3D1RA

Structure of e. coli glpx with its substrate fructose 1,6-bisphosphate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
323
structure length
321
Chain Sequence
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKGDNENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSTIRRIQSIHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase class II glpX
publication title Structural and Biochemical Characterization of the Type II Fructose-1,6-bisphosphatase GlpX from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 109
structure length 321
sequence length 323
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3d1rA01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3d1rA02
2FHYA 1FTAA 2HHMA 2Y5KA 4HE1A 5EQ8A 2JJKA 1DBZA 1LBWA 2P3VA 1QGXA 1NUWA 5EQ9A 3RYDA 1FPGA 4GWWA 2DDKA 5A5LA 2WBDA 1FJ6A 1K9ZA 3B8BA 4GWXA 1G0HA 1FBHA 1NV0A 2QVVA 1IMEA 1FPLA 2QFLA 2Q8MA 1NV7A 5ET7A 5LDZA 4AS5A 1JP4A 3A29A 1D9QA 1FPIA 5EQAA 3KC0A 2P3NA 4GWYA 5EQ7A 1FPFA 4GWSA 2FIEA 3QMFA 3KBZA 3LV0A 4GX3A 3LUZA 4QXDA 3IFAA 4KXPA 5IZ3A 1FPBA 1LBXA 1FBDA 1LEVA 1SPIA 1XI6A 1Q9DA 3BIHA 1LBZA 2FIXA 1FPJA 1IMBA 4H46A 4PTKA 5F24A 3ROJA 4N81A 1KA1A 2WEFA 1YZ0A 5DW8A 1RDYA 1NV2A 3RPLB 1G0IA 2WBBA 1KA0A 3D1RA 2F3BA 1KZ8A 5EYHA 1LBYA 4MJOA 1EYIA 2R8TA 1FBCA 1LBVA 1YYZA 1NUYA 5I3SA 5T3JA 1IMAA 1NV4A 5FBPA 1AWBA 4AS4A 1FBPA 2VT5A 1FRPA 1RDZA 2GQ1A 1IMDA 1NV1A 3IFCA 1IMFA 1K9YA 2Y5LA 5J16A 2CZKA 2OX3A 1EYKA 1INPA 4O7IA 5ET5A 1FBFA 4G61A 1FPKA 2QVUA 1YXIA 4GX6A 1NUXA 2CZHA 4I40A 1BK4A 2PCRA 2BJIA 1CNQA 5EYGA 2F3DA 4GBWA 1FPDA 5IZ1A 4GX4A 4IR8A 1NI9A 4GWUA 1NUZA 4GBVA 3BIGA 5IZ3B 3RPLA 2CZIA 2OWZA 1EYJA 4H45A 1DK4A 4HE0A 3FBPA 4HXVA 1FSAA 3T0JA 1IMCA 2Q74A 4FBPA 4I3EA 1VDWA 2FVZA 2QVRA 4I3YA 5ET8A 5ESYA 3KC1A 1RDXA 2FBPA 1FBGA 4GWZA 5ET6A 1FPEA 1FBEA 4HE2A 1NV6A 1NV3A 1FJ9A 1DCUA 1NV5A
chains in the Genus database with same CATH superfamily
3PPPA 3TTNA 5I56A 2VD2A 3CSGA 2Q88A 5L8DA 4WKMA 1NUWA 3PUWE 4JVIA 3FASA 3PMXA 2XWIA 3T9VA 2AIXA 1AH5A 1SW4A 2XXUA 1FQAA 4Q5TA 3C36A 4RNSA 3JV9A 3T22A 4NHBA 3U8QA 3FJGA 2Z8FA 4F2OA 4U2RA 3VVDA 1B52A 1M5CA 1RDYA 3PPOA 3FXQA 2OWTA 5F1QA 4MHFA 1JEUA 4NX1A 1NH8A 4KFQA 2E0SA 4MJOA 3HO7A 2DE4A 2ZZVA 1NUYA 3EHSA 1A99A 3IOTA 2XXYA 5JEIA 4FATA 2QMWA 4NN3A 2DWAA 4AS4A 1A54A 1MPBA 3U92A 5IAIA 1RDZA 2UVJA 3GBAA 1EYKA 2MKZA 4LA9A 3FATA 4GX6A 1SI0A 4GXAA 4FE8A 2NXOA 3K01A 4RPNA 1VE4A 4GBWA 5I5PA 2DOJA 3Q29A 5JTYA 4YKKA 3CG1A 1SW1A 1M5DA 1N3WA 1TT1A 1EZOA 1JETA 1UTBA 5H8QA 4GQOA 5EHMA 4FAJA 5I2NA 1FTLA 2P3VA 3F11A 4YKIA 5A5LA 1ZIUA 4X48A 1Y3QA 1WVJA 2I6EA 2F78A 5LDZA 2D3IA 4R9FA 3O28A 2A5TB 3TFLA 1PB9A 2ZYKA 4H0WA 3PPNA 3FVGA 4DE8A 2V84A 5H8HB 4KXPA 1DTZA 3RQTA 2RCBA 1FBDA 2P1SA 3U94A 1Q9DA 1LBZA 4PC9A 3VVEA 1LAXA 2F3BA 1QULA 1GTKA 3ISPA 2RC8A 1HSLA 4YB7A 1EZ9A 4HTGA 4QSDA 4R6YA 4WEPA 4GWOA 5KDTA 3QUJA 4MFIA 4XKRA 3H03A 1MXVA 1UTHA 1IXIA 4IY5A 3OO9A 1NV1A 3TKDA 3C34A 2OX3A 2NOOA 2Q9TA 3M3FA 5ET5A 1GVCA 4I8CA 3RY3A 4NF8A 4KYSA 3CRBA 3TPAA 4ZEDA 4G8NA 3W9WA 4MBPA 2PBWA 2PCRA 4QSEA 1NFTA 1SQYA 1JQFA 4FJPA 1H43A 1OLCA 4QFNA 2Q2CA 3RPLA 5TP9A 2OWZA 2I3VA 4Q30B 3THIA 4MAGA 4NF4A 2VP1A 4NAPA 3T0JA 2Q74A 3DP8A 4FBPA 2QVRA 3OMBA 4Q0CA 4G68C 1DOTA 3QSLA 4DXCA 3O2AA 1B46A 1FTAA 1LCTA 2OJTA 2JJKA 1L5TA 2V4CA 2F34A 2HZKA 2R6GE 1N7WA 4R2FA 4NE4A 4R73A 2QVVA 4DCXA 4AB6A 4RK9A 5H8FA 2REGA 2Z8DA 1IUDA 4F19A 4F1UA 4G77A 3PPRA 5A5XB 3FVKA 3TYHA 2WYKA 4KPTA 3B7DA 5CBRA 2V93A 3KN7A 1LEVA 1XI6A 2WEFA 3S9NC 2PT1A 3KZGA 1B3FA 4MF3A 3D1RA 3WAEA 5EYHA 1YTVA 4PAIA 3IJXB 2R8TA 3A3CA 1TXFA 3LC8A 3WAFA 1PDAA 1Q35A 3MVYA 4P1LA 1LBCA 3U72A 1IMAA 1JEVA 1B3LA 3G7WA 3IOVA 4M4GA 1DPEA 2VT5A 4OEVA 4XF5A 3EQ1A 3ECRA 3IO6A 3T9XB 3N6TA 4ELOA 3SDFA 4DZ1A 2Y5LA 3MWBA 4PQJA 1VFEA 3MW0A 3FIRA 3ILUB 5TPAA 3SKPA 3MAMA 1ZBMA 4YZZA 4F29A 4ELQA 3FZVA 1AL3A 2BJIA 1CNQA 5AA4B 1QUIA 1S50A 2VPNA 3FGSA 5IZ3B 2HPGA 2OK2A 2QL3A 2XWKA 4HXVA 1B7HA 3U1OA 1B5IA 3KOTA 2IA4A 2RKMA 1FJ9A 2QPQA 4HE1A 1DBZA 4X8RA 1QGXA 4ONYA 4GWWA 4PDDA 2QS3A 4P9KA 3OOAA 1IMEA 5I2KB 1D9QA 3SZPA 4JB7A 3KN8A 4QXDA 4Z0IA 2A5SA 3U93A 2YLNA 4ND9A 3MPKA 5K2XA 1Y3PA 3RLFE 5DEXB 1URDA 4ELRA 2XXTA 3QXMA 3QYTA 2QS4A 3QUFA 1G0IA 4QSCA 1FTMA 4JVDA 4PFWA 5AE4A 3CFLA 1JW5A 2I0BA 1NH7A 1URSA 