4HE0A

Crystal structure of human muscle fructose-1,6-bisphosphatase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
326
Chain Sequence
ETDMLTLTRYVMEKGRQTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human Muscle Fructose-1,6-Bisphosphatase: Novel Quaternary States, Enhanced AMP Affinity, and Allosteric Signal Transmission Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
total genus 106
structure length 326
sequence length 329
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4he0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4he0A02
1EYJA 2JJKA 4GX3A 4N81A 3QMFA 4AS4A 1IMCA 1FPIA 2P3NA 5T3JA 1IMFA 1K9ZA 4GBVA 2QVRA 1EYKA 2FVZA 5EQ9A 1Q9DA 2Q8MA 1NUZA 4H46A 1FBEA 1NUYA 2QFLA 4H45A 1JP4A 1NUWA 2Q74A 2Y5LA 3D1RA 1NV5A 5EQAA 4AS5A 5EYHA 4GWXA 3BIGA 3IFCA 1NUXA 2HHMA 4HE2A 3ROJA 3T0JA 1LBVA 1NV4A 2DDKA 3BIHA 4FBPA 3KC1A 3RPLB 1FBCA 2QVUA 4HE1A 1LBXA 4PTKA 1FJ9A 1NV6A 1FPEA 2P3VA 3A29A 1FBFA 4I3YA 1IMDA 5ESYA 1LBYA 4GWWA 5LDZA 4GX6A 2WBDA 1K9YA 5A5LA 1FRPA 2WBBA 1BK4A 1NV2A 1YYZA 1FPGA 2CZHA 5EQ7A 2PCRA 3IFAA 1IMBA 5EQ8A 5DW8A 1FPLA 1EYIA 2FIEA 1XI6A 1FJ6A 1YZ0A 3KC0A 1RDYA 1SPIA 2CZKA 4GWYA 4I40A 4G61A 4MJOA 5EYGA 5J16A 2CZIA 3KBZA 1G0IA 4HE0A 2Y5KA 2BJIA 4KXPA 2R8TA 2FIXA 1VDWA 5I3SA 1LBWA 1FTAA 1D9QA 1NI9A 2GQ1A 5IZ3A 4I3EA 1DBZA 1FPDA 1KA1A 4GWZA 2OWZA 2OX3A 5FBPA 2WEFA 3RPLA 1FPKA 4QXDA 1LBZA 4HXVA 2F3DA 1RDXA 1FPBA 1IMEA 1YXIA 1RDZA 1FPJA 1IMAA 1FBGA 5IZ1A 1FSAA 3RYDA 1DCUA 1DK4A 5ET6A 3LUZA 1INPA 1CNQA 1FPFA 1KA0A 1LEVA 3FBPA 1QGXA 4O7IA 5ET7A 5F24A 2FBPA 1NV1A 4GX4A 5ET8A 2FHYA 4GWUA 4GBWA 4IR8A 1FBPA 1NV3A 1NV0A 2VT5A 1G0HA 3B8BA 1FBHA 1KZ8A 1FBDA 1NV7A 4GWSA 3LV0A 2QVVA 2F3BA 5IZ3B 5ET5A 1AWBA
chains in the Genus database with same CATH superfamily
4GX3A 4N13A 4AS4A 5KDTA 3T22A 3SESA 1JEUA 3HHFA 3N5LA 1Q9DA 5ITOA 2ESNA 4YICA 4MIJA 3LSXA 1NUWA 1YTVA 1I6AA 1EU8A 1RKMA 1NNFA 3EHTA 2HHMA 4OETA 4EQBA 4FIMA 1ZLQA 4GLIA 4AQ4A 4DCXA 3CG1A 4LZ7A 1ZKBA 3FXRA 1SQYA 2Z8EA 4BDNA 3SETA 4GWWA 1AH5A 4DIGA 1B3FA 1WODA 3OO7A 3T66A 4ZE8A 1B32A 2YJPA 4OQOA 1NV2A 5I2NA 1OMPA 5FHMA 3W15C 5I58B 2D5WA 1IMBA 1AMFA 1B4HA 1YZ0A 2OJTA 3RN8A 2THIA 3THIA 4OFJA 1JEVA 4H8JA 4UACA 4F2QA 5H8FA 4G68C 1FTAA 4KYEA 1MPBA 3S2VA 4I3EA 1SBPA 4E0WA 2XX9A 1A55A 1Q35A 1MY2A 1YXIA 1RDZA 2RCAA 1AOVA 2UXAA 2F7BA 1M5CA 4O7IA 2B4MA 2VPOA 2V3UA 3PD9A 2QSXA 1H76A 5H8FB 3GBAA 3MW0A 1ZBMA 2H5YA 1N7XA 3LUYA 3S9EA 3RQTA 3HHGA 4R9GA 2XX7A 5FTHA 1QJMA 4YB7A 1ZIUA 2Q8MA 4P8BA 3LSFB 3VXCA 3EN3A 4H46A 2OWTA 1US4A 5M2VA 1QUIA 4YB6A 2Q74A 1MDQA 2HZLA 2XD2A 2QS1A 2ZYKA 4Q30B 4N15A 1PC3A 2UVIA 2ZYNA 1PB8A 4QRZA 4OWDA 3T96B 1PEBA 2WBDA 3TODA 4IO5A 5LOMA 1D3KA 3QK6A 4GD5A 4C1TA 1QKAA 2XWOA 4NWDA 4GWYA 3UP9A 2DE3A 4BDQA 2F6PA 1URGA 4QFOA 1MDP1 2XWIA 2FIXA 1TFAA 1B9JA 2X7PA 1BLFA 3DP6A 2UVHA 4F3SA 2ANJA 1USYH 4POWA 2VGQA 5IGAA 2A5TB 4P47A 3DELB 1FSAA 4GOTA 2D21A 1LCTA 5B7DA 3AXFA 4PGNA 3O6HA 4I62A 2I3VA 1NFTA 2G93A 4OEUA 5AE4A 3FJ7A 2B3FA 1NV7A 3CSBA 2XXXA 4OVQA 2VD2A 4H67A 1AWBA 3DM0A 2XXKA 4PAFA 4KPTA 3TCHA 5FHNA 5I57B 3R26A 3GLBA 5ELVA 1B0LA 4F3PA 3OENA 1ZU0A 4F1VA 3FJMA 5CC2A 2F7CA 2NUVA 1NUXA 4OFLA 2DDKA 4PCDA 2I6EA 3OOAA 4F1UA 5CM6A 4NF5A 2FYIA 2DS9A 1B7ZA 1D4NA 2QVUA 5K2YA 3O29A 1BIYA 5DVFA 4DXCA 4N6KA 4NWCA 4NTLA 2VOZA 3G3HA 3SEVA 2IA4A 2PMSA 2ALUA 4OVRA 2DVCA 3LC8A 2I3WA 4AB6A 3IAZA 5B70A 2F34A 2XD3A 2Z23A 3GBBA 2DOJA 3H06B 2O69A 1FTKA 3C36A 3PMXA 4XFEA 3MVYA 4EDPA 5J16A 3TFLA 1F9BA 3TDJA 2Y5KA 1M5EA 3MAMA 2DWHA 2HCAA 4U4XA 4KCDA 4O3AA 4YKPA 1MXZA 2RC7A 1FCKA 3RT8A 1KA1A 1IXHA 3RPLA 1II5A 2PFYA 3ISPA 1NNPA 3VV5A 2PYYA 3S9LC 5TPAA 3M3LA 5TP9A 2BJJX 1VFEA 2RC9A 4LQ2A 1ZMGA 1A54A 2QMXA 3KOTA 2UYEA 4NF8A 1B0HA 3M3KA 4OVTA 3T9HB 3LV0A 2QVVA 5EHMA 1QW0A 1DPEA 4G4PA 3TTRA 4O94A 1IMFA 3G3GA 1B5JA 4N07A 1FBEA 1NL5A 3O28A 3HV1A 2QRYA 4H5GA 4P56A 1RYOA 5EQAA 4F29A 5DVJA 1T0KA 1UTBB 3IJOB 4OZ9A 1LFHA 1SVXB 2YLNA 4C0RA 4PTKA 3MVXA 2ZNUA 2Q88A 3K6UA 4I3YA 4YB5A 2XXUA 4P1LA 4IO2A 2VPNA 4NG7A 4EXKA 3FASA 1H44A 2O84X 3FZVA 4P9KA 2IEEA 4QFLA 2WKYA 1J1NA 2R6GE 5I57A 1H3DA 2AL5A 4XTCQ 2CZIA 3E4RA 4KXPA 4F2OA 1VSOA 4Q5TA 3TKDA 1D9QA 1FPDA 2HQ0A 3MPKA 3MQ9A 4OMBA 4F19A 1FQCA 1SI1A 4R6KA 3V83A 1AIVA 2I58A 3G3KA 3ZKLA 