4HE0A

Crystal structure of human muscle fructose-1,6-bisphosphatase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
326
Chain Sequence
ETDMLTLTRYVMEKGRQTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Crystal Structures of Human Muscle Fructose-1,6-Bisphosphatase: Novel Quaternary States, Enhanced AMP Affinity, and Allosteric Signal Transmission Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 326
sequence length 329
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4he0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4he0A02
1SPIA 4HE2A 5EQAA 1G0HA 1FPDA 3A29A 2HHMA 1NV7A 3KBZA 3RYDA 4H45A 1FBDA 4H46A 1FJ6A 4GX4A 1NV4A 1DK4A 2F3DA 3FBPA 4HXVA 5LDZA 5EQ7A 2FVZA 4GWUA 1NV1A 2PCRA 1LBYA 4I3YA 4AS5A 2JJKA 4HE1A 1NUWA 5J16A 5ET6A 2FIXA 4HE0A 4GBWA 1QGXA 5I3SA 3RPLA 2QVVA 2QVRA 1FPBA 5DW8A 3KC1A 4O7IA 1FRPA 1RDYA 3KC0A 1FBHA 3T0JA 4GWYA 1RDXA 4MJOA 1IMAA 1JP4A 1NV6A 1NV5A 1FTAA 2FHYA 3IFAA 2R8TA 1NI9A 1NUZA 4I40A 2P3VA 5EYGA 1XI6A 4PTKA 2CZKA 1FPEA 4GWWA 1LBWA 1LBXA 2P3NA 5EQ9A 1FPIA 3LV0A 1IMBA 2WBDA 2CZHA 4GWSA 3B8BA 3D1RA 5ET7A 5IZ3A 1IMEA 1RDZA 1FBEA 1FPLA 1K9ZA 5FBPA 1K9YA 1IMFA 1IMCA 1AWBA 3RPLB 1Q9DA 1FBPA 2VT5A 3ROJA 4GX3A 1LEVA 1CNQA 2Y5LA 1KA0A 1EYJA 5ESYA 1YXIA 3IFCA 2FIEA 5ET8A 1FJ9A 1NV2A 2BJIA 1KA1A 2FBPA 4I3EA 5ET5A 4AS4A 1NUXA 2CZIA 5T3JA 2Q8MA 4GWXA 5F24A 1INPA 1D9QA 1FBCA 1NV3A 1FPKA 1YYZA 2GQ1A 2OWZA 4QXDA 5EQ8A 1EYKA 1FBFA 1FPJA 1LBZA 4FBPA 3LUZA 3QMFA 1FPFA 5IZ3B 1NUYA 1KZ8A 1G0IA 2OX3A 4N81A 4IR8A 4KXPA 1DCUA 2F3BA 2WBBA 2DDKA 2Q74A 2WEFA 4GWZA 1VDWA 1FBGA 4GBVA 4GX6A 4G61A 1FSAA 1LBVA 1YZ0A 1NV0A 1IMDA 5IZ1A 3BIGA 5EYHA 2Y5KA 1BK4A 1DBZA 1EYIA 1FPGA 2QVUA 2QFLA 3BIHA 5A5LA
chains in the Genus database with same CATH superfamily
4PFRA 2VPNA 1H3DA 3U92A 5KZTA 1TFAA 3MC2A 5ICTA 4NF6A 4JSDA 1BP5A 3TDJA 1B4HA 4EDPA 3RN8A 1Z7ME 3WAFA 4P0GA 3RPWA 2CEXA 2XWKA 3FASA 4U1ZA 4YKKA 2XX7A 3D4GA 5A5XB 4JVIA 2I4BA 3VXCA 1NMUA 2V3UA 2FYIA 1FCKA 4G4PA 2H9BA 2RC7A 2HFBA 3KFMA 2V3TA 3ZS6A 4POXA 3FXQA 3TTLA 5CMBA 1ATGA 4OYVA 4GWSA 2THIA 3A09A 3C35A 1FBEA 3LUYA 1K9YA 1NFTA 2AIXA 2QS2A 4GQOA 3ROJA 3T93B 2E0SA 1B0HA 1AH5A 5I57B 3FV2A 3CG3A 5ELVA 1P1UA 1NV2A 5I2NB 2D3IA 1MQGA 1NNFA 3TTMA 4GWXA 3U65A 3IORA 1M5BA 1NNPA 5FHMA 1A8FA 2OLBA 1B5JA 3SESA 1LBZA 3PMVA 4ZEDA 3VDFA 1YAEA 5K2XA 4RPOA 4N81A 4O8MA 2DS9A 3W9VA 5B7DA 5EYHA 2GFEA 3V83A 2I49A 3G7WA 4HS7A 3O9PA 2B4LA 3U1OA 2OJTA 3TODA 1URSA 2F3DA 4I8CA 4PE5B 4P9KA 4RYAA 3A3CA 4MIJA 3CSGA 2Y84A 1MQIA 3KSJA 1OVTA 2Y7KA 1O64A 4ELPA 1MM6A 1BIYA 3KOTA 2F6PA 4XKQA 2CZLA 1NNTA 2NOOA 4QSCA 3LSWA 5ICQA 2WBDA 4ESWA 4UABA 1FPLA 1K9ZA 4GLIA 5I58B 1MS7A 5AA3A 3PD9A 4XKNA 1MPDA 1DSNA 4XXUA 4PGNA 3KZGA 4R9GA 2D21A 5CMCA 1EU8A 1NUXA 4MLQA 4OTEA 5F24A 1PC3A 1YTVA 4R6HA 1UIUA 2XXKA 4I1DA 3K6WA 2F7AA 2HXRA 3H3GA 4JWXA 1LBVA 4IO3A 4XFEA 2HZLA 1WVJA 4F3BA 5I57A 4OFOA 4NEDA 5I59B 5I2NA 2XXHA 3A29A 5IGAA 1NKXA 4DXUA 4X1DA 4C1TA 1J1NA 3PUWE 5ISUA 1MDP1 4I3YA 4BDNA 2OBGA 2Q89A 1NUWA 1IUDA 3MZ1A 1QVSA 1D9YA 4E0WA 3DELB 2DQVA 4UACA 4EXLA 4O7MA 1T0KA 4GWYA 2DP8A 3N26A 1MQJA 3IO4A 3HV1A 5DVIA 2ANJA 4BDRA 1NNKA 1Y20A 1AL3A 3FV1A 1LB8A 4DCXA 3HFUA 4OXVA 1JETA 1JVYA 3MP8A 4ZEFA 4LZ8A 4O94A 4N8GA 2NVUB 4GX3A 4IO7A 2V84A 5IKBA 4NF4B 1SYIA 1XC1A 4EXKA 4ESXA 1Y3NA 4C0RA 4H6DA 2QMXA 4KFQA 3SKPA 1SI0A 3KOSA 4YKIA 4G77A 4OESA 2ALUA 4N07A 3OENA 4IO2A 1FPKA 4RXLA 3TELA 1TFDA 2RC8A 4LVQA 3KG2A 3EHUA 1P1WA 1QW0A 4IY6A 4N17A 1PBQA 5CMMA 4I62A 4N6KA 3K6UA 4ZEKA 2I6EA 2YLNA 4GBVA 4G61A 4TOZA 1NV0A 2O69A 1A99A 1Y3PA 4FAJA 4DXBA 5L9MA 2RINA 3VLVA 1TWYA 1WDNA 4F31B 3MP6A 4F39A 4H45A 4HXVA 1HSEA 3QUFA 1B9JA 3G3IA 1DPPA 5J16A 4HE0A 4GBWA 3TQLA 4MH5A 4O3BA 2HQ0A 2D5WA 3CHGA 1QJMA 3PUZE 1GTKA 4BDMA 2XXWA 3KC0A 1LFIA 3CFLA 4TLMB 3KSXA 3N6UA 1SQYA 3PPOA 4EQ9A 1A8EA 1SI1A 4PTKA 1FPEA 1FTKA 3G3FA 2DVCA 4QFPA 5LTCA 5IZ3A 3TFLA 3USDA 4F3SA 3OSQA 4LQ2A 3RPLB 3TAJA 3G3KA 3JZJA 2Z8EA 3IOVA 4OVTA 4R74A 1LEVA 3SEVA 3O29A 1S50A 4O3CA 2XWOA 2VD2A 2CZIA 1OMPA 3GZGA 1FBCA 4H67A 4OEUA 4PDDA 1POTA 3MZ9A 5EYFA 2DVZA 2UYFA 4FBPA 2I0CA 2OK2A 4QRZA 4TQUQ 1B1XA 4PFWA 5EHMA 2I58A 5JK4A 4WEPA 2PFYA 2ZMBA 3P7IA 3K6XA 4OENA 4JVCA 3BIGA 1MXXA 2Z22A 1LAHE 1ZKBA 3KBRA 1US5A 2P1SA 3C33A 