3D1RA

Structure of e. coli glpx with its substrate fructose 1,6-bisphosphate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
323
structure length
321
Chain Sequence
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKGDNENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSTIRRIQSIHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase class II glpX
publication title Structural and Biochemical Characterization of the Type II Fructose-1,6-bisphosphatase GlpX from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 321
sequence length 323
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3d1rA01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3d1rA02
2FHYA 1CNQA 5EQAA 1JP4A 4G61A 1LBZA 5EYGA 2CZIA 1EYIA 1Q9DA 2VT5A 4GX6A 1NV4A 1YYZA 3A29A 4KXPA 1FPEA 5EQ8A 3RPLA 1DK4A 1NV5A 4GWWA 1FPFA 2OWZA 3RYDA 1KZ8A 1EYJA 1NI9A 4H46A 4GX4A 2HHMA 2Q8MA 1NV6A 5LDZA 4I40A 1EYKA 4AS5A 3FBPA 5EQ9A 1LBYA 2QVUA 1KA0A 2WEFA 3BIGA 1IMEA 3BIHA 5ET5A 1NV2A 2QVRA 3ROJA 1FPGA 1IMBA 1FPDA 1FBCA 2WBDA 1FJ9A 1LEVA 4GWXA 2CZKA 4GBWA 1RDZA 4PTKA 2QVVA 4GWSA 4AS4A 2F3BA 4I3YA 3QMFA 2Y5KA 4HXVA 1FBDA 5ET6A 2F3DA 2FBPA 3RPLB 2FVZA 2PCRA 1DCUA 2Y5LA 3D1RA 4GWUA 4HE2A 4GX3A 1FJ6A 4H45A 1LBWA 5ESYA 2Q74A 1NV3A 1IMAA 4GWYA 1FSAA 2R8TA 4GWZA 1FPJA 1IMCA 1INPA 3T0JA 1D9QA 1FRPA 2GQ1A 3IFAA 1K9YA 3B8BA 4HE0A 2FIEA 1RDYA 1BK4A 2FIXA 5IZ3A 5J16A 1K9ZA 5FBPA 1FBEA 1NV1A 4QXDA 3KC1A 2DDKA 2JJKA 2P3VA 3LUZA 1FPKA 1FPBA 5F24A 4FBPA 1LBXA 5A5LA 1YZ0A 3KC0A 1FTAA 1NUYA 2P3NA 2BJIA 1FPIA 1QGXA 4GBVA 5DW8A 1IMDA 1LBVA 2CZHA 1AWBA 2QFLA 1VDWA 5EQ7A 4MJOA 4IR8A 2WBBA 1NV0A 1G0IA 5IZ1A 1FBPA 1KA1A 1YXIA 1FBHA 3KBZA 1G0HA 1SPIA 4O7IA 5EYHA 1NUXA 1NUWA 5I3SA 2OX3A 3IFCA 5IZ3B 5ET8A 1NUZA 3LV0A 5ET7A 4HE1A 1DBZA 1NV7A 1FBGA 1FBFA 1RDXA 1XI6A 1IMFA 4N81A 1FPLA 4I3EA 5T3JA
chains in the Genus database with same CATH superfamily
1ZU0A 4HCWA 3T66A 2F78A 1Q9DA 4FIMA 2H9BA 4KYSA 5AA4B 2PYYA 2QMXA 4IO6A 4H46A 4H65A 1NV6A 3CI8A 4NG7A 4I40A 3OELA 3PUZE 4POXA 4OERA 1N0TA 3ILUB 4GL8A 4MMPA 4OENA 1LCTA 3O97A 4QFLA 4AB5A 4PBQA 4NF0A 2OPEA 1VFEA 1VR5A 2DS9A 3HN0A 1B7HA 2X26A 2F97A 3QMFA 1Q1KA 2H99A 3Q28A 3QUJA 3CR9A 1OLAA 4JVIA 5AA1A 2DVCA 3I5OA 4G77A 3T1BA 5ESYA 3EF7A 4R6KA 4ZZEA 3UIFA 3JZJA 1XS5A 4U1ZA 2FIEA 4YKIA 1OMPA 1IXHA 3KC1A 3KN8A 2Z8DA 3PUWE 4KFQA 1LB9A 1XVXA 2VP1A 1CE2A 4FBPA 2I0BA 4F22A 3T93B 4QSEA 2CEXA 5DTBA 5KDTA 2DYXA 3QUFA 3MZ9A 4GBVA 3IX1A 3PUYE 2ZYKA 4UABA 3OO6A 4MNCA 5EQ7A 1R1NA 3PPNA 4GQOA 4IR8A 3TQWA 3TTMA 3FXBA 1G0HA 1M5BA 3SEYA 4PFUA 1NUWA 4X04A 5H8NA 4KCCA 2AIXA 1YAEA 3OENA 3CRBA 3H6VA 2F36A 2FHYA 2I3WA 2V3QA 4F3SA 2H98A 4ZE9A 3OOAA 5I58B 4YAHX 4ELPA 1LAGE 1QUIA 3H6TA 4ZZAA 1JVXA 1XOCA 2REGA 3G3IA 3PGFA 4Z0IA 2ONKE 2RKMA 1QKBA 3PTYA 4KR5A 1XC1A 5EQ9A 3TTKA 1KA0A 1QW0A 3S4UA 2O6AA 1JEUA 1FPDA 1FBCA 4N13A 1NH7A 3ZKKA 3QAXA 4F18A 3CG3A 2QS2A 1OIBA 4ZEDA 1TXFA 3LBSA 4P56A 1EZOA 3FGSA 5ICTA 4FJPA 1DTZA 4PGPA 3GYYA 3C4MA 3TCFA 4WEDA 1J1NA 1MQHA 1FPKA 5F24A 4F1VA 4YMBA 1T0KA 3R7XA 1YZ0A 1IQ7A 4ZS9A 2PMSA 1JW5A 2O7UA 2F7AA 4IO7A 4PDDA 3SDFA 1NNFA 3IO4A 2Z22A 5H8HB 3FVNA 3ZS6A 1G0IA 2A5SA 1S7YA 3U72A 2B4MA 1JVYA 1XVYA 3N6TA 4XXUA 2F7BA 1QKAA 2A5TB 2XA5A 3FIRA 1S50A 3T9HB 4Q30B 1B3HA 4BDMA 4LZ8A 4ELRA 2MKZA 3B6WA 2Y7PA 3RPLA 3A29A 4OETA 4C1UA 1DK4A 3CIJA 5CMMA 4PFWA 3RQTA 4NWCA 1R9LA 1B5JA 3BIHA 3TAJA 5ET5A 3ILTB 2B3BA 3HV1A 3QK6A 2OWTA 4ND9A 3E9XA 3IB0A 4RNSA 4RPNA 4RY1A 3BBRA 3T9XB 4FORA 4NF5B 3DM0A 3HO7A 4E0XA 3RTFB 3RGYA 3S9NC 4P9KA 4H1XA 1INPA 5TP9B 5I56B 1DOTA 4OESA 2KQZA 2DWHA 5HPQA 4OVSA 3F11A 2HZLA 2XXRA 3RPWA 3FJ7A 1FTAA 4YB7A 1B58A 5CBRA 1P1NA 4K3FA 2AL5A 2OWSA 1M5EA 2GH9A 2UXAA 1FBPA 2XD2A 3RT6B 1KA1A 4NX1A 5FTIA 1WDNA 2AL4A 3HHGA 3CFZA 3KZGA 4R6YA 3M3FA 4QSCA 1DBZA 2XWKA 4PAFA 5I56A 3W9WA 3T22A 1EZPA 2FA7A 1SD3A 3M8UA 2QPQA 3PUXE 1P1QA 4GX6A 3O2AA 4MLQA 3RYDA 3OO8A 2QS3A 3KFMA 4YKJA 5JK4A 2GHAA 1IITA 1FQFA 3FBPA 2QVUA 3JYRA 4RYAA 3O6IA 4PQJA 2CEYA 1FPGA 2RINA 4BDNA 2OLBA 1Y3NA 3OEMA 4WKMA 3U94A 5I2NB 1LFGA 4ESXA 2Y7WA 1FBDA 5ET6A 4H5GA 2D3IA 2Y7IA 3MVXA 5AA2D 1LFIA 4GWYA 1FSAA 2XXVA 3M3LA 5EYFA 4GD5A 4MLVA 4GFRA 4RJZA 1RDYA 5IZ3A 4XKRA 5CC2A 5FBPA 3H06B 4JVCA 4GL0A 1UTBA 1KWHA 1YCJA 4PF8A 1Q35A 4KQPA 3KC0A 