3OEKA 3T9VA 4DCYA 4H1XA 5ET8A 4H0WA 2WYKA 4GWUA 5CBSA 3K6XA 4QSCA 1B40A 3VE1B 4R6HA 4PFWA 4GWSA 4X1DA 3ZS6A 4F18A 3CFLA 3CSGA 4RK2A 1FQBA 4KYSA 3RTFB 1LB8A 3LR1A 1B7UA 5BUUA 3HO7A 3UN6A 4L17A 3U92A 2QFLA 1JP4A 3IOTA 2Y7KA 4OANA 3IFCA 4JBZA 1LBVA 1IUDA 1N84A 4F39A 5EHSA 5ITPA 3SEUA 1S50A 2P3VA 4ND9A 4IO7A 5FHOA 2V4CA 1UTHA 3FV1A 4N6DA 4HCYA 1LSTA 5JEIA 1DPPA 5DW8A 3KN8A 1IXIA 1URDA 3QXMA 2B3BA 4K3FA 1N0TA 3KJ7A 1G0IA 3TTMA 2KLFA 4BDRA 2QS3A 5I3SA 2HXWA 1DBZA 1FPKA 4R9FA 1B05A 2F3DA 4O7MA 3KSXA 1IMEA 3U1OA 4Z7EA 1LEVA 2Q2AA 5CRYA 4F3BA 3OO6A 2FHYA 4GBWA 2Y84A 2W7YA 1FBPA 1NV3A 2DWJA 2VT5A 5DEXB 2D3IA 3RUMA 3N6TA 1I6QA 3SEWA 2ZYOA 5CMBA 4PFBA 4KI0E 3GZGA 5ICQA 1B46A 3HSTA 5TU0A 2FNCA 2RINA 3TTKA 4KR5A 2XXPA 3USDA 3EHSA 3PMVA 2DXRA 2DSFA 3QUJA 3K0VA 1XC1A 2QMWA 4N4UA 4OERA 5CMCA 2REGA 3JZJA 3IOVA 3H7MA 3PUYE 4G8NA 1B51A 4GVOA 4PAKA 2ZMBA 4I9DA 4U2RA 1NNKA 5AA3A 5AA2A 4OVPA 4O3BA 3ILTB 4DXBA 4NF0A 3I3VA 4NF6B 4G68B 4GL0A 1DSNA 3VLWA 1MXWA 5DT6A 2OWZA 1RYXA 4ZEKA 2QS4A 4UA8A 2ABHA 3G7WA 3O6IA 1M5DA 5IZ1A 1FBGA 3ZKKA 3QSLA 1LBCA 2L5VA 1KWHA 1DMBA 1M5FA 4PAIA 4ELPA 3IX1A 2F6GA 4IO4A 3RT6B 4ZE9A 4QFKA 4TLMB 5ICTA 4ISUA 3KEIA 2VHAA 4OFOA 3OEMA 4EXLA 3H6TA 1UTBA 2VD3A 2XWKA 4NN3A 4U23A 1FQFA 2I0CA 2O7UA 1SDXA 2O1MA 4KCCA 1B4ZA 3EPEA 2ZXTA 4LONB 4O8MA 3E79A 3C35A 4NF4A 3H6WA 1P1QA 2AYSA 3MP8A 1LLSA 4YMAA 5L9OA 4NGUA 5BWJA 3K00A 4H8IA 4OHNA 4N8GA 1B5HA 3H6VA 4JWOA 1Y3NA 3KSJA 2I4BA 1BK4A 1MY1A 1JETA 3A3CA 1CB6A 3OSRA 4NMYA 2OLBA 1FPLA 2XXQA 4OENA 2X26A 1SW5A 3FXQA 2F35A 3D4GA 4JSDA 5I2KB 4ELQA 3FV2A 4QBAA 1JVXA 2WEFA 4HS7A 1DTZA 5JTYA 1XHYA 5TPAB 1NNTA 4MHFA 3RPWA 1KA0A 3FVKA 2CEYA 5JTYB 4U1OA 3VLVA 3KG2A 3U94A 3JV9A 3QUFA 4RPNA 3H03A 4XIGQ 3B8BA 3FXUA 3B50A 3TZAA 3PGFA 2HZKA 4X9TA 1MQDA 4EUOA 4OEVA 5AA4A 1IMCA 1SW1A 3MBPA 1OQHA 1HSEA 1B6HA 1A99A 4G68A 3K2DA 1QUJA 1H45A 1MG1A 5DEXA 3VLUA 5L9MA 1YCJA 3MP6A 1NV5A 2DP8A 1NH7A 3O66A 2ONSA 3BIGA 1YAEA 3MYUA 3VXBA 4JVDA 2NXOA 3ECRA 2CMOA 2Q9TA 1QUKA 4OESA 2H25A 1LBXA 5I59A 1QKBA 3FGSA 4P0IA 4LUBA 3SERA 4TQUQ 3IJXB 1O64A 5K2XA 4X8RA 1OVTA 1PDAA 4EF2A 2V84A 3MP1A 1VFDA 1N76A 3CVGA 3TCGA 5EQ7A 1GGGA 3W9WA 4YKIA 2YPNA 3KC0A 4RY1A 5I58A 4FEBA 3KBRA 5I2NB 1O7TA 3DP4A 3SEXA 2Y7WA 3V5AA 3KN3A 4EQ9A 3FUZA 2OZZA 1M5BA 3U8QA 4RNSA 3IB0A 5CMMA 4NF6A 4OA4A 1GVCA 4P11A 4HXVA 4R74A 5F1QA 1P1UA 1MH4A 3R7XA 1RDXA 3UK4A 1YPNA 4P0GA 4PFTA 1XS5A 1IMAA 1UIVA 1ATGA 4IO6A 3A3UA 5H8NA 1BP5A 1IEJA 4U4SA 1VE4A 2Z8FA 1JW4A 4P3LA 4BLAA 2HXRA 3T1BA 4QSDA 2H4IA 1MM6A 3DLNA 1LAFE 1EYJA 4MH5A 2P3NA 1D9VA 4LA9A 4MCOA 1P1OA 1EYKA 4XEQA 1NUZA 4H45A 1Z7ME 1LGBC 4JB7A 2RF1A 4MNPA 3D1RA 2PVUA 1EZOA 4AS5A 4C1UA 2F8DA 4M4GA 3HCQA 3BFTA 1MRPA 1N3WA 3Q28A 2RKMA 3RTWB 1OLCA 4HE1A 3B7DA 1SW2A 1NV6A 4F22A 3WAEA 1XVYA 2REJA 4NQ8A 1R9LA 3I6VA 4POXA 3V8XB 4PGPA 1N7WA 2KR0A 2V93A 2DWIA 4R2BA 4P1EA 3RLFE 2F5XA 3EHUA 3VVFA 1FJ6A 2CZKA 2F36A 5I56B 1N3XA 1Y4CA 3O97A 2XA5A 4MBPA 3Q26A 4X1BA 5DYHA 2GQ1A 4H65A 4M1VA 2Q89A 3G3IA 2CZLA 3C33A 1ELJA 1TT1A 3PV0E 2I0BA 1DK4A 5ET6A 3QAXA 3TQWA 5ET7A 2PFZA 4GX4A 3HPIA 4PFIA 1B1HA 4TOZA 2ZNTA 4KFQA 1SYHA 1US5A 4GXSB 4ZEIA 1B58A 4X04A 2QL3A 4LQ5A 3KFMA 2F97A 2E0SA 1FBDA 4PFYA 3MZ1A 2ONKE 2RCBA 2NVUB 3UA8A 2DYXA 1R6ZA 3JYRA 3FVOA 1Z7NE 4EQ7A 4QSEA 1IZ1A 4PP0A 2Y5LA 1Q1KA 5EYHA 4GWXA 4MFIA 1AL3A 3DP8A 4FBPA 1I69A 1SD3A 3M8UA 4MF3A 1FBCA 2DE2A 3QIMA 2E1SA 1QULA 1JW1A 4LZ5A 1FBFA 3LSLA 1PBPA 2OPDA 4H6DA 3O2AA 4DE8A 1TWYA 1GV8A 2WBBA 1B5IA 1FQAA 4I8CA 4RPOA 4N6PA 4E0XA 2Z8DA 3O9PA 3VFJA 1IIWA 2PT1A 4BDMA 3MWBA 1LCFA 3GYYA 3FJGA 1LAXA 1A8EA 3N6UA 5HPQA 4ZEDA 1NI9A 3KGCA 3B6TA 4PDHA 5H8HB 1FQEA 2VP1A 2OBGA 5CMKA 2XXTA 1I6BA 3BBRA 3TUSA 3H3GA 2I49A 4HTGA 4NF5B 4BDOA 1QGXA 1ANFA 1UTHB 5F7VA 2G29A 3OELA 1POY1 1FBHA 2H98A 3PUXE 3MVWA 4DXUA 2PT2A 3MVZA 4MX6A 1EZPA 1SYIA 5T3JA 4F31B 4ZEBA 1K9ZA 1NKXA 2OWSA 4U1ZA 1A7LA 1B3GA 1BTJA 3PMWA 2UVGA 4LVQA 2O1LA 4DDDA 2KQZA 4QFNA 1B52A 1IXCA 4KYDA 1MQIA 2DE4A 2NOOA 3O6GA 3RPLB 4XKRA 2QJEA 4QHQA 2B65A 4DI4B 4RA1A 1MXUA 4YKJA 3KN7A 3IB2A 3A29A 3IO6A 3MZBA 4KQPA 3LSWA 5LDZA 5I2KA 4IB2A 1H43A 2X7QA 4F1YA 3FIRA 1B1XA 2I4CA 4FEDA 1IITA 1YYZA 1FPGA 3N26A 5EQ8A 4U22A 4ELOA 5DTBA 3E13X 5EYGA 1A8FA 1Y4TA 2FA7A 4FJPA 4NE4A 1QVSA 1ZJLA 