA 4LUBA 2Q8MA 5KDTB 3PTYA 1LSTA 1FQEA 5IGAA 3RLFE 1VR5A 1D9YA 1FPEA 4LP2B 1EU8A 2PYYA 1BTJA 1H3DA 2DWIA 2PFZA 3W15C 1SI0A 5FHMA 1S9TA 1KZ8A 4LZ7A 5I56A 1M5DA 3BBRA 3FJMA 3HO7A 1SBPA 2B3BA 4GX6A 3N94A 1TXFA 1WDNA 4NF8B 4KYSA 3D4GA 4OVTA 4JBZA 4OYVA 4N91A 2V3TA 4DCYA 1M5CA 1MH4A 1XOCA 1N7XA 1JETA 3O6IA 5ITOA 1M5EA 3H06B 4NWDA 3BIHA 1Y1ZA 4GX4A 3N26A 3HCQA 1XI6A 1URDA 3O6HA 1JW4A 1LCFA 3OMBA 4QXDA 4NG7A 2HAVA 5F24A 4RA1A 3H6UA 3MVXA 3S4UA 4N6KA 3M3KA 1FPLA 2Y5LA 4RJZA 1SW4A 3OO6A 3LUZA 4OFOA 3FUZA 3UP9A 4F3SA 1B3LA 1MPCA 2A5TB 1RDYA 1SPIA 2I0BA 2F7CA 4QFNA 1LCTA 4YU0A 5H8HB 4NF4A 2QS3A 2F36A 1A8FA 3PPRA 3PPPA 1QUKA 2CZKA 3U93A 3TTKA 4OZ9A 1FPDA 5EQ7A 2PX1A 4OANA 1IUDA 1RKMA 4MIJA 5CMBA 2ZYKA 1N3WA 5TPAB 4EQBA 4Q8RA 5I58B 3E9XA 2VT5A 5I5PA 1SW1A 1BIYA 2CEXA 4R2FA 5CC2A 4BDOA 2XXHA 4DDDA 3VVFA 2E1SA 1II5A 1A54A 1PBPA 4OERA 4R9GA 3MZ9A 2V25A 4FORA 3IAZA 4OVSA 1NH7A 3K00A 3PUWE 3UA8A 5JK4A 5HBCA 5AE4A 4IO4A 4GQOA 2I49A 4OA4A 2UVJA 4GWOA 3Q27A 1N3XA 2V3UA 4ZEBA 4N07A 4I40A 4UA8A 3TCFA 3IL1B 2CEYA 2F78A 2P3NA 1EYJA 1LLSA 2F6PA 2PT2A 3E78A 3PUXE 4PBQA 2H9BA 2DQVA 2GQ1A 1IMFA 4PCDA 3UORA 4QHQA 2F7BA 3AXFA 1OMPA 1MQIA 3ILTB 5F7VA 2WKYA 1N76A 4MF3A 4Q5TA 1OIBA 1B2HA 4NQ8A 4RPNA 3K2DA 5L8DA 4H8IA 4MLQA 2XXIA 4ESWA 2DE4A 4U1ZA 4JVIA 1B4ZA 4IGRA 3MZBA 2HCAA 4N4UA 1MY3A 3IO6A 4DI4B 1Q1KA 5I2NB 3TTRA 1MXZA 3ECRA 2KQZA 1USYH 2QS4A 3TFLA 4G68B 2F5XA 3E79A 1ZJLA 2HFBA 4UACA 2THIA 3UN6A 4R2BA 2HHMA 1FPBA 1D4NA 1LBWA 5IZ3B 1NH8A 4G4PA 4QRZA 5CM6A 1R1NA 2UVIA 3UGWA 1B58A 4PBHA 3T93B 3IB0A 2XXRA 4H65A 2W7YA 3B7DA 1LB8A 4IO7A 1UTBA 4EF1A 2Z8DA 2PBWA 3VVDA 4N15A 2QS1A 5A5XA 2DDKA 1O7TA 3PPOA 1SW2A 4PFYA 3EHSA 4LATA 2XXXA 3V5AA 3W9VA 2VGQA 4DIGA 3LSWA 3G3FA 3IOTA 4PGNA 3WAEA 3U92A 3B8BA 2WYKA 4JVCA 1XVYA 4N8GA 1URSA 3S9LC 4MEVA 3DP8A 3T1BA 4U4SA 4WXJA 4GBVA 4YKKA 1TFAA 1FQAA 3KC0A 1SDXA 4BDNA 3O9PA 3OO7A 4O7IA 3HFUA 4GWXA 1FTMA 1YCJA 1ZMGA 3Q26A 4LA9A 1A8EA 1B3FA 5HM4B 4BDLA 4R6YA 5H8SA 5EYGA 1M5FA 1GVCA 4PFIA 3CVGA 4DE8A 3VVEA 3O66A 1XHYA 2VPOA 2HZKA 1LAGE 1US5A 5L9SA 4YMBA 1GTKA 4PAIA 1K9ZA 3A3UA 3O6GA 2DYXA 1B52A 1UQWA 3MWBA 1ZU0A 2Y84A 2H98A 1FBPA 3K6VA 3V89B 1R9LA 2XWIA 4H46A 3RGYA 4FEDA 1NUZA 4FE8A 4OVJA 4NF6B 1WODA 4BDQA 1SW5A 2ZZWA 1QJMA 3CG1A 4PF8A 1Z7NE 4EXKA 5A5XB 1CB6A 4X1BA 4YB6A 2DE2A 2B3FA 5H8FB 3OSRA 4IO2A 5JTYA 4XKNA 2O1MA 1QUIA 2GRVA 4GRKA 3TDJA 2GFEA 1B7HA 3ISPA 1KWHA 1FQBA 1IXGA 5ISUA 2VP1A 1IMEA 3RT8A 2HXRA 3PMXA 1Y3QA 4FEBA 3FV2A 2O69A 3LBSA 3OSQA 1B0HA 2XXQA 3ODBA 4NF5B 2VPNA 4POWA 3VLVA 2XHDA 1B6HA 1FPKA 2Q89A 3C36A 2OX3A 3CRBA 3KBRA 3KOTA 2HEUA 3IR1A 4HCWA 2FIXA 4ECFA 2O7IA 1EH3A 4XXUA 3QXMA 3U1OA 5IM2A 3LR1A 2DVZA 1AMFA 4NN3A 1ELJA 2Y7KA 3B6QA 4NEDA 5IKBA 1PB8A 2UXAA 4MH5A 3CFZA 3CI8A 4I9DA 3H7MA 1UIVA 2Q9TA 2YJPA 1G0HA 2DVCA 3MVWA 3VE1B 4MJOA 4RYAA 1LBVA 1R6ZA 3FV1A 4NAPA 5JTYB 1N84A 5J1DA 3HPIA 2ZNSA 1UTHA 2F7AA 2A5SA 4ISUA 2ONKE 1EZPA 3GXAA 3B6WA 3SEUA 3C4MA 4AQ4A 4EXLA 3N6UA 4F3BA 2Z22A 5FHOA 1GV8A 5KCJA 1Y9UA 2UVGA 5CMCA 1US4A 1FPGA 1YXIA 2HPGA 3VDFA 4EQ7A 4GF8A 4PTKA 5DEXA 3M3FA 2HZLA 2XX9A 3MP6A 4IGTA 3RUMA 5AA2A 2DXRA 1LBXA 4NX1A 1FPIA 3IFAA 5EQ9A 1D3KA 3T22A 2QVVA 4OFLA 3CSBA 3T9VA 1JW1A 4JWXA 2XXTA 1MY1A 4OFJA 2M8CA 1AWBA 4PFUA 4ZS9A 3K1PA 1IITA 1NKXA 3FVNA 4HCYA 3TKDA 5ESYA 3E13X 3N6TA 4NGUA 1UIUA 4P0GA 3IX1A 1OQHA 1O63A 3O97A 2XX7A 3K1MA 1AH5A 2HXWA 3KZGA 1MXVA 4G8NA 4QSEA 3KN7A 5I84A 5I2KB 4AS4A 4H5GA 2B65A 3OENA 4ZE9A 