4HE0A

Crystal structure of human muscle fructose-1,6-bisphosphatase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
326
Chain Sequence
ETDMLTLTRYVMEKGRQTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Crystal Structures of Human Muscle Fructose-1,6-Bisphosphatase: Novel Quaternary States, Enhanced AMP Affinity, and Allosteric Signal Transmission Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 326
sequence length 329
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4he0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4he0A02
1IMFA 1FPKA 1VDWA 2Y5LA 3T0JA 2F3BA 1DK4A 1NI9A 3IFCA 2PCRA 5EQ7A 2DDKA 1FBPA 1NV7A 1FBHA 2HHMA 5EYHA 4AS4A 1NV6A 4HE1A 2VT5A 1G0IA 4MJOA 1FPEA 5T3JA 1IMEA 1LBZA 1SPIA 1YXIA 1FBDA 4GWZA 4HE2A 4I40A 5EYGA 1IMAA 2FHYA 2P3NA 1IMCA 1FPDA 5FBPA 1YZ0A 4AS5A 2R8TA 1BK4A 1LBXA 1NUZA 2Q8MA 3RPLB 2OWZA 5EQ8A 1JP4A 2WBBA 4I3YA 3KC0A 2BJIA 5ESYA 2CZIA 5F24A 5ET8A 1G0HA 4I3EA 3B8BA 1LBWA 1K9ZA 4FBPA 5EQAA 4GWXA 4GWWA 1FPBA 1KA1A 2GQ1A 2JJKA 3RPLA 5IZ3B 1FBEA 1FPJA 1FJ9A 3IFAA 5J16A 2FBPA 4GWSA 1EYIA 3RYDA 5DW8A 1NV2A 4HE0A 1NUXA 5I3SA 4G61A 1FBFA 1EYKA 1XI6A 2QVUA 3BIHA 3KBZA 2CZKA 1NV4A 1CNQA 3LV0A 2WEFA 3LUZA 4IR8A 2Q74A 1NV3A 1QGXA 3ROJA 5IZ3A 4GX4A 1FRPA 2WBDA 2FIXA 4O7IA 1INPA 3BIGA 5A5LA 2QVRA 3D1RA 5EQ9A 4GBWA 2FIEA 2CZHA 1DBZA 3FBPA 1FBGA 2QFLA 1FSAA 4PTKA 2FVZA 1DCUA 1AWBA 4GX3A 1FPLA 1FPGA 2OX3A 4GWUA 1LBVA 5ET6A 4GX6A 5LDZA 4N81A 1D9QA 4HXVA 1KA0A 1KZ8A 1NV5A 4H45A 1K9YA 3QMFA 1RDXA 4KXPA 1FBCA 3KC1A 1FPFA 2QVVA 1NUWA 4GWYA 5IZ1A 1FJ6A 1NUYA 4H46A 1NV1A 1RDZA 5ET5A 1EYJA 1FPIA 1LEVA 1RDYA 2Y5KA 1YYZA 1FTAA 1IMDA 2F3DA 1LBYA 4QXDA 1Q9DA 4GBVA 5ET7A 1NV0A 3A29A 1IMBA 2P3VA
chains in the Genus database with same CATH superfamily
5H8FB 2YJPA 3VXCA 4MIJA 1FBPA 1I6BA 3K4UA 3PU5A 5DEXB 3GXAA 5L9MA 2Q88A 2XXWA 1MM7A 4JVDA 4PF6A 5TPAA 4IO5A 4C0RA 3H06B 4N17A 3OEKA 5IKBA 2QL3A 5EHSA 2RCBA 2VP1A 3MWBA 3TTNA 5ICTA 3IL1B 2REGA 4ELRA 4ZZAA 3B7DA 3B6WA 1YPNA 4M1VA 1N0TA 3UA8A 1EYIA 4HE0A 1LFIA 3LSXA 4X9TA 1H44A 4GXSB 2O51A 4OZ9A 2ZXTA 2WKYA 3VLUA 2F97A 5H8QB 2Z8DA 1EU8A 2ZZVA 2V25A 4MLQA 3IB1A 2FVZA 4IY5A 4GFRA 4BDQA 1CB6A 4F39A 3TEPA 3O2AA 2XWKA 4TQUQ 1LLSA 3TCFA 1POTA 2ZMBA 1FBCA 2PFZA 4OVRA 3T93B 1TT1A 3DP8A 3OOAA 4LQ5A 1MXWA 5ET5A 1FTAA 5LTCA 5H8HA 3OXNA 5F1QA 4DDDA 4F2QA 2XD2A 1MM6A 4LZ8A 1IMBA 4FECA 1PC3A 1LBBA 4YU0A 3FV1A 4MX6A 3N6TA 4HE1A 5CI5A 4QSEA 3K6VA 1Y4CA 4HE2A 5EYGA 1FPDA 1VSOA 1B7ZA 2ZNUA 2X26A 4YB5A 4F3SA 3TDJA 3MP6A 4F3BA 3KC0A 4PFTA 3PPQA 3L6GA 4KCDA 4GWWA 4LN5A 3IK6B 1M5EA 4N6DA 3U65A 4ZEKA 3IOTA 4YKJA 4XKPA 4OFOA 3KSJA 3MP8A 4WEPA 1LCTA 5I3SA 1B6HA 1QULA 3VLWA 1N84A 2O6AA 1M5CA 2H5YA 4WXJA 4JXIA 3MPKA 5K2YA 3CG1A 2I0BA 2V4CA 3Q28A 1IXIA 1FRPA 3EN3A 5ITPA 3DM0A 2F78A 3MUQA 4MNIA 3OO8A 1N7WA 2FIEA 1PB9A 1SYIA 5CC2A 3FGSA 1FPGA 4DI4B 1AH5A 1MY2A 3HV1A 2B4LA 3H6WA 5CMMA 2F35A 2UVIA 1MPDA 5AA2A 1ZIUA 5JTYB 3S4UA 3C33A 1NV1A 1RDZA 3PUXE 3PD8A 1FQEA 1NNPA 1P1NA 2VD2A 3HHFA 4HCWA 2DQVA 4MNPA 5I2KA 3IR1A 4I8CA 3KJTA 1IMFA 2AL5A 2PCRA 4G68A 5FHNA 1JETA 1FBHA 1B46A 3PPOA 4F22A 5TP9A 1IMAA 2FHYA 1Y3QA 4X1DA 5L8DA 4HCYA 2UYEA 2LAOA 2F6GA 5F24A 4EDPA 3B8BA 4EXKA 3UN6A 4RXLA 3T9XB 2OK2A 3RQTA 1FPJA 1FJ9A 4ZEDA 2KQZA 3M8UA 4KYSA 1AMFA 1DPPA 4OETA 1PBPA 1GGGA 3S9NC 1M5BA 3VXBA 5H8NA 4X04A 3DLNA 2Q74A 3SEYA 3T9VA 1LAHE 1BTJA 3FZVA 5A5LA 4OHNA 1JQFA 1EH3A 5AA3A 4NF6B 2OX3A 5I84A 5A5XB 4NF4B 4U23A 2Y84A 1KZ8A 3R26A 2VHAA 4LONB 1YCJA 4P8BA 3TELA 1Q1KA 4IO4A 1YTVA 1QKBA 2R71A 1DTZA 