4NF4A 4KI0E 2UVGA 2V3QA 2OPEA 4LP2B 2P0SA 1QUIA 1Z7NE 4DI4B 4GX4A 1DK4A 5EQ7A 5L9SA 3MQ9A 5H8NA 1NV1A 4NQ8A 1IXCA 1CB6A 5ITOA 1B3EA 4MCOA 1JEVA 3O6IA 4F1UA 1RDYA 2H25A 2RCBA 3PU5A 3OMBA 4MNIA 2XHDA 4XKPA 4DI3D 1I6BA 3R26A 2ZXTA 2H5YA 1VFEA 3K0VA 1EZPA 1GGGA 3KN7A 4IO6A 4EQ7A 3GYYA 1R6ZA 3MVZA 3PUVE 2Y5LA 3MSTA 1HSLA 1A55A 4M1VA 4XF5A 2Q8JA 1PB7A 4HCWA 4TLLB 1NH7A 1GR2A 3UA8A 5CC2A 1B7UA 2DDKA 3MW0A 2F5XA 3CVGA 4HW8A 3CG1A 2AYSA 1UTBB 1AOVA 1D3KA 3SETA 1B58A 2CMOA 4N6DA 1Y3QA 4PF6A 2P2AA 4PC9A 3TKDA 2PX1A 4QFKA 3FBPA 3TEPA 3O6GA 2BJJX 2WKYA 4OANA 1MRPA 1URDA 1ZU0A 3FJMA 4MAGA 1MM7A 5HM4B 2QVVA 1S7YA 4NF5B 1FRPA 2R6GE 5IZZA 3H6WA 3W9WA 4LQ5A 1IMAA 3FVGA 3QUJA 3K1MA 1NUZA 5K2YA 2CEYA 1BTJA 2ZNTA 3ZKLA 1OIBA 3T9XB 3RNNA 2O1MA 4PFTA 5I2KB 1LBWA 4KPTA 4ZEIA 5EQ9A 2PT1A 2ZNUA 3FZVA 4P0IA 5TU0A 1M5CA 1SW2A 3VLUA 2F78A 4ND9A 3KGCA 3IB0A 5M2VA 4DIGA 2OPDA 3HN0A 4NGUA 4PETA 1ZMGA 2XXVA 2QPQA 1PBPA 5AA1A 4KHZE 2FIEA 2HCAA 1UTHB 2GHBA 1IITA 2KR0A 3SEUA 1CE2A 1TXFA 2DXYA 4JXIA 3CR9A 3GXAA 4ZECA 4LZ7A 2ONSA 3OOAA 5IM2A 4NWCA 4U1OA 4GWOA 3RY3A 3SZPA 2XWVA 4P1LA 3T66A 1MDQA 1Q35A 1VDWA 3VE1B 1B5HA 3U8QA 1R9QA 1MY3A 1VR5A 3MAMA 2QFLA 3DP8A 5A5LA 4PAKA 3IOTA 5AA4B 4NX1A 1XS5A 2XXRA 4MEVA 2Y7WA 1GVCA 3OD7A 4PGPA 3CFXA 4ZS9A 2NUVA 2ZYNA 2E1SA 2KLFA 4G8HA 5I84A 3PMWA 1A7LA 1UTBA 1NV5A 2DWIA 4X8RA 4PBHA 4F3GA 4H5GA 2XXXA 5HBCA 4Z7EA 4NF8B 1B7ZA 3M3FA 2CZKA 2DSFA 2PVUA 2UYEA 2P3NA 5KDTB 2W7YA 2CZHA 3FXUA 3B8BA 5DT6A 1LSTA 2XXPA 4MMPA 4LONB 5FBPA 1SBPA 2QRYA 1B51A 3K1NA 1SVXB 1B3GA 3VXBA 4NF5A 1NL5A 2XXIA 4X1BA 4YB7A 3FUZA 3QSLA 2XXYA 2BJIA 3GLBA 4FIMA 5BUUA 3H06B 3H7MA 2UXAA 1D9QA 1NV3A 4IGTA 4QXDA 4ISUA 1B32A 2GH9A 4G68C 5AA2D 3I3VA 4FECA 1G0IA 4Q30B 3S4UA 3Q27A 4GWZA 1FBGA 1R9LA 5AA2B 2QSXA 2ZZVA 4GVOA 5A5XA 4GL8A 1IMDA 5IZ1A 4FEBA 2Y5KA 3IL1B 3IO6A 4X04A 3IOUA 3FD3A 1AIVA 1MPBA 1MXYA 1OQHA 1UTHA 3CRBA 2O1LA 5FTIA 2UVJA 3U93A 4KYEA 3IJXB 3QIMA 1FPBA 5DW8A 3KC1A 1FBHA 3TTKA 4Q0CA 3KN3A 4X48A 3TQWA 3NOHA 3IFAA 1US4A 1I6QA 2X7QA 3T96B 1PB9A 2DE3A 3OEMA 1JQFA 4ELQA 2I0BA 2QJEA 4NTLA 2HZKA 1DTZA 1A40A 1N7XA 2Q9TA 4BLAA 5AA4A 4LN5A 3FXRA 3K4UA 3ODBA 1IMEA 2M8CA 3SDFA 2PYYA 1IMFA 3ZSFA 3DM0A 5HPQA 2AL4A 3ZKKA 3IB2A 3LSXA 2MKZA 2O84X 4I3EA 4NF0A 4L17A 4ZE8A 3O97A 4BDQA 4LATA 3OO7A 1P1QA 3H03A 4NF8A 5FHNA 2V93A 3LUZA 1SDXA 2OX3A 1FQCA 3KJTA 4ZDMA 3CI8A 3KEIA 2Y7RA 2X26A 1L5TA 3FGSA 1QKAA 1R1NA 3C32A 4HE2A 2HPGA 4UA8A 1MG1A 2ONKE 1FBDA 4RK2A 1MXVA 2Z8FA 4NAPA 4G8NA 1SD3A 4FATA 5I58A 2DWJA 4PF8A 2HXWA 1M5FA 3OSRA 1YPNA 4THIA 2XXQA 1JP4A 1NV6A 4PBQA 5AA2A 1LCTA 1SW4A 3KJ7A 3EN3A 3IOWA 3CFZA 1BLFA 3SEWA 5CI5A 4PFBA 4OQOA 1LBXA 3EHSA 3MBPA 4MNCA 1IMBA 3OO9A 2FA7A 1MPCA 4IO4A 4EF1A 4NG7A 2R71A 2ZYOA 1IMCA 4PFYA 1ZTYA 3QK6A 1M5EA 1I6AA 1LFHA 3UK4A 2OZZA 5F1QA 4GFRA 4DZ1A 4H5FA 5ITPA 1KA0A 3MYUA 2RCAA 3UP9A 2I4CA 1KA1A 2F7BA 1Q1KA 3B6WA 5I59A 2VPOA 4N91A 5L9OA 5I56B 3G3JA 4XTCQ 3EKIA 3TTRA 1JNFA 1JW5A 3EPEA 3U72A 4GOTA 5TP9B 4JWYA 1FTMA 2ZZXA 1H76A 3T9HB 5H8HB 4GIZA 3E79A 1B5IA 2WYPA 2XX8A 4MFIA 4QFOA 2F97A 4ELOA 1EZOA 3O66A 3VVEA 1B7HA 1SPIA 5J1DA 4U21A 5I7IA 1B3FA 4E0XA 1N04A 2QL3A 3ECRA 2H4IA 4H0WA 4NE4A 3QAXA 4I9DA 4F19A 5ET6A 5JTYB 5EHSA 3SERA 1NH8A 2Q2CA 3LC8A 4KQPA 3HO7A 3LBSA 1QULA 2XD2A 1D9VA 1OQGA 2V4CA 1FQBA 3C34A 4P47A 1XT8A 1IIWA 4F3PA 1LAFE 4HTGA 3V5AA 1H43A 5TPAB 1Y4CA 1XI6A 4LZ5A 4AB6A 4QBAA 2XA5A 2DWAA 2XXUA 1FPIA 1FW0A 5ET7A 4N13A 3PPRA 3Q26A 5DVFA 1MY4A 1ANFA 3TCGA 1IXGA 1ZJLA 3BFUA 2F6GA 1BKAA 3TUSA 3WAEA 4EF2A 1B05A 2ZYMA 2Y7PA 1B2HA 1INPA 1Y1MA 3S2VA 2REJA 1YYZA 1H44A 1MH3A 3H6TA 4FE8A 5FTHA 3QYTA 3S9MC 1NUYA 1KZ8A 2WBBA 3OEKA 2OCUA 1MY1A 4BDOA 3R6UA 4YU0A 3OO6A 4RK9A 4WXJA 4YICA 1ZBMA 2UVIA 4PDHA 2LAOA 3PTYA 3FJGA 3K01A 1MH4A 3FJ7A 3VV5A 5I56A 4PP0A 3MP1A 2FVZA 3RT8A 3IB1A 5CM6A 3VFJA 4JBZA 4OZ9A 3RPLA 3MJNA 1RYXA 3CIJA 3QXMA 3DP4A 5TP9A 4KR5A 2DXRA 1LFGA 3IR1A 2YPNA 4P56A 2O7IA 4I40A 3PPPA 3GBBA 4ZEBA 1I69A 4OFJA 4F2OA 5CBSA 4YMAA 1P99A 4GWWA 4HCYA 3T22A 3K00A 3D4CA 1RDZA 2IA4A 4FEDA 3JV9A 2F8DA 2B3BA 5JTYA 3Q29A 4IY5A 1HSJA 5H8SA 3S9NC 1MXUA 2O68A 1CNQA 2QMWA 1MXZA 4ELRA 3LR1A 4NWDA 3O28A 3FVOA 5IAIA 3MUQA 2Q8MA 4FORA 1RYOA 4OVJA 3UGWA 5TPAA 2GQ1A 2OWZA 4RPNA 5EQ8A 1Y1ZA 1FBFA 