3QUJA 4P9KA 4MBPA 3KG2A 2HQ0A 4QBAA 1MQDA 5AA2D 1XT8A 3THIA 3CR9A 4MCOA 5DEXB 5I57A 5L9MA 3FXBA 4X48A 4GFRA 1MQJA 4FBPA 1JEVA 4ELQA 4NE4A 1MM7A 1A7LA 2XWOA 3TTMA 1B1XA 4U1OA 4H8JA 4KCDA 4WKMA 3OEKA 1QUJA 3PD8A 1MPDA 1FTOA 4GXAA 3CFLA 1QW0A 4YAHX 3VXCA 1P1OA 3Q25A 2YLNA 4PP0A 2NWJA 3SEXA 1NUXA 4YMAA 2CZHA 4JVDA 2F6GA 3U65A 1NUWA 1LAHE 1EYIA 4Q0CA 4KFQA 1G0IA 2ABHA 4ZEFA 4E0XA 1DCUA 2F97A 4PFBA 4YKPA 3RPLA 1JP4A 5ICTA 4OVPA 1NNTA 5AA3A 3MQ9A 1S7YA 5DVIA 2KLFA 3TODA 5AA4A 1SYIA 5EHMA 3KBZA 4ZZAA 4DXCA 2XD3A 1TT1A 3FIRA 2WEFA 4AS5A 3T9UA 4N17A 5ET6A 3CIJA 4XKPA 4BDMA 4IR8A 2GHAA 2L5VA 4ZEDA 2O7UA 5AA1A 4M1VA 3OXNA 3V83A 1MY2A 3QK6A 1I6AA 2VHAA 2I58A 3U72A 5I56B 3T66A 1LAFE 2Q2AA 4F39A 5ICQA 1O64A 1PDAA 2Y7WA 4M4GA 3IB2A 2I48A 3FZVA 2E0SA 2UYEA 5EQ8A 2F34A 1B05A 2P1SA 3EHUA 1P99A 4TLMB 1MY0A 3K6WA 3H6WA 1IZ1A 1Y4TA 1MXUA 4WEDA 2I4BA 4G61A 4X1DA 3JYRA 2V4CA 3IOUA 2BJJX 2ESNA 1EYKA 3A09A 4OVRA 3C35A 2PFYA 2BJIA 4O8MA 5T3JA 1EZOA 1IXCA 1ANFA 3HHFA 4XKRA 1URGA 1GR2A 4WEPA 3C33A 4Z7EA 3FD3A 4OQOA 4QSCA 3K6UA 2RC8A 1SVXB 3IJXB 3Q29A 3QYTA 3TAJA 4GL8A 3KC1A 3ZKLA 3G3KA 4O3AA 1MQHA 3FVGA 4PFTA 2D21A 1BLFA 4U21A 1P1UA 3TPAA 5CMMA 4NF4B 4X8RA 1PEBA 3GYYA 5KZTA 2JJKA 1QVSA 2DS9A 1NUYA 1FPJA 3RT6B 1NFTA 1RYOA 3RYDA 1Y3NA 4IO5A 1CE2A 5H8QA 3L6HA 4P1EA 2FYIA 2ZZVA 1YPNA 4MMPA 4P0IA 2OWTA 1MXYA 3R6UA 4NMYA 1BK4A 2LAOA 3KJ7A 1LBYA 1B3EA 1IXIA 4TOZA 4DZ1A 1MY4A 1ZLQA 4G68C 1DTZA 4P1LA 2Y5KA 2RINA 3PMVA 2DWHA 3A3CA 3IO4A 1I6BA 1USYE 3U94A 4HE2A 4H6DA 4YB7A 2DWAA 2RC9A 3IOWA 3NOHA 4P56A 3K6XA 4RXLA 4JDFA 1BKAA 5A5LA 2FA7A 1EZ9A 1WVJA 1TWYA 1FJ9A 3OO8A 4PFWA 4R73A 4EDPA 4FJPA 2FNCA 1LBCA 2AIXA 3S9NC 4OETA 1B5IA 2XXWA 4H5FA 1P1WA 4G8HA 4I1DA 3JZJA 2IEEA 4PGPA 5ET5A 4HS7A 4BDRA 2I3VA 2R8TA 5DVJA 3PUVE 1HSLA 5DW8A 4AB5A 3S9MC 1XVXA 2OCUA 4MNCA 4DXBA 1B9JA 4HTGA 1IMCA 4PAFA 3H4ZA 1FBDA 3R7XA 4UABA 4RK2A 2OJTA 4LZ8A 4P47A 2OWZA 1PBQA 4Q30B 3Q28A 5BUUA 1B51A 3I6VA 2Z23A 4C1UA 3SDFA 5ET8A 1T0KA 3UK4A 4KD5A 3S2VA 3EF7A 1MS7A 5TU0A 3VLWA
chains in the Genus database with same CATH topology
4N6DA 4PETA 4F19A 4PE3A 2ZZXA 3BIHA 1FPGA 4GX4A 1YXIA 2HPGA 1XI6A 4PTKA 4PDHA 2WBDA 4QXDA 2HZLA 4NG7A 5F24A 4LN5A 4GWWA 4N6KA 1NV0A 1FPLA 2Y5LA 4YICA 3LUZA 1LBXA 4NX1A 1FPIA 3IFAA 4HE1A 5EQ9A 1RDYA 2WBBA 2QVVA 2XWKA 3BIGA 4DI3D 1SPIA 1IMDA 1DBZA 5EQAA 2MKZA 4OVQA 1NV4A 1AWBA 2V3QA 1FBFA 4PC9A 2CZKA 4O94A 4HCYA 1FBCA 1FPDA 5EQ7A 5ESYA 4OANA 4NGUA 4MIJA 4GWSA 2VT5A 5I5PA 4NF0A 2CEXA 4HE0A 2B4MA 2PCRA 4AS4A 5IZZA 4MNIA 4P9KA 4F18A 4QBAA 4OVSA 4GBWA 4N81A 4MCOA 5J16A 1INPA 4GWYA 5JK4A 2XXKA 3FXBA 4FBPA 4OA4A 3MYUA 1D9QA 1DK4A 2XWOA 3EKIA 5I3SA 4I40A 5IZ1A 1CNQA 2FBPA 3T0JA 2CEYA 4NHBA 4PF6A 2P3NA 1EYJA 3E78A 4PBQA 2GQ1A 1IMFA 4PCDA 1NUXA 2CZHA 1NV5A 4JVDA 4XEQA 4KXPA 3U65A 1NUWA 1EYIA 1G0IA 4NQ8A 1DCUA 5EYHA 2DE4A 4PFBA 4JVIA 3RPLA 1JP4A 4I3YA 4OVPA 4N4UA 1LEVA 4DI4B 2XA5A 4MAGA 1NV6A 3KBZA 2WEFA 4AS5A 4GWUA 4N17A 2KQZA 5ET6A 1IMBA 4IR8A 4N8YA 2L5VA 2F5XA 3E79A 1VDWA 2HHMA 4M1VA 1FPBA 1NI9A 2DE3A 1LBWA 5LDZA 5IZ3B 5CM6A 4O7MA 4MNPA 4PBHA 5I7IA 2FIEA 3W9WA 2FHYA 4MX6A 4N15A 5EQ8A 2DDKA 3B50A 3IFCA 4I3EA 3W9VA 4F1VA 4G61A 2FVZA 4PGNA 3B8BA 2WYKA 4JVCA 2V4CA 1FBEA 4N8GA 3CHGA 1RDXA 2CZIA 4MEVA 3T1BA 1EYKA 4GBVA 3D1RA 4OVRA 2PFYA 1KA1A 3KC0A 1YZ0A 2BJIA 4O8MA 5T3JA 4O7IA 3HFUA 4GWXA 5EYGA 4P8BA 1FJ6A 3FBPA 4PFIA 3SZPA 3ROJA 5LTCA 2VPOA 2HZKA 2QVUA 4MHFA 3KC1A 1NV3A 4PAIA 1NV7A 1K9ZA 4PFRA 