3Q26A 4O3BA 3FXUA 5ITPA 4FE8A 3K00A 5H8QA 1P99A 3OO9A 2CZHA 2LAOA 1I6QA 3OMBA 1Y9UA 2DXYA 4NGUA 4XEQA 3Q27A 2XXHA 3C33A 2O1LA 3GZGA 1AOVA 4P1EA 3IFCA 5ET8A 4IGTA 1PB7A 2ZNUA 4YKKA 4EQBA 4IO2A 3PV0E 3IO6A 1Y1MA 2THIA 2W7YA 2CZIA 5DEXA 4O8MA 2KR0A 3DELB 2XXIA 3SEXA 1VE4A 4P3LA 5FHNA 3W9VA 2V4CA 4R6HA 2F6PA 2X7QA 2Z8FA 1B0HA 4MX6A 1PB9A 5TPAB 4X9TA 2P0SA 5EHSA 3U92A 1RDZA 4IGRA 3MWBA 1US4A 5K2XA 1M5FA 1MG1A 1LBCA 5JTYB 4ELQA 3RN8A 3SEWA 4XF5A 2H25A 3FVKA 1A8FA 1MM7A 2VHAA 3FXQA 2Q89A 2HEUA 1MH4A 4X8RA 4IY5A 5K2YA 4TLLB 2XX7A 3U8QA 1ATGA 1FRPA 2XXTA 5J16A 3MYUA 3S9EA 4OTEA 3IB2A 3BKIB 1MY2A 2HXWA 1Y20A 4EUOA 4OHNA 4F29A 3CFXA 4RK9A 2Z8EA 3QXMA 3VLVA 4ZEFA 4NF4B 3E4RA 2HQ0A 4E0WA 1D9VA 1B40A 3UGWA 2QS1A 4U23A 3KG2A 4KCDA 2DOJA 3H7MA 3EHUA 3DP6A 4IO5A 4R72A 1QVSA 1FBGA 3T9UA 1FPLA 2UVIA 4U22A 3U1OA 2YPNA 4POWA 4F1UA 4PFBA 4OVTA 2QMWA 3TMGA 2ZYOA 4AQ4A 3OEKA 3N94A 1YYZA 2R6GE 4WXJA 4GWWA 1NNKA 1B4HA 1EYJA 4DCYA 4OWDA 3LSWA 2PX1A 4U21A 2YLNA 4R9GA 1SW2A 1FQEA 3CSGA 3BIGA 3PU5A 4PBHA 1HSJA 2DSFA 4G8NA 3ROJA 1FQCA 4PAIA 3I3VA 2D21A 4MCOA 4OA4A 5HBCA 2CZKA 5B70A 3FD3A 2F3BA 4I3YA 4Q8RA 3SERA 4HXVA 2NWJA 3TTNA 3CG1A 4UA8A 3FJMA 1MY4A 4RA1A 3IOWA 3THIA 3QYTA 3B50A 3VVDA 3U65A 2UVGA 1B46A 4I9DA 3MP8A 3TTLA 4YKPA 1GVCA 3TYHA 1AL3A 4LATA 1RYXA 4NF8A 4PF6A 4EDPA 3UORA 2DWIA 4Q5TA 3IL1B 3FV2A 1GTKA 1I69A 2G29A 4OQOA 1LGBC 5AA4A 3OO7A 2DE2A 2I48A 4DXCA 1Z7NE 4G8HA 4DE8A 1HSEA 4NWDA 2IEEA 3VE1B 3B6QA 4PC9A 3LV0A 5DVIA 5KCJB 4N4UA 1FBFA 4LQ2A 1B5HA 4F3BA 2ZYMA 1OVBA 1CNQA 1ELJA 5I57B 3VXBA 2XXKA 5A5XB 4OMBA 4F2QA 2OWZA 1KZ8A 1ZTYA 4GX4A 2O68A 3CFLA 5L9SA 1LFHA 1LAHE 1GR2A 3B7DA 4XKNA 3PD9A 4OZ9A 3A3UA 2M8CA 3K02A 3KN3A 3O6GA 1TFDA 3HCQA 4HW8A 3MJNA 5I57A 2B4LA 3SEVA 4DZ1A 4U4SA 1K9YA 2B65A 4H5FA 1NV1A 2WYPA 1XT8A 4X48A 3LUZA 1FPBA 1NNPA 4EF1A 4QFOA 3O66A 2QSXA 3IOTA 4ISUA 3LSLA 5I58A 1A40A 4PCDA 4G4PA 4R74A 2F35A 1VDWA 1VFDA 4NF6B 4MJOA 2WBBA 1QUKA 4G8MA 1N84A 5EYHA 1NUXA 3S9LC 4IO3A 3IR1A 4IY6A 4H8JA 5FHOA 4X1BA 5IAIA 1IIWA 1PC3A 4OFJA 1MY1A 2UVHA 1Y4CA 1EYIA 2XX9A 2L5VA 2Z23A 3P7IA 1NNTA 2I49A 4JSDA 5I7IA 2GRVA 5B7DA 1D4NA 4GOTA 2F8DA 1PDAA 3E78A 5LDZA 4DI3D 3IOUA 2F6GA 3K2DA 3PPQA 3HFUA 1B4ZA 1LB8A 4OEVA 1EZ9A 4IO4A 1IUDA 2QRYA 3TKDA 1MRPA 3Q25A 4PDHA 4AS4A 2QVVA 4GWSA 3SZPA 4UACA 1M5DA 4LVQA 1AH5A 1DCUA 3D1RA 1LAFE 1SW5A 3N5LA 1MXYA 3FUZA 3W15C 2ESNA 3SETA 5H8HA 2O51A 3OD7A 1D9QA 5IM2A 4JXIA 2Y84A 2HXRA 3B8BA 4HTGA 4I8CA 1MQIA 2ALUA 1ZBMA 4ZE8A 5I84A 5DYHA 5F7VA 2A5TA 3KEIA 2DWAA 1O64A 4ECFA 4YICA 3H6WA 1NFTA 4TLMB 1B05A 4XTCQ 1DSNA 5DT6A 4P0GA 4BDQA 3PD8A 3RUMA 1CB6A 3LSXA 2ZNTA 4DDDA 3MBPA 1NV7A 2XXUA 1RDXA 2HZKA 1GGGA 3ODBA 1NMUA 2HCAA 4NF5A 2H5YA 4QBAA 3B6TA 4G68C 3H3GA 4PGNA 4EQ9A 1LAXA 2PFZA 1P1UA 4F2OA 4MFIA 2OBGA 1NV5A 3K6VA 1FTJA 5L9OA 5DVFA 4O7MA 4F3GA 1A55A 3N26A 4OFOA 5I2KB 3L6HA 4HS7A 5TP9A 4OVPA 4FECA 1O7TA 4P1LA 4ELOA 3IK6B 4GWXA 4GXSB 4JWOA 2XD3A 2F5XA 2FVZA 2RC9A 4PFTA 4HE2A 2DWJA 3KJTA 3QSLA 4N15A 4MIJA 4XKPA 1IMAA 5EHMA 1B7ZA 4QRZA 3MAMA 5HM4B 2HAUA 3MP1A 5IZZA 2VPNA 3DP8A 2XHDA 2GQ1A 3EQ1A 3FZVA 2Q88A 1FW0A 2FIXA 1QUJA 3OSRA 1I6AA 1B0LA 1LCFA 2V25A 5ELVA 4DXBA 4OEUA 4OVQA 4EXLA 4PP0A 4DI4B 4LUBA 1II5A 4H0WA 4QFPA 2BJIA 3LR1A 1FPIA 4BDRA 3IJXB 2ZZWA 3L6GA 4KYEA 3OSQA 5BWJA 3KJ7A 4ESWA 3V5AA 3VLUA 1DPPA 3JV9A 3K6WA 1MQDA 2ANJA 3OXNA 5LTCA 2PT1A 3AXFA 1UTHB 2O69A 1MXWA 2KLFA 1SI1A 3DLNA 3MZBA 3VXCA 5DVJA 1A8EA 3CSBA 5I2NA 1OLCA 5FTHA 4ZEKA 3VVFA 1OQGA 4JB7A 3MQ9A 1N3XA 1H44A 5EQ8A 3C9HA 1D3KA 2RCBA 2ZYNA 2Y7KA 3PMWA 2QJEA 3MPKA 5CRYA 1DTGA 3R26A 2V3UA 2QVRA 1MXZA 1MPBA 5H8FB 3RLFE 3C35A 4RXLA 4O3AA 1UIUA 4QF9A 3ISPA 4OXVA 1Y3QA 3MSTA 2Q8JA 2OJTA 3TCGA 4L17A 4DIGA 4LN5A 1FTKA 3KOTA 4R2BA 1MXUA 1MY3A 2I6EA 1MDQA 1PBQA 2ZXTA 4QSDA 1PEBA 2QS4A 3KN7A 5TU0A 4PFRA 4P8BA 3M3KA 3E79A 5I5PA 5KZTA 1JETA 3PMVA 1IZ1A 1NUYA 4FATA 3HHFA 1QGXA 1POTA 4LA9A 5L9MA 1R6ZA 1B3GA 3WAFA 4GLIA 1LBVA 1AWBA 3VV5A 2VD2A 1B3LA 4U4XA 3MVWA 4PETA 1BKAA 2WYKA 2I3VA 1IMFA 3SKPA 1OVTA 5TPAA 1JQFA 2OK2A 4G61A 5JTYA 2CZLA 2G93A 1B6HA 3CHGA 1FPEA 4MEVA 2WX9A 3ZKLA 3MC2A 2XWOA 1NI9A 3IJOB 3VFJA 1QJMA 1MXXA 3FATA 1LBYA 1HSLA 2DE4A 2OZZA 1Y1ZA 2DQVA 1SVXB 3O29A 1AIVA 4X1DA 4ZEIA 4JVDA 4JWXA 4QHQA 4GWOA 3G3KA 2ZNSA 3FASA 