4U22A 2O7UA 2Z23A 4KYSA 4MBPA 3IJOB 4U23A 4DE8A 2ZNSA 1SW5A 4QFNA 4R9FA 1FQAA 2PT2A 2O6AA 3I6VA 1YZ0A 4FJPA 4F1YA 2H99A 1IXHA 3FVKA 3T9UA 2B3FA 1MY0A 3TMGA 4XEQA 1B40A 2V25A 2F34A 1FPDA 3KBZA 4ZE9A 1Y4TA 1IQ7A 4H46A 5LDZA 2PCRA 4EQBA 1PDAA 3EQ1A 4AS5A 2DWHA 2ZYKA 4G68B 2GHAA 4F2QA 3S9LC 3ILUB 1MQDA 4U4XA 2KQZA 1PEBA 1JEUA 3MWBA 4QFLA 1N76A 4OFLA 2Q88A 2RC9A 1NI9A 3Q28A 3K6VA 1GV8A 3I5OA 4KCCA 1LBCA 5DTBA 3H4ZA 2G29A 3PMXA 1MQHA 2Q2AA 3AXFA 4OWDA 3FXBA 4K3FA 3G3GA 1FBPA 2VP1A 2OWSA 1WODA 2PMSA 2VD3A 4PAIA 1N7WA 1YXIA 3H6VA 4Z0IA 2XX9A 5ET8A 5KCJB 4GXSB 2RKMA 4GD5A 1FQDA 2I48A 3RLFE 3RUMA 2IEEA 3K02A 5AE4A 1LAXA 1JW4A 3DP6A 4OA4A 5L8DA 4GRKA 2NXOA 3G3HA 3B6TA 1N84A 3H6UA 4LA9A 1B1HA 3Q25A 3FATA 4IR8A 2F36A 4P8BA 4GF8A 4R2BA 1URGA 3THIA 4PCDA 5JEIA 3W15C 2QS4A 4PAFA 1FPGA 3PPNA 4OETA 4QSDA 3N5LA 5I5PA 4JDFA 5I2KA 2HHMA 1NV7A 3RYDA 2L5VA 4R73A 4U2RA 1LAGE 2REGA 4POWA 4OMBA 1LBYA 1IEJA 4HE1A 1DMBA 2F7CA 5I3SA 1QGXA 4KYDA 1YCJA 4G2ZA 2DYXA 1RKMA 1DPEA 3N94A 4MJOA 4QF9A 3UIFA 1A54A 2FHYA 2R8TA 4ZZEA 1F9BA 2X7PA 1TT1A 3VLWA 1USYE 2HAVA 2VHAA 1KWHA 4O3AA 4MNPA 1PB8A 2A5SA 1LB9A 2FNCA 4G8MA 4N4UA 2R9JA 3ILTB 3HSTA 2VT5A 1SYHA 3PGFA 4G68A 3MPLA 5ESYA 1EYJA 4R6YA 1XHYA 1QUJA 3HHGA 1N0TA 4R75A 3R7XA 4YKJA 3B6QA 1ZIUA 1FPFA 5IZ3B 3RT6B 1FTLA 1OLAA 2PBWA 3ONMA 4P3LA 5LOMA 2F3BA 1MXWA 2AL5A 4RJZA 4JWOA 1DBZA 2Z8DA 2QS1A 4H65A 3IAZA 3UORA 4PQJA 4Q5TA 4R6KA 4DLDA 1G0HA 4P1EA 5KCJA 4F22A 5H8QB 5KDTA 1FJ6A 4JSOA 1OVBA 1QKBA 3T9VA 4M4GA 4BDLA 2UVHA 1FTOA 3SEXA 4AQ4A 4QSEA 1XOCA 3MPKA 5DEXB 1IZ1A 4PE3A 3C36A 3O6HA 2F35A 3A3UA 4GXAA 3IX1A 3O2AA 1FQEA 3OO8A 5CMKA 4RNSA 3LV0A 4H8IA 3HPIA 4YB5A 5H8NB 2A5TB 4YKPA 2B4MA 3FVNA 3E4RA 3TPAA 4H1XA 3L6HA 3B7DA 1UQWA 2YJPA 4XKRA 3CSBA 5H8FB 3SEYA 3U94A 1VFDA 1SW1A 2VGQA 5B70A 3F11A 3C4MA 3TCHA 1LCFA 3RTWB 4YB6A 2HAUA 3VVFA 1N3XA 3C31A 3L6GA 3KN8A 4N15A 4KD5A 1DCUA 2WEFA 2DE2A 4NMYA 1O63A 1FSAA 4X9TA 1B3HA 1QUKA 2QVUA 1FTJA 1JVXA 2Y7IA 3S9EA 3GBAA 3IK6B 3RQTA 2ZZWA 3MVWA 3N6TA 3E13X 4JVDA 4C1UA 1H45A 4DDDA 2ONRA 2VOZA 3M3LA 4IGRA 3BFTA 2JJKA 4OVRA 2B65A 2QVRA 1P1NA 3M8UA 3FIRA 4ZZAA 4OVPA 1RDXA 4OVSA 3E78A 3UN6A 2XXTA 1EH3A 3V8XB 3T1BA 4KCDA 4WKMA 5EYGA 1P1OA 3BBRA 3TTNA 3M3KA 3DLNA 1LLSA 1II5A 1B0LA 2G93A 3K1PA 1DOTA 5CRYA 3D1RA 5H8QA 4OVQA 1AWBA 1DTGA 3MVXA 4N8YA 4PFIA 3VVDA 1IXIA 2OWTA 4OEVA 3PUXE 4ONYA 4DXCA 5CBRA 1Y9UA 5DEXA 4YZZA 4PFUA 1FJ9A 2FBPA 5ET5A 4IB2A 5F7VA 4MLVA 3E9XA 2XD3A 1M5DA 4NF6B 2H98A 4WEDA 4ECFA 4EUOA 2XWIA 3PPQA 3QMFA 5DYHA 3K2DA 3TYHA 3ISPA 2Q74A 4DCYA 2A5TA 4R2FA 3OELA 2GRVA 3EF7A 1B6HA 3E3KA 1BK4A 3BIHA 2ESNA 1B3LA 5EQAA 5H8FA 1B46A 1S9TA 3B50A 4RY1A 1O7TA 1OLCA 1NV4A 4N6PA 4AB5A 4H8JA 4OHNA 4GWUA 2QS3A 1LBBA 1N3WA 1LGBC 2FIXA 2I3WA 4RA1A 3MZBA 4O7IA 3PUYE 3T0JA 4GL0A 3EHTA 2NWJA 4F18A 1VSOA 1FTAA 3TZAA 1B4ZA 3RGYA 2P3VA 2HEUA 2DE4A 4YAHX 2WYKA 3JYRA 1USYH 1XVXA 3MVYA 3PV0E 3LSLA 4F1VA 4P11A 1XVYA 2I3VA 4MX6A 4JB7A 1MY2A 2WX9A 4Q8RA 4OERA 1FQFA 1Q9DA 2O51A 5H8HA 4MHFA 3RTFB 1UIVA 3V89B 4MF3A 1EZ9A 3LSFB 5BWJA 1POY1 4R72A 1ELJA 3IFCA 3BKIB 1ZLQA 4AS4A 2PFZA 4XIGQ 2DOJA 5T3JA 4LUBA 3C9HA 3TCFA 5FHOA 1D4NA 4YMBA 4F29A 3HCQA 3PD8A 1EYKA 4IO5A 1FPJA 3OXNA 1AMFA 4NHBA 1JW1A 4KXPA 2RF1A 1B52A 4GX6A 1VE4A 5DVJA 4QHQA 2ABHA 4NN3A 3HHFA 1EYIA 4U4SA
chains in the Genus database with same CATH topology
4PFRA 4HE2A 2HPGA 5I5PA 2VPNA 2HHMA 1NV7A 3RYDA 2L5VA 4DI4B 1FBDA 4GX4A 1DK4A 4NAPA 5EQ7A 1NV1A 4NQ8A 1LBYA 4HE1A 5I3SA 1QGXA 2CEXA 2XWKA 4MCOA 4F1UA 1RDYA 4PF8A 4JVIA 4MJOA 1JP4A 1NV6A 4PBQA 2FHYA 2R8TA 4MNIA 4DI3D 4PFBA 4MNPA 1LBXA 4MNCA 1IMBA 4GWSA 1FBEA 4N4UA 4NG7A 1K9YA 1IMCA 3GYYA 2VT5A 3ROJA 2Y5LA 1KA0A 1EYJA 5ESYA 3MSTA 3MYUA 1NV2A 1KA1A 4M1VA 4XF5A 4HCWA 4GWXA 2VPOA 4N91A 3U65A 3EKIA 1LBZA 1FPFA 5IZ3B 4N81A 4P3LA 2F3BA 4O8MA 2DDKA 2F5XA 2ZZXA 3E79A 3W9VA 5EYHA 2WYPA 1DBZA 4N6DA 5J1DA 1SPIA 4PF6A 5I7IA 1G0HA 2B4LA 4P1EA 4PC9A 1FJ6A 2F3DA 3FBPA 4P9KA 4OANA 4F19A 5ET6A 4MAGA 4MIJA 2QVVA 1FRPA 5IZZA 3W9WA 4PE3A 2V4CA 1IMAA 4P47A 1NUZA 2CEYA 1XI6A 4QBAA 2XA5A 1LBWA 5EQ9A 1FPIA 3LV0A 2WBDA 5ET7A 4UABA 1FPLA 1K9ZA 2B4MA 4NGUA 4PGNA 4PETA 2QPQA 2FIEA 1NUXA 2KR0A 5F24A 1INPA 1YYZA 5IM2A 4N15A 1NUYA 1KZ8A 2XXKA 3SZPA 2XWVA 1DCUA 4P1LA 2WBBA 