4YZZA 4X8RA 4PDDA 1FBPA 1RDZA 3GYYA 2F3BA 2XWIA 2KR0A 4H46A 1FSAA 2JJKA 1NUZA 1NUYA 1FPJA 1FBGA 1LBZA 2ZZWA 4PF8A 3RYDA 4X04A 1KA0A 3A29A 1IMAA 4P1EA 2ZZVA 2WYPA 3QMFA 2DE2A 4MMPA 2B4LA 1BK4A 4P3LA 3ISPA 1LBYA 2QVRA 1NV1A 4GX3A 4X9TA 4P1LA 2Y5KA 1IMEA 2HXRA 4HE2A 2QFLA 3NOHA 4P56A 2Q74A 5A5LA 2VPNA 1FJ9A 1YYZA 1FPKA 4H45A 2OX3A 2XWVA 1FTAA 1Q9DA 4F1UA 4HCWA 2WX9A 2FIXA 2QPQA 4HXVA 5IM2A 2DVZA 4XFEA 4PGPA 5ET5A 4NN3A 1FRPA 2F3DA 2Q8MA 1FBHA 3PTYA 1NV2A 2R8TA 3RPLB 5IGAA 5DW8A 4GWZA 1FPEA 4MNCA 2Q9TA 5IZ3A 1G0HA 4XF5A 2PFZA 1IMCA 4MJOA 4PAFA 1KZ8A 1FBDA 1LBVA 1FPFA 2P3VA 4UABA 4NAPA 1K9YA 3LV0A 5ET7A 5J1DA 4GX6A 4P47A 2OWZA 1QGXA 3MSTA 4OVTA 5FBPA 4PAKA 4N91A 5ET8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV1 A;  4FBP A;  3IFC A;  4GX3 A;  4I3E A;  2Y5K A;  1D9Q A;  1DK4 A;  1IME A;  3BIH A;  1FPG A;  4GX4 A;  1YXI A;  5I3S A;  4HE2 A;  4I40 A;  1XI6 A;  2FVZ A;  4G61 A;  4PTK A;  2QFL A;  5IZ1 A;  3B8B A;  2WBD A;  1CNQ A;  2FBP A;  4QXD A;  2Q74 A;  3T0J A;  1FBE A;  5F24 A;  1RDX A;  5A5L A;  2CZI A;  2P3N A;  4GWW A;  1EYJ A;  1EYK A;  1NV0 A;  1FPL A;  4GBV A;  2Y5L A;  2DDK A;  1FJ9 A;  3D1R A;  2GQ1 A;  1IMF A;  1YYZ A;  1KA1 A;  1NUX A;  3KC0 A;  1FPK A;  1YZ0 A;  2BJI A;  3LUZ A;  1LBX A;  2CZH A;  5T3J A;  1FPI A;  1NV5 A;  4O7I A;  4H45 A;  4GWX A;  4KXP A;  1NUW A;  2OX3 A;  1EYI A;  1FTA A;  1Q9D A;  3IFA A;  1G0I A;  4HE1 A;  5EQ9 A;  1RDY A;  5EYG A;  2WBB A;  1FJ6 A;  2QVV A;  3FBP A;  3BIG A;  2FIX A;  1DCU A;  5EYH A;  3ROJ A;  1SPI A;  1IMD A;  4HXV A;  1DBZ A;  2QVU A;  5EQA A;  3RPL A;  1JP4 A;  4I3Y A;  1LEV A;  1NV4 A;  3KC1 A;  5ET5 A;  1NV3 A;  1FRP A;  2F3D A;  1AWB A;  1NV6 A;  1FBH A;  1NV7 A;  2Q8M A;  1K9Z A;  1NV2 A;  2R8T A;  3KBZ A;  1FBF A;  3RPL B;  2CZK A;  5DW8 A;  2WEF A;  4AS5 A;  4GWU A;  4GWY A;  4GWZ A;  1FPE A;  5ET6 A;  1IMB A;  1FBC A;  1FPD A;  1FBP A;  4IR8 A;  1RDZ A;  5EQ7 A;  5ESY A;  5IZ3 A;  1G0H A;  2F3B A;  1VDW A;  1IMC A;  4MJO A;  4H46 A;  1FSA A;  1KZ8 A;  2JJK A;  1FBD A;  1LBV A;  1NUZ A;  2HHM A;  4GWS A;  1NUY A;  2VT5 A;  1FPJ A;  1FPF A;  1FPB A;  1NI9 A;  2P3V A;  1FBG A;  1LBZ A;  1LBW A;  5LDZ A;  5IZ3 B;  1K9Y A;  4HE0 A;  3LV0 A;  5ET7 A;  4GX6 A;  2PCR A;  3RYD A;  4AS4 A;  1KA0 A;  2OWZ A;  3A29 A;  1IMA A;  2FIE A;  1QGX A;  3QMF A;  2FHY A;  5FBP A;  5ET8 A;  4GBW A;  4N81 A;  5J16 A;  1BK4 A;  5EQ8 A;  1INP A;  1LBY A;  2QVR A; 
#chains in the Genus database with same CATH topology
 2Q88 A;  4R6H A;  1UTB B;  4PET A;  1JW5 A;  3V8X B;  3MAM A;  4DLD A;  4OEU A;  1I6Q A;  2R9J A;  3PUZ E;  4PDH A;  5ITP A;  1B4H A;  3SER A;  2WBD A;  4ONY A;  3M8U A;  3MZ1 A;  1J1N A;  4IO3 A;  1PB7 A;  2XX8 A;  4LN5 A;  4R75 A;  1DPP A;  1MRP A;  4I8C A;  4GWW A;  1NV0 A;  4LON B;  5TP9 A;  1FTL A;  4KCC A;  5K2Y A;  4F29 A;  2WBB A;  2O1L A;  2XWK A;  1JVX A;  4R74 A;  2H4I A;  2DOJ A;  3MVZ A;  3TTL A;  2MKZ A;  3MPK A;  1MG1 A;  4KYE A;  4OVQ A;  3FXU A;  4C0R A;  1FCK A;  2PT1 A;  2YPN A;  2V3Q A;  3G3J A;  4KYD A;  1FBF A;  4KQP A;  4PC9 A;  3K01 A;  2V84 A;  4O94 A;  3SKP A;  1IQ7 A;  2F8D A;  4N13 A;  3BKI B;  1FBC A;  4H1X A;  1VSO A;  2OK2 A;  2DXY A;  3IK6 B;  3MUQ A;  1OVB A;  4NWC A;  2VD2 A;  1VFD A;  2VOZ A;  4NF0 A;  3WAF A;  3D4C A;  4XTC Q;  1ZIU A;  2B4M A;  2PCR A;  5IZZ A;  4DXU A;  4MNI A;  5I59 A;  5DVF A;  3MBP A;  1NNP A;  3E3K A;  1INP A;  2OWS