1B0LA 2Z23A 3DELB 2PMSA 4GBVA 5ET7A 1H3DA 3PV0E 2VOZA 3E78A 2D5WA 5HM4B 4ZEIA 4H5GA 4U21A 3K6UA 2HXRA 4NF8A 3IOUA 4GXAA 4XF5A 1MXVA 1F9BA 2DOJA 4GWZA 2P3NA 1Y3PA 3KSXA 4AS5A 1BK4A 4NWDA 3O6GA 2QMWA 1JP4A 2I6EA 5I56A 1ZBMA 1SW4A 2XXXA 3TTKA 4H5FA 1K9ZA 5I57B 4PDHA 4N6KA 3ZKKA 3CI8A 2I3WA 3I6VA 3W9WA 4ZEFA 2V84A 1MH3A 3GZGA 3CFLA 1ZJLA 2F7AA 1QVSA 2OPEA 2ALUA 4GL8A 2WYPA 2F7CA 2BJJX 3K2DA 1MS7A 1MXYA 4XXUA 4O7IA 3RY3A 4QFKA 3RLFE 2CEXA 4PFIA 2P2AA 4GBWA 4OTEA 5DYHA 3VDFA 2QFLA 1FSAA 4PTKA 2ZNSA 1OLAA 1QUJA 2I0CA 4MEVA 1FQAA 2UYFA 3O9PA 4HTGA 3TCGA 5HBCA 4KYDA 3UK4A 2XX8A 3KZGA 4PGPA 3ISPA 4U4SA 4XKNA 2QJEA 3E3KA 4P1LA 3IORA 1ATGA 3N6UA 2Y5KA 1R9QA 4PE3A 2QS4A 3C35A 4PBQA 3N26A 3OENA 4AQ4A 3IOVA 4OVQA 4YB7A 2F3BA 1UIVA 2Y7WA 4NF0A 4PQJA 4NN3A 2VT5A 1LBZA 5HPQA 1A99A 1B9JA 4I62A 5FHMA 4P11A 2OJTA 1P1QA 3G3JA 2A5TA 2H9BA 1JW4A 3U72A 4MHFA 1MY4A 3L6HA 5DTBA 5AA2D 3MVXA 4P1EA 4QSDA 1TWYA 1XC1A 2B4MA 5I58A 1LAGE 1A8EA 4OENA 3MJNA 5DW8A 1SQYA 4C1TA 4OVSA 1IXCA 4OMBA 4EF2A 4OVJA 4IR8A 2GRVA 3T1BA 4QFPA 3PTYA 5DVIA 3M3KA 2RCAA 1SVXB 5JEIA 3AXFA 3UGWA 1DBZA 3QAXA 1GV8A 4RPNA 3VE1B 1NNTA 3WAFA 3OMBA 4HS7A 1WDNA 3DP4A 3MYUA 4ZS9A 3FJGA 4RK2A 5KDTA 5EHMA 4P47A 4YKIA 4EXLA 1EYJA 4Q0CA 1IMDA 4PBHA 1I69A 4QF9A 3IO6A 4FE8A 4IY6A 5TPAB 5M2VA 4DZ1A 2G93A 4BDNA 1MY0A 2I4CA 4OVPA 4R6KA 1G0IA 5I2NA 3TAJA 1ZLQA 2Y7PA 2V3TA 2F6PA 3H6VA 4F18A 1NUZA 3M3LA 1N3WA 2HXWA 2CZIA 1JVYA 3I3VA 2UVGA 5B7DA 1B40A 1RYOA 4MCOA 1O63A 3U8QA 2YLNA 3RPLA 1UTBA 3T96B 3IFAA 4F31B 2FBPA 2O68A 3BKIB 4P0GA 4XIGQ 4JDFA 2XXYA 1A8FA 2Q8JA 4OESA 1D9YA 1US5A 1XI6A 3NOHA 4BLAA 3LC8A 2QS1A 3MZ1A 3Q26A 2Z22A 4LP2B 4YAHX 3D4CA 4MBPA 4F2OA 2F5XA 4XKRA 1ZKBA 3EF7A 4P3LA 3KOSA 3S9EA 1FPLA 1XHYA 2XD3A 4MMPA 1WODA 4QFNA 2P0SA 4OWDA 3K00A 4JSDA 5FHOA 3IAZA 5H8HB 1QUKA 3QIMA 3QMFA 4KXPA 1FPFA 4MNCA 4NTLA 1LBCA 4F3PA 5IZ1A 1NUYA 4QRZA 3G3IA 4Q30B 4GD5A 1B3EA 3O6HA 1Y9UA 3WAEA 5J1DA 3CVGA 3A09A 5ISUA 3LSLA 3PUWE 4ZEBA 1ELJA 1PB8A 3TZAA 1VDWA 4X48A 4PFYA 2Y7KA 2OLBA 2HEUA 2XXKA 2G29A 3S9LC 1JEVA 2HPGA 2P1SA 4IO2A 2QMXA 4MH5A 2GH9A 1XOCA 4O94A 2H98A 4G8MA 2XXRA 3MC2A 4PAFA 4LUBA 1S9TA 2ZYKA 4YZZA 3RTWB 3G7WA 1XS5A 3JV9A 5ESYA 4OFLA 1MQJA 1Z7NE 3O66A 4F19A 4FEBA 1ZMGA 4NE4A 2DE3A 4BDMA 3CHGA 2H4IA 3H7MA 3I5OA 1IITA 4G61A 1Y1MA 2NVUB 3KBZA 4F29A 3CSBA 1A40A 4MF3A 3RGYA 2VGQA 3RTFB 3W9VA 1QGXA 5I59A 1B4ZA 3PMWA 1EZOA 3EHUA 1FTJA 2I49A 2M8CA 3OO9A 4R75A 2DXYA 1B7UA 3TFLA 4JVIA 1LB8A 5AA2B 3FXQA 4GX3A 1LB9A 4AB5A 3HPIA 3UORA 1D9QA 1FCKA 1S7YA 1R1NA 3OO6A 1LGBC 3EHTA 2DSFA 1MXXA 3KC1A 5I2KB 3V8XB 1LCFA 3F11A 2OPDA 3KEIA 4G68B 4DXUA 2QS2A 4JWXA 5CRYA 2ZYOA 5TP9B 3CFXA 2Y5LA 3IFCA 3C9HA 5CMKA 2DYXA 2HHMA 1NV6A 3CSGA 1MPCA 4DIGA 3BBRA 1IMEA 5KZTA 4DE8A 4ELPA 1FBDA 4PFRA 5FBPA 1M5FA 1A55A 4POWA 2V3QA 2Q8MA 2HFBA 2WX9A 4PGNA 1JW1A 3H3GA 1B3HA 4FBPA 4NF5A 1FQFA 5H8NB 3PPNA 1B5IA 2HAVA 3RT8A 4P9KA 4N6PA 4PP0A 2PFYA 3ECRA 4DXCA 4H8JA 1HSLA 4R72A 3LV0A 3S9MC 2HZKA 1SW1A 3KN3A 2NXOA 4QFOA 1I6AA 3FVKA 2O1MA 2Q2AA 4G2ZA 1FQBA 4KD5A 4NG7A 1Y20A 4EUOA 4PDDA 4R73A 4RY1A 2PT1A 1B32A 1GR2A 3A3UA 2ZYMA 4IO6A 1H45A 4RJZA 4ZE8A 2DVCA 4N81A 4G77A 1SD3A 2AL4A 4DLDA 4F1VA 1Y1ZA 4NMYA 3V83A 4G8NA 1JEUA 4R6YA 2H25A 2H99A 1Z7ME 4KI0E 5L9SA 5KCJA 2DVZA 4YMBA 4DCYA 3OD7A 4GWYA 2DWAA 1JNFA 1FPIA 4NF8B 1EZ9A 2O69A 2CZLA 2FYIA 2RC7A 1IEJA 1DTGA 1UQWA 3T0JA 2ANJA 1NI9A 1MY1A 1PDAA 5EQ7A 1DSNA 4U1OA 5I56B 3RT6B 4UACA 1URDA 4MJOA 4PFWA 1SPIA 3FXRA 4H8IA 2AYSA 3IO4A 5K2XA 3TCHA 3ILTB 2F36A 3B50A 2DWJA 5ET8A 1G0HA 1RKMA 