4DDDA 3LBSA 1XT8A 5T3JA 2OWSA 4IB2A 1NV4A 1MS7A 4G4PA 3UORA 4N15A 1B6HA 2XXRA 3G3GA 1MXXA 4NF5A 1BK4A 4BDLA 2HFBA 4OFJA 2XXWA 2RCAA 4N6KA 3PMWA 4BDOA 1MQDA 3H6VA 4DXBA 4LZ8A 3L6GA 1N76A 5AA2A 2GFEA 4N17A 1TFDA 3HHGA 1MXZA 2F36A 4GD5A 1B1XA 4MLQA 1MM7A 4LONB 2ONSA 1NV5A 2HHMA 3A3UA 4NQ8A 4EXKA 1B5HA 1Z7NE 3PV0E 2XXKA 3MBPA 2DVZA 3EKIA 2Y7IA 3OD7A 4R74A 4QHQA 3PUXE 4OA4A 3DP6A 3VLUA 2P3NA 3TMGA 1UTBB 5H8QB 2O51A 3FXBA 2QRYA 2F6GA 1UQWA 5LOMA 1B51A 5DYHA 1SPIA 1CE2A 2X7QA 1IMBA 3RNNA 4EXLA 3TCHA 1XHYA 1YZ0A 3DM0A 1D3KA 4FEDA 4NMYA 5L9MA 2ESNA 4HCWA 5FHNA 1B7UA 5B7DA 3FVOA 4PFIA 5I58B 2Q2AA 4ZECA 2UYFA 4KHZE 1A8EA 3K6XA 2HQ0A 1IMFA 1FQFA 4H65A 2HZLA 4G61A 4LATA 2OLBA 2H4IA 4KR5A 3RTFB 4P0IA 1YXIA 1NUXA 2CZHA 3MC2A 4AB5A 4POXA 5KDTB 1XOCA 2Z23A 2O7IA 3TQLA 1LB8A 2DWIA 3IJOB 4GOTA 3TCFA 4RY1A 2I4CA 3T9HB 1OVBA 4AQ4A 1RDXA 5K2YA 3GZGA 2F5XA 3UK4A 2H5YA 2Y5KA 5EQ8A 4ZDMA 1MQHA 4P56A 1A8FA 3VLVA 2XX9A 4YICA 4PE3A 5CM6A 1FPLA 4OESA 3GYYA 2V25A 2PT2A 3D4GA 2XD2A 4G68A 3QMFA 3M8UA 1JVYA 4PFBA 2WKYA 3E3KA 3LUZA 3MZ1A 1TWYA 1ELJA 2FIXA 3ROJA 3M3KA 4LQ5A 3S2VA 1WODA 4LP2B 3FJMA 3PTYA 4MNIA 1KZ8A 1XVXA 3KJTA 3D4CA 2ZZWA 1Y20A 1P1QA 1PBQA 3EHTA 2FA7A 4RYAA 4I1DA 3SEXA 3SESA 3K1PA 3RPWA 5EYFA 3VV5A 3SEUA 2E1SA 4N8YA 1LFHA 3ILTB 4BLAA 4LVQA 1RYOA 2F6PA 5I7IA 3SERA 1EH3A 1S7YA 1B0HA 2UVHA 3C9HA 1FQEA 5KCJA 2OPEA 3P7IA 4ZZAA 1NI9A 4GBVA 1SDXA 1A40A 1FCKA 1RYXA 3KJ7A 3KFMA 4YB5A 4RA1A 4I3EA 4XXUA 3C33A 3I5OA 4GWZA 3B50A 4O8MA 4LZ5A 3W15C 3LR1A 3I3VA 4ESXA 1EZPA 1DCUA 4XIGQ 5CBSA 3V83A 2ZXTA 5EQ9A 1FPGA 1P1NA 2PFZA 1AOVA 3B6TA 2VD3A 2V3TA 1PB7A 3IOWA 4WXJA 2RC9A 4KCDA 3KN3A 5EQAA 3Q27A 3KBZA 4IGRA 4EDPA 3N6UA 3MZBA 4JWYA 3TELA 4U1OA 1LBXA 1KWHA 3TTMA 4N07A 3O9PA 4L17A 2XX7A 1MXYA 1T0KA 5DW8A 4YMBA 5DVJA 4GVOA 1LBVA 3ODBA 1MQGA 3K6UA 3W9VA 1B3EA 4G2ZA 1JW4A 3PPQA 1AWBA 1DSNA 3C4MA 3PUYE 1WDNA 2XXXA 3TDJA 2NVUB 5CMBA 1M5BA 3IFCA 5J16A 1INPA 1I6QA 3H4ZA 4KYEA 4UA8A 3K1MA 2D5WA 1I6AA 4O7MA 1VR5A 4F3PA 4BDMA 2AL5A 5L9SA 2F3DA 4BDNA 1GR2A 2P0SA 1OQGA 2WX9A 4OANA 1B1HA 3IO4A 1FBGA 2X26A 4HE2A 1MDQA 4C1TA 5CMCA 4TLMB 4PCDA 4OETA 1Y4TA 3RYDA 3EHUA 2GRVA 3LSFB 4PAFA 3T1BA 1P99A 2ZNUA 4X9TA 1P1WA 1B0LA 4EQBA 4NGUA 3MP1A 1MY1A 1FTJA 1OQHA 1POY1 4MIJA 3K6WA 3MVXA 3UN6A 1US5A 2H9BA 1KA1A 3VFJA 2D21A 4RK2A 4MEVA 3T9UA 2VOZA 4N91A 3TUSA 1JVXA 4X1DA 3MQ9A 1OVTA 2PMSA 3EPEA 1LLSA 2Z22A 1MDP1 3N5LA 4NWDA 2DVCA 1ZMGA 3N94A 1B40A 4F39A 4N13A 4O3AA 1B32A 4OVTA 4I40A 2F7BA 3A09A 1IXCA 4F22A 3VVFA 3K6VA 3CFXA 3K4UA 1B4ZA 4RPOA 3K02A 2ZNSA 4PP0A 1FTOA 2QMXA 4H45A 2XXVA 3H6UA 1FQBA 3IB0A 2DE2A 5ET8A 1PBPA 3R26A 3I6VA 4PE5B 5IZZA 2QS2A 5ICTA 1USYH 2FHYA 1Q1KA 3JYRA 4U22A 1ZJLA 4GIZA 4EF2A 1NV0A 5H8SA 4G8MA 1H44A 4QFOA 2H98A 3PUVE 1LAFE 4GWYA 3PD9A 1XC1A 3MSTA 1FPFA 1B3HA 4GRKA 5IKBA 1USYE 1OLAA 4I62A 3CHGA 4MNCA 2VHAA 2F97A 4RXLA 2ZNTA 3SEVA 1FPJA 3DLNA 3OEMA 1NV2A 2O1MA 4ZS9A 3KGCA 1XS5A 3ZS6A 5I59A 4O3BA 3IB2A 4OVSA 3CFZA 3UIFA 5HBCA 3ZKKA 5I3SA 3B6WA 1MY4A 4QBAA 5I56B 3OENA 2DYXA 2W7YA 2A5TA 2R71A 4LQ2A 4PBQA 4PETA 2B65A 1FPKA 3CVGA 2QVUA 5CMMA 4EQ7A 1R9QA 4R72A 5H8HA 5EYGA 1M5FA 4P0GA 1MH3A 1US4A 3H6WA 4GX4A 4IR8A 1NUZA 3PD8A 4XKQA 3E4RA 1YCJA 1R9LA 2O84X 3FBPA 3HFUA 3PGFA 4F18A 2ZYNA 4I3YA 1PB8A 1OMPA 3CG3A 1B9JA 4IO6A 4NG7A 2F7AA 5ISUA 2HXWA 2CEXA 2I58A 4PAKA 4R9GA 1LBWA 2GH9A 5DVFA 4C1UA 1ATGA 1Y9UA 1FJ6A 1K9ZA 1FQCA 3VE1B 1I6BA 3SETA 4AS5A 2KQZA 1JP4A 3A29A 1QW0A 1QUKA 1IIWA 1LAGE 1QKBA 2IEEA 1ZLQA 4OTEA 2PFYA 4YU0A 1SW5A 2Y7PA 4UABA 4IO3A 4OVQA 4OFLA 5L9OA 5DTBA 1LAHE 4JVCA 4PBHA 4DCYA 4KCCA 4H46A 5JTYB 3IORA 4JWXA 5I57A 2KR0A 3T66A 1N3XA 1DMBA 3G3IA 1FBCA 5FHOA 2FNCA 1R1NA 4Q8RA 3QAXA 5CI5A 3OXNA 3TTKA 4LZ7A 3QIMA 5I2NB 1P1UA 2LAOA 2VPOA 4K3FA 1Y3NA 3JZJA 2M8CA 3KOSA 4OWDA 4ZE8A 4YB6A 2ONRA 5ICQA 4PF8A 4F31B 5IZ1A 4F1VA 2OBGA 4F1YA 1UIUA 3SEYA 4ZEKA 4QFLA 4FEBA 1ZKBA 1SYHA 3C31A 3UGWA 3HPIA 5ET6A 2ZZXA 5CMKA 3IL1B 1NV6A 4YKJA 1Y1ZA 4BDQA 3TTLA 4POWA 2WBDA 1G0HA 3LSWA 1FBHA 1UTHB 2CEYA 3DELB 2O68A 1LFGA 3L6HA 5AA4A 5EQ7A 1LGBC 4GWSA 4QRZA 1H3DA 1N84A 5HPQA 5KZTA 2QS1A 4DI3D 4NF8B 4QF9A 1D9VA 5IZ3A 1BP5A 2XHDA 3MVZA 5EHSA 3R7XA 1Z7ME 5H8NA 3RPLB 5TP9B 1LSTA 4NF4B 4LUBA 4WEDA 4H5FA 4GL0A 1MRPA 1PC3A 3HV1A 3O6GA 3K1NA 3FV1A 