4R9FA 1N7XA 4NF4A 3LSFB 4NHBA 4GWUA 5JEIA 1ZMGA 2PVUA 2RCAA 4O3CA 4ZECA 1FQBA 3SESA 1A99A 5CBSA 2UYFA 3D4GA 4ZDMA 2PBWA 3RY3A 4QXDA 3EPEA 1B5IA 3MP6A 1H76A 2Q9TA 3TELA 4EF2A 1OQHA 4OVJA 4U2RA 1FCKA 5DW8A 1IMDA 4ONYA 4F31B 5J1DA 4PE5B 2NUVA 4BLAA 4GF8A 1YPNA 2QFLA 1R9QA 4MF3A 4N17A 1GV8A 4F39A 2CMOA 1SQYA 1YXIA 1SPIA 4G2ZA 4O94A 5ICQA 1XI6A 1VSOA 3S2VA 1URDA 2IA4A 5KDTB 2P1SA 1JP4A 3RNNA 1LBZA 5M2VA 1TFAA 2GFEA 3TFLA 4Z7EA 2REJA 4N8GA 4YZZA 1USYH 1LBBA 2H4IA 4JWYA 4WEPA 1IXIA 5H8NB 1UQWA 2F7CA 4P11A 4LQ5A 5CMBA 1MQJA 3V89B 5IGAA 2OPDA 2Y5KA 2ZZVA 4U1OA 1F9BA 4H45A 1ZJLA 2D5WA 2Q74A 1NV3A 1D9YA 3H4ZA 1IMCA 1POY1 4THIA 3K1NA 4HCYA 5ITOA 3EHTA 3GBAA 3K01A 1FBEA 3VDFA 4KI0E 4GIZA 4N91A 5KCJA 2RC7A 2GHBA 3LC8A 2VGQA 4FEDA 1URSA 1EH3A 3MVZA 4N6KA 3G3GA 2X7PA 3G7WA 4GXAA 4AB6A 2ZZXA 3QIMA 5A5XA 3UK4A 1H3DA 4KPTA 5CMKA 2XXXA 1NV0A 2O84X 1S9TA 1FTOA 3O9PA 3GXAA 1Z7ME 2XXQA 3TTRA 4NQ8A 3PPPA 1MS7A 3K1PA 4MAGA 3TDJA 1A54A 5EYGA 4LONB 3T96B 3I6VA 4N07A 3EHSA 1BIYA 1SW1A 4XIGQ 4BDLA 2VOZA 4NN3A 4AS5A 3K0VA 2WEFA 4XFEA 3RT8A 4PE3A 5AE4A 2Q2AA 1H43A 3EN3A 3K1MA 2BJJX 4PTKA 1SYIA 3H03A 2HAVA 2I58A 3GBBA 2I4BA 5CM6A 3RPLB 4F1YA 1B32A 1MXVA 3EKIA 2V3TA 3C32A 1LBWA 1Y3PA 4FEBA 3O6HA 3RTWB 3T9VA 2UYEA 4QFNA 4NF6A 3V8XB 4MNPA 1TWYA 3ECRA 4HE0A 1BK4A 4F19A 2VPOA 3KBRA 1LSTA 1K9ZA 2E1SA 3VLWA 2JJKA 3UN6A 4YMAA 3TEPA 3KSXA 1Y4TA 4ZEBA 2NOOA 4I1DA 4G68B 4DCXA 3IB1A 3PPOA 1B3EA 2YJPA 1FBHA 1FTMA 4F3PA 5I3SA 3C36A 4HE1A 2DXRA 4TOZA 5FHMA 5T3JA 2V93A 3O28A 2RC8A 4KD5A 3UA8A 2QL3A 4M4GA 2V84A 1EYKA 2UVJA 1M5CA 1MM6A 3UP9A 1JW1A 1MQGA 1YTVA 1IMEA 4G68A 1USYE 1FTLA 1NV2A 1IXGA 1IMBA 3G3HA 5L8DA 4KYDA 1LEVA 3LUYA 1BP5A 1NH8A 3MW0A 5LOMA 2FNCA 1MDP1 1P1WA 2ZMBA 2PCRA 3DP4A 4YB6A 1US5A 2PT2A 4GWZA 4FAJA 1RKMA 4H6DA 4NAPA 1PB8A 3FV1A 1SW4A 3IORA 2DDKA 2ONRA 1NL5A 4LZ7A 3TZAA 2WKYA 4TQUQ 4NE4A 3PMXA 2NXOA 4IB2A 4P0IA 1DMBA 1MY0A 4BDOA 3USDA 2NVUB 5AA3A 3GLBA 3FVOA 2R71A 5I59B 4H8IA 4NTLA 3D4CA 4XKQA 4MNIA 4M1VA 3HPIA 1A7LA 3TPAA 3KBZA 1B9JA 3VVEA 5I2KA 1SI0A 2OX3A 5IZ3B 1IEJA 2ONSA 1NUZA 5ET7A 1H45A 2E0SA 1O63A 3S9MC 4Q0CA 1UTBB 3PUVE 4LZ5A 1PBPA 5CMCA 4I3EA 3SEUA 1MPCA 1BTJA 3HSTA 1B51A 1N7WA 3BFUA 3N6UA 1URGA 4R73A 5H8QB 3BFTA 3CVGA 2VT5A 4LP2B 3MUQA 1FPFA 1RYOA 2HHMA 2Q8MA 4OYVA 3G3JA 5BUUA 4YU0A 1FQAA 2Q2CA 4N8YA 5IKBA 2DP8A 4OVRA 1EU8A 2VD3A 5I59A 3TODA 4MH5A 2I0CA 5F1QA 2DVZA 4GVOA 1I6BA 1ZIUA 5AA2B 2OCUA 4JSOA 3TCHA 2FYIA 1WODA 2Y7RA 5DEXB 2F3DA 3KSJA 2Y5LA 2B3FA 4GX3A 4P47A 3A09A 3TQLA 3E3KA 3NOHA 2HPGA 2R8TA 1FPJA 1XHYA 4H67A 3ZSFA 3R6UA 4GRKA 3IFAA 1SYHA 2O7IA 1UTHA 1NKXA 4N6PA 2P3VA 2HFBA 4PAKA 5A5LA 3PPRA 3V83A 4QFKA 2XXYA 1SDXA 1WVJA 4RPOA 5AA2A 3K4UA 3Q29A 3K6UA 4OANA 1QULA 3H6UA 1L5TA 1B1XA 4R2FA 4O7IA 2XX8A 1ZKBA 4N6DA 1B52A 5CI5A 4N81A 5H8FA 2ABHA 3IAZA 1B7UA 4RK2A 3C31A 2F34A 1N3WA 4NMYA 1IXCA 5EQAA 3A3CA 1LLSA 4C0RA 4PFIA 1NV4A 4KXPA 1N76A 3TUSA 5H8SA 3ONMA 3MZ1A 1UIVA 1N04A 1ANFA 4JDFA 3WAEA 2WBDA 1FJ9A 4R75A 4GBWA 2XWVA 3C34A 3MPLA 1AMFA 3FVGA 4YB5A 2R9JA 2FBPA 4OFLA 2I4CA 1ZLQA 4PFYA 4I62A 1FJ6A 1DPEA 1JEVA 3G3FA 4EXKA 1SBPA 3KGCA 1MH3A 3T0JA 2AYSA 3MVYA 2XWIA 4EQ7A 2XXWA 1B2HA 3FXRA 4KHZE 3KOSA 2PFYA 4MBPA 1TT1A 3E13X 1LBXA 1JW4A 1BLFA 3IOVA 1FQDA 2P3NA 2O1MA 1B3FA 4DXUA 5ISUA 1JNFA 3U93A 4C1TA 5IZ1A 3K6XA 2DE3A 2P2AA 2RF1A 4DLDA 3FJGA 1MPDA 1B1HA 2XXPA 4JBZA 4NF8B 1P1OA 4NEDA 4MHFA
chains in the Genus database with same CATH topology
4HCWA 4MAGA 5EYGA 4QBAA 2CZIA 1Q9DA 4O8MA 4PGNA 2PFZA 1NV5A 4H46A 2KR0A 1NV6A 4NG7A 4I40A 4P3LA 4O7MA 3W9VA 2V4CA 4NN3A 4AS5A 2WEFA 4XFEA 4OVPA 4MMPA 4PE3A 4P1LA 4MX6A 4X9TA 4PBQA 4NF0A 4GWXA 4PTKA 1RDZA 3QMFA 4XF5A 5CM6A 2F5XA 3RPLB 2FVZA 4HE2A 4JVIA 3T1BA 3EKIA 4N15A 1LBWA 5ESYA 4MIJA 1IMAA 4X8RA 5IZZA 2VPNA 1FRPA 2GQ1A 4MNPA 4HE0A 2FIEA 2FIXA 1BK4A 5J16A 3MYUA 2VPOA 4F19A 1K9ZA 3KC1A 2JJKA 4FBPA 4OVQA 4DI4B 2CEXA 2BJIA 1FPIA 4GBVA 2ZZWA 4UABA 4MNCA 5EQ7A 4IR8A 1FBHA 3FXBA 1G0HA 1NUWA 5I3SA 4X04A 5LTCA 4HE1A 1FBGA 1FPLA 4F1UA 4PFBA 4OVTA 5T3JA 2FHYA 2V3QA 1YYZA 5EQ8A 4GWWA 1EYJA 3PTYA 1EYKA 5EQ9A 1KA0A 3BIGA 4PBHA 1IMEA 1NV2A 2QVRA 3ROJA 4PAIA 1IMBA 1FPDA 4MCOA 1FBCA 4OA4A 1LEVA 2CZKA 4F18A 2F3BA 4I3YA 3ISPA 4HXVA 3MSTA 2PCRA 4LN5A 4P56A 4GWZA 3B50A 3U65A 4PFRA 