A;  3TYH A;  3M3L A;  3MYU A;  3EHT A;  5JEI A;  2AYS A;  3EKI A;  5I3S A;  3K02 A;  3FAT A;  5IZ1 A;  1AOV A;  4ZEC A;  4NHB A;  2P0S A;  3IB1 A;  1ZKB A;  2GH9 A;  3E4R A;  1LFG A;  2AL4 A;  2RC7 A;  2X7P A;  1IIW A;  2DP8 A;  5LOM A;  2XXP A;  3TQL A;  4XEQ A;  4KXP A;  1OVT A;  4F2Q A;  2D3I A;  1LFH A;  5EYH A;  3KSX A;  3DLN A;  3FXR A;  3GZG A;  3H03 A;  5B70 A;  1P1N A;  3T9X B;  4I3Y A;  4R9F A;  3JV9 A;  2O68 A;  2QMX A;  1SI1 A;  2XXU A;  4GWU A;  2VD3 A;  1IMB A;  3OD7 A;  3QIM A;  5DT6 A;  4OES A;  5BWJ A;  3IOV A;  4NF8 A;  4ZDM A;  1NI9 A;  2H99 A;  4YKJ A;  5I59 B;  1AIV A;  1MXW A;  1N04 A;  5ELV A;  4O7M A;  4XIG Q;  4Z0I A;  3PU5 A;  2Q2C A;  3TCG A;  1VE4 A;  4R72 A;  5I7I A;  3W9W A;  3KJT A;  3C31 A;  4PQJ A;  3K4U A;  4FIM A;  1B5H A;  4GOT A;  2I4C A;  4LQ2 A;  1UTH B;  1DSN A;  2NVU B;  3PUY E;  4H0W A;  3G3I A;  3B50 A;  3UIF A;  4FEC A;  4KR5 A;  4I3E A;  4O3C A;  4G2Z A;  3VV5 A;  2ALU A;  1FTJ A;  2OLB A;  3OEM A;  5L9O A;  2FVZ A;  5KCJ B;  3TMG A;  2QL3 A;  3CHG A;  1RDX A;  2CZI A;  2OZZ A;  4THI A;  1B1H A;  2A5T A;  4POX A;  4RPO A;  3KN3 A;  1M5B A;  1KA1 A;  1YZ0 A;  1A99 A;  3EPE A;  4OMB A;  1B32 A;  4BLA A;  4ELP A;  4P8B A;  1FJ6 A;  3FBP A;  5H8H A;  4HW8 A;  5AA2 B;  5LTC A;  3MVY A;  3MPL A;  1AL3 A;  4GL0 A;  1XS5 A;  1NNF A;  3LC8 A;  2ANJ A;  3C34 A;  1F9B A;  5TPA A;  2IA4 A;  4PFR A;  5I58 A;  2PVU A;  2OPE A;  1LB9 A;  4PDD A;  1JVY A;  3CG3 A;  3L6G A;  2ZYN A;  2OPD A;  4F2O A;  1FSA A;  2ONS A;  5CBS A;  4U2R A;  2UVH A;  3RNN A;  2I0C A;  5M2V A;  1DPE A;  3DP4 A;  3KOS A;  3A29 A;  3CSG A;  2QMW A;  1A55 A;  4GD5 A;  3RN8 A;  2WYP A;  2Y7R A;  3FGS A;  4AB6 A;  5F1Q A;  5EHS A;  2B4L A;  1Q35 A;  3QUF A;  4QFL A;  1P1Q A;  2DWJ A;  3VFJ A;  3QAX A;  4GLI A;  2QVR A;  4IY6 A;  2Q8J A;  3MJN A;  1OQG A;  4X9T A;  2XXV A;  3K1N A;  1DTG A;  2R6G E;  4U22 A;  1LBB A;  1D9V A;  5I57 B;  1MQG A;  5FHN A;  1L5T A;  2QRY A;  3T96 B;  3DEL B;  4IB2 A;  4RY1 A;  1POT A;  3LUY A;  1H76 A;  2NOO A;  5IAI A;  4GXS B;  2H5Y A;  2P2A A;  1YYZ A;  1IEJ A;  1R9Q A;  3KEI A;  1H44 A;  2XWV A;  1FTA A;  1Q9D A;  1QKB A;  4F1U A;  1LFI A;  1ATG A;  5I2N A;  1Z7M E;  3MW0 A;  3I5O A;  4ZE8 A;  1Y4C A;  3HV1 A;  4QF9 A;  2F35 A;  2F3D A;  3G3G A;  4G68 A;  4PE5 B;  1FBH A;  2XD2 A;  1NV2 A;  2ZYM A;  3RPL B;  4QFP A;  3KN8 A;  1LGB C;  1JNF A;  3O2A A;  4GWZ A;  5AA4 B;  5IZ3 A;  4KPT A;  4GVO A;  4XF5 A;  4XKQ A;  1FTK A;  3FJ7 A;  3SET A;  4ND9 A;  1FPF A;  2P3V A;  3C32 A;  1RYX A;  1B7Z A;  1K9Y A;  4JWY A;  3LV0 A;  3FVO A;  5ET7 A;  3SEV A;  1QGX A;  3MST A;  3HST A;  3C9H A;  3TEL A;  2ONR A;  2ZXT A;  2RCB A;  3IJO B;  5FBP A;  1FQF A;  2ZNU A;  4F3G A;  4RNS A;  4PAK A;  3MP8 A;  3ZKK A;  4L17 A;  3OOA A;  1GGG A;  4N6D A;  3LSF B;  4F19 A;  4PE3 A;  2ZZX A;  3GLB A;  2AL5 A;  2I6E A;  1N7W A;  4F1Y A;  3HHG A;  3R26 A;  4EF2 A;  4QFO A;  2UYF A;  4R6K A;  1LAX A;  2G29 A;  4ZEK A;  3FVK A;  4YIC A;  4TLL B;  2H25 A;  4QSD A;  1PC3 A;  1DMB A;  1YTV A;  5B7D A;  3DM0 A;  4ELR A;  4EUO A;  3MC2 A;  4IY5 A;  3TUS A;  2PMS A;  4HE1 A;  3KGC A;  2REG A;  3HN0 A;  3BIG A;  4DI3 D;  2Z8E A;  1IMD A;  4EQ9 A;  1DBZ A;  5EQA A;  3ONM A;  1HSE A;  3B6T A;  1NL5 A;  4OEV A;  1NV4 A;  1MPB A;  1Y1M A;  3U8Q A;  3USD A;  4JSD A;  2ZMB A;  1OLA A;  1FQC A;  3TQW A;  4I62 A;  4E0W A;  2RKM A;  4NF6 A;  2D5W