4WEPA 3UORA 2ZNSA 3MZ9A 4ZDMA 4RJZA 4LP2B 2QS2A 3S9MC 5IZ3A 1OIBA 2M8CA 3U93A 3OSQA 3K4UA 2XXVA 1LBZA 2HFBA 1MY3A 4JVCA 3B6QA 3KOSA 3PPPA 3K1NA 4OYVA 1DCUA 3FD3A 3IB1A 1ZTYA 1INPA 4H5FA 3FBPA 3B6WA 3V89B 5IM2A 5I84A 2NWJA 4IO3A 3TCFA 1GR2A 2B4LA 2O51A 2XXWA 5A5XB 4PF8A 4JXIA 3SDFA 2I48A 1JQFA 2P0SA 3H6UA 2PX1A 4I1DA 3K01A 1NUYA 1DTGA 4Z0IA 4R2FA 1FTOA 3IOWA 4FATA 5EYFA 3UIFA 1WVJA 1OLAA 4G77A 2XXYA 1FJ9A 5H8NB 4NF4B 1XT8A 2O6AA 5ESYA 4NAPA 3OO9A 4GX6A 2ONRA 4XF5A 1K9YA 1WDNA 4JWXA 1Y1ZA 3OD7A 2CZHA 4PBQA 4IY6A 4X48A 4GL8A 3EKIA 2V25A 1PB7A 1SPIA 4XXUA 4MJOA 3IOUA 3N94A 5ISUA 4PC9A 4ZEFA 4HW8A 4HE0A 3PD8A 4R75A 1VDWA 4OVSA 1LBWA 3QYTA 1EZ9A 2DVZA 2XHDA 5FBPA 1FQDA 3SEYA 5L9SA 2GHBA 3CFXA 4YKKA 2A5SA 3D4CA 1SW4A 1LAGE 1FPJA 5IZZA 3RYDA 4FE8A 2GHAA 3P7IA 1S7YA 4KHZE 4N17A 5I59B 2ZYMA 3K6VA 4GFRA 4XKQA 2P2AA 1JVYA 5I5PA 5FTIA 4PE5B 2R9JA 3SKPA 3VVEA 1Y20A 3EQ1A 4OXVA 3KZGA 4PFUA 3WAFA 4PF6A 2F3BA 2XWVA 2JJKA 4GXAA 3MUQA 5AA2D 4JSOA 3RGYA 1OQGA 4HCWA 3RNNA 4MLQA 4N91A 3ZSFA 3MC2A 1Y3QA 1PBQA 3GXAA 4KD5A 3BFUA 4U21A 2OCUA 3KC1A 3MJNA 1MPDA 4FAJA 2Y7PA 5HM4B 3NOHA 1PB9A 2GFEA 3HFUA 4FECA 1FPEA 3VVDA 2F78A 3TQLA 2DWAA 3PUZE 1IMDA 2Z22A 1L5TA 5CI5A 3RY3A 1MH3A 1HSLA 4IY5A 4R73A 3K1MA 2OK2A 1JW5A 1VR5A 3K6WA 2O68A 1GTKA 1UIUA 3OXNA 2PCRA 4JDFA 3I5OA 2FIEA 5KZTA 3KJTA 3KBZA 1TFDA 3A09A 4DI3D 4Q0CA 5HBCA 3TEPA 1SI0A 2XXRA 1FW0A 3IORA 4QXDA 3CG3A 5J1DA 4PDDA 3TMGA 1Y3PA 3Q25A 3G3JA 5IKBA 2FBPA 3IO4A 3U72A 4YAHX 1D9YA 2HAUA 4G2ZA 1G0HA 1LBBA 1FTLA 1USYE 2RC8A 1B3HA 1Y9UA 3EF7A 2QVRA 5EQ9A 4ONYA 4F3GA 5A5XA 4QFPA 3M3FA 1P1WA 1P1NA 4MAGA 5H8HA 2Q8JA 1MS7A 4JVIA 2ZZVA 5KDTB 4IGRA 3PUWE 5IAIA 4TLLB 5AA1A 3CR9A 1TXFA 1MY4A 1R9QA 1LBYA 2OPEA 1MQHA 4NEDA 3PTYA 3FXBA 1N04A 4PETA 3U65A 5A5LA 5KCJA 4AB5A 4ECFA 4ESWA 2WYPA 1MXXA 3MSTA 3IFAA 3E9XA 3E3KA 1RDYA 1CE2A 4G61A 2AL4A 4ZECA 3PPQA 2BJIA 4OVJA 4G8MA 2R8TA 3CI8A 3TTNA 2WX9A 1XVXA 3TYHA 4FORA 4R6YA 1HSJA 1B3LA 4NX1A 3CHGA 2OX3A 2UYFA 3FATA 3ONMA 5I7IA 2PBWA 5H8QA 1Y1MA 4PFRA 4IGTA 1LAHE 3L6HA 3HN0A 4MMPA 4IR8A 4XKNA 1NV0A 4JWYA 3Q27A 4ZZEA 4R72A 1DOTA 1FTMA 3PPRA 2F7AA 5IZ3B 4O3CA 4EF1A 1B3EA 4N81A 3QMFA 4YZZA 5H8QB 3FVNA 3BKIB 1A40A 3IR1A 4MNCA 2FVZA 3E78A 3Q29A 4BDLA 4DLDA 4MLVA 4ESXA 4DZ1A 1NH8A 3TTLA 4HE2A 3T0JA 3BIHA 3F11A 3PUVE 3LBSA 5AA2B 4WKMA 3C4MA 3UGWA 3H4ZA 4WXJA 3CIJA 4PQJA 1POTA 3TAJA 4RYAA 3T93B 2DQVA 3G3FA 1XOCA 4N8YA 2UVJA 4THIA 1MXVA 3C9HA 3ODBA 4G8HA 3C32A 3SZPA 4LZ8A 5I56A 1EYIA 2H9BA 1MXYA 4PBHA 5AA4B 3T9XB 2GH9A 4GWOA 2Y7IA 2MKZA 3K02A 2H99A 4ELRA 3TELA 4MEVA 4ZS9A 1FPBA 4YMBA 5JK4A 1MY0A 1S9TA 1O63A 2XXIA 2V3TA 3ILUB 1CNQA 1FPFA 2HAVA 1EH3A 2GRVA 4ZZAA 2DXYA 3CFZA 2XX8A 3PPOA 3IL1B 2A5TA 2ZZWA 4WEDA 1NMUA 2P1SA 3PU5A 3C31A 4XKPA 1JNFA 3W9VA 3R6UA 4LN5A 5L8DA 4RXLA 4MNIA 1FPIA 4GBVA 4RK9A 3C34A 3K1PA 4UABA 1URSA 4GQOA 2AIXA 4QF9A 2CEXA 3FVGA 2QPQA 1LB9A 3CRBA 3OMBA 3ROJA 1NV4A 4GRKA 3VDFA 3PPNA 1UQWA 1LFGA 1P99A 3L6GA 5TP9B 5LTCA 2ZZXA 1LFIA 5DVIA 1FRPA 3S9NC 5CBRA 1B7HA 1MQGA 1FTJA 1R1NA 1BKAA 3IK6B 3TPAA 4GF8A 2Q2CA 2HEUA 2V3QA 5KCJB 1XI6A 4I40A 4NF8B 4GIZA 3OO8A 2O7IA 1IXGA 4GWZA 4NHBA 3S4UA 1OVBA 4YU0A 4OTEA 3LUZA 1B2HA 1IQ7A 3T9UA 5F24A 1NV1A 4LATA 2R71A 2XXHA 1MPCA 2LAOA 3MPLA 1MQJA 2Y7RA 4Q8RA 1KZ8A 5H8SA 1MM7A 4PE3A 5ET5A 2HPGA
chains in the Genus database with same CATH topology
1EYJA 2JJKA 4GX3A 2XXKA 4LN5A 4PAFA 3W9VA 4N81A 3U65A 3QMFA 4AS4A 4MNIA 1IMCA 1FPIA 2P3NA 4PFBA 4YZZA 5T3JA 4O94A 1IMFA 4MCOA 1K9ZA 4GBVA 2QVRA 1EYKA 4MNCA 2FVZA 5EQ9A 2XWKA 1Q9DA 4NN3A 4UABA 3E78A 4XEQA 2Q8MA 4P8BA 1NUZA 4HCWA 4H46A 1FBEA 2CEXA 4N91A 1NUYA 2QFLA 4H45A 1JP4A 2QPQA 2KQZA 4YICA 4MIJA 4MAGA 1NUWA 4F1VA 4MNPA 2Q74A 2Y5LA 4P56A 3D1RA 4PBHA 1NV5A 5EQAA 4AS5A 3E79A 2HZLA 5EYHA 4OANA 4GWXA 3BIGA 3IFCA 1NUXA 2HHMA 4HE2A 3ROJA 3MYUA 4JVIA 3T0JA 2DE4A 1LBVA 1NV4A 2ZZVA 4JVDA 2DDKA 3BIHA 4FBPA 4PCDA 4PGNA 3KC1A 4F1UA 4N4UA 5CM6A 3RPLB 2Q9TA 1FBCA 2QVUA 4HE1A 4N15A 3NOHA 1LBXA 4DI4B 4MX6A 2DE2A 4PTKA 1FJ9A 1NV6A 3HFUA 4PF8A 4NGUA 1FPEA 4N6KA 2P3VA 3A29A 1FBFA 4PAKA 4I3YA 1IMDA 5LTCA 5ESYA 4N8GA 1LBYA 4GWWA 5LDZA 4NAPA 4NQ8A 4OVRA 4X8RA 4NF0A 4GX6A 2WBDA 2V4CA 2ZZXA 4N8YA 4P1LA 2VPNA 3FXBA 3PTYA 4NG7A 4PETA 1K9YA 4XF5A 4N6DA 5A5LA 