4P8BA 4NAPA 4PGPA 3GYYA 3E79A 2DDKA 4PF6A 5I5PA 1FPKA 5F24A 4F1VA 1YZ0A 1NUYA 1QGXA 1LBVA 1AWBA 4PDDA 2DE2A 4MNIA 4M1VA 1G0IA 3KBZA 4PC9A 2OX3A 5IZ3B 1NUZA 3LV0A 5ET7A 2B4MA 4PETA 2WYKA 4N4UA 1FBFA 1IMFA 2XA5A 4I3EA 1CNQA 4G61A 2VT5A 2MKZA 3CHGA 3RPLA 3A29A 1FPEA 4MEVA 2WX9A 2XXKA 1DK4A 1FPFA 2OWZA 2XWOA 1KZ8A 1NI9A 4GX4A 2HHMA 2Q8MA 1LBYA 4N8YA 2DE4A 4OVRA 3BIHA 5ET5A 2DVZA 4JVDA 2F3DA 4NHBA 2Y5LA 4GWUA 4GX3A 4P47A 4P9KA 3NOHA 2HPGA 2R8TA 2B4LA 1FPJA 1INPA 3IFAA 1K9YA 2KQZA 1NV1A 4QXDA 2WYPA 4OVSA 2P3VA 3LUZA 1FPBA 4PAKA 2Q9TA 2HZLA 5A5LA 1FTAA 4PCDA 5DW8A 1IMDA 5J1DA 4OANA 2QFLA 1VDWA 4MJOA 2WBBA 4N17A 1FBPA 1KA1A 4NX1A 1YXIA 1SPIA 4O7IA 5EYHA 1NUXA 4N6DA 4O94A 1DBZA 2XWKA 4N81A 1XI6A 4PAFA 3W9WA 5EQAA 1JP4A 2QPQA 1LBZA 1EYIA 4GX6A 2L5VA 4PFIA 1NV4A 4KXPA 3RYDA 5I7IA 5JK4A 4YZZA 5LDZA 4N8GA 3E78A 4DI3D 3FBPA 2QVUA 3HFUA 2CEYA 1FPGA 5IGAA 2WBDA 1FJ9A 4PDHA 4GBWA 4AS4A 2QVVA 4GWSA 2XWVA 3SZPA 2Y5KA 2ZZVA 1FBDA 5ET6A 2FBPA 1DCUA 3D1RA 1FJ6A 4H45A 2Q74A 1NV3A 4GWYA 1FSAA 1IMCA 3T0JA 1D9QA 5IM2A 4HCYA 2HXRA 3B8BA 1RDYA 5IZ3A 2XWIA 5FBPA 1FBEA 4JVCA 4N91A 2PFYA 4PF8A 1LBXA 4YICA 3KC0A 4N6KA 2P3NA 2CZHA 2ZZXA 4NGUA 1NV0A 4XEQA 5IZ1A 2DE3A 4P1EA 3IFCA 5ET8A 1NV7A 1RDXA 2HZKA 4NQ8A 4MHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHY A;  1CNQ A;  5EQA A;  1JP4 A;  4G61 A;  1LBZ A;  5EYG A;  2CZI A;  1EYI A;  1Q9D A;  2VT5 A;  4GX6 A;  1NV4 A;  1YYZ A;  3A29 A;  4KXP A;  1FPE A;  5EQ8 A;  3RPL A;  1DK4 A;  1NV5 A;  4GWW A;  1FPF A;  2OWZ A;  3RYD A;  1KZ8 A;  1EYJ A;  1NI9 A;  4H46 A;  4GX4 A;  2HHM A;  2Q8M A;  1NV6 A;  5LDZ A;  4I40 A;  1EYK A;  4AS5 A;  3FBP A;  5EQ9 A;  1LBY A;  2QVU A;  1KA0 A;  2WEF A;  3BIG A;  1IME A;  3BIH A;  5ET5 A;  1NV2 A;  2QVR A;  3ROJ A;  1FPG A;  1IMB A;  1FPD A;  1FBC A;  2WBD A;  1FJ9 A;  1LEV A;  4GWX A;  2CZK A;  4GBW A;  1RDZ A;  4PTK A;  2QVV A;  4GWS A;  4AS4 A;  2F3B A;  4I3Y A;  3QMF A;  2Y5K A;  4HXV A;  1FBD A;  5ET6 A;  2F3D A;  2FBP A;  3RPL B;  2FVZ A;  2PCR A;  1DCU A;  2Y5L A;  3D1R A;  4GWU A;  4HE2 A;  4GX3 A;  1FJ6 A;  4H45 A;  1LBW A;  5ESY A;  2Q74 A;  1NV3 A;  1IMA A;  4GWY A;  1FSA A;  2R8T A;  4GWZ A;  1FPJ A;  1IMC A;  1INP A;  3T0J A;  1D9Q A;  1FRP A;  2GQ1 A;  3IFA A;  1K9Y A;  3B8B A;  4HE0 A;  2FIE A;  1RDY A;  1BK4 A;  2FIX A;  5IZ3 A;  5J16 A;  1K9Z A;  5FBP A;  1FBE A;  1NV1 A;  4QXD A;  3KC1 A;  2DDK A;  2JJK A;  2P3V A;  3LUZ A;  1FPK A;  1FPB A;  5F24 A;  4FBP A;  1LBX A;  5A5L A;  1YZ0 A;  3KC0 A;  1FTA A;  1NUY A;  2P3N A;  2BJI A;  1FPI A;  1QGX A;  4GBV A;  5DW8 A;  1IMD A;  1LBV A;  2CZH A;  1AWB A;  2QFL A;  1VDW A;  5EQ7 A;  4MJO A;  4IR8 A;  2WBB A;  1NV0 A;  1G0I A;  5IZ1 A;  1FBP A;  1KA1 A;  1YXI A;  1FBH A;  3KBZ A;  1G0H A;  1SPI A;  4O7I A;  5EYH A;  1NUX A;  1NUW A;  5I3S A;  2OX3 A;  3IFC A;  5IZ3 B;  5ET8 A;  1NUZ A;  3LV0 A;  5ET7 A;  4HE1 A;  1DBZ A;  1NV7 A;  1FBG A;  1FBF A;  1RDX A;  1XI6 A;  1IMF A;  4N81 A;  1FPL A;  4I3E A;  5T3J A; 
#chains in the Genus database with same CATH topology
 1ZU0 A;  4HCW A;  3T66 A;  2F78 A;  1Q9D A;  4FIM A;  2H9B A;  4KYS A;  5AA4 B;  2PYY A;  2QMX A;  4IO6 A;  4H46 A;  4H65 A;  1NV6 A;  3CI8 A;  4NG7 A;  4I40 A;  3OEL A;  3PUZ E;  4POX A;  4OER A;  1N0T A;  3ILU B;  4GL8 A;  4MMP A;  4OEN A;  1LCT A;  3O97 A;  4QFL A;  4AB5 A;  4PBQ A;  4NF0 A;  2OPE A;  1VFE A;  1VR5 A;  2DS9 A;  3HN0 A;  1B7H A;  2X26 A;  2F97 A;  3QMF A;  1Q1K A;  2H99 A;  3Q28 A;  3QUJ A;  3CR9 A;  1OLA A;  4JVI A;  5AA1 A;  2DVC A;  3I5O A;  4G77 A;  3T1B A;  5ESY A;  3EF7 A;  4R6K A;  4ZZE A;  3UIF A;  3JZJ A;  1XS5 A;  4U1Z A;  2FIE A;  4YKI A;  1OMP A;  1IXH A;  3KC1 A;  3KN8 A;  2Z8D A;  3PUW E;  4KFQ A;  1LB9 A;  1XVX A;  2VP1 A;  1CE2 A;  4FBP A;  2I0B A;  4F22 A;  3T93 B;  4QSE A;  2CEX A;  5DTB A;  5KDT A;  2DYX A;  3QUF A;  3MZ9 A;  4GBV A;  3IX1 A;  3PUY E;  2ZYK A;  4UAB A;  3OO6 A;  4MNC A;  5EQ7 A;  1R1N A;  3PPN A;  4GQO A;  4IR8 A;  3TQW A;  3TTM A;  3FXB A;  1G0H A;  1M5B A;  3SEY A;  4PFU A;  1NUW A;  4X04 A;  5H8N A;  4KCC A;  2AIX A;  1YAE A;  3OEN A;  3CRB A;  3H6V A;  2F36 A;  2FHY A;  2I3W A;  2V3Q A;  4F3S A;  2H98 A;  4ZE9 A;  3OOA A;  5I58 B;  4YAH X;  4ELP A;  