3IB1A 2WYPA 3HN0A 4NF0A 3Q26A 1NNFA 3PUZE 1FRPA 1MM6A 2GQ1A 1IMDA 5I2KA 2UXAA 1PEBA 4NF6A 4GL8A 4H67A 2BJJX 1F9BA 2O6AA 5H8FB 2VGQA 4U1ZA 5ITPA 3H06B 5DEXA 4GWUA 1NNTA 3RN8A 2CZIA 2X7PA 4MX6A 4HE0A 1JW1A 3IK6B 2ABHA 4IO4A 1SYIA 3KEIA 3K00A 2FBPA 4E0XA 3RT6B 1FBEA 5FHMA 1MQIA 2G93A 1J1NA 4ZZEA 1H45A 3G3FA 4H1XA 4N6PA 3V8XB 1FQDA 3BKIB 1DPPA 3B8BA 4GWXA 4Z7EA 2QFLA 1VSOA 1TFAA 1FPIA 5TPAB 3E9XA 1B2HA 2FIEA 1N04A 4OVJA 1YPNA 1LBBA 4RJZA 4OVRA 2PX1A 5BUUA 4JDFA 3S9MC 4GLIA 1AIVA 5J1DA 4ZEFA 3VDFA 1O63A 3OO7A 4OMBA 4EF1A 1H76A 1MY3A 4IO2A 2YJPA 2B3BA 1GV8A 3TAJA 2AL4A 2RF1A 3E79A 3MZ9A 3MUQA 3QK6A 5AA1A 4ELPA 3SEWA 1IEJA 3IR1A 3VXCA 5FBPA 3OEKA 4O94A 2DE3A 4ESWA 1XVYA 4I9DA 4FIMA 2KLFA 4PFTA 4KQPA 2ZMBA 1N0TA 3ZKLA 5I59B 3C32A 3OO6A 3FJ7A 2O7UA 1SVXB 3BIGA 1JNFA 1EYJA 2H99A 3E13X 3BFTA 3G3JA 5FTIA 3ONMA 4YMAA 5I58A 1VDWA 5CRYA 2Y7WA 2DWJA 5ITOA 1QKAA 1MY2A 4ZE9A 4FECA 4R6KA 3UA8A 2DDKA 3LUYA 4IO7A 2B4LA 1EU8A 3TQWA 1B05A 3EN3A 2HEUA 3Q28A 2Q8MA 1NV7A 5ET7A 2F8DA 3FV2A 1VFDA 2Y7RA 3MVWA 4HW8A 4QFPA 5HM4B 4N4UA 4OYVA 2V3UA 3FVNA 3IFAA 1QUJA 4NF5B 4F3GA 3BIHA 4N81A 4PFRA 2ONKE 4JXIA 3LSLA 1DTGA 2OPDA 2XX8A 5AA2B 3T96B 3NOHA 1BIYA 4JWOA 4HS7A 2OZZA 3MJNA 3BFUA 3GBBA 2CMOA 5DVIA 3KG2A 1HSJA 1K9YA 2I3WA 2B3FA 2CZKA 4XEQA 4THIA 3H3GA 5I57B 1FBFA 3O29A 4ZEBA 1NKXA 4H6DA 4XKPA 1R6ZA 2DWHA 4ZEIA 5ELVA 4OVPA 1MXUA 4DLDA 3K0VA 4P3LA 1IMCA 4PFYA 2UVIA 2DXRA 4LN5A 2GHAA 4H8JA 1SI1A 2UYEA 3HSTA 3C35A 4U21A 4TOZA 4P8BA 2I48A 4MCOA 4JBZA 5JK4A 4OENA 4ECFA 1NMUA 4TLLB 1IXHA 4C0RA 4IY6A 2DSFA 3ZSFA 1POTA 3H7MA 2O1LA 3FXUA 1MQJA 3T93B 3LV0A 1NL5A 4X04A 2XWOA 2GHBA 3GXAA 3HHFA 1LCFA 2Q89A 4P47A 4X1BA 1ZU0A 2H25A 3MP6A 1Y1MA 4XKNA 4NTLA 2WBBA 5TU0A 4EUOA 1LBYA 4P1EA 1YYZA 4TQUQ 4YKPA 2Z8EA 3PU5A 2OCUA 2THIA 4IGTA 2I4BA 4KD5A 3BBRA 2CZLA 3CR9A 3VXBA 4KYDA 4N8GA 4M1VA 4PGPA 2RC7A 2XD3A 5LTCA 5H8NB 3IOUA 3OELA 3O66A 4MH5A 5IGAA 3LSXA 1YAEA 4U4XA 4OZ9A 4G68B 3EF7A 2HXRA 4N6DA 1FPDA 4G8HA 4F3BA 2Y84A 4OQOA 3E78A 4OHNA 3G3HA 3RGYA 1DK4A 3KSJA 3RUMA 2QSXA 4NWCA 4JSOA 4MLVA 4YAHX 1MPDA 5I84A 3B6QA 4H8IA 1I69A 4U4SA 4NF6B 3S9EA 4DI4B 1NV3A 5M2VA 4E0WA 2R9JA 3CI8A 1IQ7A 3N26A 2ZYMA 4OFOA 5B70A 3DP4A 1GGGA 4PDHA 5IM2A 1P1OA 1Y4CA 4P11A 3IX1A 3KC0A 1BLFA 1FW0A 3KSXA 3V89B 1B3GA 3GLBA 1MG1A 3TEPA 3FD3A 2HAUA 4U23A 5KCJB 3CIJA 5F24A 1MH4A 2F7CA 2Y7KA 3HCQA 2I49A 4PGNA 2PVUA 3PMVA 2YPNA 4MMPA 1EYIA 1HSEA 3MYUA 3IAZA 4GXSB 3M3LA 3G3KA 4BDRA 3MP8A 3S9LC 2NUVA 2XXPA 4JSDA 4O3CA 4FORA 3R6UA 1O7TA 2Q8JA 3VLWA 1URGA 2DS9A 4EQ9A 4QFKA 2F35A 4DXUA 3V5AA 2RINA 4H5GA 3TZAA 1A7LA 1QVSA 1D9YA 2ALUA 4IO5A 2B4MA 4F3SA 5BWJA 2FYIA 3OSQA 1NNPA 4GFRA 4R75A 2XA5A 2P2AA 1FSAA 4OXVA 1IXGA 3KC1A 2XXQA 3O6IA 4KI0E 4MNPA 5A5XA 4ISUA 2I0CA 2HAVA 1NNKA 1FPEA 3TTRA 1B4HA 4R6HA 1M5EA 2QJEA 2ANJA 1ZTYA 3TODA 2AYSA 3KBRA 4HCYA 1AMFA 2REJA 2XXIA 1SW2A 3H6TA 5FTHA 3MPLA 2PYYA 5AA2D 3OSRA 2DQVA 1LFIA 1O64A 1MY0A 1CB6A 4PFUA 5DT6A 5CC2A 4GX3A 2NWJA 1FPBA 4DIGA 2O69A 1MXWA 4PTKA 1UIVA 2L5VA 3TCGA 3CSBA 3FUZA 1OIBA 1KA0A 1FTKA 2V3QA 2XXHA 2XWVA 3Q25A 3S4UA 3O97A 3K2DA 4XFEA 1BKAA 1MPCA 3OO8A 2ZYOA 3FXRA 4OEUA 2DP8A 1D4NA 1IITA 1FBPA 3U65A 1QJMA 1BTJA 4F2QA 2DXYA 5F7VA 4O7IA 5AA3A 1B58A 4OERA 1B7ZA 2G29A 1RKMA 2UVGA 4UACA 4NEDA 3RT8A 3USDA 3UP9A 1ANFA 4XTCQ 1A55A 3RTWB 4PF6A 4GF8A 1IZ1A 3O6HA 1SD3A 2FVZA 5ESYA 1B5JA 1S9TA 2HCAA 1N7XA 1LB9A 1SBPA 4R2BA 3AXFA 1II5A
chains in the Genus database with same CATH topology
2FHYA 2HHMA 4NQ8A 1NUWA 2DDKA 2XXKA 4JVIA 2B4LA 2DVZA 3EKIA 1NV0A 2Q8MA 1NV7A 5ET7A 2XWIA 4OA4A 2P3NA 4GWYA 3MSTA 1FPFA 4N4UA 3FXBA 4NHBA 3IFAA 3CHGA 4MNCA 1SPIA 3BIHA 1FPJA 1IMBA 4N81A 4PFRA 1YZ0A 1RDYA 1NV2A 4MHFA 4HCWA 4NX1A 4MJOA 2DE4A 3NOHA 4PFIA 2ZZVA 4OVSA 1NUYA 5I3SA 4NN3A 4AS4A 4QBAA 1RDZA 1IMFA 1K9YA 2CZKA 4XEQA 1EYKA 2HZLA 2MKZA 4PBQA 1FBFA 4G61A 4PETA 1FPKA 2QVUA 1YXIA 4GX6A 1NUXA 2CZHA 4OVPA 5EYGA 4GBWA 5I5PA 4GX4A 4IR8A 1NUZA 4P3LA 3HFUA 3FBPA 4F18A 1IMCA 4I3YA 4LN5A 1RDXA 4NG7A 2F5XA 2CEXA 4PAKA 2Y5KA 5EQ8A 4P8BA 1LBWA 4MCOA 2P3VA 5JK4A 4P56A 5A5LA 1FJ6A 1K9ZA 4YICA 4PE3A 5CM6A 1FPLA 3GYYA 5LDZA 4AS5A 2KQZA 1JP4A 3A29A 3QMFA 2PFYA 4PFBA 3LV0A 4X04A 3LUZA 2XWOA 4UABA 4KXPA 4OVQA 1FBDA 4JVCA 1Q9DA 4P47A 4PBHA 1LBZA 2FIXA 4H46A 3ROJA 4PC9A 