2WEFA 1VDWA 2DE2A 2HXRA 1FSAA 1LBVA 4XFEA 4YICA 4X9TA 2HZLA 4PDHA 2QVUA 3PTYA 2QFLA 5A5LA 2ZZWA 3A29A 4PAKA 5IGAA 4JVDA 4NX1A 4MEVA 2FVZA 4PGPA 5CM6A 4I3YA 2JJKA 4OVRA 1NUWA 3RPLA 2QVRA 4O7MA 4GWYA 4OVPA 1RDXA 1NV5A 4OVSA 3E78A 4X8RA 4P56A 4PBHA 4I40A 3T1BA 5EYGA 2CZKA 4GWWA 4HCYA 2P3NA 2CZHA 3B8BA 3D1RA 3HFUA 4MMPA 1RDZA 4OVQA 5FBPA 1AWBA 4O94A 4N8GA 4N8YA 4GX3A 4PFIA 1CNQA 4YZZA 1FJ9A 2FBPA 2BJIA 5ET5A 2Q8MA 1D9QA 1NV3A 1FPKA 2GQ1A 2OWZA 4QXDA 5EQ8A 2XWIA 1FBFA 3QMFA 4N17A 1G0IA 4N6KA 3ISPA 2Q74A 4GWZA 1FBGA 4GBVA 4G61A 1YZ0A 2ZZVA 1NV0A 1IMDA 5IZ1A 2Y5KA 4X04A 1BK4A 4XEQA 3BIHA 5EQAA 1FPDA 3B50A 3KBZA 4H45A 4H46A 1NV4A 4HXVA 5LDZA 4GWUA 2PCRA 4AS5A 5J16A 2FIXA 4HE0A 4GBWA 1FPBA 5DW8A 3KC1A 4O7IA 3CHGA 3KC0A 1FBHA 3T0JA 2KQZA 4F18A 1FTAA 3NOHA 3IFAA 1NI9A 2P3VA 2DE4A 4PTKA 2DE3A 1FPEA 2WYKA 2HZKA 2Q9TA 4F1VA 4LN5A 4MX6A 3FXBA 5LTCA 5IZ3A 1IMEA 2WX9A 1IMFA 3RPLB 1Q9DA 1FBPA 4MHFA 4OVTA 1LEVA 4PAIA 2MKZA 1YXIA 3IFCA 5ET8A 4I3EA 4NF0A 2XWOA 4AS4A 2PFZA 2CZIA 5T3JA 1FBCA 4PDDA 4OA4A 1EYKA 1FPJA 2DVZA 4FBPA 3LUZA 4NHBA 2OX3A 4IR8A 4KXPA 4P8BA 5JK4A 4GX6A 2PFYA 4PCDA 4JVCA 3BIGA 4PAFA 4NN3A 1EYIA 1FPGA 2V3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPI A;  4HE2 A;  5EQA A;  1G0H A;  1FPD A;  3A29 A;  2HHM A;  1NV7 A;  3KBZ A;  3RYD A;  4H45 A;  1FBD A;  4H46 A;  1FJ6 A;  4GX4 A;  1NV4 A;  1DK4 A;  2F3D A;  3FBP A;  4HXV A;  5LDZ A;  5EQ7 A;  2FVZ A;  4GWU A;  1NV1 A;  2PCR A;  1LBY A;  4I3Y A;  4AS5 A;  2JJK A;  4HE1 A;  1NUW A;  5J16 A;  5ET6 A;  2FIX A;  4HE0 A;  4GBW A;  1QGX A;  5I3S A;  3RPL A;  2QVV A;  2QVR A;  1FPB A;  5DW8 A;  3KC1 A;  4O7I A;  1FRP A;  1RDY A;  3KC0 A;  1FBH A;  3T0J A;  4GWY A;  1RDX A;  4MJO A;  1IMA A;  1JP4 A;  1NV6 A;  1NV5 A;  1FTA A;  2FHY A;  3IFA A;  2R8T A;  1NI9 A;  1NUZ A;  4I40 A;  2P3V A;  5EYG A;  1XI6 A;  4PTK A;  2CZK A;  1FPE A;  4GWW A;  1LBW A;  1LBX A;  2P3N A;  5EQ9 A;  1FPI A;  3LV0 A;  1IMB A;  2WBD A;  2CZH A;  4GWS A;  3B8B A;  3D1R A;  5ET7 A;  5IZ3 A;  1IME A;  1RDZ A;  1FBE A;  1FPL A;  1K9Z A;  5FBP A;  1K9Y A;  1IMF A;  1IMC A;  1AWB A;  3RPL B;  1Q9D A;  1FBP A;  2VT5 A;  3ROJ A;  4GX3 A;  1LEV A;  1CNQ A;  2Y5L A;  1KA0 A;  1EYJ A;  5ESY A;  1YXI A;  3IFC A;  2FIE A;  5ET8 A;  1FJ9 A;  1NV2 A;  2BJI A;  1KA1 A;  2FBP A;  4I3E A;  5ET5 A;  4AS4 A;  1NUX A;  2CZI A;  5T3J A;  2Q8M A;  4GWX A;  5F24 A;  1INP A;  1D9Q A;  1FBC A;  1NV3 A;  1FPK A;  1YYZ A;  2GQ1 A;  2OWZ A;  4QXD A;  5EQ8 A;  1EYK A;  1FBF A;  1FPJ A;  1LBZ A;  4FBP A;  3LUZ A;  3QMF A;  1FPF A;  5IZ3 B;  1NUY A;  1KZ8 A;  1G0I A;  2OX3 A;  4N81 A;  4IR8 A;  4KXP A;  1DCU A;  2F3B A;  2WBB A;  2DDK A;  2Q74 A;  2WEF A;  4GWZ A;  1VDW A;  1FBG A;  4GBV A;  4GX6 A;  4G61 A;  1FSA A;  1LBV A;  1YZ0 A;  1NV0 A;  1IMD A;  5IZ1 A;  3BIG A;  5EYH A;  2Y5K A;  1BK4 A;  1DBZ A;  1EYI A;  1FPG A;  2QVU A;  2QFL A;  3BIH A;  5A5L A; 
#chains in the Genus database with same CATH topology
 4PFR A;  2VPN A;  1H3D A;  3U92 A;  5KZT A;  1TFA A;  3MC2 A;  5ICT A;  4NF6 A;  4JSD A;  1BP5 A;  3TDJ A;  1B4H A;  4EDP A;  3RN8 A;  1Z7M E;  3WAF A;  4P0G A;  3RPW A;  2CEX A;  2XWK A;  3FAS A;  4U1Z A;  4YKK A;  2XX7 A;  3D4G A;  5A5X B;  4JVI A;  2I4B A;  3VXC A;  1NMU A;  2V3U A;  2FYI A;  1FCK A;  4G4P A;  2H9B A;  2RC7 A;  2HFB A;  3KFM A;  2V3T A;  3ZS6 A;  4POX A;  3FXQ A;  3TTL A;  5CMB A;  1ATG A;  4OYV A;  4GWS A;  2THI A;  3A09 A;  3C35 A;  1FBE A;  3LUY A;  1K9Y A;  1NFT A;  2AIX A;  2QS2 A;  4GQO A;  3ROJ A;  3T93 B;  2E0S A;  1B0H A;  1AH5 A;  5I57 B;  3FV2 A;  3CG3 A;  5ELV A;  1P1U A;  1NV2 A;  5I2N B;  2D3I A;  1MQG A;  1NNF A;  3TTM A;  4GWX A;  3U65 A;  3IOR A;  1M5B A;  1NNP A;  5FHM A;  1A8F A;  2OLB A;  1B5J A;  3SES A;  1LBZ A;  3PMV A;  4ZED A;  3VDF A;  1YAE A;  5K2X A;  4RPO A;  4N81 A;  4O8M A;  2DS9 A;  3W9V A;  5B7D A;  5EYH A;  2GFE A;  3V83 A;  2I49 A;  3G7W A;  4HS7 A;  3O9P A;  2B4L A;  3U1O A;  2OJT A;  3TOD A;  1URS A;  2F3D A;  4I8C A;  4PE5 B;  4P9K A;  4RYA A;  3A3C A;  4MIJ A;  3CSG A;  2Y84 A;  1MQI A;  3KSJ A;  1OVT A;  2Y7K A;  1O64 A;  4ELP A;  1MM6 A;  1BIY A;  3KOT A;  2F6P A;  4XKQ A;  2CZL A;  1NNT A;  2NOO A;  4QSC