4RA1A 3LSWA 1UTHA 4U2RA 4P0IA 1NNKA 3PUZE 1BKAA 3K02A 2QVUA 2XXQA 4OVTA 1OQHA 3OELA 3KFMA 3FXUA 2Q2CA 3ROJA 3IB2A 4R2FA 5IZ3A 1PEBA 2RF1A 5JK4A 1B3LA 3HCQA 5DVJA 3W15C 3H4ZA 2HAUA 1II5A 2IA4A 4GQOA 2QPQA 3SEWA 1URSA 4QFLA 2Y7RA 3B6QA 4G4PA 4PF8A 3PUVE 2VD3A 4ZZEA 4BDOA 3PMVA 3MZBA 1FJ6A 1DPEA 4QBAA 2F34A 1JW5A 3ODBA 2B65A 2X7PA 3PPPA 4NQ8A 2NUVA 4FEDA 3M3FA 3SDFA 2ZZWA 2A5TB 5EYHA 4MFIA 4JB7A 5T3JA 3HSTA 3G3FA 3HO7A 2RKMA 4JWOA 4N13A 4MLVA 5I58B 2OWZA 4WEDA 3MW0A 4N07A 4KHZE 1LBWA 1AIVA 4GWXA 4ONYA 5DVFA 2GQ1A 2XXHA 3T9UA 1FBEA 3MQ9A 4E0XA 1OIBA 1QJMA 5AA4A 4PCDA 1NUXA 1O7TA 1FQCA 4ELQA 1CNQA 2WEFA 1FTOA 5CBSA 2I3VA 4O3AA 2WBDA 4FAJA 1LFHA 1B2HA 1INPA 3BIGA 1O64A 3BFTA 2KR0A 1AOVA 4OQOA 4AB6A 5KDTB 4UABA 1NL5A 3EKIA 1AWBA 4XFEA 3VLVA 3T22A 3QXMA 2I58A 5AA1A 3GBAA 1POY1 4ZECA 3N94A 4JVCA 2HCAA 4H45A 1JVXA 1UIUA 3IOWA 3C32A 1ZTYA 1MH4A 1OMPA 1IZ1A 4NX1A 4X1BA 5I2NB 2XXUA 5ICQA 5IGAA 3KGCA 2KLFA 3GYYA 1FTKA 2B3FA 3TQLA 3E13X 4FORA 3EPEA 3RUMA 2UVHA 1OVBA 5LOMA 3SZPA 1FTLA 3O28A 2HZLA 4OFJA 3MAMA 4O3BA 4AS4A 3FIRA 1YXIA 3FD3A 2ONSA 4OEVA 3VVFA 3IJOB 1YZ0A 1IUDA 2Q9TA 2R8TA 3SESA 4POXA 3RPLB 2ZYNA 1UTBB 2ONRA 3T66A 2W7YA 3VVEA 3PGFA 4ISUA 4U1ZA 3OO7A 2E1SA 1MQIA 4XTCQ 4R74A 3TODA 4TOZA 4JBZA 2JJKA 2FA7A 4PAIA 5J16A 1PBQA 2XXPA 1N76A 4PFUA 1BP5A 4JSOA 2PT2A 2RINA 1FBFA 4QSCA 3SEVA 1NH7A 3SETA 2GHBA 1D4NA 3FVNA 3TMGA 4DXBA 3K6XA 1US4A 2RC9A 3O6IA 4GX4A 2FIXA 1URGA 3R7XA 2XX7A 4IGRA 4O3CA 4GOTA 4N91A 2QSXA 1LBVA 2F7BA 2MKZA 3FVGA 2NOOA 3LR1A 1BLFA 1VE4A 3IJXB 3MBPA 1P1UA 1B7HA 3UP9A 3FATA 1GTKA 4ECFA 4E0WA 4QHQA 5H8SA 4I1DA 1A7LA 3UIFA 4R2BA 2R9JA 1RDYA 1P1OA 4K3FA 4PAKA 1B3GA 2DXRA 4EQ7A 3ZKLA 4M4GA 3FXBA 1M5DA 4OYVA 1DK4A 2DDKA 3MVWA 2O7UA 3FVOA 2DP8A 1FPEA 2QS3A 2OZZA 2FNCA 1HSJA 5H8FA 3CRBA 1R9LA 3K1MA 5DEXA 4ELOA 2ZNTA 1N3XA 1KA1A 5I59B 2Z8EA 1MRPA 2GHAA 1SW5A 4GLIA 3CR9A 4YB6A 4LZ5A 3RNNA 2D3IA 3FUZA 4R9FA 4N8YA 1NV4A 3LUZA 3OSQA 1CE2A 1IQ7A 4GRKA 2Z8FA 2QVRA 5IZZA 3FBPA 3LSFB 4PE5B 3KN7A 1OLCA 3E79A 5B70A 1B0HA 4YICA 5LDZA 1NMUA 3SEXA 4KR5A 3E4RA 4XEQA 1B3FA 1LFGA 3MSTA 3VFJA 1NV5A 5H8QA 3THIA 2QVVA 1NUWA 1IXHA 1B5JA 3B6TA 3QUFA 3MP1A 2Q89A 5TU0A 1XT8A 1YYZA 5I5PA 1WVJA 1NV0A 1A54A 3O29A 1I6QA 4EQ9A 1FPKA 2O84X 1Q35A 4GWOA 3LBSA 1RYXA 4NEDA 1B05A 4FIMA 1DMBA 4H67A 4LVQA 1LAXA 2X7QA 4NF5B 4XKQA 2DWIA 5FTHA 3K1NA 1NKXA 2V93A 3PMXA 4GIZA 1SYHA 3MVYA 4OA4A 4I3YA 1FTMA 2BJIA 1SDXA 4I3EA 3C31A 1VR5A 3OSRA 1NFTA 1H76A 4L17A 1J1NA 4OXVA 3GLBA 3VV5A 4H1XA 2ONKE 1SI1A 3HFUA 3H6TA 3KBRA 1HSEA 4KFQA 2ABHA 4NWCA 1QUIA 4JWYA 4KPTA 3K01A 4PFBA 1QKAA 3D1RA 3G3GA 4GF8A 5KCJB 5EYFA 1R6ZA 3U93A 1DCUA 3IB0A 3RPWA 3KG2A 2F8DA 4PC9A 4O7MA 1IXGA 2DS9A 3QUJA 4Z7EA 2XWVA 3RN8A 1KA0A 4P56A 3N5LA 3C36A 4HW8A 2OWSA 2THIA 1AL3A 4R9GA 1MDQA 1OVTA 2PBWA 4KYEA 4GL0A 4RNSA 4IO7A 1LEVA 1NH8A 3JYRA 4U22A 4YKPA 3V89B 3EQ1A 2XWOA 1Q9DA 1PB7A 3GBBA 4FATA 3A29A 5JTYA 4ESWA 4MAGA 3KOTA 1SI0A 3TTLA 5BWJA 1NV7A 4IO3A 4LQ2A 2QRYA 3IX1A 1USYE 3USDA 1B52A 3VVDA 4BDLA 2I48A 3BFUA 4I40A 4R6HA 3V5AA 1UTHB 3PD9A 2DE4A 4OEUA 3C4MA 4C1UA 4O8MA 5ELVA 3T9HB 5EQ8A 2WBBA 4GVOA 4ESXA 4IGTA 1TFDA 3LUYA 2REJA 3FJ7A 4NHBA 2XHDA 5EQAA 2UXAA 4THIA 5I7IA 3PUYE 4KCCA 1Y3NA 4Z0IA 5IZ3B 2XXIA 4YMAA 4GWSA 1LAFE 1XVXA 3ZS6A 4H65A 1NV2A 3BIHA 2UVJA 4Q8RA 2AIXA 3OEMA 3S2VA 3K1PA 1MQHA 2XX9A 1N7XA 5EQ9A 3EHSA 5CMBA 1B1XA 2CZHA 4UA8A 4LZ7A 4TLLB 4PETA 3U92A 1MDP1 1S50A 4RK9A 1TFAA 3K6WA 4F1YA 2OWTA 4NF6A 2XXVA 4H46A 2WYKA 5A5XA 4TLMB 1MQGA 1L5TA 4NF4A 1MXZA 2F3DA 3U1OA 5CMCA 4NAPA 4QXDA 