2KR0A 2WBBA 3PTYA 2F3BA 4MNIA 1KZ8A 1LBYA 4P1EA 2ZZWA 1FBCA 3ISPA 1YYZA 4N8YA 2VPOA 4N8GA 1NV1A 2OX3A 2Q9TA 4M1VA 4PGPA 5ET5A 5I7IA 5LTCA 3W9WA 5IGAA 4PF8A 2PCRA 2HXRA 4N6DA 1FPDA 5IZ1A 1NI9A 4F1VA 4GBVA 3RPLA 3E78A 2OWZA 4MAGA 1DK4A 4NAPA 3T0JA 2Q74A 4FBPA 4I3EA 2QVRA 4GWZA 5ET6A 2ZZXA 3B50A 4O8MA 1NV6A 4DI4B 1NV3A 1DCUA 1FTAA 2JJKA 5EQ9A 2V4CA 1FPGA 2HZKA 2PFZA 2WBDA 1G0HA 1FBHA 2QVVA 4PDHA 2CEYA 5IM2A 4F19A 4F1UA 5EQAA 3KC0A 5EQ7A 4GWSA 3KBZA 4DI3D 2WYKA 5IZ3A 1LBXA 1LEVA 1XI6A 5F24A 2WEFA 5DW8A 4PGNA 3RPLB 3D1RA 5EYHA 4PAIA 1EYIA 4MMPA 2R8TA 3MYUA 1LBVA 4P1LA 1IMAA 2WYPA 3W9VA 4NF0A 1AWBA 2VT5A 1FRPA 4XF5A 2GQ1A 1IMDA 3IFCA 2Y5LA 5J16A 1INPA 4YZZA 4O7MA 2BJIA 1CNQA 2B4MA 2F3DA 2VPNA 4GWUA 5IZ3B 2HPGA 2CZIA 4MX6A 2WX9A 4HE0A 2XA5A 2XWKA 4OANA 4HXVA 1FSAA 3KC1A 4MNPA 2FBPA 1FBGA 1FPEA 1FBEA 4HE2A 1FJ9A 2QPQA 4HE1A 1DBZA 4PCDA 4X8RA 4HCYA 1QGXA 3RYDA 4GWWA 4PAFA 4PDDA 3T1BA 3B8BA 4GWXA 4P9KA 1IMEA 2QFLA 4X9TA 4NGUA 1D9QA 1FPIA 3SZPA 2FIEA 4GX3A 4OVRA 4QXDA 1FPBA 5J1DA 4MIJA 4PTKA 2L5VA 1KA1A 1G0IA 1KA0A 4MEVA 4JVDA 3E79A 4N91A 2V3QA 2XWVA 5T3JA 4XFEA 1NV4A 5FBPA 1FBPA 3U65A 4N15A 4O94A 4O7IA 2DE3A 4OVTA 4I40A 1BK4A 4N6KA 3BIGA 1EYJA 4H45A 4PF6A 4N17A 2DE2A 5ET8A 1VDWA 2FVZA 5ESYA 5IZZA 1NV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHY A;  1FTA A;  2HHM A;  2Y5K A;  4HE1 A;  5EQ8 A;  2JJK A;  1DBZ A;  1LBW A;  2P3V A;  1QGX A;  1NUW A;  5EQ9 A;  3RYD A;  1FPG A;  4GWW A;  2DDK A;  5A5L A;  2WBD A;  1FJ6 A;  1K9Z A;  3B8B A;  4GWX A;  1G0H A;  1FBH A;  1NV0 A;  2QVV A;  1IME A;  1FPL A;  2QFL A;  2Q8M A;  1NV7 A;  5ET7 A;  5LDZ A;  4AS5 A;  1JP4 A;  3A29 A;  1D9Q A;  1FPI A;  5EQA A;  3KC0 A;  2P3N A;  4GWY A;  5EQ7 A;  1FPF A;  4GWS A;  2FIE A;  3QMF A;  3KBZ A;  3LV0 A;  4GX3 A;  3LUZ A;  4QXD A;  3IFA A;  4KXP A;  5IZ3 A;  1FPB A;  1LBX A;  1FBD A;  1LEV A;  1SPI A;  1XI6 A;  1Q9D A;  3BIH A;  1LBZ A;  2FIX A;  1FPJ A;  1IMB A;  4H46 A;  4PTK A;  5F24 A;  3ROJ A;  4N81 A;  1KA1 A;  2WEF A;  1YZ0 A;  5DW8 A;  1RDY A;  1NV2 A;  3RPL B;  1G0I A;  2WBB A;  1KA0 A;  3D1R A;  2F3B A;  1KZ8 A;  5EYH A;  1LBY A;  4MJO A;  1EYI A;  2R8T A;  1FBC A;  1LBV A;  1YYZ A;  1NUY A;  5I3S A;  5T3J A;  1IMA A;  1NV4 A;  5FBP A;  1AWB A;  4AS4 A;  1FBP A;  2VT5 A;  1FRP A;  1RDZ A;  2GQ1 A;  1IMD A;  1NV1 A;  3IFC A;  1IMF A;  1K9Y A;  2Y5L A;  5J16 A;  2CZK A;  2OX3 A;  1EYK A;  1INP A;  4O7I A;  5ET5 A;  1FBF A;  4G61 A;  1FPK A;  2QVU A;  1YXI A;  4GX6 A;  1NUX A;  2CZH A;  4I40 A;  1BK4 A;  2PCR A;  2BJI A;  1CNQ A;  5EYG A;  2F3D A;  4GBW A;  1FPD A;  5IZ1 A;  4GX4 A;  4IR8 A;  1NI9 A;  4GWU A;  1NUZ A;  4GBV A;  3BIG A;  5IZ3 B;  3RPL A;  2CZI A;  2OWZ A;  1EYJ A;  4H45 A;  1DK4 A;  4HE0 A;  3FBP A;  4HXV A;  1FSA A;  3T0J A;  1IMC A;  2Q74 A;  4FBP A;  4I3E A;  1VDW A;  2FVZ A;  2QVR A;  4I3Y A;  5ET8 A;  5ESY A;  3KC1 A;  1RDX A;  2FBP A;  1FBG A;  4GWZ A;  5ET6 A;  1FPE A;  1FBE A;  4HE2 A;  1NV6 A;  1NV3 A;  1FJ9 A;  1DCU A;  1NV5 A; 
#chains in the Genus database with same CATH topology
 3PPP A;  3TTN A;  5I56 A;  2VD2 A;  3CSG A;  2Q88 A;  5L8D A;  4WKM A;  1NUW A;  3PUW E;  4JVI A;  3FAS A;  3PMX A;  2XWI A;  3T9V A;  2AIX A;  1AH5 A;  1SW4 A;  2XXU A;  1FQA A;  4Q5T A;  3C36 A;  4RNS A;  3JV9 A;  3T22 A;  4NHB A;  3U8Q A;  3FJG A;  2Z8F A;  4F2O A;  4U2R A;  3VVD A;  1B52 A;  1M5C A;  1RDY A;  3PPO A;  3FXQ A;  2OWT A;  5F1Q A;  4MHF A;  1JEU A;  4NX1 A;  1NH8 A;  4KFQ A;  2E0S A;  4MJO A;  3HO7 A;  2DE4 A;  2ZZV A;  1NUY A;  3EHS A;  1A99 A;  3IOT A;  2XXY A;  5JEI A;  4FAT A;  2QMW A;  4NN3 A;  2DWA A;  4AS4 A;  1A54 A;  1MPB A;  3U92 A;  5IAI A;  1RDZ A;  2UVJ A;  3GBA A;  1EYK A;  2MKZ A;  4LA9 A;  3FAT A;  4GX6 A;  1SI0 A;  4GXA A;  4FE8 A;  2NXO A;  3K01 A;  4RPN A;  1VE4 A;  4GBW A;  5I5P A;  2DOJ A;  3Q29 A;  5JTY A;  4YKK A;  3CG1 A;  1SW1 A;  1M5D A;  1N3W A;  1TT1 A;  1EZO A;  1JET A;  1UTB A;  5H8Q A;  4GQO A;  5EHM A;  4FAJ A;  5I2N A;  1FTL A;  2P3V A;  3F11 A;  4YKI A;  5A5L A;  1ZIU A;  4X48 A;  1Y3Q A;  1WVJ A;  2I6E A;  2F78 A;  5LDZ A;  2D3I A;  4R9F A;  3O28 A;  2A5T B;  3TFL A;  1PB9 A;  2ZYK A;  4H0W A;  3PPN A;  3FVG A;  4DE8 A;  2V84 A;  5H8H B;  4KXP