A;  3LSW A;  5ICQ A;  2WBD A;  4ESW A;  4UAB A;  1FPL A;  1K9Z A;  4GLI A;  5I58 B;  1MS7 A;  5AA3 A;  3PD9 A;  4XKN A;  1MPD A;  1DSN A;  4XXU A;  4PGN A;  3KZG A;  4R9G A;  2D21 A;  5CMC A;  1EU8 A;  1NUX A;  4MLQ A;  4OTE A;  5F24 A;  1PC3 A;  1YTV A;  4R6H A;  1UIU A;  2XXK A;  4I1D A;  3K6W A;  2F7A A;  2HXR A;  3H3G A;  4JWX A;  1LBV A;  4IO3 A;  4XFE A;  2HZL A;  1WVJ A;  4F3B A;  5I57 A;  4OFO A;  4NED A;  5I59 B;  5I2N A;  2XXH A;  3A29 A;  5IGA A;  1NKX A;  4DXU A;  4X1D A;  4C1T A;  1J1N A;  3PUW E;  5ISU A;  1MDP 1;  4I3Y A;  4BDN A;  2OBG A;  2Q89 A;  1NUW A;  1IUD A;  3MZ1 A;  1QVS A;  1D9Y A;  4E0W A;  3DEL B;  2DQV A;  4UAC A;  4EXL A;  4O7M A;  1T0K A;  4GWY A;  2DP8 A;  3N26 A;  1MQJ A;  3IO4 A;  3HV1 A;  5DVI A;  2ANJ A;  4BDR A;  1NNK A;  1Y20 A;  1AL3 A;  3FV1 A;  1LB8 A;  4DCX A;  3HFU A;  4OXV A;  1JET A;  1JVY A;  3MP8 A;  4ZEF A;  4LZ8 A;  4O94 A;  4N8G A;  2NVU B;  4GX3 A;  4IO7 A;  2V84 A;  5IKB A;  4NF4 B;  1SYI A;  1XC1 A;  4EXK A;  4ESX A;  1Y3N A;  4C0R A;  4H6D A;  2QMX A;  4KFQ A;  3SKP A;  1SI0 A;  3KOS A;  4YKI A;  4G77 A;  4OES A;  2ALU A;  4N07 A;  3OEN A;  4IO2 A;  1FPK A;  4RXL A;  3TEL A;  1TFD A;  2RC8 A;  4LVQ A;  3KG2 A;  3EHU A;  1P1W A;  1QW0 A;  4IY6 A;  4N17 A;  1PBQ A;  5CMM A;  4I62 A;  4N6K A;  3K6U A;  4ZEK A;  2I6E A;  2YLN A;  4GBV A;  4G61 A;  4TOZ A;  1NV0 A;  2O69 A;  1A99 A;  1Y3P A;  4FAJ A;  4DXB A;  5L9M A;  2RIN A;  3VLV A;  1TWY A;  1WDN A;  4F31 B;  3MP6 A;  4F39 A;  4H45 A;  4HXV A;  1HSE A;  3QUF A;  1B9J A;  3G3I A;  1DPP A;  5J16 A;  4HE0 A;  4GBW A;  3TQL A;  4MH5 A;  4O3B A;  2HQ0 A;  2D5W A;  3CHG A;  1QJM A;  3PUZ E;  1GTK A;  4BDM A;  2XXW A;  3KC0 A;  1LFI A;  3CFL A;  4TLM B;  3KSX A;  3N6U A;  1SQY A;  3PPO A;  4EQ9 A;  1A8E A;  1SI1 A;  4PTK A;  1FPE A;  1FTK A;  3G3F A;  2DVC A;  4QFP A;  5LTC A;  5IZ3 A;  3TFL A;  3USD A;  4F3S A;  3OSQ A;  4LQ2 A;  3RPL B;  3TAJ A;  3G3K A;  3JZJ A;  2Z8E A;  3IOV A;  4OVT A;  4R74 A;  1LEV A;  3SEV A;  3O29 A;  1S50 A;  4O3C A;  2XWO A;  2VD2 A;  2CZI A;  1OMP A;  3GZG A;  1FBC A;  4H67 A;  4OEU A;  4PDD A;  1POT A;  3MZ9 A;  5EYF A;  2DVZ A;  2UYF A;  4FBP A;  2I0C A;  2OK2 A;  4QRZ A;  4TQU Q;  1B1X A;  4PFW A;  5EHM A;  2I58 A;  5JK4 A;  4WEP A;  2PFY A;  2ZMB A;  3P7I A;  3K6X A;  4OEN A;  4JVC A;  3BIG A;  1MXX A;  2Z22 A;  1LAH E;  1ZKB A;  3KBR A;  1US5 A;  2P1S A;  3C33 A;  4NF4 A;  4KI0 E;  2UVG A;  2V3Q A;  2OPE A;  4LP2 B;  2P0S A;  1QUI A;  1Z7N E;  4DI4 B;  4GX4 A;  1DK4 A;  5EQ7 A;  5L9S A;  3MQ9 A;  5H8N A;  1NV1 A;  4NQ8 A;  1IXC A;  1CB6 A;  5ITO A;  1B3E A;  4MCO A;  1JEV A;  3O6I A;  4F1U A;  1RDY A;  2H25 A;  2RCB A;  3PU5 A;  3OMB A;  4MNI A;  2XHD A;  4XKP A;  4DI3 D;  1I6B A;  3R26 A;  2ZXT A;  2H5Y A;  1VFE A;  3K0V A;  1EZP A;  1GGG A;  3KN7 A;  4IO6 A;  4EQ7 A;  3GYY A;  1R6Z A;  3MVZ A;  3PUV E;  2Y5L A;  3MST A;  1HSL A;  1A55 A;  4M1V A;  4XF5 A;  2Q8J A;  1PB7 A;  4HCW A;  4TLL B;  1NH7 A;  1GR2 A;  3UA8 A;  5CC2 A;  1B7U A;  2DDK A;  3MW0 A;  2F5X A;  3CVG A;  4HW8 A;  3CG1 A;  2AYS A;  1UTB B;  1AOV A;  1D3K A;  3SET A;  1B58 A;  2CMO A;  4N6D A;  1Y3Q A;  4PF6 A;  2P2A A;  4PC9 A;  3TKD A;  2PX1 A;  4QFK A;  3FBP A;  3TEP A;  3O6G A;  2BJJ X;  2WKY A;  4OAN A;  1MRP A;  1URD A;  1ZU0 A;  3FJM A;  4MAG A;  1MM7 A;  5HM4 B;  2QVV A;  1S7Y A;  4NF5 B;  1FRP A;  2R6G E;  5IZZ A;  3H6W A;  3W9W A;  4LQ5 A;  1IMA A;  3FVG A;  3QUJ A;  3K1M A;  1NUZ A;  5K2Y A;  2CEY A;  1BTJ A;  2ZNT A;  3ZKL A;  1OIB A;  3T9X B;  3RNN A;  2O1M A;  4PFT A;  5I2K B;  1LBW A;  4KPT A;  4ZEI A;  5EQ9 A;  2PT1 A;  2ZNU A;  3FZV A;  4P0I A;  5TU0 A;  1M5C A;  1SW2 A;  3VLU A;  2F78 A;  4ND9 A;  3KGC A;  3IB0 A;  5M2V A;  4DIG A;  2OPD A;  3HN0 A;  4NGU A;  4PET A;  1ZMG A;  2XXV A;  2QPQ A;  1PBP A;  5AA1 A;  4KHZ E;  2FIE A;  2HCA A;  1UTH B;  2GHB A;  1IIT A;  2KR0 A;  3SEU A;  1CE2 A;  1TXF A;  2DXY A;  4JXI A;  3CR9 A;  3GXA A;  4ZEC A;  4LZ7 A;  2ONS A;  3OOA A;  5IM2 A;  4NWC A;  4U1O A;  4GWO A;  3RY3 A;  3SZP A;  2XWV A;  4P1L A;  3T66 A;  1MDQ A;  1Q35 A;  1VDW A;  3VE1 B;  1B5H A;  3U8Q A;  1R9Q A;  1MY3 A;  1VR5 A;  3MAM A;  2QFL A;  3DP8 