1FRPA 2WBBA 4HCYA 4NX1A 4PGPA 1BK4A 2KR0A 1NV2A 2WYPA 4MEVA 1YYZA 3MSTA 4P9KA 4NHBA 1FPGA 2CZHA 5EQ7A 2PCRA 3SZPA 4PBQA 4P1EA 3IFAA 1IMBA 4OVPA 5EQ8A 5DW8A 2F5XA 3EKIA 1FPLA 3W9WA 1EYIA 2FIEA 2V3QA 2XWOA 1XI6A 1FJ6A 1YZ0A 3KC0A 1RDYA 1SPIA 2CZKA 4GWYA 4I40A 4G61A 4MJOA 5EYGA 2DE3A 5J16A 2CZIA 4F18A 4PC9A 3KBZA 1G0IA 4HE0A 2Y5KA 3GYYA 2MKZA 2BJIA 4KXPA 4DI3D 2XWIA 2R8TA 2FIXA 2XA5A 1VDWA 5I3SA 4OVSA 2WX9A 1LBWA 1FTAA 1D9QA 2HZKA 4O8MA 1NI9A 2GQ1A 4QBAA 5IZ3A 4I3EA 2DVZA 1DBZA 1FPDA 1KA1A 4GWZA 4M1VA 3CHGA 2OWZA 2OX3A 5FBPA 2WEFA 3RPLA 1FPKA 4QXDA 4OA4A 4F19A 1LBZA 4HXVA 5I7IA 5J1DA 2F3DA 4PDDA 2PFYA 3ISPA 4JVCA 1RDXA 1FPBA 4O7MA 5JK4A 4PFRA 1IMEA 1YXIA 5IGAA 1RDZA 1FPJA 1IMAA 1FBGA 5IZ1A 1FSAA 4MHFA 4P47A 3RYDA 5IZZA 1DCUA 1DK4A 5ET6A 4PDHA 3LUZA 1INPA 4XFEA 1CNQA 1FPFA 1KA0A 1LEVA 3FBPA 1QGXA 4O7IA 5ET7A 5F24A 2CEYA 2L5VA 2PFZA 4MMPA 4N17A 2FBPA 1NV1A 4GX4A 5ET8A 4PFIA 5IM2A 2WYKA 2FHYA 4GWUA 4PAIA 4GBWA 4IR8A 4P3LA 1FBPA 4X04A 5I5PA 1NV3A 1NV0A 2VT5A 2B4MA 2VPOA 2ZZWA 1G0HA 2B4LA 3B8BA 1FBHA 1KZ8A 2HXRA 3T1BA 1FBDA 1NV7A 4GWSA 4OVTA 4PF6A 4OVQA 3LV0A 3B50A 2QVVA 2F3BA 5IZ3B 4PE3A 5ET5A 2HPGA 2XWVA 4X9TA 1AWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYJ A;  2JJK A;  4GX3 A;  4N81 A;  3QMF A;  4AS4 A;  1IMC A;  1FPI A;  2P3N A;  5T3J A;  1IMF A;  1K9Z A;  4GBV A;  2QVR A;  1EYK A;  2FVZ A;  5EQ9 A;  1Q9D A;  2Q8M A;  1NUZ A;  4H46 A;  1FBE A;  1NUY A;  2QFL A;  4H45 A;  1JP4 A;  1NUW A;  2Q74 A;  2Y5L A;  3D1R A;  1NV5 A;  5EQA A;  4AS5 A;  5EYH A;  4GWX A;  3BIG A;  3IFC A;  1NUX A;  2HHM A;  4HE2 A;  3ROJ A;  3T0J A;  1LBV A;  1NV4 A;  2DDK A;  3BIH A;  4FBP A;  3KC1 A;  3RPL B;  1FBC A;  2QVU A;  4HE1 A;  1LBX A;  4PTK A;  1FJ9 A;  1NV6 A;  1FPE A;  2P3V A;  3A29 A;  1FBF A;  4I3Y A;  1IMD A;  5ESY A;  1LBY A;  4GWW A;  5LDZ A;  4GX6 A;  2WBD A;  1K9Y A;  5A5L A;  1FRP A;  2WBB A;  1BK4 A;  1NV2 A;  1YYZ A;  1FPG A;  2CZH A;  5EQ7 A;  2PCR A;  3IFA A;  1IMB A;  5EQ8 A;  5DW8 A;  1FPL A;  1EYI A;  2FIE A;  1XI6 A;  1FJ6 A;  1YZ0 A;  3KC0 A;  1RDY A;  1SPI A;  2CZK A;  4GWY A;  4I40 A;  4G61 A;  4MJO A;  5EYG A;  5J16 A;  2CZI A;  3KBZ A;  1G0I A;  4HE0 A;  2Y5K A;  2BJI A;  4KXP A;  2R8T A;  2FIX A;  1VDW A;  5I3S A;  1LBW A;  1FTA A;  1D9Q A;  1NI9 A;  2GQ1 A;  5IZ3 A;  4I3E A;  1DBZ A;  1FPD A;  1KA1 A;  4GWZ A;  2OWZ A;  2OX3 A;  5FBP A;  2WEF A;  3RPL A;  1FPK A;  4QXD A;  1LBZ A;  4HXV A;  2F3D A;  1RDX A;  1FPB A;  1IME A;  1YXI A;  1RDZ A;  1FPJ A;  1IMA A;  1FBG A;  5IZ1 A;  1FSA A;  3RYD A;  1DCU A;  1DK4 A;  5ET6 A;  3LUZ A;  1INP A;  1CNQ A;  1FPF A;  1KA0 A;  1LEV A;  3FBP A;  1QGX A;  4O7I A;  5ET7 A;  5F24 A;  2FBP A;  1NV1 A;  4GX4 A;  5ET8 A;  2FHY A;  4GWU A;  4GBW A;  4IR8 A;  1FBP A;  1NV3 A;  1NV0 A;  2VT5 A;  1G0H A;  3B8B A;  1FBH A;  1KZ8 A;  1FBD A;  1NV7 A;  4GWS A;  3LV0 A;  2QVV A;  2F3B A;  5IZ3 B;  5ET5 A;  1AWB A; 
#chains in the Genus database with same CATH topology
 4GX3 A;  4N13 A;  4AS4 A;  5KDT A;  3T22 A;  3SES A;  1JEU A;  3HHF A;  3N5L A;  1Q9D A;  5ITO A;  2ESN A;  4YIC A;  4MIJ A;  3LSX A;  1NUW A;  1YTV A;  1I6A A;  1EU8 A;  1RKM A;  1NNF A;  3EHT A;  2HHM A;  4OET A;  4EQB A;  4FIM A;  1ZLQ A;  4GLI A;  4AQ4 A;  4DCX A;  3CG1 A;  4LZ7 A;  1ZKB A;  3FXR A;  1SQY A;  2Z8E A;  4BDN A;  3SET A;  4GWW A;  1AH5 A;  4DIG A;  1B3F A;  1WOD A;  3OO7 A;  3T66 A;  4ZE8 A;  1B32 A;  2YJP A;  4OQO A;  1NV2 A;  5I2N A;  1OMP A;  5FHM A;  3W15 C;  5I58 B;  2D5W A;  1IMB A;  1AMF A;  1B4H A;  1YZ0 A;  2OJT A;  3RN8 A;  2THI A;  3THI A;  4OFJ A;  1JEV A;  4H8J A;  4UAC A;  4F2Q A;  5H8F A;  4G68 C;  1FTA A;  4KYE A;  1MPB A;  3S2V A;  4I3E A;  1SBP A;  4E0W A;  2XX9 A;  1A55 A;  1Q35 A;  1MY2 A;  1YXI A;  1RDZ A;  2RCA A;  1AOV A;  2UXA A;  2F7B A;  1M5C A;  4O7I A;  2B4M A;  2VPO A;  2V3U A;  3PD9 A;  2QSX A;  1H76 A;  5H8F B;  3GBA A;  3MW0 A;  1ZBM A;  2H5Y A;  1N7X A;  3LUY A;  3S9E A;  3RQT A;  3HHG A;  4R9G A;  2XX7 A;  5FTH A;  1QJM A;  4YB7 A;  1ZIU A;  2Q8M A;  4P8B A;  3LSF B;  3VXC A;  3EN3 A;  4H46 A;  2OWT A;  1US4 A;  5M2V A;  1QUI A;  4YB6 A;  2Q74 A;  1MDQ A;  2HZL A;  2XD2 A;  2QS1 A;  2ZYK A;  4Q30 B;  4N15 A;  