A;  1DTZ A;  3RQT A;  2RCB A;  1FBD A;  2P1S A;  3U94 A;  1Q9D A;  1LBZ A;  4PC9 A;  3VVE A;  1LAX A;  2F3B A;  1QUL A;  1GTK A;  3ISP A;  2RC8 A;  1HSL A;  4YB7 A;  1EZ9 A;  4HTG A;  4QSD A;  4R6Y A;  4WEP A;  4GWO A;  5KDT A;  3QUJ A;  4MFI A;  4XKR A;  3H03 A;  1MXV A;  1UTH A;  1IXI A;  4IY5 A;  3OO9 A;  1NV1 A;  3TKD A;  3C34 A;  2OX3 A;  2NOO A;  2Q9T A;  3M3F A;  5ET5 A;  1GVC A;  4I8C A;  3RY3 A;  4NF8 A;  4KYS A;  3CRB A;  3TPA A;  4ZED A;  4G8N A;  3W9W A;  4MBP A;  2PBW A;  2PCR A;  4QSE A;  1NFT A;  1SQY A;  1JQF A;  4FJP A;  1H43 A;  1OLC A;  4QFN A;  2Q2C A;  3RPL A;  5TP9 A;  2OWZ A;  2I3V A;  4Q30 B;  3THI A;  4MAG A;  4NF4 A;  2VP1 A;  4NAP A;  3T0J A;  2Q74 A;  3DP8 A;  4FBP A;  2QVR A;  3OMB A;  4Q0C A;  4G68 C;  1DOT A;  3QSL A;  4DXC A;  3O2A A;  1B46 A;  1FTA A;  1LCT A;  2OJT A;  2JJK A;  1L5T A;  2V4C A;  2F34 A;  2HZK A;  2R6G E;  1N7W A;  4R2F A;  4NE4 A;  4R73 A;  2QVV A;  4DCX A;  4AB6 A;  4RK9 A;  5H8F A;  2REG A;  2Z8D A;  1IUD A;  4F19 A;  4F1U A;  4G77 A;  3PPR A;  5A5X B;  3FVK A;  3TYH A;  2WYK A;  4KPT A;  3B7D A;  5CBR A;  2V93 A;  3KN7 A;  1LEV A;  1XI6 A;  2WEF A;  3S9N C;  2PT1 A;  3KZG A;  1B3F A;  4MF3 A;  3D1R A;  3WAE A;  5EYH A;  1YTV A;  4PAI A;  3IJX B;  2R8T A;  3A3C A;  1TXF A;  3LC8 A;  3WAF A;  1PDA A;  1Q35 A;  3MVY A;  4P1L A;  1LBC A;  3U72 A;  1IMA A;  1JEV A;  1B3L A;  3G7W A;  3IOV A;  4M4G A;  1DPE A;  2VT5 A;  4OEV A;  4XF5 A;  3EQ1 A;  3ECR A;  3IO6 A;  3T9X B;  3N6T A;  4ELO A;  3SDF A;  4DZ1 A;  2Y5L A;  3MWB A;  4PQJ A;  1VFE A;  3MW0 A;  3FIR A;  3ILU B;  5TPA A;  3SKP A;  3MAM A;  1ZBM A;  4YZZ A;  4F29 A;  4ELQ A;  3FZV A;  1AL3 A;  2BJI A;  1CNQ A;  5AA4 B;  1QUI A;  1S50 A;  2VPN A;  3FGS A;  5IZ3 B;  2HPG A;  2OK2 A;  2QL3 A;  2XWK A;  4HXV A;  1B7H A;  3U1O A;  1B5I A;  3KOT A;  2IA4 A;  2RKM A;  1FJ9 A;  2QPQ A;  4HE1 A;  1DBZ A;  4X8R A;  1QGX A;  4ONY A;  4GWW A;  4PDD A;  2QS3 A;  4P9K A;  3OOA A;  1IME A;  5I2K B;  1D9Q A;  3SZP A;  4JB7 A;  3KN8 A;  4QXD A;  4Z0I A;  2A5S A;  3U93 A;  2YLN A;  4ND9 A;  3MPK A;  5K2X A;  1Y3P A;  3RLF E;  5DEX B;  1URD A;  4ELR A;  2XXT A;  3QXM A;  3QYT A;  2QS4 A;  3QUF A;  1G0I A;  4QSC A;  1FTM A;  4JVD A;  4PFW A;  5AE4 A;  3CFL A;  1JW5 A;  2I0B A;  1NH7 A;  1URS A;  4DDD A;  3LBS A;  1XT8 A;  5T3J A;  2OWS A;  4IB2 A;  1NV4 A;  1MS7 A;  4G4P A;  3UOR A;  4N15 A;  1B6H A;  2XXR A;  3G3G A;  1MXX A;  4NF5 A;  1BK4 A;  4BDL A;  2HFB A;  4OFJ A;  2XXW A;  2RCA A;  4N6K A;  3PMW A;  4BDO A;  1MQD A;  3H6V A;  4DXB A;  4LZ8 A;  3L6G A;  1N76 A;  5AA2 A;  2GFE A;  4N17 A;  1TFD A;  3HHG A;  1MXZ A;  2F36 A;  4GD5 A;  1B1X A;  4MLQ A;  1MM7 A;  4LON B;  2ONS A;  1NV5 A;  2HHM A;  3A3U A;  4NQ8 A;  4EXK A;  1B5H A;  1Z7N E;  3PV0 E;  2XXK A;  3MBP A;  2DVZ A;  3EKI A;  2Y7I A;  3OD7 A;  4R74 A;  4QHQ A;  3PUX E;  4OA4 A;  3DP6 A;  3VLU A;  2P3N A;  3TMG A;  1UTB B;  5H8Q B;  2O51 A;  3FXB A;  2QRY A;  2F6G A;  1UQW A;  5LOM A;  1B51 A;  5DYH A;  1SPI A;  1CE2 A;  2X7Q A;  1IMB A;  3RNN A;  4EXL A;  3TCH A;  1XHY A;  1YZ0 A;  3DM0 A;  1D3K A;  4FED A;  4NMY A;  5L9M A;  2ESN A;  4HCW A;  5FHN A;  1B7U A;  5B7D A;  3FVO A;  4PFI A;  5I58 B;  2Q2A A;  4ZEC A;  2UYF A;  4KHZ E;  1A8E A;  3K6X A;  2HQ0 A;  1IMF A;  1FQF A;  4H65 A;  2HZL A;  4G61 A;  4LAT A;  2OLB A;  2H4I A;  4KR5 A;  3RTF B;  4P0I A;  1YXI A;  1NUX A;  2CZH A;  3MC2 A;  4AB5 A;  4POX A;  5KDT B;  1XOC A;  2Z23 A;  2O7I A;  3TQL A;  1LB8 A;  2DWI A;  3IJO B;  4GOT A;  3TCF A;  4RY1 A;  2I4C A;  3T9H B;  1OVB A;  4AQ4 A;  1RDX A;  5K2Y A;  3GZG A;  2F5X A;  3UK4 A;  2H5Y A;  2Y5K A;  5EQ8 A;  4ZDM A;  1MQH A;  4P56 A;  1A8F A;  3VLV A;  2XX9 A;  4YIC A;  4PE3 A;  5CM6 A;  1FPL A;  4OES A;  3GYY A;  2V25 A;  2PT2 A;  3D4G A;  2XD2 A;  4G68 A;  3QMF A;  3M8U A;  1JVY A;  4PFB A;  2WKY A;  3E3K A;  3LUZ A;  3MZ1 A;  1TWY A;  1ELJ A;  2FIX A;  3ROJ A;  3M3K A;  4LQ5 A;  3S2V A;  1WOD A;  4LP2 B;  3FJM A;  3PTY A;  4MNI A;  1KZ8 A;  1XVX A;  3KJT A;  3D4C A;  2ZZW A;  1Y20 A;  1P1Q A;  1PBQ A;  3EHT A;  2FA7 A;  4RYA A;  4I1D A;  3SEX A;  3SES A;  3K1P A;  3RPW A;  5EYF A;  3VV5 A;  3SEU A;  2E1S A;  4N8Y A;  1LFH A;  3ILT