A;  5A5L A;  4PAK A;  3IOT A;  5AA4 B;  4NX1 A;  1XS5 A;  2XXR A;  4MEV A;  2Y7W A;  1GVC A;  3OD7 A;  4PGP A;  3CFX A;  4ZS9 A;  2NUV A;  2ZYN A;  2E1S A;  2KLF A;  4G8H A;  5I84 A;  3PMW A;  1A7L A;  1UTB A;  1NV5 A;  2DWI A;  4X8R A;  4PBH A;  4F3G A;  4H5G A;  2XXX A;  5HBC A;  4Z7E A;  4NF8 B;  1B7Z A;  3M3F A;  2CZK A;  2DSF A;  2PVU A;  2UYE A;  2P3N A;  5KDT B;  2W7Y A;  2CZH A;  3FXU A;  3B8B A;  5DT6 A;  1LST A;  2XXP A;  4MMP A;  4LON B;  5FBP A;  1SBP A;  2QRY A;  1B51 A;  3K1N A;  1SVX B;  1B3G A;  3VXB A;  4NF5 A;  1NL5 A;  2XXI A;  4X1B A;  4YB7 A;  3FUZ A;  3QSL A;  2XXY A;  2BJI A;  3GLB A;  4FIM A;  5BUU A;  3H06 B;  3H7M A;  2UXA A;  1D9Q A;  1NV3 A;  4IGT A;  4QXD A;  4ISU A;  1B32 A;  2GH9 A;  4G68 C;  5AA2 D;  3I3V A;  4FEC A;  1G0I A;  4Q30 B;  3S4U A;  3Q27 A;  4GWZ A;  1FBG A;  1R9L A;  5AA2 B;  2QSX A;  2ZZV A;  4GVO A;  5A5X A;  4GL8 A;  1IMD A;  5IZ1 A;  4FEB A;  2Y5K A;  3IL1 B;  3IO6 A;  4X04 A;  3IOU A;  3FD3 A;  1AIV A;  1MPB A;  1MXY A;  1OQH A;  1UTH A;  3CRB A;  2O1L A;  5FTI A;  2UVJ A;  3U93 A;  4KYE A;  3IJX B;  3QIM A;  1FPB A;  5DW8 A;  3KC1 A;  1FBH A;  3TTK A;  4Q0C A;  3KN3 A;  4X48 A;  3TQW A;  3NOH A;  3IFA A;  1US4 A;  1I6Q A;  2X7Q A;  3T96 B;  1PB9 A;  2DE3 A;  3OEM A;  1JQF A;  4ELQ A;  2I0B A;  2QJE A;  4NTL A;  2HZK A;  1DTZ A;  1A40 A;  1N7X A;  2Q9T A;  4BLA A;  5AA4 A;  4LN5 A;  3FXR A;  3K4U A;  3ODB A;  1IME A;  2M8C A;  3SDF A;  2PYY A;  1IMF A;  3ZSF A;  3DM0 A;  5HPQ A;  2AL4 A;  3ZKK A;  3IB2 A;  3LSX A;  2MKZ A;  2O84 X;  4I3E A;  4NF0 A;  4L17 A;  4ZE8 A;  3O97 A;  4BDQ A;  4LAT A;  3OO7 A;  1P1Q A;  3H03 A;  4NF8 A;  5FHN A;  2V93 A;  3LUZ A;  1SDX A;  2OX3 A;  1FQC A;  3KJT A;  4ZDM A;  3CI8 A;  3KEI A;  2Y7R A;  2X26 A;  1L5T A;  3FGS A;  1QKA A;  1R1N A;  3C32 A;  4HE2 A;  2HPG A;  4UA8 A;  1MG1 A;  2ONK E;  1FBD A;  4RK2 A;  1MXV A;  2Z8F A;  4NAP A;  4G8N A;  1SD3 A;  4FAT A;  5I58 A;  2DWJ A;  4PF8 A;  2HXW A;  1M5F A;  3OSR A;  1YPN A;  4THI A;  2XXQ A;  1JP4 A;  1NV6 A;  4PBQ A;  5AA2 A;  1LCT A;  1SW4 A;  3KJ7 A;  3EN3 A;  3IOW A;  3CFZ A;  1BLF A;  3SEW A;  5CI5 A;  4PFB A;  4OQO A;  1LBX A;  3EHS A;  3MBP A;  4MNC A;  1IMB A;  3OO9 A;  2FA7 A;  1MPC A;  4IO4 A;  4EF1 A;  4NG7 A;  2R71 A;  2ZYO A;  1IMC A;  4PFY A;  1ZTY A;  3QK6 A;  1M5E A;  1I6A A;  1LFH A;  3UK4 A;  2OZZ A;  5F1Q A;  4GFR A;  4DZ1 A;  4H5F A;  5ITP A;  1KA0 A;  3MYU A;  2RCA A;  3UP9 A;  2I4C A;  1KA1 A;  2F7B A;  1Q1K A;  3B6W A;  5I59 A;  2VPO A;  4N91 A;  5L9O A;  5I56 B;  3G3J A;  4XTC Q;  3EKI A;  3TTR A;  1JNF A;  1JW5 A;  3EPE A;  3U72 A;  4GOT A;  5TP9 B;  4JWY A;  1FTM A;  2ZZX A;  1H76 A;  3T9H B;  5H8H B;  4GIZ A;  3E79 A;  1B5I A;  2WYP A;  2XX8 A;  4MFI A;  4QFO A;  2F97 A;  4ELO A;  1EZO A;  3O66 A;  3VVE A;  1B7H A;  1SPI A;  5J1D A;  4U21 A;  5I7I A;  1B3F A;  4E0X A;  1N04 A;  2QL3 A;  3ECR A;  2H4I A;  4H0W A;  4NE4 A;  3QAX A;  4I9D A;  4F19 A;  5ET6 A;  5JTY B;  5EHS A;  3SER A;  1NH8 A;  2Q2C A;  3LC8 A;  4KQP A;  3HO7 A;  3LBS A;  1QUL A;  2XD2 A;  1D9V A;  1OQG A;  2V4C A;  1FQB A;  3C34 A;  4P47 A;  1XT8 A;  1IIW A;  4F3P A;  1LAF E;  4HTG A;  3V5A A;  1H43 A;  5TPA B;  1Y4C A;  1XI6 A;  4LZ5 A;  4AB6 A;  4QBA A;  2XA5 A;  2DWA A;  2XXU A;  1FPI A;  1FW0 A;  5ET7 A;  4N13 A;  3PPR A;  3Q26 A;  5DVF A;  1MY4 A;  1ANF A;  3TCG A;  1IXG A;  1ZJL A;  3BFU A;  2F6G A;  1BKA A;  3TUS A;  3WAE A;  4EF2 A;  1B05 A;  2ZYM A;  2Y7P A;  1B2H A;  1INP A;  1Y1M A;  3S2V A;  2REJ A;  1YYZ A;  1H44 A;  1MH3 A;  3H6T A;  4FE8 A;  5FTH A;  3QYT A;  3S9M C;  1NUY A;  1KZ8 A;  2WBB A;  3OEK A;  2OCU A;  1MY1 A;  4BDO A;  3R6U A;  4YU0 A;  3OO6 A;  4RK9 A;  4WXJ A;  4YIC A;  1ZBM A;  2UVI A;  4PDH A;  2LAO A;  3PTY A;  3FJG A;  3K01 A;  1MH4 A;  3FJ7 A;  3VV5 A;  5I56 A;  4PP0 A;  3MP1 A;  2FVZ A;  3RT8 A;  3IB1 A;  5CM6 A;  3VFJ A;  4JBZ A;  4OZ9 A;  3RPL A;  3MJN A;  1RYX A;  3CIJ A;  3QXM A;  3DP4 A;  5TP9 A;  4KR5 A;  2DXR A;  1LFG A;  3IR1 A;  2YPN A;  4P56 A;  2O7I A;  4I40 A;  3PPP A;  3GBB A;  4ZEB A;  1I69 A;  4OFJ A;  4F2O A;  5CBS A;  4YMA A;  1P99 A;  4GWW A;  4HCY A;  3T22 A;  3K00 A;  3D4C A;  1RDZ A;  2IA4 