1PC3 A;  2UVI A;  2ZYN A;  1PB8 A;  4QRZ A;  4OWD A;  3T96 B;  1PEB A;  2WBD A;  3TOD A;  4IO5 A;  5LOM A;  1D3K A;  3QK6 A;  4GD5 A;  4C1T A;  1QKA A;  2XWO A;  4NWD A;  4GWY A;  3UP9 A;  2DE3 A;  4BDQ A;  2F6P A;  1URG A;  4QFO A;  1MDP 1;  2XWI A;  2FIX A;  1TFA A;  1B9J A;  2X7P A;  1BLF A;  3DP6 A;  2UVH A;  4F3S A;  2ANJ A;  1USY H;  4POW A;  2VGQ A;  5IGA A;  2A5T B;  4P47 A;  3DEL B;  1FSA A;  4GOT A;  2D21 A;  1LCT A;  5B7D A;  3AXF A;  4PGN A;  3O6H A;  4I62 A;  2I3V A;  1NFT A;  2G93 A;  4OEU A;  5AE4 A;  3FJ7 A;  2B3F A;  1NV7 A;  3CSB A;  2XXX A;  4OVQ A;  2VD2 A;  4H67 A;  1AWB A;  3DM0 A;  2XXK A;  4PAF A;  4KPT A;  3TCH A;  5FHN A;  5I57 B;  3R26 A;  3GLB A;  5ELV A;  1B0L A;  4F3P A;  3OEN A;  1ZU0 A;  4F1V A;  3FJM A;  5CC2 A;  2F7C A;  2NUV A;  1NUX A;  4OFL A;  2DDK A;  4PCD A;  2I6E A;  3OOA A;  4F1U A;  5CM6 A;  4NF5 A;  2FYI A;  2DS9 A;  1B7Z A;  1D4N A;  2QVU A;  5K2Y A;  3O29 A;  1BIY A;  5DVF A;  4DXC A;  4N6K A;  4NWC A;  4NTL A;  2VOZ A;  3G3H A;  3SEV A;  2IA4 A;  2PMS A;  2ALU A;  4OVR A;  2DVC A;  3LC8 A;  2I3W A;  4AB6 A;  3IAZ A;  5B70 A;  2F34 A;  2XD3 A;  2Z23 A;  3GBB A;  2DOJ A;  3H06 B;  2O69 A;  1FTK A;  3C36 A;  3PMX A;  4XFE A;  3MVY A;  4EDP A;  5J16 A;  3TFL A;  1F9B A;  3TDJ A;  2Y5K A;  1M5E A;  3MAM A;  2DWH A;  2HCA A;  4U4X A;  4KCD A;  4O3A A;  4YKP A;  1MXZ A;  2RC7 A;  1FCK A;  3RT8 A;  1KA1 A;  1IXH A;  3RPL A;  1II5 A;  2PFY A;  3ISP A;  1NNP A;  3VV5 A;  2PYY A;  3S9L C;  5TPA A;  3M3L A;  5TP9 A;  2BJJ X;  1VFE A;  2RC9 A;  4LQ2 A;  1ZMG A;  1A54 A;  2QMX A;  3KOT A;  2UYE A;  4NF8 A;  1B0H A;  3M3K A;  4OVT A;  3T9H B;  3LV0 A;  2QVV A;  5EHM A;  1QW0 A;  1DPE A;  4G4P A;  3TTR A;  4O94 A;  1IMF A;  3G3G A;  1B5J A;  4N07 A;  1FBE A;  1NL5 A;  3O28 A;  3HV1 A;  2QRY A;  4H5G A;  4P56 A;  1RYO A;  5EQA A;  4F29 A;  5DVJ A;  1T0K A;  1UTB B;  3IJO B;  4OZ9 A;  1LFH A;  1SVX B;  2YLN A;  4C0R A;  4PTK A;  3MVX A;  2ZNU A;  2Q88 A;  3K6U A;  4I3Y A;  4YB5 A;  2XXU A;  4P1L A;  4IO2 A;  2VPN A;  4NG7 A;  4EXK A;  3FAS A;  1H44 A;  2O84 X;  3FZV A;  4P9K A;  2IEE A;  4QFL A;  2WKY A;  1J1N A;  2R6G E;  5I57 A;  1H3D A;  2AL5 A;  4XTC Q;  2CZI A;  3E4R A;  4KXP A;  4F2O A;  1VSO A;  4Q5T A;  3TKD A;  1D9Q A;  1FPD A;  2HQ0 A;  3MPK A;  3MQ9 A;  4OMB A;  4F19 A;  1FQC A;  1SI1 A;  4R6K A;  3V83 A;  1AIV A;  2I58 A;  3G3K A;  3ZKL A;  3OEK A;  3T9V A;  4DCY A;  4H1X A;  5ET8 A;  4H0W A;  2WYK A;  4GWU A;  5CBS A;  3K6X A;  4QSC A;  1B40 A;  3VE1 B;  4R6H A;  4PFW A;  4GWS A;  4X1D A;  3ZS6 A;  4F18 A;  3CFL A;  3CSG A;  4RK2 A;  1FQB A;  4KYS A;  3RTF B;  1LB8 A;  3LR1 A;  1B7U A;  5BUU A;  3HO7 A;  3UN6 A;  4L17 A;  3U92 A;  2QFL A;  1JP4 A;  3IOT A;  2Y7K A;  4OAN A;  3IFC A;  4JBZ A;  1LBV A;  1IUD A;  1N84 A;  4F39 A;  5EHS A;  5ITP A;  3SEU A;  1S50 A;  2P3V A;  4ND9 A;  4IO7 A;  5FHO A;  2V4C A;  1UTH A;  3FV1 A;  4N6D A;  4HCY A;  1LST A;  5JEI A;  1DPP A;  5DW8 A;  3KN8 A;  1IXI A;  1URD A;  3QXM A;  2B3B A;  4K3F A;  1N0T A;  3KJ7 A;  1G0I A;  3TTM A;  2KLF A;  4BDR A;  2QS3 A;  5I3S A;  2HXW A;  1DBZ A;  1FPK A;  4R9F A;  1B05 A;  2F3D A;  4O7M A;  3KSX A;  1IME A;  3U1O A;  4Z7E A;  1LEV A;  2Q2A A;  5CRY A;  4F3B A;  3OO6 A;  2FHY A;  4GBW A;  2Y84 A;  2W7Y A;  1FBP A;  1NV3 A;  2DWJ A;  2VT5 A;  5DEX B;  2D3I A;  3RUM A;  3N6T A;  1I6Q A;  3SEW A;  2ZYO A;  5CMB A;  4PFB A;  4KI0 E;  3GZG A;  5ICQ A;  1B46 A;  3HST A;  5TU0 A;  2FNC A;  2RIN A;  3TTK A;  4KR5 A;  2XXP A;  3USD A;  3EHS A;  3PMV A;  2DXR A;  2DSF A;  3QUJ A;  3K0V A;  1XC1 A;  2QMW A;  4N4U A;  4OER A;  5CMC A;  2REG A;  3JZJ A;  3IOV A;  3H7M A;  3PUY E;  4G8N A;  1B51 A;  4GVO A;  4PAK A;  2ZMB A;  4I9D A;  4U2R A;  1NNK A;  5AA3 A;  5AA2 A;  4OVP A;  4O3B A;  3ILT B;  4DXB A;  4NF0 A;  3I3V A;  4NF6 B;  4G68 B;  4GL0 A;  1DSN A;  3VLW A;  1MXW A;  5DT6 A;  2OWZ A;  1RYX A;  4ZEK A;  2QS4 A;  4UA8 A;  2ABH A;  3G7W A;  3O6I A;  1M5D A;  5IZ1 A;  1FBG A;  3ZKK A;  3QSL A;  1LBC A;  2L5V A;  1KWH A;  1DMB A;  1M5F A;  4PAI A;  4ELP A;  3IX1 A;  2F6G A;  4IO4 A;  3RT6 B;  4ZE9 A;  4QFK A;  4TLM B;  5ICT A;  4ISU A;  3KEI A;  2VHA A;  4OFO A;  3OEM