B;  4BLA A;  4LVQ A;  1RYO A;  2F6P A;  5I7I A;  3SER A;  1EH3 A;  1S7Y A;  1B0H A;  2UVH A;  3C9H A;  1FQE A;  5KCJ A;  2OPE A;  3P7I A;  4ZZA A;  1NI9 A;  4GBV A;  1SDX A;  1A40 A;  1FCK A;  1RYX A;  3KJ7 A;  3KFM A;  4YB5 A;  4RA1 A;  4I3E A;  4XXU A;  3C33 A;  3I5O A;  4GWZ A;  3B50 A;  4O8M A;  4LZ5 A;  3W15 C;  3LR1 A;  3I3V A;  4ESX A;  1EZP A;  1DCU A;  4XIG Q;  5CBS A;  3V83 A;  2ZXT A;  5EQ9 A;  1FPG A;  1P1N A;  2PFZ A;  1AOV A;  3B6T A;  2VD3 A;  2V3T A;  1PB7 A;  3IOW A;  4WXJ A;  2RC9 A;  4KCD A;  3KN3 A;  5EQA A;  3Q27 A;  3KBZ A;  4IGR A;  4EDP A;  3N6U A;  3MZB A;  4JWY A;  3TEL A;  4U1O A;  1LBX A;  1KWH A;  3TTM A;  4N07 A;  3O9P A;  4L17 A;  2XX7 A;  1MXY A;  1T0K A;  5DW8 A;  4YMB A;  5DVJ A;  4GVO A;  1LBV A;  3ODB A;  1MQG A;  3K6U A;  3W9V A;  1B3E A;  4G2Z A;  1JW4 A;  3PPQ A;  1AWB A;  1DSN A;  3C4M A;  3PUY E;  1WDN A;  2XXX A;  3TDJ A;  2NVU B;  5CMB A;  1M5B A;  3IFC A;  5J16 A;  1INP A;  1I6Q A;  3H4Z A;  4KYE A;  4UA8 A;  3K1M A;  2D5W A;  1I6A A;  4O7M A;  1VR5 A;  4F3P A;  4BDM A;  2AL5 A;  5L9S A;  2F3D A;  4BDN A;  1GR2 A;  2P0S A;  1OQG A;  2WX9 A;  4OAN A;  1B1H A;  3IO4 A;  1FBG A;  2X26 A;  4HE2 A;  1MDQ A;  4C1T A;  5CMC A;  4TLM B;  4PCD A;  4OET A;  1Y4T A;  3RYD A;  3EHU A;  2GRV A;  3LSF B;  4PAF A;  3T1B A;  1P99 A;  2ZNU A;  4X9T A;  1P1W A;  1B0L A;  4EQB A;  4NGU A;  3MP1 A;  1MY1 A;  1FTJ A;  1OQH A;  1POY 1;  4MIJ A;  3K6W A;  3MVX A;  3UN6 A;  1US5 A;  2H9B A;  1KA1 A;  3VFJ A;  2D21 A;  4RK2 A;  4MEV A;  3T9U A;  2VOZ A;  4N91 A;  3TUS A;  1JVX A;  4X1D A;  3MQ9 A;  1OVT A;  2PMS A;  3EPE A;  1LLS A;  2Z22 A;  1MDP 1;  3N5L A;  4NWD A;  2DVC A;  1ZMG A;  3N94 A;  1B40 A;  4F39 A;  4N13 A;  4O3A A;  1B32 A;  4OVT A;  4I40 A;  2F7B A;  3A09 A;  1IXC A;  4F22 A;  3VVF A;  3K6V A;  3CFX A;  3K4U A;  1B4Z A;  4RPO A;  3K02 A;  2ZNS A;  4PP0 A;  1FTO A;  2QMX A;  4H45 A;  2XXV A;  3H6U A;  1FQB A;  3IB0 A;  2DE2 A;  5ET8 A;  1PBP A;  3R26 A;  3I6V A;  4PE5 B;  5IZZ A;  2QS2 A;  5ICT A;  1USY H;  2FHY A;  1Q1K A;  3JYR A;  4U22 A;  1ZJL A;  4GIZ A;  4EF2 A;  1NV0 A;  5H8S A;  4G8M A;  1H44 A;  4QFO A;  2H98 A;  3PUV E;  1LAF E;  4GWY A;  3PD9 A;  1XC1 A;  3MST A;  1FPF A;  1B3H A;  4GRK A;  5IKB A;  1USY E;  1OLA A;  4I62 A;  3CHG A;  4MNC A;  2VHA A;  2F97 A;  4RXL A;  2ZNT A;  3SEV A;  1FPJ A;  3DLN A;  3OEM A;  1NV2 A;  2O1M A;  4ZS9 A;  3KGC A;  1XS5 A;  3ZS6 A;  5I59 A;  4O3B A;  3IB2 A;  4OVS A;  3CFZ A;  3UIF A;  5HBC A;  3ZKK A;  5I3S A;  3B6W A;  1MY4 A;  4QBA A;  5I56 B;  3OEN A;  2DYX A;  2W7Y A;  2A5T A;  2R71 A;  4LQ2 A;  4PBQ A;  4PET A;  2B65 A;  1FPK A;  3CVG A;  2QVU A;  5CMM A;  4EQ7 A;  1R9Q A;  4R72 A;  5H8H A;  5EYG A;  1M5F A;  4P0G A;  1MH3 A;  1US4 A;  3H6W A;  4GX4 A;  4IR8 A;  1NUZ A;  3PD8 A;  4XKQ A;  3E4R A;  1YCJ A;  1R9L A;  2O84 X;  3FBP A;  3HFU A;  3PGF A;  4F18 A;  2ZYN A;  4I3Y A;  1PB8 A;  1OMP A;  3CG3 A;  1B9J A;  4IO6 A;  4NG7 A;  2F7A A;  5ISU A;  2HXW A;  2CEX A;  2I58 A;  4PAK A;  4R9G A;  1LBW A;  2GH9 A;  5DVF A;  4C1U A;  1ATG A;  1Y9U A;  1FJ6 A;  1K9Z A;  1FQC A;  3VE1 B;  1I6B A;  3SET A;  4AS5 A;  2KQZ A;  1JP4 A;  3A29 A;  1QW0 A;  1QUK A;  1IIW A;  1LAG E;  1QKB A;  2IEE A;  1ZLQ A;  4OTE A;  2PFY A;  4YU0 A;  1SW5 A;  2Y7P A;  4UAB A;  4IO3 A;  4OVQ A;  4OFL A;  5L9O A;  5DTB A;  1LAH E;  4JVC A;  4PBH A;  4DCY A;  4KCC A;  4H46 A;  5JTY B;  3IOR A;  4JWX A;  5I57 A;  2KR0 A;  3T66 A;  1N3X A;  1DMB A;  3G3I A;  1FBC A;  5FHO A;  2FNC A;  1R1N A;  4Q8R A;  3QAX A;  5CI5 A;  3OXN A;  3TTK A;  4LZ7 A;  3QIM A;  5I2N B;  1P1U A;  2LAO A;  2VPO A;  4K3F A;  1Y3N A;  3JZJ A;  2M8C A;  3KOS A;  4OWD A;  4ZE8 A;  4YB6 A;  2ONR A;  5ICQ A;  4PF8 A;  4F31 B;  5IZ1 A;  4F1V A;  2OBG A;  4F1Y A;  1UIU A;  3SEY A;  4ZEK A;  4QFL A;  4FEB A;  1ZKB A;  1SYH A;  3C31 A;  3UGW A;  3HPI A;  5ET6 A;  2ZZX A;  5CMK A;  3IL1 B;  1NV6 A;  4YKJ A;  1Y1Z A;  4BDQ A;  3TTL A;  4POW A;  2WBD A;  1G0H A;  3LSW A;  1FBH A;  1UTH B;  2CEY A;  3DEL B;  2O68 A;  1LFG A;  3L6H A;  5AA4 A;  5EQ7 A;  1LGB C;  4GWS A;  4QRZ A;  1H3D A;  1N84 A;  5HPQ A;  5KZT A;  2QS1 A;  4DI3 D;  4NF8 B;  4QF9 A;  1D9V A;  5IZ3 A;  1BP5 