1LAG E;  1QUI A;  3H6T A;  4ZZA A;  1JVX A;  1XOC A;  2REG A;  3G3I A;  3PGF A;  4Z0I A;  2ONK E;  2RKM A;  1QKB A;  3PTY A;  4KR5 A;  1XC1 A;  5EQ9 A;  3TTK A;  1KA0 A;  1QW0 A;  3S4U A;  2O6A A;  1JEU A;  1FPD A;  1FBC A;  4N13 A;  1NH7 A;  3ZKK A;  3QAX A;  4F18 A;  3CG3 A;  2QS2 A;  1OIB A;  4ZED A;  1TXF A;  3LBS A;  4P56 A;  1EZO A;  3FGS A;  5ICT A;  4FJP A;  1DTZ A;  4PGP A;  3GYY A;  3C4M A;  3TCF A;  4WED A;  1J1N A;  1MQH A;  1FPK A;  5F24 A;  4F1V A;  4YMB A;  1T0K A;  3R7X A;  1YZ0 A;  1IQ7 A;  4ZS9 A;  2PMS A;  1JW5 A;  2O7U A;  2F7A A;  4IO7 A;  4PDD A;  3SDF A;  1NNF A;  3IO4 A;  2Z22 A;  5H8H B;  3FVN A;  3ZS6 A;  1G0I A;  2A5S A;  1S7Y A;  3U72 A;  2B4M A;  1JVY A;  1XVY A;  3N6T A;  4XXU A;  2F7B A;  1QKA A;  2A5T B;  2XA5 A;  3FIR A;  1S50 A;  3T9H B;  4Q30 B;  1B3H A;  4BDM A;  4LZ8 A;  4ELR A;  2MKZ A;  3B6W A;  2Y7P A;  3RPL A;  3A29 A;  4OET A;  4C1U A;  1DK4 A;  3CIJ A;  5CMM A;  4PFW A;  3RQT A;  4NWC A;  1R9L A;  1B5J A;  3BIH A;  3TAJ A;  5ET5 A;  3ILT B;  2B3B A;  3HV1 A;  3QK6 A;  2OWT A;  4ND9 A;  3E9X A;  3IB0 A;  4RNS A;  4RPN A;  4RY1 A;  3BBR A;  3T9X B;  4FOR A;  4NF5 B;  3DM0 A;  3HO7 A;  4E0X A;  3RTF B;  3RGY A;  3S9N C;  4P9K A;  4H1X A;  1INP A;  5TP9 B;  5I56 B;  1DOT A;  4OES A;  2KQZ A;  2DWH A;  5HPQ A;  4OVS A;  3F11 A;  2HZL A;  2XXR A;  3RPW A;  3FJ7 A;  1FTA A;  4YB7 A;  1B58 A;  5CBR A;  1P1N A;  4K3F A;  2AL5 A;  2OWS A;  1M5E A;  2GH9 A;  2UXA A;  1FBP A;  2XD2 A;  3RT6 B;  1KA1 A;  4NX1 A;  5FTI A;  1WDN A;  2AL4 A;  3HHG A;  3CFZ A;  3KZG A;  4R6Y A;  3M3F A;  4QSC A;  1DBZ A;  2XWK A;  4PAF A;  5I56 A;  3W9W A;  3T22 A;  1EZP A;  2FA7 A;  1SD3 A;  3M8U A;  2QPQ A;  3PUX E;  1P1Q A;  4GX6 A;  3O2A A;  4MLQ A;  3RYD A;  3OO8 A;  2QS3 A;  3KFM A;  4YKJ A;  5JK4 A;  2GHA A;  1IIT A;  1FQF A;  3FBP A;  2QVU A;  3JYR A;  4RYA A;  3O6I A;  4PQJ A;  2CEY A;  1FPG A;  2RIN A;  4BDN A;  2OLB A;  1Y3N A;  3OEM A;  4WKM A;  3U94 A;  5I2N B;  1LFG A;  4ESX A;  2Y7W A;  1FBD A;  5ET6 A;  4H5G A;  2D3I A;  2Y7I A;  3MVX A;  5AA2 D;  1LFI A;  4GWY A;  1FSA A;  2XXV A;  3M3L A;  5EYF A;  4GD5 A;  4MLV A;  4GFR A;  4RJZ A;  1RDY A;  5IZ3 A;  4XKR A;  5CC2 A;  5FBP A;  3H06 B;  4JVC A;  4GL0 A;  1UTB A;  1KWH A;  1YCJ A;  4PF8 A;  1Q35 A;  4KQP A;  3KC0 A;  3Q26 A;  4O3B A;  3FXU A;  5ITP A;  4FE8 A;  3K00 A;  5H8Q A;  1P99 A;  3OO9 A;  2CZH A;  2LAO A;  1I6Q A;  3OMB A;  1Y9U A;  2DXY A;  4NGU A;  4XEQ A;  3Q27 A;  2XXH A;  3C33 A;  2O1L A;  3GZG A;  1AOV A;  4P1E A;  3IFC A;  5ET8 A;  4IGT A;  1PB7 A;  2ZNU A;  4YKK A;  4EQB A;  4IO2 A;  3PV0 E;  3IO6 A;  1Y1M A;  2THI A;  2W7Y A;  2CZI A;  5DEX A;  4O8M A;  2KR0 A;  3DEL B;  2XXI A;  3SEX A;  1VE4 A;  4P3L A;  5FHN A;  3W9V A;  2V4C A;  4R6H A;  2F6P A;  2X7Q A;  2Z8F A;  1B0H A;  4MX6 A;  1PB9 A;  5TPA B;  4X9T A;  2P0S A;  5EHS A;  3U92 A;  1RDZ A;  4IGR A;  3MWB A;  1US4 A;  5K2X A;  1M5F A;  1MG1 A;  1LBC A;  5JTY B;  4ELQ A;  3RN8 A;  3SEW A;  4XF5 A;  2H25 A;  3FVK A;  1A8F A;  1MM7 A;  2VHA A;  3FXQ A;  2Q89 A;  2HEU A;  1MH4 A;  4X8R A;  4IY5 A;  5K2Y A;  4TLL B;  2XX7 A;  3U8Q A;  1ATG A;  1FRP A;  2XXT A;  5J16 A;  3MYU A;  3S9E A;  4OTE A;  3IB2 A;  3BKI B;  1MY2 A;  2HXW A;  1Y20 A;  4EUO A;  4OHN A;  4F29 A;  3CFX A;  4RK9 A;  2Z8E A;  3QXM A;  3VLV A;  4ZEF A;  4NF4 B;  3E4R A;  2HQ0 A;  4E0W A;  1D9V A;  1B40 A;  3UGW A;  2QS1 A;  4U23 A;  3KG2 A;  4KCD A;  2DOJ A;  3H7M A;  3EHU A;  3DP6 A;  4IO5 A;  4R72 A;  1QVS A;  1FBG A;  3T9U A;  1FPL A;  2UVI A;  4U22 A;  3U1O A;  2YPN A;  4POW A;  4F1U A;  4PFB A;  4OVT A;  2QMW A;  3TMG A;  2ZYO A;  4AQ4 A;  3OEK A;  3N94 A;  1YYZ A;  2R6G E;  4WXJ A;  4GWW A;  1NNK A;  1B4H A;  1EYJ A;  4DCY A;  4OWD A;  3LSW A;  2PX1 A;  4U21 A;  2YLN A;  4R9G A;  1SW2 A;  1FQE A;  3CSG A;  3BIG A;  3PU5 A;  4PBH A;  1HSJ A;  2DSF A;  4G8N A;  3ROJ A;  1FQC A;  4PAI A;  3I3V A;  2D21 A;  4MCO A;  4OA4 A;  5HBC A;  2CZK A;  5B70 A;  3FD3 A;  2F3B A;  4I3Y A;  4Q8R A;  3SER A;  4HXV A;  2NWJ A;  3TTN A;  3CG1 A;  4UA8 A;  3FJM A;  1MY4 A;  4RA1 A;  3IOW A;  3THI A;  3QYT A;  3B50 A;  3VVD A;  3U65 A;  2UVG A;  1B46 A;  4I9D A;  3MP8 A;  3TTL A;  4YKP