A;  1B46 A;  1B3G A;  2QJE A;  2O51 A;  4GWS A;  4F31 B;  5DTB A;  1DOT A;  1JQF A;  4YKI A;  4NTL A;  5H8F A;  4HE0 A;  1N0T A;  4G77 A;  4KHZ E;  3TTN A;  4FAJ A;  1I69 A;  2Y7I A;  4F18 A;  3TZA A;  3PMW A;  5DYH A;  4OHN A;  4GBW A;  1QKA A;  4N81 A;  4JB7 A;  5H8Q B;  5J16 A;  1FW0 A;  4GWY A;  2ZNT A;  1A40 A;  2XXK A;  4RK9 A;  5CRY A;  1ZTY A;  1H45 A;  4U23 A;  3EN3 A;  1D9Q A;  3O28 A;  1DK4 A;  4NF5 A;  2G93 A;  3FXQ A;  1CNQ A;  2FBP A;  4O3B A;  3T0J A;  4PF6 A;  4OWD A;  3RTW B;  3LSX A;  4P11 A;  1PB9 A;  1B40 A;  1POY 1;  1NV5 A;  3OO9 A;  1XC1 A;  2I3W A;  5FTH A;  2RF1 A;  5CMK A;  2QSX A;  2O6A A;  1LEV A;  3G3H A;  5CBR A;  1S50 A;  2ZYO A;  2XA5 A;  4MAG A;  2RCA A;  5H8N A;  3F11 A;  1NV6 A;  1B7U A;  3FAS A;  4F3P A;  3H6V A;  3QSL A;  5K2X A;  3GBA A;  4ZZE A;  4N8Y A;  1JEU A;  2V93 A;  2XXY A;  1VDW A;  3TEP A;  2R71 A;  2Z8F A;  2GHB A;  2DE3 A;  1VFE A;  5LDZ A;  4K3F A;  2NXO A;  3KFM A;  4MNP A;  4LQ5 A;  2FIE A;  1QUL A;  2FHY A;  4MX6 A;  4F22 A;  3ILU B;  1B0L A;  3SEY A;  3VXB A;  4DCX A;  4LVQ A;  3RQT A;  3IFC A;  3BFU A;  3S9E A;  4N6P A;  4F1V A;  1FBE A;  3ZSF A;  2DSF A;  4IO6 A;  3PPN A;  1MDQ A;  3D1R A;  3RY3 A;  3LSL A;  1IXH A;  2OBG A;  3OEL A;  3SEW A;  3ZS6 A;  4OEN A;  1SYH A;  1MDP 1;  3PV0 E;  1FQD A;  3SZP A;  5H8N B;  5TP9 B;  3ROJ A;  4LZ5 A;  2QVU A;  3H6T A;  3K0V A;  1MM6 A;  4MHF A;  1HSJ A;  1NV3 A;  4JWO A;  1NV7 A;  1BP5 A;  4ESX A;  4YB5 A;  1H43 A;  3RTF B;  2HAU A;  3MP1 A;  5FTI A;  1SD3 A;  4YZZ A;  3GBB A;  4C1T A;  4MFI A;  4QFK A;  4ELO A;  3VLU A;  1RDZ A;  1MXX A;  3PPQ A;  5KDT A;  4ZEI A;  2F3B A;  5I2K A;  2KR0 A;  1MH3 A;  1FBG A;  1LBZ A;  4FAT A;  3H3G A;  1ZBM A;  3O29 A;  4X04 A;  2X26 A;  1KA0 A;  1NMU A;  2QS2 A;  3FJG A;  1IMA A;  4U4X A;  1Y3P A;  1SQY A;  1NNK A;  3PD9 A;  3QMF A;  4GIZ A;  3CFX A;  3P7I A;  4JXI A;  1B5J A;  3N5L A;  2REJ A;  4P3L A;  3IOR A;  1NV1 A;  4GX3 A;  2CZL A;  2X7Q A;  5EYF A;  2CMO A;  3KSJ A;  2QFL A;  1OLC A;  3BFT A;  2O84 X;  2Q74 A;  3DP6 A;  4OTE A;  5CI5 A;  3EQ1 A;  4H67 A;  3T9H B;  1B3H A;  3RPW A;  3G7W A;  1YAE A;  5HPQ A;  4H45 A;  4KI0 E;  4MLV A;  2NUV A;  1Y20 A;  3SES A;  4TQU Q;  2WX9 A;  1TFD A;  2QPQ A;  4HXV A;  3I3V A;  4G8M A;  2Y7P A;  3PGF A;  4XFE A;  4JSO A;  3TCH A;  4OXV A;  1FRP A;  4LUB A;  2Q8M A;  5KDT B;  3PTY A;  1LST A;  1FQE A;  5IGA A;  3RLF E;  1VR5 A;  1D9Y A;  1FPE A;  4LP2 B;  1EU8 A;  2PYY A;  1BTJ A;  1H3D A;  2DWI A;  2PFZ A;  3W15 C;  1SI0 A;  5FHM A;  1S9T A;  1KZ8 A;  4LZ7 A;  5I56 A;  1M5D A;  3BBR A;  3FJM A;  3HO7 A;  1SBP A;  2B3B A;  4GX6 A;  3N94 A;  1TXF A;  1WDN A;  4NF8 B;  4KYS A;  3D4G A;  4OVT A;  4JBZ A;  4OYV A;  4N91 A;  2V3T A;  4DCY A;  1M5C A;  1MH4 A;  1XOC A;  1N7X A;  1JET A;  3O6I A;  5ITO A;  1M5E A;  3H06 B;  4NWD A;  3BIH A;  1Y1Z A;  4GX4 A;  3N26 A;  3HCQ A;  1XI6 A;  1URD A;  3O6H A;  1JW4 A;  1LCF A;  3OMB A;  4QXD A;  4NG7 A;  2HAV A;  5F24 A;  4RA1 A;  3H6U A;  3MVX A;  3S4U A;  4N6K A;  3M3K A;  1FPL A;  2Y5L A;  4RJZ A;  1SW4 A;  3OO6 A;  3LUZ A;  4OFO A;  3FUZ A;  3UP9 A;  4F3S A;  1B3L A;  1MPC A;  2A5T B;  1RDY A;  1SPI A;  2I0B A;  2F7C A;  4QFN A;  1LCT A;  4YU0 A;  5H8H B;  4NF4 A;  2QS3 A;  2F36 A;  1A8F A;  3PPR A;  3PPP A;  1QUK A;  2CZK A;  3U93 A;  3TTK A;  4OZ9 A;  1FPD A;  5EQ7 A;  2PX1 A;  4OAN A;  1IUD A;  1RKM A;  4MIJ A;  5CMB