A;  2XHD A;  3MVZ A;  5EHS A;  3R7X A;  1Z7M E;  5H8N A;  3RPL B;  5TP9 B;  1LST A;  4NF4 B;  4LUB A;  4WED A;  4H5F A;  4GL0 A;  1MRP A;  1PC3 A;  3HV1 A;  3O6G A;  3K1N A;  3FV1 A;  3IB1 A;  2WYP A;  3HN0 A;  4NF0 A;  3Q26 A;  1NNF A;  3PUZ E;  1FRP A;  1MM6 A;  2GQ1 A;  1IMD A;  5I2K A;  2UXA A;  1PEB A;  4NF6 A;  4GL8 A;  4H67 A;  2BJJ X;  1F9B A;  2O6A A;  5H8F B;  2VGQ A;  4U1Z A;  5ITP A;  3H06 B;  5DEX A;  4GWU A;  1NNT A;  3RN8 A;  2CZI A;  2X7P A;  4MX6 A;  4HE0 A;  1JW1 A;  3IK6 B;  2ABH A;  4IO4 A;  1SYI A;  3KEI A;  3K00 A;  2FBP A;  4E0X A;  3RT6 B;  1FBE A;  5FHM A;  1MQI A;  2G93 A;  1J1N A;  4ZZE A;  1H45 A;  3G3F A;  4H1X A;  4N6P A;  3V8X B;  1FQD A;  3BKI B;  1DPP A;  3B8B A;  4GWX A;  4Z7E A;  2QFL A;  1VSO A;  1TFA A;  1FPI A;  5TPA B;  3E9X A;  1B2H A;  2FIE A;  1N04 A;  4OVJ A;  1YPN A;  1LBB A;  4RJZ A;  4OVR A;  2PX1 A;  5BUU A;  4JDF A;  3S9M C;  4GLI A;  1AIV A;  5J1D A;  4ZEF A;  3VDF A;  1O63 A;  3OO7 A;  4OMB A;  4EF1 A;  1H76 A;  1MY3 A;  4IO2 A;  2YJP A;  2B3B A;  1GV8 A;  3TAJ A;  2AL4 A;  2RF1 A;  3E79 A;  3MZ9 A;  3MUQ A;  3QK6 A;  5AA1 A;  4ELP A;  3SEW A;  1IEJ A;  3IR1 A;  3VXC A;  5FBP A;  3OEK A;  4O94 A;  2DE3 A;  4ESW A;  1XVY A;  4I9D A;  4FIM A;  2KLF A;  4PFT A;  4KQP A;  2ZMB A;  1N0T A;  3ZKL A;  5I59 B;  3C32 A;  3OO6 A;  3FJ7 A;  2O7U A;  1SVX B;  3BIG A;  1JNF A;  1EYJ A;  2H99 A;  3E13 X;  3BFT A;  3G3J A;  5FTI A;  3ONM A;  4YMA A;  5I58 A;  1VDW A;  5CRY A;  2Y7W A;  2DWJ A;  5ITO A;  1QKA A;  1MY2 A;  4ZE9 A;  4FEC A;  4R6K A;  3UA8 A;  2DDK A;  3LUY A;  4IO7 A;  2B4L A;  1EU8 A;  3TQW A;  1B05 A;  3EN3 A;  2HEU A;  3Q28 A;  2Q8M A;  1NV7 A;  5ET7 A;  2F8D A;  3FV2 A;  1VFD A;  2Y7R A;  3MVW A;  4HW8 A;  4QFP A;  5HM4 B;  4N4U A;  4OYV A;  2V3U A;  3FVN A;  3IFA A;  1QUJ A;  4NF5 B;  4F3G A;  3BIH A;  4N81 A;  4PFR A;  2ONK E;  4JXI A;  3LSL A;  1DTG A;  2OPD A;  2XX8 A;  5AA2 B;  3T96 B;  3NOH A;  1BIY A;  4JWO A;  4HS7 A;  2OZZ A;  3MJN A;  3BFU A;  3GBB A;  2CMO A;  5DVI A;  3KG2 A;  1HSJ A;  1K9Y A;  2I3W A;  2B3F A;  2CZK A;  4XEQ A;  4THI A;  3H3G A;  5I57 B;  1FBF A;  3O29 A;  4ZEB A;  1NKX A;  4H6D A;  4XKP A;  1R6Z A;  2DWH A;  4ZEI A;  5ELV A;  4OVP A;  1MXU A;  4DLD A;  3K0V A;  4P3L A;  1IMC A;  4PFY A;  2UVI A;  2DXR A;  4LN5 A;  2GHA A;  4H8J A;  1SI1 A;  2UYE A;  3HST A;  3C35 A;  4U21 A;  4TOZ A;  4P8B A;  2I48 A;  4MCO A;  4JBZ A;  5JK4 A;  4OEN A;  4ECF A;  1NMU A;  4TLL B;  1IXH A;  4C0R A;  4IY6 A;  2DSF A;  3ZSF A;  1POT A;  3H7M A;  2O1L A;  3FXU A;  1MQJ A;  3T93 B;  3LV0 A;  1NL5 A;  4X04 A;  2XWO A;  2GHB A;  3GXA A;  3HHF A;  1LCF A;  2Q89 A;  4P47 A;  4X1B A;  1ZU0 A;  2H25 A;  3MP6 A;  1Y1M A;  4XKN A;  4NTL A;  2WBB A;  5TU0 A;  4EUO A;  1LBY A;  4P1E A;  1YYZ A;  4TQU Q;  4YKP A;  2Z8E A;  3PU5 A;  2OCU A;  2THI A;  4IGT A;  2I4B A;  4KD5 A;  3BBR A;  2CZL A;  3CR9 A;  3VXB A;  4KYD A;  4N8G A;  4M1V A;  4PGP A;  2RC7 A;  2XD3 A;  5LTC A;  5H8N B;  3IOU A;  3OEL A;  3O66 A;  4MH5 A;  5IGA A;  3LSX A;  1YAE A;  4U4X A;  4OZ9 A;  4G68 B;  3EF7 A;  2HXR A;  4N6D A;  1FPD A;  4G8H A;  4F3B A;  2Y84 A;  4OQO A;  3E78 A;  4OHN A;  3G3H A;  3RGY A;  1DK4 A;  3KSJ A;  3RUM A;  2QSX A;  4NWC A;  4JSO A;  4MLV A;  4YAH X;  1MPD A;  5I84 A;  3B6Q A;  4H8I A;  1I69 A;  4U4S A;  4NF6 B;  3S9E A;  4DI4 B;  1NV3 A;  5M2V A;  4E0W A;  2R9J A;  3CI8 A;  1IQ7 A;  3N26 A;  2ZYM A;  4OFO A;  5B70 A;  3DP4 A;  1GGG A;  4PDH A;  5IM2 A;  1P1O A;  1Y4C A;  4P11 A;  3IX1 A;  3KC0 A;  1BLF A;  1FW0 A;  3KSX A;  3V89 B;  1B3G A;  3GLB A;  1MG1 A;  3TEP A;  3FD3 A;  2HAU A;  4U23 A;  5KCJ B;  3CIJ A;  5F24 A;  1MH4 A;  2F7C A;  2Y7K A;  3HCQ A;  2I49 A;  4PGN A;  2PVU A;  3PMV A;  2YPN A;  4MMP A;  1EYI A;  1HSE A;  3MYU A;  3IAZ A;  4GXS B;  3M3L A;  3G3K A;  4BDR A;  3MP8 A;  3S9L C;  2NUV A;  2XXP A;  4JSD A;  4O3C A;  4FOR A;  3R6U A;  1O7T A;  2Q8J A;  3VLW A;  1URG A;  2DS9 A;  4EQ9 A;  4QFK A;  2F35 A;  4DXU A;  3V5A A;  2RIN A;  4H5G A;  3TZA A;  1A7L A;  1QVS A;  1D9Y A;  2ALU A;  4IO5 A;  2B4M A;  4F3S A;  5BWJ A;  2FYI A;  3OSQ A;  1NNP A;  4GFR A;  4R75 A;  2XA5 A;  2P2A A;  1FSA A;  4OXV A;  1IXG A;  3KC1 A;  2XXQ A;  3O6I A;  4KI0 E;  4MNP A;  5A5X A;  4ISU A;  2I0C A;  2HAV A;  1NNK A;  1FPE A;  3TTR A;  1B4H A;  4R6H A;  1M5E A;  2QJE A;  2ANJ A;  1ZTY A;  3TOD A;  2AYS A;  3KBR A;  4HCY A;  1AMF A;  2REJ A;  2XXI A;  1SW2 A;  3H6T A;  5FTH A;  3MPL A;  2PYY A;  5AA2 D;  3OSR A;  2DQV A;  1LFI A;  1O64 A;  1MY0 A;  1CB6 A;  4PFU A;  5DT6 A;  5CC2 A;  4GX3 A;  2NWJ A;  1FPB A;  4DIG A;  2O69 A;  1MXW A;  4PTK A;  1UIV A;  2L5V A;  3TCG A;  3CSB A;  3FUZ A;  1OIB A;  1KA0 A;  1FTK A;  2V3Q A;  2XXH A;  2XWV A;  3Q25 A;  3S4U A;  3O97 A;  3K2D A;  4XFE A;  1BKA A;  1MPC A;  3OO8 A;  2ZYO A;  3FXR A;  4OEU A;  2DP8 A;  1D4N A;  1IIT A;  1FBP A;  3U65 A;  1QJM A;  1BTJ A;  4F2Q A;  2DXY A;  5F7V A;  4O7I A;  5AA3 A;  1B58 A;  4OER A;  1B7Z A;  2G29 A;  1RKM A;  2UVG A;  4UAC A;  4NED A;  3RT8 A;  3USD A;  3UP9 A;  1ANF A;  4XTC Q;  1A55 A;  3RTW B;  4PF6 A;  4GF8 A;  1IZ1 A;  3O6H A;  1SD3 A;  2FVZ A;  5ESY A;  1B5J A;  1S9T A;  2HCA A;  1N7X A;  1LB9 A;  1SBP A;  4R2B A;  3AXF A;  1II5 A; 
#chains in the Genus database with same CATH homology
 2FHY A;  2HHM A;  4NQ8 A;  1NUW A;  2DDK A;  2XXK A;  4JVI A;  2B4L A;  2DVZ A;  3EKI A;  1NV0 A;  2Q8M A;  1NV7 A;  5ET7 A;  2XWI A;  4OA4 A;  2P3N A;  4GWY A;  3MST A;  1FPF A;  4N4U A;  3FXB A;  4NHB A;  3IFA A;  3CHG A;  4MNC A;  1SPI A;  3BIH A;  1FPJ A;  1IMB A;  4N81 A;  4PFR A;  1YZ0 A;  1RDY A;  1NV2 A;  4MHF A;  4HCW A;  4NX1 A;  4MJO A;  2DE4 A;  3NOH A;  4PFI A;  2ZZV A;  4OVS A;  1NUY A;  5I3S A;  4NN3 A;  4AS4 A;  4QBA A;  1RDZ A;  1IMF A;  1K9Y A;  2CZK A;  4XEQ A;  1EYK A;  2HZL A;  2MKZ A;  4PBQ A;  1FBF A;  4G61 A;  4PET A;  1FPK A;  2QVU A;  1YXI A;  4GX6 A;  1NUX A;  2CZH A;  4OVP A;  5EYG A;  4GBW A;  5I5P A;  4GX4 A;  4IR8 A;  1NUZ A;  4P3L A;  3HFU A;  3FBP A;  4F18 A;  1IMC A;  4I3Y A;  4LN5 A;  1RDX A;  4NG7 A;  2F5X A;  2CEX A;  4PAK A;  2Y5K A;  5EQ8 A;  4P8B A;  1LBW A;  4MCO A;  2P3V A;  5JK4 A;  4P56 A;  5A5L A;  1FJ6 A;  1K9Z A;  4YIC A;  4PE3 A;  5CM6 A;  1FPL A;  3GYY A;  5LDZ A;  4AS5 A;  2KQZ A;  1JP4 A;  3A29 A;  3QMF A;  2PFY A;  4PFB A;  3LV0 A;  4X04 A;  3LUZ A;  2XWO A;  4UAB A;  4KXP A;  4OVQ A;  1FBD A;  4JVC A;  1Q9D A;  4P47 A;  4PBH A;  1LBZ A;  2FIX A;  4H46 A;  3ROJ A;  4PC9 A;  2KR0 A;  2WBB A;  3PTY A;  2F3B A;  4MNI A;  1KZ8 A;  1LBY A;  4P1E A;  2ZZW A;  1FBC A;  3ISP A;  1YYZ A;  4N8Y A;  2VPO A;  4N8G A;  1NV1 A;  2OX3 A;  2Q9T A;  4M1V A;  4PGP A;  5ET5 A;  5I7I A;  5LTC A;  3W9W A;  5IGA A;  4PF8 A;  2PCR A;  2HXR A;  4N6D A;  1FPD A;  5IZ1 A;  1NI9 A;  4F1V A;  4GBV A;  3RPL A;  3E78 A;  2OWZ A;  4MAG A;  1DK4 A;  4NAP A;  3T0J A;  2Q74 A;  4FBP A;  4I3E A;  2QVR A;  4GWZ A;  5ET6 A;  2ZZX A;  3B50 A;  4O8M A;  1NV6 A;  4DI4 B;  1NV3 A;  1DCU A;  1FTA A;  2JJK A;  5EQ9 A;  2V4C A;  1FPG A;  2HZK A;  2PFZ A;  2WBD A;  1G0H A;  1FBH A;  2QVV A;  4PDH A;  2CEY A;  5IM2 A;  4F19 A;  4F1U A;  5EQA A;  3KC0 A;  5EQ7 A;  4GWS A;  3KBZ A;  4DI3 D;  2WYK A;  5IZ3 A;  1LBX A;  1LEV A;  1XI6 A;  5F24 A;  2WEF A;  5DW8 A;  4PGN A;  3RPL B;  3D1R A;  5EYH A;  4PAI A;  1EYI A;  4MMP A;  2R8T A;  3MYU A;  1LBV A;  4P1L A;  1IMA A;  2WYP A;  3W9V A;  4NF0 A;  1AWB A;  2VT5 A;  1FRP A;  4XF5 A;  2GQ1 A;  1IMD A;  3IFC A;  2Y5L A;  5J16 A;  1INP A;  4YZZ A;  4O7M A;  2BJI A;  1CNQ A;  2B4M A;  2F3D A;  2VPN A;  4GWU A;  5IZ3 B;  2HPG A;  2CZI A;  4MX6 A;  2WX9 A;  4HE0 A;  2XA5 A;  2XWK A;  4OAN A;  4HXV A;  1FSA A;  3KC1 A;  4MNP A;  2FBP A;  1FBG A;  1FPE A;  1FBE A;  4HE2 A;  1FJ9 A;  2QPQ A;  4HE1 A;  1DBZ A;  4PCD A;  4X8R A;  4HCY A;  1QGX A;  3RYD A;  4GWW A;  4PAF A;  4PDD A;  3T1B A;  3B8B A;  4GWX A;  4P9K A;  1IME A;  2QFL A;  4X9T A;  4NGU A;  1D9Q A;  1FPI A;  3SZP A;  2FIE A;  4GX3 A;  4OVR A;  4QXD A;  1FPB A;  5J1D A;  4MIJ A;  4PTK A;  2L5V A;  1KA1 A;  1G0I A;  1KA0 A;  4MEV A;  4JVD A;  3E79 A;  4N91 A;  2V3Q A;  2XWV A;  5T3J A;  4XFE A;  1NV4 A;  5FBP A;  1FBP A;  3U65 A;  4N15 A;  4O94 A;  4O7I A;  2DE3 A;  4OVT A;  4I40 A;  1BK4 A;  4N6K A;  3BIG A;  1EYJ A;  4H45 A;  4PF6 A;  4N17 A;  2DE2 A;  5ET8 A;  1VDW A;  2FVZ A;  5ESY A;  5IZZ A;  1NV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...