5F7VA 4KQPA 2I4BA 4LATA 3TTMA 3SKPA 5ITOA 3JZJA 3HHGA 4F1UA 2XXTA 2B3BA 1OQGA 1DOTA 4H6DA 3TTRA 2ZZXA 1B1HA 1IMCA 1LBXA 3CIJA 3A3CA 2YPNA 5AA4B 4ND9A 3U94A 3Q29A 5BUUA 3FASA 1FPBA 2D21A 4DCXA 2O1LA 3KJ7A 1H43A 1LSTA 1Y4TA 5IAIA 4N15A 2E0SA 3K0VA 3TQWA 2XA5A 5I57A 3P7IA 3CG3A 5DT6A 3SEUA 3ZSFA 3QYTA 1MY3A 2OBGA 2NWJA 1NNFA 4LA9A 1SBPA 1ZU0A 1FBGA 3H6UA 2L5VA 1B51A 3ONMA 4I9DA 1D3KA 5ET6A 1KWHA 3MPLA 2OCUA 2V3UA 2PYYA 4HXVA 4IB2A 1QW0A 1K9YA 1D9VA 3HN0A 1YAEA 1N04A 4RYAA 4YKKA 3G3HA 1MQDA 3KN8A 1MG1A 3MZ9A 1B58A 3O97A 3TKDA 3Q25A 5L9OA 1EZPA 3ILUB 3FJMA 2XWIA 1BIYA 3D4GA 5IM2A 2IEEA 5AE4A 1GVCA 4ZE9A 1FQDA 1MXUA 3QSLA 1VFDA 4G68C 4Q5TA 4G8HA 3E9XA 2PVUA 2RC8A 2A5SA 1USYH 2VPOA 4DI3D 4ZDMA 2O7IA 2VPNA 3FV2A 4H0WA 5FTIA 3SERA 3DP6A 2CMOA 3RYDA 2CEYA 4N4UA 4RPOA 4X8RA 1EYKA 2CZKA 5CBRA 1NV3A 2GFEA 2DE2A 1T0KA 2HQ0A 4FJPA 1IIWA 3QK6A 3G3KA 4OANA 4WKMA 4OERA 4NGUA 3Q27A 3TUSA 4GWUA 3TPAA 4GX6A 1XVYA 1MPBA 1FW0A 2PX1A 5CM6A 3MVZA 3CFZA 1B4HA 3PPRA 1VFEA 1P99A 1RDXA 2R6GE 4F3GA 1TXFA 1P1WA 1SW2A 2ESNA 4EF1A 3H03A 4U4XA 2Y7IA 1ANFA 3R6UA 1B5HA 1LBYA 4BDRA 2DWHA 3C34A 4N8GA 3TYHA 4EQBA 2P3VA
chains in the Genus database with same CATH topology
1FPKA 3T0JA 4OVQA 2F3BA 1NI9A 4MIJA 5EQ7A 1FBPA 4NF0A 4NN3A 2VT5A 4MJOA 1LBZA 4JVDA 4PF6A 1SPIA 4N17A 4OA4A 4I3YA 3B50A 2BJIA 4MHFA 5ET8A 1G0HA 4I3EA 4P1EA 4M1VA 2B4MA 1EYIA 3HFUA 5DW8A 4HE0A 4OVSA 2QVUA 4OVTA 4X9TA 4IR8A 3T1BA 3PTYA 3ROJA 5IZ3A 4PFBA 5JK4A 3D1RA 1DBZA 2ZZVA 2FVZA 1DCUA 2QPQA 4PC9A 4O7MA 4PF8A 2XWVA 1KA0A 3MYUA 2XWKA 4P56A 1FBCA 2PFZA 4OVRA 1FJ6A 4P47A 5ET5A 1EYJA 1LEVA 4QBAA 1FTAA 1IMDA 4PBHA 5LTCA 4NQ8A 2XWOA 1Q9DA 3A29A 1IMBA 4MAGA 4MX6A 1NV7A 2ZZWA 5EYHA 4OVPA 4HE1A 1G0IA 5T3JA 4HE2A 4I40A 5EYGA 1FPDA 4F18A 1NUZA 2DE4A 2OWZA 4O8MA 5EQ8A 2WBBA 3KC0A 2CZIA 1LBWA 4NHBA 5EQAA 4GWXA 4GWWA 4MCOA 4LN5A 5I7IA 2GQ1A 3RPLA 4N6DA 3U65A 5IZ3B 1FBEA 3IFAA 2FBPA 4GWSA 4PCDA 1NV2A 1NUXA 5I3SA 1XI6A 3BIHA 1CNQA 3NOHA 2WEFA 2V4CA 1FRPA 2WBDA 1INPA 3BIGA 2KR0A 4MNIA 5EQ9A 2FIEA 2F5XA 2CZHA 4UABA 4P3LA 3EKIA 1AWBA 1FPLA 1FPGA 4XFEA 4DI4B 2B4LA 4MMPA 4PETA 4JVCA 4H45A 3QMFA 4KXPA 1FPFA 4MNCA 5IZ1A 1NUYA 4H46A 2WYKA 1NV1A 1RDZA 4NX1A 4HCWA 2F3DA 5IGAA 5J1DA 4NAPA 4QXDA 4MNPA 3GYYA 1IMFA 1VDWA 3SZPA 2PCRA 2HZLA 1FBHA 4AS4A 2XXKA 2HPGA 4F1UA 1YXIA 2ZZXA 1IMAA 2FHYA 4O94A 1IMCA 1YZ0A 2Q9TA 2R8TA 1LBXA 3RPLB 4PAFA 4HCYA 4YZZA 5ESYA 5F24A 3B8BA 1FPBA 4F19A 2JJKA 2DE3A 1FPJA 1FJ9A 4PAIA 5J16A 2KQZA 3CHGA 4N15A 4G61A 1FBFA 3KBZA 2XA5A 3W9VA 4X04A 2Q74A 1QGXA 4GX4A 2FIXA 5A5LA 4JVIA 1FBGA 2L5VA 4N91A 4GX3A 2OX3A 1LBVA 5ET6A 2MKZA 1D9QA 4HXVA 1KZ8A 1K9YA 4P8BA 3KC1A 1RDYA 4PAKA 4GBVA 5ET7A 3FXBA 2Y5LA 2XWIA 3E78A 1DK4A 3IFCA 2DDKA 2HXRA 2HHMA 5IM2A 1NV6A 4XF5A 1FPEA 1IMEA 1FBDA 4GWZA 4PFRA 2P3NA 5FBPA 4AS5A 1BK4A 2V3QA 2Q8MA 2WX9A 4PGNA 1JP4A 1K9ZA 4FBPA 2VPOA 4PDHA 4DI3D 4N6KA 2VPNA 1KA1A 4P9KA 2PFYA 3W9WA 3RYDA 2CEYA 4N4UA 4X8RA 1EYKA 2CZKA 4N8YA 1NV4A 3LV0A 3LUZA 2HZKA 1NV3A 2DE2A 2WYPA 4NG7A 4OANA 4O7IA 2QVRA 2CEXA 4PDDA 4PFIA 4GBWA 5IZZA 4NGUA 3FBPA 2QFLA 1FSAA 4PTKA 3E79A 4YICA 4GWUA 4MEVA 4GX6A 5LDZA 4N81A 4XEQA 4F1VA 5CM6A 3MSTA 1NV5A 1RDXA 4PGPA 2DVZA 3ISPA 2QVVA 1NUWA 4GWYA 4P1LA 1FPIA 2Y5KA 1YYZA 4PE3A 5I5PA 1LBYA 4PBQA 4N8GA 1NV0A 2P3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMF A;  1FPK A;  1VDW A;  2Y5L A;  3T0J A;  2F3B A;  1DK4 A;  1NI9 A;  3IFC A;  2PCR A;  5EQ7 A;  2DDK A;  1FBP A;  1NV7 A;  1FBH A;  2HHM A;  5EYH A;  4AS4 A;  1NV6 A;  4HE1 A;  2VT5 A;  1G0I A;  