A;  2ZYK A;  1N3W A;  5TPA B;  4EQB A;  4Q8R A;  5I58 B;  3E9X A;  2VT5 A;  5I5P A;  1SW1 A;  1BIY A;  2CEX A;  4R2F A;  5CC2 A;  4BDO A;  2XXH A;  4DDD A;  3VVF A;  2E1S A;  1II5 A;  1A54 A;  1PBP A;  4OER A;  4R9G A;  3MZ9 A;  2V25 A;  4FOR A;  3IAZ A;  4OVS A;  1NH7 A;  3K00 A;  3PUW E;  3UA8 A;  5JK4 A;  5HBC A;  5AE4 A;  4IO4 A;  4GQO A;  2I49 A;  4OA4 A;  2UVJ A;  4GWO A;  3Q27 A;  1N3X A;  2V3U A;  4ZEB A;  4N07 A;  4I40 A;  4UA8 A;  3TCF A;  3IL1 B;  2CEY A;  2F78 A;  2P3N A;  1EYJ A;  1LLS A;  2F6P A;  2PT2 A;  3E78 A;  3PUX E;  4PBQ A;  2H9B A;  2DQV A;  2GQ1 A;  1IMF A;  4PCD A;  3UOR A;  4QHQ A;  2F7B A;  3AXF A;  1OMP A;  1MQI A;  3ILT B;  5F7V A;  2WKY A;  1N76 A;  4MF3 A;  4Q5T A;  1OIB A;  1B2H A;  4NQ8 A;  4RPN A;  3K2D A;  5L8D A;  4H8I A;  4MLQ A;  2XXI A;  4ESW A;  2DE4 A;  4U1Z A;  4JVI A;  1B4Z A;  4IGR A;  3MZB A;  2HCA A;  4N4U A;  1MY3 A;  3IO6 A;  4DI4 B;  1Q1K A;  5I2N B;  3TTR A;  1MXZ A;  3ECR A;  2KQZ A;  1USY H;  2QS4 A;  3TFL A;  4G68 B;  2F5X A;  3E79 A;  1ZJL A;  2HFB A;  4UAC A;  2THI A;  3UN6 A;  4R2B A;  2HHM A;  1FPB A;  1D4N A;  1LBW A;  5IZ3 B;  1NH8 A;  4G4P A;  4QRZ A;  5CM6 A;  1R1N A;  2UVI A;  3UGW A;  1B58 A;  4PBH A;  3T93 B;  3IB0 A;  2XXR A;  4H65 A;  2W7Y A;  3B7D A;  1LB8 A;  4IO7 A;  1UTB A;  4EF1 A;  2Z8D A;  2PBW A;  3VVD A;  4N15 A;  2QS1 A;  5A5X A;  2DDK A;  1O7T A;  3PPO A;  1SW2 A;  4PFY A;  3EHS A;  4LAT A;  2XXX A;  3V5A A;  3W9V A;  2VGQ A;  4DIG A;  3LSW A;  3G3F A;  3IOT A;  4PGN A;  3WAE A;  3U92 A;  3B8B A;  2WYK A;  4JVC A;  1XVY A;  4N8G A;  1URS A;  3S9L C;  4MEV A;  3DP8 A;  3T1B A;  4U4S A;  4WXJ A;  4GBV A;  4YKK A;  1TFA A;  1FQA A;  3KC0 A;  1SDX A;  4BDN A;  3O9P A;  3OO7 A;  4O7I A;  3HFU A;  4GWX A;  1FTM A;  1YCJ A;  1ZMG A;  3Q26 A;  4LA9 A;  1A8E A;  1B3F A;  5HM4 B;  4BDL A;  4R6Y A;  5H8S A;  5EYG A;  1M5F A;  1GVC A;  4PFI A;  3CVG A;  4DE8 A;  3VVE A;  3O66 A;  1XHY A;  2VPO A;  2HZK A;  1LAG E;  1US5 A;  5L9S A;  4YMB A;  1GTK A;  4PAI A;  1K9Z A;  3A3U A;  3O6G A;  2DYX A;  1B52 A;  1UQW A;  3MWB A;  1ZU0 A;  2Y84 A;  2H98 A;  1FBP A;  3K6V A;  3V89 B;  1R9L A;  2XWI A;  4H46 A;  3RGY A;  4FED A;  1NUZ A;  4FE8 A;  4OVJ A;  4NF6 B;  1WOD A;  4BDQ A;  1SW5 A;  2ZZW A;  1QJM A;  3CG1 A;  4PF8 A;  1Z7N E;  4EXK A;  5A5X B;  1CB6 A;  4X1B A;  4YB6 A;  2DE2 A;  2B3F A;  5H8F B;  3OSR A;  4IO2 A;  5JTY A;  4XKN A;  2O1M A;  1QUI A;  2GRV A;  4GRK A;  3TDJ A;  2GFE A;  1B7H A;  3ISP A;  1KWH A;  1FQB A;  1IXG A;  5ISU A;  2VP1 A;  1IME A;  3RT8 A;  2HXR A;  3PMX A;  1Y3Q A;  4FEB A;  3FV2 A;  2O69 A;  3LBS A;  3OSQ A;  1B0H A;  2XXQ A;  3ODB A;  4NF5 B;  2VPN A;  4POW A;  3VLV A;  2XHD A;  1B6H A;  1FPK A;  2Q89 A;  3C36 A;  2OX3 A;  3CRB A;  3KBR A;  3KOT A;  2HEU A;  3IR1 A;  4HCW A;  2FIX A;  4ECF A;  2O7I A;  1EH3 A;  4XXU A;  3QXM A;  3U1O A;  5IM2 A;  3LR1 A;  2DVZ A;  1AMF A;  4NN3 A;  1ELJ A;  2Y7K A;  3B6Q A;  4NED A;  5IKB A;  1PB8 A;  2UXA A;  4MH5 A;  3CFZ A;  3CI8 A;  4I9D A;  3H7M A;  1UIV A;  2Q9T A;  2YJP A;  1G0H A;  2DVC A;  3MVW A;  3VE1 B;  4MJO A;  4RYA A;  1LBV A;  1R6Z A;  3FV1 A;  4NAP A;  5JTY B;  1N84 A;  5J1D A;  3HPI A;  2ZNS A;  1UTH A;  2F7A A;  2A5S A;  4ISU A;  2ONK E;  1EZP A;  3GXA A;  3B6W A;  3SEU A;  3C4M A;  4AQ4 A;  4EXL A;  3N6U A;  4F3B A;  2Z22 A;  5FHO A;  1GV8 A;  5KCJ A;  1Y9U A;  2UVG A;  5CMC A;  1US4 A;  1FPG A;  1YXI A;  2HPG A;  3VDF A;  4EQ7 A;  4GF8 A;  4PTK A;  5DEX A;  3M3F A;  2HZL A;  2XX9 A;  3MP6 A;  4IGT A;  3RUM A;  5AA2 A;  2DXR A;  1LBX A;  4NX1 A;  1FPI A;  3IFA A;  5EQ9 A;  1D3K A;  3T22 A;  2QVV A;  4OFL A;  3CSB A;  3T9V A;  1JW1 A;  4JWX A;  2XXT A;  1MY1 A;  4OFJ A;  2M8C A;  1AWB A;  4PFU A;  4ZS9 A;  3K1P A;  1IIT A;  1NKX A;  3FVN A;  4HCY A;  3TKD A;  5ESY A;  3E13 X;  3N6T A;  4NGU A;  1UIU A;  4P0G A;  3IX1 A;  1OQH A;  1O63 A;  3O97 A;  2XX7 A;  3K1M A;  1AH5 A;  2HXW A;  3KZG A;  1MXV A;  4G8N A;  4QSE A;  3KN7 A;  5I84 A;  5I2K B;  4AS4 A;  4H5G A;  2B65 A;  3OEN A;  4ZE9 A;  3QUJ A;  4P9K A;  4MBP A;  3KG2 A;  2HQ0 A;  4QBA A;  1MQD A;  5AA2 D;  1XT8 A;  3THI A;  3CR9 A;  4MCO A;  5DEX B;  5I57 A;  5L9M A;  3FXB A;  4X48 A;  4GFR A;  1MQJ A;  4FBP A;  1JEV A;  4ELQ A;  4NE4 A;  1MM7 A;  1A7L A;  2XWO A;  3TTM A;  1B1X A;  4U1O A;  4H8J A;  4KCD A;  4WKM A;  3OEK A;  1QUJ A;  3PD8 A;  1MPD A;  1FTO A;  4GXA A;  3CFL A;  1QW0 A;  4YAH X;  3VXC A;  1P1O A;  3Q25 A;  2YLN A;  4PP0 A;  2NWJ A;  3SEX A;  1NUX A;  4YMA A;  2CZH A;  4JVD A;  2F6G A;  3U65 A;  1NUW A;  1LAH E;  1EYI A;  4Q0C A;  4KFQ A;  1G0I A;  2ABH A;  4ZEF A;  4E0X A;  1DCU A;  2F97 A;  4PFB A;  4YKP A;  3RPL A;  1JP4 A;  5ICT A;  4OVP A;  1NNT A;  5AA3 A;  3MQ9 A;  1S7Y A;  5DVI A;  2KLF A;  3TOD A;  5AA4 A;  1SYI A;  5EHM A;  3KBZ A;  4ZZA A;  4DXC A;  2XD3 A;  1TT1 A;  3FIR A;  2WEF A;  4AS5 A;  3T9U A;  4N17 A;  5ET6 A;  3CIJ A;  4XKP A;  4BDM A;  4IR8 A;  2GHA A;  2L5V A;  4ZED A;  2O7U A;  5AA1 A;  4M1V A;  3OXN A;  3V83 A;  1MY2 A;  3QK6 A;  1I6A A;  2VHA A;  2I58 A;  3U72 A;  5I56 B;  3T66 A;  1LAF E;  2Q2A A;  4F39 A;  5ICQ A;  1O64 A;  1PDA A;  2Y7W A;  4M4G A;  3IB2 A;  2I48 A;  3FZV A;  2E0S A;  2UYE A;  5EQ8 A;  2F34 A;  1B05 A;  2P1S A;  3EHU A;  1P99 A;  4TLM B;  1MY0 A;  3K6W A;  3H6W A;  1IZ1 A;  1Y4T A;  1MXU A;  4WED A;  2I4B A;  4G61 A;  4X1D A;  3JYR A;  2V4C A;  3IOU A;  2BJJ X;  2ESN A;  1EYK A;  3A09 A;  4OVR A;  3C35 A;  2PFY A;  2BJI A;  4O8M A;  5T3J A;  1EZO A;  1IXC A;  1ANF A;  3HHF A;  4XKR A;  1URG A;  1GR2 A;  4WEP A;  3C33 A;  4Z7E A;  3FD3 A;  4OQO A;  4QSC A;  3K6U A;  2RC8 A;  1SVX B;  3IJX B;  3Q29 A;  3QYT A;  3TAJ A;  4GL8 A;  3KC1 A;  3ZKL A;  3G3K A;  4O3A A;  1MQH A;  3FVG A;  4PFT A;  2D21 A;  1BLF A;  4U21 A;  1P1U A;  3TPA A;  5CMM A;  4NF4 B;  4X8R A;  1PEB A;  3GYY A;  5KZT A;  2JJK A;  1QVS A;  2DS9 A;  1NUY A;  1FPJ A;  3RT6 B;  1NFT A;  1RYO A;  3RYD A;  1Y3N A;  4IO5 A;  1CE2 A;  5H8Q A;  3L6H A;  4P1E A;  2FYI A;  2ZZV A;  1YPN A;  4MMP A;  4P0I A;  2OWT A;  1MXY A;  3R6U A;  4NMY A;  1BK4 A;  2LAO A;  3KJ7 A;  1LBY A;  1B3E A;  1IXI A;  4TOZ A;  4DZ1 A;  1MY4 A;  1ZLQ A;  4G68 C;  1DTZ A;  4P1L A;  2Y5K A;  2RIN A;  3PMV A;  2DWH A;  3A3C A;  3IO4 A;  1I6B A;  1USY E;  3U94 A;  4HE2 A;  4H6D A;  4YB7 A;  2DWA A;  2RC9 A;  3IOW A;  3NOH A;  4P56 A;  3K6X A;  4RXL A;  4JDF A;  1BKA A;  5A5L A;  2FA7 A;  1EZ9 A;  1WVJ A;  1TWY A;  1FJ9 A;  3OO8 A;  4PFW A;  4R73 A;  4EDP A;  4FJP A;  2FNC A;  1LBC A;  2AIX A;  3S9N C;  4OET A;  1B5I A;  2XXW A;  4H5F A;  1P1W A;  4G8H A;  4I1D A;  3JZJ A;  2IEE A;  4PGP A;  5ET5 A;  4HS7 A;  4BDR A;  2I3V A;  2R8T A;  5DVJ A;  3PUV E;  1HSL A;  5DW8 A;  4AB5 A;  3S9M C;  1XVX A;  2OCU A;  4MNC A;  4DXB A;  1B9J A;  4HTG A;  1IMC A;  4PAF A;  3H4Z A;  1FBD A;  3R7X A;  4UAB A;  4RK2 A;  2OJT A;  4LZ8 A;  4P47 A;  2OWZ A;  1PBQ A;  4Q30 B;  3Q28 A;  5BUU A;  1B51 A;  3I6V A;  2Z23 A;  4C1U A;  3SDF A;  5ET8 A;  1T0K A;  3UK4 A;  4KD5 A;  3S2V A;  3EF7 A;  1MS7 A;  5TU0 A;  3VLW A; 