A;  4FED A;  3JV9 A;  2F8D A;  2B3B A;  5JTY A;  3Q29 A;  4IY5 A;  1HSJ A;  5H8S A;  3S9N C;  1MXU A;  2O68 A;  1CNQ A;  2QMW A;  1MXZ A;  4ELR A;  3LR1 A;  4NWD A;  3O28 A;  3FVO A;  5IAI A;  3MUQ A;  2Q8M A;  4FOR A;  1RYO A;  4OVJ A;  3UGW A;  5TPA A;  2GQ1 A;  2OWZ A;  4RPN A;  5EQ8 A;  1Y1Z A;  1FBF A;  4U22 A;  2O7U A;  2Z23 A;  4KYS A;  4MBP A;  3IJO B;  4U23 A;  4DE8 A;  2ZNS A;  1SW5 A;  4QFN A;  4R9F A;  1FQA A;  2PT2 A;  2O6A A;  3I6V A;  1YZ0 A;  4FJP A;  4F1Y A;  2H99 A;  1IXH A;  3FVK A;  3T9U A;  2B3F A;  1MY0 A;  3TMG A;  4XEQ A;  1B40 A;  2V25 A;  2F34 A;  1FPD A;  3KBZ A;  4ZE9 A;  1Y4T A;  1IQ7 A;  4H46 A;  5LDZ A;  2PCR A;  4EQB A;  1PDA A;  3EQ1 A;  4AS5 A;  2DWH A;  2ZYK A;  4G68 B;  2GHA A;  4F2Q A;  3S9L C;  3ILU B;  1MQD A;  4U4X A;  2KQZ A;  1PEB A;  1JEU A;  3MWB A;  4QFL A;  1N76 A;  4OFL A;  2Q88 A;  2RC9 A;  1NI9 A;  3Q28 A;  3K6V A;  1GV8 A;  3I5O A;  4KCC A;  1LBC A;  5DTB A;  3H4Z A;  2G29 A;  3PMX A;  1MQH A;  2Q2A A;  3AXF A;  4OWD A;  3FXB A;  4K3F A;  3G3G A;  1FBP A;  2VP1 A;  2OWS A;  1WOD A;  2PMS A;  2VD3 A;  4PAI A;  1N7W A;  1YXI A;  3H6V A;  4Z0I A;  2XX9 A;  5ET8 A;  5KCJ B;  4GXS B;  2RKM A;  4GD5 A;  1FQD A;  2I48 A;  3RLF E;  3RUM A;  2IEE A;  3K02 A;  5AE4 A;  1LAX A;  1JW4 A;  3DP6 A;  4OA4 A;  5L8D A;  4GRK A;  2NXO A;  3G3H A;  3B6T A;  1N84 A;  3H6U A;  4LA9 A;  1B1H A;  3Q25 A;  3FAT A;  4IR8 A;  2F36 A;  4P8B A;  4GF8 A;  4R2B A;  1URG A;  3THI A;  4PCD A;  5JEI A;  3W15 C;  2QS4 A;  4PAF A;  1FPG A;  3PPN A;  4OET A;  4QSD A;  3N5L A;  5I5P A;  4JDF A;  5I2K A;  2HHM A;  1NV7 A;  3RYD A;  2L5V A;  4R73 A;  4U2R A;  1LAG E;  2REG A;  4POW A;  4OMB A;  1LBY A;  1IEJ A;  4HE1 A;  1DMB A;  2F7C A;  5I3S A;  1QGX A;  4KYD A;  1YCJ A;  4G2Z A;  2DYX A;  1RKM A;  1DPE A;  3N94 A;  4MJO A;  4QF9 A;  3UIF A;  1A54 A;  2FHY A;  2R8T A;  4ZZE A;  1F9B A;  2X7P A;  1TT1 A;  3VLW A;  1USY E;  2HAV A;  2VHA A;  1KWH A;  4O3A A;  4MNP A;  1PB8 A;  2A5S A;  1LB9 A;  2FNC A;  4G8M A;  4N4U A;  2R9J A;  3ILT B;  3HST A;  2VT5 A;  1SYH A;  3PGF A;  4G68 A;  3MPL A;  5ESY A;  1EYJ A;  4R6Y A;  1XHY A;  1QUJ A;  3HHG A;  1N0T A;  4R75 A;  3R7X A;  4YKJ A;  3B6Q A;  1ZIU A;  1FPF A;  5IZ3 B;  3RT6 B;  1FTL A;  1OLA A;  2PBW A;  3ONM A;  4P3L A;  5LOM A;  2F3B A;  1MXW A;  2AL5 A;  4RJZ A;  4JWO A;  1DBZ A;  2Z8D A;  2QS1 A;  4H65 A;  3IAZ A;  3UOR A;  4PQJ A;  4Q5T A;  4R6K A;  4DLD A;  1G0H A;  4P1E A;  5KCJ A;  4F22 A;  5H8Q B;  5KDT A;  1FJ6 A;  4JSO A;  1OVB A;  1QKB A;  3T9V A;  4M4G A;  4BDL A;  2UVH A;  1FTO A;  3SEX A;  4AQ4 A;  4QSE A;  1XOC A;  3MPK A;  5DEX B;  1IZ1 A;  4PE3 A;  3C36 A;  3O6H A;  2F35 A;  3A3U A;  4GXA A;  3IX1 A;  3O2A A;  1FQE A;  3OO8 A;  5CMK A;  4RNS A;  3LV0 A;  4H8I A;  3HPI A;  4YB5 A;  5H8N B;  2A5T B;  4YKP A;  2B4M A;  3FVN A;  3E4R A;  3TPA A;  4H1X A;  3L6H A;  3B7D A;  1UQW A;  2YJP A;  4XKR A;  3CSB A;  5H8F B;  3SEY A;  3U94 A;  1VFD A;  1SW1 A;  2VGQ A;  5B70 A;  3F11 A;  3C4M A;  3TCH A;  1LCF A;  3RTW B;  4YB6 A;  2HAU A;  3VVF A;  1N3X A;  3C31 A;  3L6G A;  3KN8 A;  4N15 A;  4KD5 A;  1DCU A;  2WEF A;  2DE2 A;  4NMY A;  1O63 A;  1FSA A;  4X9T A;  1B3H A;  1QUK A;  2QVU A;  1FTJ A;  1JVX A;  2Y7I A;  3S9E A;  3GBA A;  3IK6 B;  3RQT A;  2ZZW A;  3MVW A;  3N6T A;  3E13 X;  4JVD A;  4C1U A;  1H45 A;  4DDD A;  2ONR A;  2VOZ A;  3M3L A;  4IGR A;  3BFT A;  2JJK A;  4OVR A;  2B65 A;  2QVR A;  1P1N A;  3M8U A;  3FIR A;  4ZZA A;  4OVP A;  1RDX A;  4OVS A;  3E78 A;  3UN6 A;  2XXT A;  1EH3 A;  3V8X B;  3T1B A;  4KCD A;  4WKM A;  5EYG A;  1P1O A;  3BBR A;  3TTN A;  3M3K A;  3DLN A;  1LLS A;  1II5 A;  1B0L A;  2G93 A;  3K1P A;  1DOT A;  5CRY A;  3D1R A;  5H8Q A;  4OVQ A;  1AWB A;  1DTG A;  3MVX A;  4N8Y A;  4PFI A;  3VVD A;  1IXI A;  2OWT A;  4OEV A;  3PUX E;  4ONY A;  4DXC A;  5CBR A;  1Y9U A;  5DEX A;  4YZZ A;  4PFU A;  1FJ9 A;  2FBP A;  5ET5 A;  4IB2 A;  5F7V A;  4MLV A;  3E9X A;  2XD3 A;  1M5D A;  4NF6 B;  2H98 A;  4WED A;  4ECF A;  4EUO A;  2XWI A;  3PPQ A;  3QMF A;  5DYH A;  3K2D A;  3TYH A;  3ISP A;  2Q74 A;  4DCY A;  2A5T A;  4R2F A;  3OEL A;  2GRV A;  3EF7 A;  1B6H A;  3E3K A;  1BK4 A;  3BIH