A;  1GVC A;  3TYH A;  1AL3 A;  4LAT A;  1RYX A;  4NF8 A;  4PF6 A;  4EDP A;  3UOR A;  2DWI A;  4Q5T A;  3IL1 B;  3FV2 A;  1GTK A;  1I69 A;  2G29 A;  4OQO A;  1LGB C;  5AA4 A;  3OO7 A;  2DE2 A;  2I48 A;  4DXC A;  1Z7N E;  4G8H A;  4DE8 A;  1HSE A;  4NWD A;  2IEE A;  3VE1 B;  3B6Q A;  4PC9 A;  3LV0 A;  5DVI A;  5KCJ B;  4N4U A;  1FBF A;  4LQ2 A;  1B5H A;  4F3B A;  2ZYM A;  1OVB A;  1CNQ A;  1ELJ A;  5I57 B;  3VXB A;  2XXK A;  5A5X B;  4OMB A;  4F2Q A;  2OWZ A;  1KZ8 A;  1ZTY A;  4GX4 A;  2O68 A;  3CFL A;  5L9S A;  1LFH A;  1LAH E;  1GR2 A;  3B7D A;  4XKN A;  3PD9 A;  4OZ9 A;  3A3U A;  2M8C A;  3K02 A;  3KN3 A;  3O6G A;  1TFD A;  3HCQ A;  4HW8 A;  3MJN A;  5I57 A;  2B4L A;  3SEV A;  4DZ1 A;  4U4S A;  1K9Y A;  2B65 A;  4H5F A;  1NV1 A;  2WYP A;  1XT8 A;  4X48 A;  3LUZ A;  1FPB A;  1NNP A;  4EF1 A;  4QFO A;  3O66 A;  2QSX A;  3IOT A;  4ISU A;  3LSL A;  5I58 A;  1A40 A;  4PCD A;  4G4P A;  4R74 A;  2F35 A;  1VDW A;  1VFD A;  4NF6 B;  4MJO A;  2WBB A;  1QUK A;  4G8M A;  1N84 A;  5EYH A;  1NUX A;  3S9L C;  4IO3 A;  3IR1 A;  4IY6 A;  4H8J A;  5FHO A;  4X1B A;  5IAI A;  1IIW A;  1PC3 A;  4OFJ A;  1MY1 A;  2UVH A;  1Y4C A;  1EYI A;  2XX9 A;  2L5V A;  2Z23 A;  3P7I A;  1NNT A;  2I49 A;  4JSD A;  5I7I A;  2GRV A;  5B7D A;  1D4N A;  4GOT A;  2F8D A;  1PDA A;  3E78 A;  5LDZ A;  4DI3 D;  3IOU A;  2F6G A;  3K2D A;  3PPQ A;  3HFU A;  1B4Z A;  1LB8 A;  4OEV A;  1EZ9 A;  4IO4 A;  1IUD A;  2QRY A;  3TKD A;  1MRP A;  3Q25 A;  4PDH A;  4AS4 A;  2QVV A;  4GWS A;  3SZP A;  4UAC A;  1M5D A;  4LVQ A;  1AH5 A;  1DCU A;  3D1R A;  1LAF E;  1SW5 A;  3N5L A;  1MXY A;  3FUZ A;  3W15 C;  2ESN A;  3SET A;  5H8H A;  2O51 A;  3OD7 A;  1D9Q A;  5IM2 A;  4JXI A;  2Y84 A;  2HXR A;  3B8B A;  4HTG A;  4I8C A;  1MQI A;  2ALU A;  1ZBM A;  4ZE8 A;  5I84 A;  5DYH A;  5F7V A;  2A5T A;  3KEI A;  2DWA A;  1O64 A;  4ECF A;  4YIC A;  3H6W A;  1NFT A;  4TLM B;  1B05 A;  4XTC Q;  1DSN A;  5DT6 A;  4P0G A;  4BDQ A;  3PD8 A;  3RUM A;  1CB6 A;  3LSX A;  2ZNT A;  4DDD A;  3MBP A;  1NV7 A;  2XXU A;  1RDX A;  2HZK A;  1GGG A;  3ODB A;  1NMU A;  2HCA A;  4NF5 A;  2H5Y A;  4QBA A;  3B6T A;  4G68 C;  3H3G A;  4PGN A;  4EQ9 A;  1LAX A;  2PFZ A;  1P1U A;  4F2O A;  4MFI A;  2OBG A;  1NV5 A;  3K6V A;  1FTJ A;  5L9O A;  5DVF A;  4O7M A;  4F3G A;  1A55 A;  3N26 A;  4OFO A;  5I2K B;  3L6H A;  4HS7 A;  5TP9 A;  4OVP A;  4FEC A;  1O7T A;  4P1L A;  4ELO A;  3IK6 B;  4GWX A;  4GXS B;  4JWO A;  2XD3 A;  2F5X A;  2FVZ A;  2RC9 A;  4PFT A;  4HE2 A;  2DWJ A;  3KJT A;  3QSL A;  4N15 A;  4MIJ A;  4XKP A;  1IMA A;  5EHM A;  1B7Z A;  4QRZ A;  3MAM A;  5HM4 B;  2HAU A;  3MP1 A;  5IZZ A;  2VPN A;  3DP8 A;  2XHD A;  2GQ1 A;  3EQ1 A;  3FZV A;  2Q88 A;  1FW0 A;  2FIX A;  1QUJ A;  3OSR A;  1I6A A;  1B0L A;  1LCF A;  2V25 A;  5ELV A;  4DXB A;  4OEU A;  4OVQ A;  4EXL A;  4PP0 A;  4DI4 B;  4LUB A;  1II5 A;  4H0W A;  4QFP A;  2BJI A;  3LR1 A;  1FPI A;  4BDR A;  3IJX B;  2ZZW A;  3L6G A;  4KYE A;  3OSQ A;  5BWJ A;  3KJ7 A;  4ESW A;  3V5A A;  3VLU A;  1DPP A;  3JV9 A;  3K6W A;  1MQD A;  2ANJ A;  3OXN A;  5LTC A;  2PT1 A;  3AXF A;  1UTH B;  2O69 A;  1MXW A;  2KLF A;  1SI1 A;  3DLN A;  3MZB A;  3VXC A;  5DVJ A;  1A8E A;  3CSB A;  5I2N A;  1OLC A;  5FTH A;  4ZEK A;  3VVF A;  1OQG A;  4JB7 A;  3MQ9 A;  1N3X A;  1H44 A;  5EQ8 A;  3C9H A;  1D3K A;  2RCB A;  2ZYN A;  2Y7K A;  3PMW A;  2QJE A;  3MPK A;  5CRY A;  1DTG A;  3R26 A;  2V3U A;  2QVR A;  1MXZ A;  1MPB A;  5H8F B;  3RLF E;  3C35 A;  4RXL A;  4O3A A;  1UIU A;  4QF9 A;  3ISP A;  4OXV A;  1Y3Q A;  3MST A;  2Q8J A;  2OJT A;  3TCG A;  4L17 A;  4DIG A;  4LN5 A;  1FTK A;  3KOT A;  4R2B A;  1MXU A;  1MY3 A;  2I6E A;  1MDQ A;  1PBQ A;  2ZXT A;  4QSD A;  1PEB A;  2QS4 A;  3KN7 A;  5TU0 A;  4PFR A;  4P8B A;  3M3K A;  3E79 A;  5I5P A;  5KZT A;  1JET A;  3PMV A;  1IZ1 A;  1NUY A;  4FAT A;  3HHF A;  1QGX A;  1POT A;  4LA9 A;  5L9M A;  1R6Z A;  1B3G A;  3WAF A;  4GLI A;  1LBV A;  1AWB A;  3VV5 A;  2VD2 A;  1B3L A;  4U4X A;  3MVW A;  4PET A;  1BKA A;  2WYK A;  2I3V A;  1IMF A;  3SKP A;  1OVT A;  5TPA A;  1JQF A;  2OK2 A;  4G61 A;  5JTY A;  2CZL A;  2G93 A;  1B6H A;  3CHG A;  1FPE A;  4MEV A;  2WX9 A;  3ZKL A;  3MC2 A;  2XWO A;  1NI9 A;  3IJO