#chains in the Genus database with same CATH homology
 4N6D A;  4PET A;  4F19 A;  4PE3 A;  2ZZX A;  3BIH A;  1FPG A;  4GX4 A;  1YXI A;  2HPG A;  1XI6 A;  4PTK A;  4PDH A;  2WBD A;  4QXD A;  2HZL A;  4NG7 A;  5F24 A;  4LN5 A;  4GWW A;  4N6K A;  1NV0 A;  1FPL A;  2Y5L A;  4YIC A;  3LUZ A;  1LBX A;  4NX1 A;  1FPI A;  3IFA A;  4HE1 A;  5EQ9 A;  1RDY A;  2WBB A;  2QVV A;  2XWK A;  3BIG A;  4DI3 D;  1SPI A;  1IMD A;  1DBZ A;  5EQA A;  2MKZ A;  4OVQ A;  1NV4 A;  1AWB A;  2V3Q A;  1FBF A;  4PC9 A;  2CZK A;  4O94 A;  4HCY A;  1FBC A;  1FPD A;  5EQ7 A;  5ESY A;  4OAN A;  4NGU A;  4MIJ A;  4GWS A;  2VT5 A;  5I5P A;  4NF0 A;  2CEX A;  4HE0 A;  2B4M A;  2PCR A;  4AS4 A;  5IZZ A;  4MNI A;  4P9K A;  4F18 A;  4QBA A;  4OVS A;  4GBW A;  4N81 A;  4MCO A;  5J16 A;  1INP A;  4GWY A;  5JK4 A;  2XXK A;  3FXB A;  4FBP A;  4OA4 A;  3MYU A;  1D9Q A;  1DK4 A;  2XWO A;  3EKI A;  5I3S A;  4I40 A;  5IZ1 A;  1CNQ A;  2FBP A;  3T0J A;  2CEY A;  4NHB A;  4PF6 A;  2P3N A;  1EYJ A;  3E78 A;  4PBQ A;  2GQ1 A;  1IMF A;  4PCD A;  1NUX A;  2CZH A;  1NV5 A;  4JVD A;  4XEQ A;  4KXP A;  3U65 A;  1NUW A;  1EYI A;  1G0I A;  4NQ8 A;  1DCU A;  5EYH A;  2DE4 A;  4PFB A;  4JVI A;  3RPL A;  1JP4 A;  4I3Y A;  4OVP A;  4N4U A;  1LEV A;  4DI4 B;  2XA5 A;  4MAG A;  1NV6 A;  3KBZ A;  2WEF A;  4AS5 A;  4GWU A;  4N17 A;  2KQZ A;  5ET6 A;  1IMB A;  4IR8 A;  4N8Y A;  2L5V A;  2F5X A;  3E79 A;  1VDW A;  2HHM A;  4M1V A;  1FPB A;  1NI9 A;  2DE3 A;  1LBW A;  5LDZ A;  5IZ3 B;  5CM6 A;  4O7M A;  4MNP A;  4PBH A;  5I7I A;  2FIE A;  3W9W A;  2FHY A;  4MX6 A;  4N15 A;  5EQ8 A;  2DDK A;  3B50 A;  3IFC A;  4I3E A;  3W9V A;  4F1V A;  4G61 A;  2FVZ A;  4PGN A;  3B8B A;  2WYK A;  4JVC A;  2V4C A;  1FBE A;  4N8G A;  3CHG A;  1RDX A;  2CZI A;  4MEV A;  3T1B A;  1EYK A;  4GBV A;  3D1R A;  4OVR A;  2PFY A;  1KA1 A;  3KC0 A;  1YZ0 A;  2BJI A;  4O8M A;  5T3J A;  4O7I A;  3HFU A;  4GWX A;  5EYG A;  4P8B A;  1FJ6 A;  3FBP A;  4PFI A;  3SZP A;  3ROJ A;  5LTC A;  2VPO A;  2HZK A;  2QVU A;  4MHF A;  3KC1 A;  1NV3 A;  4PAI A;  1NV7 A;  1K9Z A;  4PFR A;  4YZZ A;  4X8R A;  4PDD A;  1FBP A;  1RDZ A;  3GYY A;  2F3B A;  2XWI A;  2KR0 A;  4H46 A;  1FSA A;  2JJK A;  1NUZ A;  1NUY A;  1FPJ A;  1FBG A;  1LBZ A;  2ZZW A;  4PF8 A;  3RYD A;  4X04 A;  1KA0 A;  3A29 A;  1IMA A;  4P1E A;  2ZZV A;  2WYP A;  3QMF A;  2DE2 A;  4MMP A;  2B4L A;  1BK4 A;  4P3L A;  3ISP A;  1LBY A;  2QVR A;  1NV1 A;  4GX3 A;  4X9T A;  4P1L A;  2Y5K A;  1IME A;  2HXR A;  4HE2 A;  2QFL A;  3NOH A;  4P56 A;  2Q74 A;  5A5L A;  2VPN A;  1FJ9 A;  1YYZ A;  1FPK A;  4H45 A;  2OX3 A;  2XWV A;  1FTA A;  1Q9D A;  4F1U A;  4HCW A;  2WX9 A;  2FIX A;  2QPQ A;  4HXV A;  5IM2 A;  2DVZ A;  4XFE A;  4PGP A;  5ET5 A;  4NN3 A;  1FRP A;  2F3D A;  2Q8M A;  1FBH A;  3PTY A;  1NV2 A;  2R8T A;  3RPL B;  5IGA A;  5DW8 A;  4GWZ A;  1FPE A;  4MNC A;  2Q9T A;  5IZ3 A;  1G0H A;  4XF5 A;  2PFZ A;  1IMC A;  4MJO A;  4PAF A;  1KZ8 A;  1FBD A;  1LBV A;  1FPF A;  2P3V A;  4UAB A;  4NAP A;  1K9Y A;  3LV0 A;  5ET7 A;  5J1D A;  4GX6 A;  4P47 A;  2OWZ A;  1QGX A;  3MST A;  4OVT A;  5FBP A;  4PAK A;  4N91 A;  5ET8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...