4MJO A;  1FPE A;  5T3J A;  1IME A;  1LBZ A;  1SPI A;  1YXI A;  1FBD A;  4GWZ A;  4HE2 A;  4I40 A;  5EYG A;  1IMA A;  2FHY A;  2P3N A;  1IMC A;  1FPD A;  5FBP A;  1YZ0 A;  4AS5 A;  2R8T A;  1BK4 A;  1LBX A;  1NUZ A;  2Q8M A;  3RPL B;  2OWZ A;  5EQ8 A;  1JP4 A;  2WBB A;  4I3Y A;  3KC0 A;  2BJI A;  5ESY A;  2CZI A;  5F24 A;  5ET8 A;  1G0H A;  4I3E A;  3B8B A;  1LBW A;  1K9Z A;  4FBP A;  5EQA A;  4GWX A;  4GWW A;  1FPB A;  1KA1 A;  2GQ1 A;  2JJK A;  3RPL A;  5IZ3 B;  1FBE A;  1FPJ A;  1FJ9 A;  3IFA A;  5J16 A;  2FBP A;  4GWS A;  1EYI A;  3RYD A;  5DW8 A;  1NV2 A;  4HE0 A;  1NUX A;  5I3S A;  4G61 A;  1FBF A;  1EYK A;  1XI6 A;  2QVU A;  3BIH A;  3KBZ A;  2CZK A;  1NV4 A;  1CNQ A;  3LV0 A;  2WEF A;  3LUZ A;  4IR8 A;  2Q74 A;  1NV3 A;  1QGX A;  3ROJ A;  5IZ3 A;  4GX4 A;  1FRP A;  2WBD A;  2FIX A;  4O7I A;  1INP A;  3BIG A;  5A5L A;  2QVR A;  3D1R A;  5EQ9 A;  4GBW A;  2FIE A;  2CZH A;  1DBZ A;  3FBP A;  1FBG A;  2QFL A;  1FSA A;  4PTK A;  2FVZ A;  1DCU A;  1AWB A;  4GX3 A;  1FPL A;  1FPG A;  2OX3 A;  4GWU A;  1LBV A;  5ET6 A;  4GX6 A;  5LDZ A;  4N81 A;  1D9Q A;  4HXV A;  1KA0 A;  1KZ8 A;  1NV5 A;  4H45 A;  1K9Y A;  3QMF A;  1RDX A;  4KXP A;  1FBC A;  3KC1 A;  1FPF A;  2QVV A;  1NUW A;  4GWY A;  5IZ1 A;  1FJ6 A;  1NUY A;  4H46 A;  1NV1 A;  1RDZ A;  5ET5 A;  1EYJ A;  1FPI A;  1LEV A;  1RDY A;  2Y5K A;  1YYZ A;  1FTA A;  1IMD A;  2F3D A;  1LBY A;  4QXD A;  1Q9D A;  4GBV A;  5ET7 A;  1NV0 A;  3A29 A;  1IMB A;  2P3V A; 
#chains in the Genus database with same CATH topology
 5H8F B;  2YJP A;  3VXC A;  4MIJ A;  1FBP A;  1I6B A;  3K4U A;  3PU5 A;  5DEX B;  3GXA A;  5L9M A;  2Q88 A;  2XXW A;  1MM7 A;  4JVD A;  4PF6 A;  5TPA A;  4IO5 A;  4C0R A;  3H06 B;  4N17 A;  3OEK A;  5IKB A;  2QL3 A;  5EHS A;  2RCB A;  2VP1 A;  3MWB A;  3TTN A;  5ICT A;  3IL1 B;  2REG A;  4ELR A;  4ZZA A;  3B7D A;  3B6W A;  1YPN A;  4M1V A;  1N0T A;  3UA8 A;  1EYI A;  4HE0 A;  1LFI A;  3LSX A;  4X9T A;  1H44 A;  4GXS B;  2O51 A;  4OZ9 A;  2ZXT A;  2WKY A;  3VLU A;  2F97 A;  5H8Q B;  2Z8D A;  1EU8 A;  2ZZV A;  2V25 A;  4MLQ A;  3IB1 A;  2FVZ A;  4IY5 A;  4GFR A;  4BDQ A;  1CB6 A;  4F39 A;  3TEP A;  3O2A A;  2XWK A;  4TQU Q;  1LLS A;  3TCF A;  1POT A;  2ZMB A;  1FBC A;  2PFZ A;  4OVR A;  3T93 B;  1TT1 A;  3DP8 A;  3OOA A;  4LQ5 A;  1MXW A;  5ET5 A;  1FTA A;  5LTC A;  5H8H A;  3OXN A;  5F1Q A;  4DDD A;  4F2Q A;  2XD2 A;  1MM6 A;  4LZ8 A;  1IMB A;  4FEC A;  1PC3 A;  1LBB A;  4YU0 A;  3FV1 A;  4MX6 A;  3N6T A;  4HE1 A;  5CI5 A;  4QSE A;  3K6V A;  1Y4C A;  4HE2 A;  5EYG A;  1FPD A;  1VSO A;  1B7Z A;  2ZNU A;  2X26 A;  4YB5 A;  4F3S A;  3TDJ A;  3MP6 A;  4F3B A;  3KC0 A;  4PFT A;  3PPQ A;  3L6G A;  4KCD A;  4GWW A;  4LN5 A;  3IK6 B;  1M5E A;  4N6D A;  3U65 A;  4ZEK A;  3IOT A;  4YKJ A;  4XKP A;  4OFO A;  3KSJ A;  3MP8 A;  4WEP A;  1LCT A;  5I3S A;  1B6H A;  1QUL A;  3VLW A;  1N84 A;  2O6A A;  1M5C A;  2H5Y A;  4WXJ A;  4JXI A;  3MPK A;  5K2Y A;  3CG1 A;  2I0B A;  2V4C A;  3Q28 A;  1IXI A;  1FRP A;  3EN3 A;  5ITP A;  3DM0 A;  2F78 A;  3MUQ A;  4MNI A;  3OO8 A;  1N7W A;  2FIE A;  1PB9 A;  1SYI A;  5CC2 A;  3FGS A;  1FPG A;  4DI4 B;  1AH5 A;  1MY2 A;  3HV1 A;  2B4L A;  3H6W A;  5CMM A;  2F35 A;  2UVI A;  1MPD A;  5AA2 A;  1ZIU A;  5JTY B;  3S4U A;  3C33 A;  1NV1 A;  1RDZ A;  3PUX E;  3PD8 A;  1FQE A;  1NNP A;  1P1N A;  2VD2 A;  3HHF A;  4HCW A;  2DQV A;  4MNP A;  5I2K A;  3IR1 A;  4I8C A;  3KJT A;  1IMF A;  2AL5 A;  2PCR A;  4G68 A;  5FHN A;  1JET A;  1FBH A;  1B46 