A;  4EXL A;  3H6T A;  1UTB A;  2VD3 A;  2XWK A;  4NN3 A;  4U23 A;  1FQF A;  2I0C A;  2O7U A;  1SDX A;  2O1M A;  4KCC A;  1B4Z A;  3EPE A;  2ZXT A;  4LON B;  4O8M A;  3E79 A;  3C35 A;  4NF4 A;  3H6W A;  1P1Q A;  2AYS A;  3MP8 A;  1LLS A;  4YMA A;  5L9O A;  4NGU A;  5BWJ A;  3K00 A;  4H8I A;  4OHN A;  4N8G A;  1B5H A;  3H6V A;  4JWO A;  1Y3N A;  3KSJ A;  2I4B A;  1BK4 A;  1MY1 A;  1JET A;  3A3C A;  1CB6 A;  3OSR A;  4NMY A;  2OLB A;  1FPL A;  2XXQ A;  4OEN A;  2X26 A;  1SW5 A;  3FXQ A;  2F35 A;  3D4G A;  4JSD A;  5I2K B;  4ELQ A;  3FV2 A;  4QBA A;  1JVX A;  2WEF A;  4HS7 A;  1DTZ A;  5JTY A;  1XHY A;  5TPA B;  1NNT A;  4MHF A;  3RPW A;  1KA0 A;  3FVK A;  2CEY A;  5JTY B;  4U1O A;  3VLV A;  3KG2 A;  3U94 A;  3JV9 A;  3QUF A;  4RPN A;  3H03 A;  4XIG Q;  3B8B A;  3FXU A;  3B50 A;  3TZA A;  3PGF A;  2HZK A;  4X9T A;  1MQD A;  4EUO A;  4OEV A;  5AA4 A;  1IMC A;  1SW1 A;  3MBP A;  1OQH A;  1HSE A;  1B6H A;  1A99 A;  4G68 A;  3K2D A;  1QUJ A;  1H45 A;  1MG1 A;  5DEX A;  3VLU A;  5L9M A;  1YCJ A;  3MP6 A;  1NV5 A;  2DP8 A;  1NH7 A;  3O66 A;  2ONS A;  3BIG A;  1YAE A;  3MYU A;  3VXB A;  4JVD A;  2NXO A;  3ECR A;  2CMO A;  2Q9T A;  1QUK A;  4OES A;  2H25 A;  1LBX A;  5I59 A;  1QKB A;  3FGS A;  4P0I A;  4LUB A;  3SER A;  4TQU Q;  3IJX B;  1O64 A;  5K2X A;  4X8R A;  1OVT A;  1PDA A;  4EF2 A;  2V84 A;  3MP1 A;  1VFD A;  1N76 A;  3CVG A;  3TCG A;  5EQ7 A;  1GGG A;  3W9W A;  4YKI A;  2YPN A;  3KC0 A;  4RY1 A;  5I58 A;  4FEB A;  3KBR A;  5I2N B;  1O7T A;  3DP4 A;  3SEX A;  2Y7W A;  3V5A A;  3KN3 A;  4EQ9 A;  3FUZ A;  2OZZ A;  1M5B A;  3U8Q A;  4RNS A;  3IB0 A;  5CMM A;  4NF6 A;  4OA4 A;  1GVC A;  4P11 A;  4HXV A;  4R74 A;  5F1Q A;  1P1U A;  1MH4 A;  3R7X A;  1RDX A;  3UK4 A;  1YPN A;  4P0G A;  4PFT A;  1XS5 A;  1IMA A;  1UIV A;  1ATG A;  4IO6 A;  3A3U A;  5H8N A;  1BP5 A;  1IEJ A;  4U4S A;  1VE4 A;  2Z8F A;  1JW4 A;  4P3L A;  4BLA A;  2HXR A;  3T1B A;  4QSD A;  2H4I A;  1MM6 A;  3DLN A;  1LAF E;  1EYJ A;  4MH5 A;  2P3N A;  1D9V A;  4LA9 A;  4MCO A;  1P1O A;  1EYK A;  4XEQ A;  1NUZ A;  4H45 A;  1Z7M E;  1LGB C;  4JB7 A;  2RF1 A;  4MNP A;  3D1R A;  2PVU A;  1EZO A;  4AS5 A;  4C1U A;  2F8D A;  4M4G A;  3HCQ A;  3BFT A;  1MRP A;  1N3W A;  3Q28 A;  2RKM A;  3RTW B;  1OLC A;  4HE1 A;  3B7D A;  1SW2 A;  1NV6 A;  4F22 A;  3WAE A;  1XVY A;  2REJ A;  4NQ8 A;  1R9L A;  3I6V A;  4POX A;  3V8X B;  4PGP A;  1N7W A;  2KR0 A;  2V93 A;  2DWI A;  4R2B A;  4P1E A;  3RLF E;  2F5X A;  3EHU A;  3VVF A;  1FJ6 A;  2CZK A;  2F36 A;  5I56 B;  1N3X A;  1Y4C A;  3O97 A;  2XA5 A;  4MBP A;  3Q26 A;  4X1B A;  5DYH A;  2GQ1 A;  4H65 A;  4M1V A;  2Q89 A;  3G3I A;  2CZL A;  3C33 A;  1ELJ A;  1TT1 A;  3PV0 E;  2I0B A;  1DK4 A;  5ET6 A;  3QAX A;  3TQW A;  5ET7 A;  2PFZ A;  4GX4 A;  3HPI A;  4PFI A;  1B1H A;  4TOZ A;  2ZNT A;  4KFQ A;  1SYH A;  1US5 A;  4GXS B;  4ZEI A;  1B58 A;  4X04 A;  2QL3 A;  4LQ5 A;  3KFM A;  2F97 A;  2E0S A;  1FBD A;  4PFY A;  3MZ1 A;  2ONK E;  2RCB A;  2NVU B;  3UA8 A;  2DYX A;  1R6Z A;  3JYR A;  3FVO A;  1Z7N E;  4EQ7 A;  4QSE A;  1IZ1 A;  4PP0 A;  2Y5L A;  1Q1K A;  5EYH A;  4GWX A;  4MFI A;  1AL3 A;  3DP8 A;  4FBP A;  1I69 A;  1SD3 A;  3M8U A;  4MF3 A;  1FBC A;  2DE2 A;  3QIM A;  2E1S A;  1QUL A;  1JW1 A;  4LZ5 A;  1FBF A;  3LSL A;  1PBP A;  2OPD A;  4H6D A;  3O2A A;  4DE8 A;  1TWY A;  1GV8 A;  2WBB A;  1B5I A;  1FQA A;  4I8C A;  4RPO A;  4N6P A;  4E0X A;  2Z8D A;  3O9P A;  3VFJ A;  1IIW A;  2PT1 A;  4BDM A;  3MWB A;  1LCF A;  3GYY A;  3FJG A;  1LAX A;  1A8E A;  3N6U A;  5HPQ A;  4ZED A;  1NI9 A;  3KGC A;  3B6T A;  4PDH A;  5H8H B;  1FQE A;  2VP1 A;  2OBG A;  5CMK A;  2XXT A;  1I6B A;  3BBR A;  3TUS A;  3H3G A;  2I49 A;  4HTG A;  4NF5 B;  4BDO A;  1QGX A;  1ANF A;  1UTH B;  5F7V A;  2G29 A;  3OEL A;  1POY 1;  1FBH A;  2H98 A;  3PUX E;  3MVW A;  4DXU A;  2PT2 A;  3MVZ A;  4MX6 A;  1EZP A;  1SYI A;  5T3J A;  4F31 B;  4ZEB A;  1K9Z A;  1NKX A;  2OWS A;  4U1Z A;  1A7L A;  1B3G A;  1BTJ A;  3PMW A;  2UVG A;  4LVQ A;  2O1L A;  4DDD A;  2KQZ A;  4QFN A;  1B52 A;  1IXC A;  4KYD A;  1MQI A;  2DE4 A;  2NOO A;  3O6G A;  3RPL B;  4XKR A;  2QJE A;  4QHQ A;  2B65 A;  4DI4 B;  4RA1 A;  1MXU A;  4YKJ A;  3KN7 