A;  2ESN A;  1B3L A;  5EQA A;  5H8F A;  1B46 A;  1S9T A;  3B50 A;  4RY1 A;  1O7T A;  1OLC A;  1NV4 A;  4N6P A;  4AB5 A;  4H8J A;  4OHN A;  4GWU A;  2QS3 A;  1LBB A;  1N3W A;  1LGB C;  2FIX A;  2I3W A;  4RA1 A;  3MZB A;  4O7I A;  3PUY E;  3T0J A;  4GL0 A;  3EHT A;  2NWJ A;  4F18 A;  1VSO A;  1FTA A;  3TZA A;  1B4Z A;  3RGY A;  2P3V A;  2HEU A;  2DE4 A;  4YAH X;  2WYK A;  3JYR A;  1USY H;  1XVX A;  3MVY A;  3PV0 E;  3LSL A;  4F1V A;  4P11 A;  1XVY A;  2I3V A;  4MX6 A;  4JB7 A;  1MY2 A;  2WX9 A;  4Q8R A;  4OER A;  1FQF A;  1Q9D A;  2O51 A;  5H8H A;  4MHF A;  3RTF B;  1UIV A;  3V89 B;  4MF3 A;  1EZ9 A;  3LSF B;  5BWJ A;  1POY 1;  4R72 A;  1ELJ A;  3IFC A;  3BKI B;  1ZLQ A;  4AS4 A;  2PFZ A;  4XIG Q;  2DOJ A;  5T3J A;  4LUB A;  3C9H A;  3TCF A;  5FHO A;  1D4N A;  4YMB A;  4F29 A;  3HCQ A;  3PD8 A;  1EYK A;  4IO5 A;  1FPJ A;  3OXN A;  1AMF A;  4NHB A;  1JW1 A;  4KXP A;  2RF1 A;  1B52 A;  4GX6 A;  1VE4 A;  5DVJ A;  4QHQ A;  2ABH A;  4NN3 A;  3HHF A;  1EYI A;  4U4S A; 
#chains in the Genus database with same CATH homology
 4PFR A;  4HE2 A;  2HPG A;  5I5P A;  2VPN A;  2HHM A;  1NV7 A;  3RYD A;  2L5V A;  4DI4 B;  1FBD A;  4GX4 A;  1DK4 A;  4NAP A;  5EQ7 A;  1NV1 A;  4NQ8 A;  1LBY A;  4HE1 A;  5I3S A;  1QGX A;  2CEX A;  2XWK A;  4MCO A;  4F1U A;  1RDY A;  4PF8 A;  4JVI A;  4MJO A;  1JP4 A;  1NV6 A;  4PBQ A;  2FHY A;  2R8T A;  4MNI A;  4DI3 D;  4PFB A;  4MNP A;  1LBX A;  4MNC A;  1IMB A;  4GWS A;  1FBE A;  4N4U A;  4NG7 A;  1K9Y A;  1IMC A;  3GYY A;  2VT5 A;  3ROJ A;  2Y5L A;  1KA0 A;  1EYJ A;  5ESY A;  3MST A;  3MYU A;  1NV2 A;  1KA1 A;  4M1V A;  4XF5 A;  4HCW A;  4GWX A;  2VPO A;  4N91 A;  3U65 A;  3EKI A;  1LBZ A;  1FPF A;  5IZ3 B;  4N81 A;  4P3L A;  2F3B A;  4O8M A;  2DDK A;  2F5X A;  2ZZX A;  3E79 A;  3W9V A;  5EYH A;  2WYP A;  1DBZ A;  4N6D A;  5J1D A;  1SPI A;  4PF6 A;  5I7I A;  1G0H A;  2B4L A;  4P1E A;  4PC9 A;  1FJ6 A;  2F3D A;  3FBP A;  4P9K A;  4OAN A;  4F19 A;  5ET6 A;  4MAG A;  4MIJ A;  2QVV A;  1FRP A;  5IZZ A;  3W9W A;  4PE3 A;  2V4C A;  1IMA A;  4P47 A;  1NUZ A;  2CEY A;  1XI6 A;  4QBA A;  2XA5 A;  1LBW A;  5EQ9 A;  1FPI A;  3LV0 A;  2WBD A;  5ET7 A;  4UAB A;  1FPL A;  1K9Z A;  2B4M A;  4NGU A;  4PGN A;  4PET A;  2QPQ A;  2FIE A;  1NUX A;  2KR0 A;  5F24 A;  1INP A;  1YYZ A;  5IM2 A;  4N15 A;  1NUY A;  1KZ8 A;  2XXK A;  3SZP A;  2XWV A;  1DCU A;  4P1L A;  2WBB A;  2WEF A;  1VDW A;  2DE2 A;  2HXR A;  1FSA A;  1LBV A;  4XFE A;  4YIC A;  4X9T A;  2HZL A;  4PDH A;  2QVU A;  3PTY A;  2QFL A;  5A5L A;  2ZZW A;  3A29 A;  4PAK A;  5IGA A;  4JVD A;  4NX1 A;  4MEV A;  2FVZ A;  4PGP A;  5CM6 A;  4I3Y A;  2JJK A;  4OVR A;  1NUW A;  3RPL A;  2QVR A;  4O7M A;  4GWY A;  4OVP A;  1RDX A;  1NV5 A;  4OVS A;  3E78 A;  4X8R A;  4P56 A;  4PBH A;  4I40 A;  3T1B A;  5EYG A;  2CZK A;  4GWW A;  4HCY A;  2P3N A;  2CZH A;  3B8B A;  3D1R A;  3HFU A;  4MMP A;  1RDZ A;  4OVQ A;  5FBP A;  1AWB A;  4O94 A;  4N8G A;  4N8Y A;  4GX3 A;  4PFI A;  1CNQ A;  4YZZ A;  1FJ9 A;  2FBP A;  2BJI A;  5ET5 A;  2Q8M A;  1D9Q A;  1NV3 A;  1FPK A;  2GQ1 A;  2OWZ A;  4QXD A;  5EQ8 A;  2XWI A;  1FBF A;  3QMF A;  4N17 A;  1G0I A;  4N6K A;  3ISP A;  2Q74 A;  4GWZ A;  1FBG A;  4GBV A;  4G61 A;  1YZ0 A;  2ZZV A;  1NV0 A;  1IMD A;  5IZ1 A;  2Y5K A;  4X04 A;  1BK4 A;  4XEQ A;  3BIH A;  5EQA A;  1FPD A;  3B50 A;  3KBZ A;  4H45 A;  4H46 A;  1NV4 A;  4HXV A;  5LDZ A;  4GWU A;  2PCR A;  4AS5 A;  5J16 A;  2FIX A;  4HE0 A;  4GBW A;  1FPB A;  5DW8 A;  3KC1 A;  4O7I A;  3CHG A;  3KC0 A;  1FBH A;  3T0J A;  2KQZ A;  4F18 A;  1FTA A;  3NOH A;  3IFA A;  1NI9 A;  2P3V A;  2DE4 A;  4PTK A;  2DE3 A;  1FPE A;  2WYK A;  2HZK A;  2Q9T A;  4F1V A;  4LN5 A;  4MX6 A;  3FXB A;  5LTC A;  5IZ3 A;  1IME A;  2WX9 A;  1IMF A;  3RPL B;  1Q9D A;  1FBP A;  4MHF A;  4OVT A;  1LEV A;  4PAI A;  2MKZ A;  1YXI A;  3IFC A;  5ET8 A;  4I3E A;  4NF0 A;  2XWO A;  4AS4 A;  2PFZ A;  2CZI A;  5T3J A;  1FBC A;  4PDD A;  4OA4 A;  1EYK A;  1FPJ A;  2DVZ A;  4FBP A;  3LUZ A;  4NHB A;  2OX3 A;  4IR8 A;  4KXP A;  4P8B A;  5JK4 A;  4GX6 A;  2PFY A;  4PCD A;  4JVC A;  3BIG A;  4PAF A;  4NN3 A;  1EYI A;  1FPG A;  2V3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...