A;  3PPO A;  4F22 A;  5TP9 A;  1IMA A;  2FHY A;  1Y3Q A;  4X1D A;  5L8D A;  4HCY A;  2UYE A;  2LAO A;  2F6G A;  5F24 A;  4EDP A;  3B8B A;  4EXK A;  3UN6 A;  4RXL A;  3T9X B;  2OK2 A;  3RQT A;  1FPJ A;  1FJ9 A;  4ZED A;  2KQZ A;  3M8U A;  4KYS A;  1AMF A;  1DPP A;  4OET A;  1PBP A;  1GGG A;  3S9N C;  1M5B A;  3VXB A;  5H8N A;  4X04 A;  3DLN A;  2Q74 A;  3SEY A;  3T9V A;  1LAH E;  1BTJ A;  3FZV A;  5A5L A;  4OHN A;  1JQF A;  1EH3 A;  5AA3 A;  4NF6 B;  2OX3 A;  5I84 A;  5A5X B;  4NF4 B;  4U23 A;  2Y84 A;  1KZ8 A;  3R26 A;  2VHA A;  4LON B;  1YCJ A;  4P8B A;  3TEL A;  1Q1K A;  4IO4 A;  1YTV A;  1QKB A;  2R71 A;  1DTZ A;  1B0L A;  2Z23 A;  3DEL B;  2PMS A;  4GBV A;  5ET7 A;  1H3D A;  3PV0 E;  2VOZ A;  3E78 A;  2D5W A;  5HM4 B;  4ZEI A;  4H5G A;  4U21 A;  3K6U A;  2HXR A;  4NF8 A;  3IOU A;  4GXA A;  4XF5 A;  1MXV A;  1F9B A;  2DOJ A;  4GWZ A;  2P3N A;  1Y3P A;  3KSX A;  4AS5 A;  1BK4 A;  4NWD A;  3O6G A;  2QMW A;  1JP4 A;  2I6E A;  5I56 A;  1ZBM A;  1SW4 A;  2XXX A;  3TTK A;  4H5F A;  1K9Z A;  5I57 B;  4PDH A;  4N6K A;  3ZKK A;  3CI8 A;  2I3W A;  3I6V A;  3W9W A;  4ZEF A;  2V84 A;  1MH3 A;  3GZG A;  3CFL A;  1ZJL A;  2F7A A;  1QVS A;  2OPE A;  2ALU A;  4GL8 A;  2WYP A;  2F7C A;  2BJJ X;  3K2D A;  1MS7 A;  1MXY A;  4XXU A;  4O7I A;  3RY3 A;  4QFK A;  3RLF E;  2CEX A;  4PFI A;  2P2A A;  4GBW A;  4OTE A;  5DYH A;  3VDF A;  2QFL A;  1FSA A;  4PTK A;  2ZNS A;  1OLA A;  1QUJ A;  2I0C A;  4MEV A;  1FQA A;  2UYF A;  3O9P A;  4HTG A;  3TCG A;  5HBC A;  4KYD A;  3UK4 A;  2XX8 A;  3KZG A;  4PGP A;  3ISP A;  4U4S A;  4XKN A;  2QJE A;  3E3K A;  4P1L A;  3IOR A;  1ATG A;  3N6U A;  2Y5K A;  1R9Q A;  4PE3 A;  2QS4 A;  3C35 A;  4PBQ A;  3N26 A;  3OEN A;  4AQ4 A;  3IOV A;  4OVQ A;  4YB7 A;  2F3B A;  1UIV A;  2Y7W A;  4NF0 A;  4PQJ A;  4NN3 A;  2VT5 A;  1LBZ A;  5HPQ A;  1A99 A;  1B9J A;  4I62 A;  5FHM A;  4P11 A;  2OJT A;  1P1Q A;  3G3J A;  2A5T A;  2H9B A;  1JW4 A;  3U72 A;  4MHF A;  1MY4 A;  3L6H A;  5DTB A;  5AA2 D;  3MVX A;  4P1E A;  4QSD A;  1TWY A;  1XC1 A;  2B4M A;  5I58 A;  1LAG E;  1A8E A;  4OEN A;  3MJN A;  5DW8 A;  1SQY A;  4C1T A;  4OVS A;  1IXC A;  4OMB A;  4EF2 A;  4OVJ A;  4IR8 A;  2GRV A;  3T1B A;  4QFP A;  3PTY A;  5DVI A;  3M3K A;  2RCA A;  1SVX B;  5JEI A;  3AXF A;  3UGW A;  1DBZ A;  3QAX A;  1GV8 A;  4RPN A;  3VE1 B;  1NNT A;  3WAF A;  3OMB A;  4HS7 A;  1WDN A;  3DP4 A;  3MYU A;  4ZS9 A;  3FJG A;  4RK2 A;  5KDT A;  5EHM A;  4P47 A;  4YKI A;  4EXL A;  1EYJ A;  4Q0C A;  1IMD A;  4PBH A;  1I69 A;  4QF9 A;  3IO6 A;  4FE8 A;  4IY6 A;  5TPA B;  5M2V A;  4DZ1 A;  2G93 A;  4BDN A;  1MY0 A;  2I4C A;  4OVP A;  4R6K A;  1G0I A;  5I2N A;  3TAJ A;  1ZLQ A;  2Y7P A;  2V3T A;  2F6P A;  3H6V A;  4F18 A;  1NUZ A;  3M3L A;  1N3W A;  2HXW A;  2CZI A;  1JVY A;  3I3V A;  2UVG A;  5B7D A;  1B40 A;  1RYO A;  4MCO A;  1O63 A;  3U8Q A;  2YLN A;  3RPL A;  1UTB A;  3T96 B;  3IFA A;  4F31 B;  2FBP A;  2O68 A;  3BKI B;  4P0G A;  4XIG Q;  4JDF A;  2XXY A;  1A8F A;  2Q8J A;  4OES A;  1D9Y A;  1US5 A;  1XI6 A;  3NOH A;  4BLA A;  3LC8 A;  2QS1 A;  3MZ1 A;  3Q26 A;  2Z22 A;  4LP2 B;  4YAH X;  3D4C A;  4MBP A;  4F2O A;  2F5X A;  4XKR A;  1ZKB A;  3EF7 A;  4P3L A;  3KOS A;  3S9E A;  1FPL A;  1XHY A;  2XD3 A;  4MMP A;  1WOD A;  4QFN A;  2P0S A;  4OWD A;  3K00 A;  4JSD A;  5FHO A;  3IAZ A;  5H8H B;  1QUK A;  3QIM A;  3QMF A;  4KXP A;  1FPF A;  4MNC A;  4NTL A;  1LBC A;  4F3P A;  5IZ1 A;  1NUY A;  4QRZ A;  3G3I A;  4Q30 B;  4GD5 A;  1B3E A;  3O6H A;  