B;  3VFJ A;  1QJM A;  1MXX A;  3FAT A;  1LBY A;  1HSL A;  2DE4 A;  2OZZ A;  1Y1Z A;  2DQV A;  1SVX B;  3O29 A;  1AIV A;  4X1D A;  4ZEI A;  4JVD A;  4JWX A;  4QHQ A;  4GWO A;  3G3K A;  2ZNS A;  3FAS A;  4R9F A;  1N7X A;  4NF4 A;  3LSF B;  4NHB A;  4GWU A;  5JEI A;  1ZMG A;  2PVU A;  2RCA A;  4O3C A;  4ZEC A;  1FQB A;  3SES A;  1A99 A;  5CBS A;  2UYF A;  3D4G A;  4ZDM A;  2PBW A;  3RY3 A;  4QXD A;  3EPE A;  1B5I A;  3MP6 A;  1H76 A;  2Q9T A;  3TEL A;  4EF2 A;  1OQH A;  4OVJ A;  4U2R A;  1FCK A;  5DW8 A;  1IMD A;  4ONY A;  4F31 B;  5J1D A;  4PE5 B;  2NUV A;  4BLA A;  4GF8 A;  1YPN A;  2QFL A;  1R9Q A;  4MF3 A;  4N17 A;  1GV8 A;  4F39 A;  2CMO A;  1SQY A;  1YXI A;  1SPI A;  4G2Z A;  4O94 A;  5ICQ A;  1XI6 A;  1VSO A;  3S2V A;  1URD A;  2IA4 A;  5KDT B;  2P1S A;  1JP4 A;  3RNN A;  1LBZ A;  5M2V A;  1TFA A;  2GFE A;  3TFL A;  4Z7E A;  2REJ A;  4N8G A;  4YZZ A;  1USY H;  1LBB A;  2H4I A;  4JWY A;  4WEP A;  1IXI A;  5H8N B;  1UQW A;  2F7C A;  4P11 A;  4LQ5 A;  5CMB A;  1MQJ A;  3V89 B;  5IGA A;  2OPD A;  2Y5K A;  2ZZV A;  4U1O A;  1F9B A;  4H45 A;  1ZJL A;  2D5W A;  2Q74 A;  1NV3 A;  1D9Y A;  3H4Z A;  1IMC A;  1POY 1;  4THI A;  3K1N A;  4HCY A;  5ITO A;  3EHT A;  3GBA A;  3K01 A;  1FBE A;  3VDF A;  4KI0 E;  4GIZ A;  4N91 A;  5KCJ A;  2RC7 A;  2GHB A;  3LC8 A;  2VGQ A;  4FED A;  1URS A;  1EH3 A;  3MVZ A;  4N6K A;  3G3G A;  2X7P A;  3G7W A;  4GXA A;  4AB6 A;  2ZZX A;  3QIM A;  5A5X A;  3UK4 A;  1H3D A;  4KPT A;  5CMK A;  2XXX A;  1NV0 A;  2O84 X;  1S9T A;  1FTO A;  3O9P A;  3GXA A;  1Z7M E;  2XXQ A;  3TTR A;  4NQ8 A;  3PPP A;  1MS7 A;  3K1P A;  4MAG A;  3TDJ A;  1A54 A;  5EYG A;  4LON B;  3T96 B;  3I6V A;  4N07 A;  3EHS A;  1BIY A;  1SW1 A;  4XIG Q;  4BDL A;  2VOZ A;  4NN3 A;  4AS5 A;  3K0V A;  2WEF A;  4XFE A;  3RT8 A;  4PE3 A;  5AE4 A;  2Q2A A;  1H43 A;  3EN3 A;  3K1M A;  2BJJ X;  4PTK A;  1SYI A;  3H03 A;  2HAV A;  2I58 A;  3GBB A;  2I4B A;  5CM6 A;  3RPL B;  4F1Y A;  1B32 A;  1MXV A;  3EKI A;  2V3T A;  3C32 A;  1LBW A;  1Y3P A;  4FEB A;  3O6H A;  3RTW B;  3T9V A;  2UYE A;  4QFN A;  4NF6 A;  3V8X B;  4MNP A;  1TWY A;  3ECR A;  4HE0 A;  1BK4 A;  4F19 A;  2VPO A;  3KBR A;  1LST A;  1K9Z A;  2E1S A;  3VLW A;  2JJK A;  3UN6 A;  4YMA A;  3TEP A;  3KSX A;  1Y4T A;  4ZEB A;  2NOO A;  4I1D A;  4G68 B;  4DCX A;  3IB1 A;  3PPO A;  1B3E A;  2YJP A;  1FBH A;  1FTM A;  4F3P A;  5I3S A;  3C36 A;  4HE1 A;  2DXR A;  4TOZ A;  5FHM A;  5T3J A;  2V93 A;  3O28 A;  2RC8 A;  4KD5 A;  3UA8 A;  2QL3 A;  4M4G A;  2V84 A;  1EYK A;  2UVJ A;  1M5C A;  1MM6 A;  3UP9 A;  1JW1 A;  1MQG A;  1YTV A;  1IME A;  4G68 A;  1USY E;  1FTL A;  1NV2 A;  1IXG A;  1IMB A;  3G3H A;  5L8D A;  4KYD A;  1LEV A;  3LUY A;  1BP5 A;  1NH8 A;  3MW0 A;  5LOM A;  2FNC A;  1MDP 1;  1P1W A;  2ZMB A;  2PCR A;  3DP4 A;  4YB6 A;  1US5 A;  2PT2 A;  4GWZ A;  4FAJ A;  1RKM A;  4H6D A;  4NAP A;  1PB8 A;  3FV1 A;  1SW4 A;  3IOR A;  2DDK A;  2ONR A;  1NL5 A;  4LZ7 A;  3TZA A;  2WKY A;  4TQU Q;  4NE4 A;  3PMX A;  2NXO A;  4IB2 A;  4P0I A;  1DMB A;  1MY0 A;  4BDO A;  3USD A;  2NVU B;  5AA3 A;  3GLB A;  3FVO A;  2R71 A;  5I59 B;  4H8I A;  4NTL A;  3D4C A;  4XKQ A;  4MNI A;  4M1V A;  3HPI A;  1A7L A;  3TPA A;  3KBZ A;  1B9J A;  3VVE A;  5I2K A;  1SI0 A;  2OX3 A;  5IZ3 B;  1IEJ A;  2ONS A;  1NUZ A;  5ET7 A;  1H45 A;  2E0S A;  1O63 A;  3S9M C;  4Q0C A;  1UTB B;  3PUV E;  4LZ5 A;  1PBP A;  5CMC A;  4I3E A;  3SEU A;  1MPC A;  1BTJ A;  3HST A;  1B51 A;  1N7W A;  3BFU A;  3N6U A;  1URG A;  4R73 A;  5H8Q B;  3BFT A;  3CVG A;  2VT5 A;  4LP2 B;  3MUQ A;  1FPF A;  1RYO A;  2HHM A;  2Q8M A;  4OYV A;  3G3J A;  5BUU A;  4YU0 A;  1FQA A;  2Q2C A;  4N8Y A;  5IKB A;  2DP8 A;  4OVR A;  1EU8 A;  2VD3 A;  5I59 A;  3TOD A;  4MH5 A;  2I0C A;  5F1Q A;  2DVZ A;  4GVO A;  1I6B A;  1ZIU A;  5AA2 B;  2OCU A;  4JSO A;  3TCH A;  2FYI A;  1WOD A;  2Y7R A;  5DEX B;  2F3D A;  3KSJ A;  2Y5L A;  2B3F A;  4GX3 A;  4P47 A;  3A09 A;  3TQL A;  3E3K A;  3NOH A;  2HPG A;  2R8T A;  1FPJ A;  1XHY A;  4H67 A;  3ZSF A;  3R6U A;  4GRK A;  3IFA A;  1SYH A;  2O7I A;  1UTH A;  1NKX A;  4N6P A;  2P3V A;  2HFB A;  4PAK A;  5A5L A;  3PPR A;  3V83 A;  4QFK A;  2XXY A;  1SDX A;  1WVJ A;  4RPO A;  5AA2 A;  