A;  3IB2 A;  3A29 A;  3IO6 A;  3MZB A;  4KQP A;  3LSW A;  5LDZ A;  5I2K A;  4IB2 A;  1H43 A;  2X7Q A;  4F1Y A;  3FIR A;  1B1X A;  2I4C A;  4FED A;  1IIT A;  1YYZ A;  1FPG A;  3N26 A;  5EQ8 A;  4U22 A;  4ELO A;  5DTB A;  3E13 X;  5EYG A;  1A8F A;  1Y4T A;  2FA7 A;  4FJP A;  4NE4 A;  1QVS A;  1ZJL A;  4WEP A;  3UOR A;  2ZNS A;  3MZ9 A;  4ZDM A;  4RJZ A;  4LP2 B;  2QS2 A;  3S9M C;  5IZ3 A;  1OIB A;  2M8C A;  3U93 A;  3OSQ A;  3K4U A;  2XXV A;  1LBZ A;  2HFB A;  1MY3 A;  4JVC A;  3B6Q A;  3KOS A;  3PPP A;  3K1N A;  4OYV A;  1DCU A;  3FD3 A;  3IB1 A;  1ZTY A;  1INP A;  4H5F A;  3FBP A;  3B6W A;  3V89 B;  5IM2 A;  5I84 A;  2NWJ A;  4IO3 A;  3TCF A;  1GR2 A;  2B4L A;  2O51 A;  2XXW A;  5A5X B;  4PF8 A;  4JXI A;  3SDF A;  2I48 A;  1JQF A;  2P0S A;  3H6U A;  2PX1 A;  4I1D A;  3K01 A;  1NUY A;  1DTG A;  4Z0I A;  4R2F A;  1FTO A;  3IOW A;  4FAT A;  5EYF A;  3UIF A;  1WVJ A;  1OLA A;  4G77 A;  2XXY A;  1FJ9 A;  5H8N B;  4NF4 B;  1XT8 A;  2O6A A;  5ESY A;  4NAP A;  3OO9 A;  4GX6 A;  2ONR A;  4XF5 A;  1K9Y A;  1WDN A;  4JWX A;  1Y1Z A;  3OD7 A;  2CZH A;  4PBQ A;  4IY6 A;  4X48 A;  4GL8 A;  3EKI A;  2V25 A;  1PB7 A;  1SPI A;  4XXU A;  4MJO A;  3IOU A;  3N94 A;  5ISU A;  4PC9 A;  4ZEF A;  4HW8 A;  4HE0 A;  3PD8 A;  4R75 A;  1VDW A;  4OVS A;  1LBW A;  3QYT A;  1EZ9 A;  2DVZ A;  2XHD A;  5FBP A;  1FQD A;  3SEY A;  5L9S A;  2GHB A;  3CFX A;  4YKK A;  2A5S A;  3D4C A;  1SW4 A;  1LAG E;  1FPJ A;  5IZZ A;  3RYD A;  4FE8 A;  2GHA A;  3P7I A;  1S7Y A;  4KHZ E;  4N17 A;  5I59 B;  2ZYM A;  3K6V A;  4GFR A;  4XKQ A;  2P2A A;  1JVY A;  5I5P A;  5FTI A;  4PE5 B;  2R9J A;  3SKP A;  3VVE A;  1Y20 A;  3EQ1 A;  4OXV A;  3KZG A;  4PFU A;  3WAF A;  4PF6 A;  2F3B A;  2XWV A;  2JJK A;  4GXA A;  3MUQ A;  5AA2 D;  4JSO A;  3RGY A;  1OQG A;  4HCW A;  3RNN A;  4MLQ A;  4N91 A;  3ZSF A;  3MC2 A;  1Y3Q A;  1PBQ A;  3GXA A;  4KD5 A;  3BFU A;  4U21 A;  2OCU A;  3KC1 A;  3MJN A;  1MPD A;  4FAJ A;  2Y7P A;  5HM4 B;  3NOH A;  1PB9 A;  2GFE A;  3HFU A;  4FEC A;  1FPE A;  3VVD A;  2F78 A;  3TQL A;  2DWA A;  3PUZ E;  1IMD A;  2Z22 A;  1L5T A;  5CI5 A;  3RY3 A;  1MH3 A;  1HSL A;  4IY5 A;  4R73 A;  3K1M A;  2OK2 A;  1JW5 A;  1VR5 A;  3K6W A;  2O68 A;  1GTK A;  1UIU A;  3OXN A;  2PCR A;  4JDF A;  3I5O A;  2FIE A;  5KZT A;  3KJT A;  3KBZ A;  1TFD A;  3A09 A;  4DI3 D;  4Q0C A;  5HBC A;  3TEP A;  1SI0 A;  2XXR A;  1FW0 A;  3IOR A;  4QXD A;  3CG3 A;  5J1D A;  4PDD A;  3TMG A;  1Y3P A;  3Q25 A;  3G3J A;  5IKB A;  2FBP A;  3IO4 A;  3U72 A;  4YAH X;  1D9Y A;  2HAU A;  4G2Z A;  1G0H A;  1LBB A;  1FTL A;  1USY E;  2RC8 A;  1B3H A;  1Y9U A;  3EF7 A;  2QVR A;  5EQ9 A;  4ONY A;  4F3G A;  5A5X A;  4QFP A;  3M3F A;  1P1W A;  1P1N A;  4MAG A;  5H8H A;  2Q8J A;  1MS7 A;  4JVI A;  2ZZV A;  5KDT B;  4IGR A;  3PUW E;  5IAI A;  4TLL B;  5AA1 A;  3CR9 A;  1TXF A;  1MY4 A;  1R9Q A;  1LBY A;  2OPE A;  1MQH A;  4NED A;  3PTY A;  3FXB A;  1N04 A;  4PET A;  3U65 A;  5A5L A;  5KCJ A;  4AB5 A;  4ECF A;  4ESW A;  2WYP A;  1MXX A;  3MST A;  3IFA A;  3E9X A;  3E3K A;  1RDY A;  1CE2 A;  4G61 A;  2AL4 A;  4ZEC A;  3PPQ A;  2BJI A;  4OVJ A;  4G8M A;  2R8T A;  3CI8 A;  3TTN A;  2WX9 A;  1XVX A;  3TYH A;  4FOR A;  4R6Y A;  1HSJ A;  1B3L A;  4NX1 A;  3CHG A;  2OX3 A;  2UYF A;  3FAT A;  3ONM A;  5I7I A;  2PBW A;  5H8Q A;  1Y1M A;  4PFR A;  4IGT A;  1LAH E;  3L6H A;  3HN0 A;  4MMP A;  4IR8 A;  4XKN A;  1NV0 A;  4JWY A;  3Q27 A;  4ZZE A;  4R72 A;  1DOT A;  1FTM A;  3PPR A;  2F7A A;  5IZ3 B;  4O3C A;  4EF1 A;  1B3E A;  4N81 A;  3QMF A;  4YZZ A;  5H8Q B;  3FVN A;  3BKI B;  1A40 A;  3IR1 A;  4MNC A;  2FVZ A;  3E78 A;  3Q29 A;  4BDL A;  4DLD A;  4MLV A;  4ESX A;  4DZ1 A;  1NH8 A;  3TTL A;  4HE2 A;  3T0J A;  3BIH A;  3F11 A;  3PUV E;  3LBS A;  5AA2 B;  4WKM A;  3C4M A;  3UGW A;  3H4Z A;  4WXJ A;  3CIJ A;  4PQJ A;  1POT A;  3TAJ A;  4RYA A;  3T93 B;  2DQV A;  3G3F A;  1XOC A;  4N8Y A;  2UVJ A;  4THI A;  1MXV A;  3C9H A;  3ODB A;  4G8H A;  3C32 A;  3SZP A;  4LZ8 A;  5I56 A;  1EYI A;  2H9B A;  1MXY A;  4PBH A;  5AA4 B;  3T9X B;  2GH9 A;  4GWO A;  2Y7I A;  2MKZ A;  3K02 A;  2H99 A;  4ELR A;  3TEL A;  4MEV A;  4ZS9 A;  1FPB A;  4YMB A;  5JK4 A;  1MY0 A;  1S9T A;  1O63 