1Y9U A;  3WAE A;  5J1D A;  3CVG A;  3A09 A;  5ISU A;  3LSL A;  3PUW E;  4ZEB A;  1ELJ A;  1PB8 A;  3TZA A;  1VDW A;  4X48 A;  4PFY A;  2Y7K A;  2OLB A;  2HEU A;  2XXK A;  2G29 A;  3S9L C;  1JEV A;  2HPG A;  2P1S A;  4IO2 A;  2QMX A;  4MH5 A;  2GH9 A;  1XOC A;  4O94 A;  2H98 A;  4G8M A;  2XXR A;  3MC2 A;  4PAF A;  4LUB A;  1S9T A;  2ZYK A;  4YZZ A;  3RTW B;  3G7W A;  1XS5 A;  3JV9 A;  5ESY A;  4OFL A;  1MQJ A;  1Z7N E;  3O66 A;  4F19 A;  4FEB A;  1ZMG A;  4NE4 A;  2DE3 A;  4BDM A;  3CHG A;  2H4I A;  3H7M A;  3I5O A;  1IIT A;  4G61 A;  1Y1M A;  2NVU B;  3KBZ A;  4F29 A;  3CSB A;  1A40 A;  4MF3 A;  3RGY A;  2VGQ A;  3RTF B;  3W9V A;  1QGX A;  5I59 A;  1B4Z A;  3PMW A;  1EZO A;  3EHU A;  1FTJ A;  2I49 A;  2M8C A;  3OO9 A;  4R75 A;  2DXY A;  1B7U A;  3TFL A;  4JVI A;  1LB8 A;  5AA2 B;  3FXQ A;  4GX3 A;  1LB9 A;  4AB5 A;  3HPI A;  3UOR A;  1D9Q A;  1FCK A;  1S7Y A;  1R1N A;  3OO6 A;  1LGB C;  3EHT A;  2DSF A;  1MXX A;  3KC1 A;  5I2K B;  3V8X B;  1LCF A;  3F11 A;  2OPD A;  3KEI A;  4G68 B;  4DXU A;  2QS2 A;  4JWX A;  5CRY A;  2ZYO A;  5TP9 B;  3CFX A;  2Y5L A;  3IFC A;  3C9H A;  5CMK A;  2DYX A;  2HHM A;  1NV6 A;  3CSG A;  1MPC A;  4DIG A;  3BBR A;  1IME A;  5KZT A;  4DE8 A;  4ELP A;  1FBD A;  4PFR A;  5FBP A;  1M5F A;  1A55 A;  4POW A;  2V3Q A;  2Q8M A;  2HFB A;  2WX9 A;  4PGN A;  1JW1 A;  3H3G A;  1B3H A;  4FBP A;  4NF5 A;  1FQF A;  5H8N B;  3PPN A;  1B5I A;  2HAV A;  3RT8 A;  4P9K A;  4N6P A;  4PP0 A;  2PFY A;  3ECR A;  4DXC A;  4H8J A;  1HSL A;  4R72 A;  3LV0 A;  3S9M C;  2HZK A;  1SW1 A;  3KN3 A;  2NXO A;  4QFO A;  1I6A A;  3FVK A;  2O1M A;  2Q2A A;  4G2Z A;  1FQB A;  4KD5 A;  4NG7 A;  1Y20 A;  4EUO A;  4PDD A;  4R73 A;  4RY1 A;  2PT1 A;  1B32 A;  1GR2 A;  3A3U A;  2ZYM A;  4IO6 A;  1H45 A;  4RJZ A;  4ZE8 A;  2DVC A;  4N81 A;  4G77 A;  1SD3 A;  2AL4 A;  4DLD A;  4F1V A;  1Y1Z A;  4NMY A;  3V83 A;  4G8N A;  1JEU A;  4R6Y A;  2H25 A;  2H99 A;  1Z7M E;  4KI0 E;  5L9S A;  5KCJ A;  2DVZ A;  4YMB A;  4DCY A;  3OD7 A;  4GWY A;  2DWA A;  1JNF A;  1FPI A;  4NF8 B;  1EZ9 A;  2O69 A;  2CZL A;  2FYI A;  2RC7 A;  1IEJ A;  1DTG A;  1UQW A;  3T0J A;  2ANJ A;  1NI9 A;  1MY1 A;  1PDA A;  5EQ7 A;  1DSN A;  4U1O A;  5I56 B;  3RT6 B;  4UAC A;  1URD A;  4MJO A;  4PFW A;  1SPI A;  3FXR A;  4H8I A;  2AYS A;  3IO4 A;  5K2X A;  3TCH A;  3ILT B;  2F36 A;  3B50 A;  2DWJ A;  5ET8 A;  1G0H A;  1RKM A;  4RA1 A;  3LSW A;  1UTH A;  4U2R A;  4P0I A;  1NNK A;  3PUZ E;  1BKA A;  3K02 A;  2QVU A;  2XXQ A;  4OVT A;  1OQH A;  3OEL A;  3KFM A;  3FXU A;  2Q2C A;  3ROJ A;  3IB2 A;  4R2F A;  5IZ3 A;  1PEB A;  2RF1 A;  5JK4 A;  1B3L A;  3HCQ A;  5DVJ A;  3W15 C;  3H4Z A;  2HAU A;  1II5 A;  2IA4 A;  4GQO A;  2QPQ A;  3SEW A;  1URS A;  4QFL A;  2Y7R A;  3B6Q A;  4G4P A;  4PF8 A;  3PUV E;  2VD3 A;  4ZZE A;  4BDO A;  3PMV A;  3MZB A;  1FJ6 A;  1DPE A;  4QBA A;  2F34 A;  1JW5 A;  3ODB A;  2B65 A;  2X7P A;  3PPP A;  4NQ8 A;  2NUV A;  4FED A;  3M3F A;  3SDF A;  2ZZW A;  2A5T B;  5EYH A;  4MFI A;  4JB7 A;  5T3J A;  3HST A;  3G3F A;  3HO7 A;  2RKM A;  4JWO A;  4N13 A;  4MLV A;  5I58 B;  2OWZ A;  4WED A;  3MW0 A;  4N07 A;  4KHZ E;  1LBW A;  1AIV A;  4GWX A;  4ONY A;  5DVF A;  2GQ1 A;  2XXH A;  3T9U A;  1FBE A;  3MQ9 A;  4E0X A;  1OIB A;  1QJM A;  5AA4 A;  4PCD A;  1NUX A;  1O7T A;  1FQC A;  4ELQ A;  1CNQ A;  2WEF A;  1FTO A;  5CBS A;  2I3V A;  4O3A A;  2WBD A;  4FAJ A;  1LFH A;  1B2H A;  1INP A;  3BIG A;  1O64 A;  3BFT A;  2KR0 A;  1AOV A;  4OQO A;  4AB6 A;  5KDT B;  