3K4U A;  3Q29 A;  3K6U A;  4OAN A;  1QUL A;  3H6U A;  1L5T A;  1B1X A;  4R2F A;  4O7I A;  2XX8 A;  1ZKB A;  4N6D A;  1B52 A;  5CI5 A;  4N81 A;  5H8F A;  2ABH A;  3IAZ A;  1B7U A;  4RK2 A;  3C31 A;  2F34 A;  1N3W A;  4NMY A;  1IXC A;  5EQA A;  3A3C A;  1LLS A;  4C0R A;  4PFI A;  1NV4 A;  4KXP A;  1N76 A;  3TUS A;  5H8S A;  3ONM A;  3MZ1 A;  1UIV A;  1N04 A;  1ANF A;  4JDF A;  3WAE A;  2WBD A;  1FJ9 A;  4R75 A;  4GBW A;  2XWV A;  3C34 A;  3MPL A;  1AMF A;  3FVG A;  4YB5 A;  2R9J A;  2FBP A;  4OFL A;  2I4C A;  1ZLQ A;  4PFY A;  4I62 A;  1FJ6 A;  1DPE A;  1JEV A;  3G3F A;  4EXK A;  1SBP A;  3KGC A;  1MH3 A;  3T0J A;  2AYS A;  3MVY A;  2XWI A;  4EQ7 A;  2XXW A;  1B2H A;  3FXR A;  4KHZ E;  3KOS A;  2PFY A;  4MBP A;  1TT1 A;  3E13 X;  1LBX A;  1JW4 A;  1BLF A;  3IOV A;  1FQD A;  2P3N A;  2O1M A;  1B3F A;  4DXU A;  5ISU A;  1JNF A;  3U93 A;  4C1T A;  5IZ1 A;  3K6X A;  2DE3 A;  2P2A A;  2RF1 A;  4DLD A;  3FJG A;  1MPD A;  1B1H A;  2XXP A;  4JBZ A;  4NF8 B;  1P1O A;  4NED A;  4MHF A; 
#chains in the Genus database with same CATH homology
 4HCW A;  4MAG A;  5EYG A;  4QBA A;  2CZI A;  1Q9D A;  4O8M A;  4PGN A;  2PFZ A;  1NV5 A;  4H46 A;  2KR0 A;  1NV6 A;  4NG7 A;  4I40 A;  4P3L A;  4O7M A;  3W9V A;  2V4C A;  4NN3 A;  4AS5 A;  2WEF A;  4XFE A;  4OVP A;  4MMP A;  4PE3 A;  4P1L A;  4MX6 A;  4X9T A;  4PBQ A;  4NF0 A;  4GWX A;  4PTK A;  1RDZ A;  3QMF A;  4XF5 A;  5CM6 A;  2F5X A;  3RPL B;  2FVZ A;  4HE2 A;  4JVI A;  3T1B A;  3EKI A;  4N15 A;  1LBW A;  5ESY A;  4MIJ A;  1IMA A;  4X8R A;  5IZZ A;  2VPN A;  1FRP A;  2GQ1 A;  4MNP A;  4HE0 A;  2FIE A;  2FIX A;  1BK4 A;  5J16 A;  3MYU A;  2VPO A;  4F19 A;  1K9Z A;  3KC1 A;  2JJK A;  4FBP A;  4OVQ A;  4DI4 B;  2CEX A;  2BJI A;  1FPI A;  4GBV A;  2ZZW A;  4UAB A;  4MNC A;  5EQ7 A;  4IR8 A;  1FBH A;  3FXB A;  1G0H A;  1NUW A;  5I3S A;  4X04 A;  5LTC A;  4HE1 A;  1FBG A;  1FPL A;  4F1U A;  4PFB A;  4OVT A;  5T3J A;  2FHY A;  2V3Q A;  1YYZ A;  5EQ8 A;  4GWW A;  1EYJ A;  3PTY A;  1EYK A;  5EQ9 A;  1KA0 A;  3BIG A;  4PBH A;  1IME A;  1NV2 A;  2QVR A;  3ROJ A;  4PAI A;  1IMB A;  1FPD A;  4MCO A;  1FBC A;  4OA4 A;  1LEV A;  2CZK A;  4F18 A;  2F3B A;  4I3Y A;  3ISP A;  4HXV A;  3MST A;  2PCR A;  4LN5 A;  4P56 A;  4GWZ A;  3B50 A;  3U65 A;  4PFR A;  4P8B A;  4NAP A;  4PGP A;  3GYY A;  3E79 A;  2DDK A;  4PF6 A;  5I5P A;  1FPK A;  5F24 A;  4F1V A;  1YZ0 A;  1NUY A;  1QGX A;  1LBV A;  1AWB A;  4PDD A;  2DE2 A;  4MNI A;  4M1V A;  1G0I A;  3KBZ A;  4PC9 A;  2OX3 A;  5IZ3 B;  1NUZ A;  3LV0 A;  5ET7 A;  2B4M A;  4PET A;  2WYK A;  4N4U A;  1FBF A;  1IMF A;  2XA5 A;  4I3E A;  1CNQ A;  4G61 A;  2VT5 A;  2MKZ A;  3CHG A;  3RPL A;  3A29 A;  1FPE A;  4MEV A;  2WX9 A;  2XXK A;  1DK4 A;  1FPF A;  2OWZ A;  2XWO A;  1KZ8 A;  1NI9 A;  4GX4 A;  2HHM A;  2Q8M A;  1LBY A;  4N8Y A;  2DE4 A;  4OVR A;  3BIH A;  5ET5 A;  2DVZ A;  4JVD A;  2F3D A;  4NHB A;  2Y5L A;  4GWU A;  4GX3 A;  4P47 A;  4P9K A;  3NOH A;  2HPG A;  2R8T A;  2B4L A;  1FPJ A;  1INP A;  3IFA A;  1K9Y A;  2KQZ A;  1NV1 A;  4QXD A;  2WYP A;  4OVS A;  2P3V A;  3LUZ A;  1FPB A;  4PAK A;  2Q9T A;  2HZL A;  5A5L A;  1FTA A;  4PCD A;  5DW8 A;  1IMD A;  5J1D A;  4OAN A;  2QFL A;  1VDW A;  4MJO A;  2WBB A;  4N17 A;  1FBP A;  1KA1 A;  4NX1 A;  1YXI A;  1SPI A;  4O7I A;  5EYH A;  1NUX A;  4N6D A;  4O94 A;  1DBZ A;  2XWK A;  4N81 A;  1XI6 A;  4PAF A;  3W9W A;  5EQA A;  1JP4 A;  2QPQ A;  1LBZ A;  1EYI A;  4GX6 A;  2L5V A;  4PFI A;  1NV4 A;  4KXP A;  3RYD A;  5I7I A;  5JK4 A;  4YZZ A;  5LDZ A;  4N8G A;  3E78 A;  4DI3 D;  3FBP A;  2QVU A;  3HFU A;  2CEY A;  1FPG A;  5IGA A;  2WBD A;  1FJ9 A;  4PDH A;  4GBW A;  4AS4 A;  2QVV A;  4GWS A;  2XWV A;  3SZP A;  2Y5K A;  2ZZV A;  1FBD A;  5ET6 A;  2FBP A;  1DCU A;  3D1R A;  1FJ6 A;  4H45 A;  2Q74 A;  1NV3 A;  4GWY A;  1FSA A;  1IMC A;  3T0J A;  1D9Q A;  5IM2 A;  4HCY A;  2HXR A;  3B8B A;  1RDY A;  5IZ3 A;  2XWI A;  5FBP A;  1FBE A;  4JVC A;  4N91 A;  2PFY A;  4PF8 A;  1LBX A;  4YIC A;  3KC0 A;  4N6K A;  2P3N A;  2CZH A;  2ZZX A;  4NGU A;  1NV0 A;  4XEQ A;  5IZ1 A;  2DE3 A;  4P1E A;  3IFC A;  5ET8 A;  1NV7 A;  1RDX A;  2HZK A;  4NQ8 A;  4MHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...