A;  2XXI A;  2V3T A;  3ILU B;  1CNQ A;  1FPF A;  2HAV A;  1EH3 A;  2GRV A;  4ZZA A;  2DXY A;  3CFZ A;  2XX8 A;  3PPO A;  3IL1 B;  2A5T A;  2ZZW A;  4WED A;  1NMU A;  2P1S A;  3PU5 A;  3C31 A;  4XKP A;  1JNF A;  3W9V A;  3R6U A;  4LN5 A;  5L8D A;  4RXL A;  4MNI A;  1FPI A;  4GBV A;  4RK9 A;  3C34 A;  3K1P A;  4UAB A;  1URS A;  4GQO A;  2AIX A;  4QF9 A;  2CEX A;  3FVG A;  2QPQ A;  1LB9 A;  3CRB A;  3OMB A;  3ROJ A;  1NV4 A;  4GRK A;  3VDF A;  3PPN A;  1UQW A;  1LFG A;  1P99 A;  3L6G A;  5TP9 B;  5LTC A;  2ZZX A;  1LFI A;  5DVI A;  1FRP A;  3S9N C;  5CBR A;  1B7H A;  1MQG A;  1FTJ A;  1R1N A;  1BKA A;  3IK6 B;  3TPA A;  4GF8 A;  2Q2C A;  2HEU A;  2V3Q A;  5KCJ B;  1XI6 A;  4I40 A;  4NF8 B;  4GIZ A;  3OO8 A;  2O7I A;  1IXG A;  4GWZ A;  4NHB A;  3S4U A;  1OVB A;  4YU0 A;  4OTE A;  3LUZ A;  1B2H A;  1IQ7 A;  3T9U A;  5F24 A;  1NV1 A;  4LAT A;  2R71 A;  2XXH A;  1MPC A;  2LAO A;  3MPL A;  1MQJ A;  2Y7R A;  4Q8R A;  1KZ8 A;  5H8S A;  1MM7 A;  4PE3 A;  5ET5 A;  2HPG A; 
#chains in the Genus database with same CATH homology
 1EYJ A;  2JJK A;  4GX3 A;  2XXK A;  4LN5 A;  4PAF A;  3W9V A;  4N81 A;  3U65 A;  3QMF A;  4AS4 A;  4MNI A;  1IMC A;  1FPI A;  2P3N A;  4PFB A;  4YZZ A;  5T3J A;  4O94 A;  1IMF A;  4MCO A;  1K9Z A;  4GBV A;  2QVR A;  1EYK A;  4MNC A;  2FVZ A;  5EQ9 A;  2XWK A;  1Q9D A;  4NN3 A;  4UAB A;  3E78 A;  4XEQ A;  2Q8M A;  4P8B A;  1NUZ A;  4HCW A;  4H46 A;  1FBE A;  2CEX A;  4N91 A;  1NUY A;  2QFL A;  4H45 A;  1JP4 A;  2QPQ A;  2KQZ A;  4YIC A;  4MIJ A;  4MAG A;  1NUW A;  4F1V A;  4MNP A;  2Q74 A;  2Y5L A;  4P56 A;  3D1R A;  4PBH A;  1NV5 A;  5EQA A;  4AS5 A;  3E79 A;  2HZL A;  5EYH A;  4OAN A;  4GWX A;  3BIG A;  3IFC A;  1NUX A;  2HHM A;  4HE2 A;  3ROJ A;  3MYU A;  4JVI A;  3T0J A;  2DE4 A;  1LBV A;  1NV4 A;  2ZZV A;  4JVD A;  2DDK A;  3BIH A;  4FBP A;  4PCD A;  4PGN A;  3KC1 A;  4F1U A;  4N4U A;  5CM6 A;  3RPL B;  2Q9T A;  1FBC A;  2QVU A;  4HE1 A;  4N15 A;  3NOH A;  1LBX A;  4DI4 B;  4MX6 A;  2DE2 A;  4PTK A;  1FJ9 A;  1NV6 A;  3HFU A;  4PF8 A;  4NGU A;  1FPE A;  4N6K A;  2P3V A;  3A29 A;  1FBF A;  4PAK A;  4I3Y A;  1IMD A;  5LTC A;  5ESY A;  4N8G A;  1LBY A;  4GWW A;  5LDZ A;  4NAP A;  4NQ8 A;  4OVR A;  4X8R A;  4NF0 A;  4GX6 A;  2WBD A;  2V4C A;  2ZZX A;  4N8Y A;  4P1L A;  2VPN A;  3FXB A;  3PTY A;  4NG7 A;  4PET A;  1K9Y A;  4XF5 A;  4N6D A;  5A5L A;  1FRP A;  2WBB A;  4HCY A;  4NX1 A;  4PGP A;  1BK4 A;  2KR0 A;  1NV2 A;  2WYP A;  4MEV A;  1YYZ A;  3MST A;  4P9K A;  4NHB A;  1FPG A;  2CZH A;  5EQ7 A;  2PCR A;  3SZP A;  4PBQ A;  4P1E A;  3IFA A;  1IMB A;  4OVP A;  5EQ8 A;  5DW8 A;  2F5X A;  3EKI A;  1FPL A;  3W9W A;  1EYI A;  2FIE A;  2V3Q A;  2XWO A;  1XI6 A;  1FJ6 A;  1YZ0 A;  3KC0 A;  1RDY A;  1SPI A;  2CZK A;  4GWY A;  4I40 A;  4G61 A;  4MJO A;  5EYG A;  2DE3 A;  5J16 A;  2CZI A;  4F18 A;  4PC9 A;  3KBZ A;  1G0I A;  4HE0 A;  2Y5K A;  3GYY A;  2MKZ A;  2BJI A;  4KXP A;  4DI3 D;  2XWI A;  2R8T A;  2FIX A;  2XA5 A;  1VDW A;  5I3S A;  4OVS A;  2WX9 A;  1LBW A;  1FTA A;  1D9Q A;  2HZK A;  4O8M A;  1NI9 A;  2GQ1 A;  4QBA A;  5IZ3 A;  4I3E A;  2DVZ A;  1DBZ A;  1FPD A;  1KA1 A;  4GWZ A;  4M1V A;  3CHG A;  2OWZ A;  2OX3 A;  5FBP A;  2WEF A;  3RPL A;  1FPK A;  4QXD A;  4OA4 A;  4F19 A;  1LBZ A;  4HXV A;  5I7I A;  5J1D A;  2F3D A;  4PDD A;  2PFY A;  3ISP A;  4JVC A;  1RDX A;  1FPB A;  4O7M A;  5JK4 A;  4PFR A;  1IME A;  1YXI A;  5IGA A;  1RDZ A;  1FPJ A;  1IMA A;  1FBG A;  5IZ1 A;  1FSA A;  4MHF A;  4P47 A;  3RYD A;  5IZZ A;  1DCU A;  1DK4 A;  5ET6 A;  4PDH A;  3LUZ A;  1INP A;  4XFE A;  1CNQ A;  1FPF A;  1KA0 A;  1LEV A;  3FBP A;  1QGX A;  4O7I A;  5ET7 A;  5F24 A;  2CEY A;  2L5V A;  2PFZ A;  4MMP A;  4N17 A;  2FBP A;  1NV1 A;  4GX4 A;  5ET8 A;  4PFI A;  5IM2 A;  2WYK A;  2FHY A;  4GWU A;  4PAI A;  4GBW A;  4IR8 A;  4P3L A;  1FBP A;  4X04 A;  5I5P A;  1NV3 A;  1NV0 A;  2VT5 A;  2B4M A;  2VPO A;  2ZZW A;  1G0H A;  2B4L A;  3B8B A;  1FBH A;  1KZ8 A;  2HXR A;  3T1B A;  1FBD A;  1NV7 A;  4GWS A;  4OVT A;  4PF6 A;  4OVQ A;  3LV0 A;  3B50 A;  2QVV A;  2F3B A;  5IZ3 B;  4PE3 A;  5ET5 A;  2HPG A;  2XWV A;  4X9T A;  1AWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...