4UAB A;  1NL5 A;  3EKI A;  1AWB A;  4XFE A;  3VLV A;  3T22 A;  3QXM A;  2I58 A;  5AA1 A;  3GBA A;  1POY 1;  4ZEC A;  3N94 A;  4JVC A;  2HCA A;  4H45 A;  1JVX A;  1UIU A;  3IOW A;  3C32 A;  1ZTY A;  1MH4 A;  1OMP A;  1IZ1 A;  4NX1 A;  4X1B A;  5I2N B;  2XXU A;  5ICQ A;  5IGA A;  3KGC A;  2KLF A;  3GYY A;  1FTK A;  2B3F A;  3TQL A;  3E13 X;  4FOR A;  3EPE A;  3RUM A;  2UVH A;  1OVB A;  5LOM A;  3SZP A;  1FTL A;  3O28 A;  2HZL A;  4OFJ A;  3MAM A;  4O3B A;  4AS4 A;  3FIR A;  1YXI A;  3FD3 A;  2ONS A;  4OEV A;  3VVF A;  3IJO B;  1YZ0 A;  1IUD A;  2Q9T A;  2R8T A;  3SES A;  4POX A;  3RPL B;  2ZYN A;  1UTB B;  2ONR A;  3T66 A;  2W7Y A;  3VVE A;  3PGF A;  4ISU A;  4U1Z A;  3OO7 A;  2E1S A;  1MQI A;  4XTC Q;  4R74 A;  3TOD A;  4TOZ A;  4JBZ A;  2JJK A;  2FA7 A;  4PAI A;  5J16 A;  1PBQ A;  2XXP A;  1N76 A;  4PFU A;  1BP5 A;  4JSO A;  2PT2 A;  2RIN A;  1FBF A;  4QSC A;  3SEV A;  1NH7 A;  3SET A;  2GHB A;  1D4N A;  3FVN A;  3TMG A;  4DXB A;  3K6X A;  1US4 A;  2RC9 A;  3O6I A;  4GX4 A;  2FIX A;  1URG A;  3R7X A;  2XX7 A;  4IGR A;  4O3C A;  4GOT A;  4N91 A;  2QSX A;  1LBV A;  2F7B A;  2MKZ A;  3FVG A;  2NOO A;  3LR1 A;  1BLF A;  1VE4 A;  3IJX B;  3MBP A;  1P1U A;  1B7H A;  3UP9 A;  3FAT A;  1GTK A;  4ECF A;  4E0W A;  4QHQ A;  5H8S A;  4I1D A;  1A7L A;  3UIF A;  4R2B A;  2R9J A;  1RDY A;  1P1O A;  4K3F A;  4PAK A;  1B3G A;  2DXR A;  4EQ7 A;  3ZKL A;  4M4G A;  3FXB A;  1M5D A;  4OYV A;  1DK4 A;  2DDK A;  3MVW A;  2O7U A;  3FVO A;  2DP8 A;  1FPE A;  2QS3 A;  2OZZ A;  2FNC A;  1HSJ A;  5H8F A;  3CRB A;  1R9L A;  3K1M A;  5DEX A;  4ELO A;  2ZNT A;  1N3X A;  1KA1 A;  5I59 B;  2Z8E A;  1MRP A;  2GHA A;  1SW5 A;  4GLI A;  3CR9 A;  4YB6 A;  4LZ5 A;  3RNN A;  2D3I A;  3FUZ A;  4R9F A;  4N8Y A;  1NV4 A;  3LUZ A;  3OSQ A;  1CE2 A;  1IQ7 A;  4GRK A;  2Z8F A;  2QVR A;  5IZZ A;  3FBP A;  3LSF B;  4PE5 B;  3KN7 A;  1OLC A;  3E79 A;  5B70 A;  1B0H A;  4YIC A;  5LDZ A;  1NMU A;  3SEX A;  4KR5 A;  3E4R A;  4XEQ A;  1B3F A;  1LFG A;  3MST A;  3VFJ A;  1NV5 A;  5H8Q A;  3THI A;  2QVV A;  1NUW A;  1IXH A;  1B5J A;  3B6T A;  3QUF A;  3MP1 A;  2Q89 A;  5TU0 A;  1XT8 A;  1YYZ A;  5I5P A;  1WVJ A;  1NV0 A;  1A54 A;  3O29 A;  1I6Q A;  4EQ9 A;  1FPK A;  2O84 X;  1Q35 A;  4GWO A;  3LBS A;  1RYX A;  4NED A;  1B05 A;  4FIM A;  1DMB A;  4H67 A;  4LVQ A;  1LAX A;  2X7Q A;  4NF5 B;  4XKQ A;  2DWI A;  5FTH A;  3K1N A;  1NKX A;  2V93 A;  3PMX A;  4GIZ A;  1SYH A;  3MVY A;  4OA4 A;  4I3Y A;  1FTM A;  2BJI A;  1SDX A;  4I3E A;  3C31 A;  1VR5 A;  3OSR A;  1NFT A;  1H76 A;  4L17 A;  1J1N A;  4OXV A;  3GLB A;  3VV5 A;  4H1X A;  2ONK E;  1SI1 A;  3HFU A;  3H6T A;  3KBR A;  1HSE A;  4KFQ A;  2ABH A;  4NWC A;  1QUI A;  4JWY A;  4KPT A;  3K01 A;  4PFB A;  1QKA A;  3D1R A;  3G3G A;  4GF8 A;  5KCJ B;  5EYF A;  1R6Z A;  3U93 A;  1DCU A;  3IB0 A;  3RPW A;  3KG2 A;  2F8D A;  4PC9 A;  4O7M A;  1IXG A;  2DS9 A;  3QUJ A;  4Z7E A;  2XWV A;  3RN8 A;  1KA0 A;  4P56 A;  3N5L A;  3C36 A;  4HW8 A;  2OWS A;  2THI A;  1AL3 A;  4R9G A;  1MDQ A;  1OVT A;  2PBW A;  4KYE A;  4GL0 A;  4RNS A;  4IO7 A;  1LEV A;  1NH8 A;  3JYR A;  4U22 A;  4YKP A;  3V89 B;  3EQ1 A;  2XWO A;  1Q9D A;  1PB7 A;  3GBB A;  4FAT A;  3A29 A;  5JTY A;  4ESW A;  4MAG A;  3KOT A;  1SI0 A;  3TTL A;  5BWJ A;  1NV7 A;  4IO3 A;  4LQ2 A;  2QRY A;  3IX1 A;  1USY E;  3USD A;  1B52 A;  3VVD A;  4BDL A;  2I48 A;  3BFU A;  4I40 A;  4R6H A;  3V5A A;  1UTH B;  3PD9 A;  2DE4 A;  4OEU A;  3C4M A;  4C1U A;  4O8M A;  5ELV A;  3T9H B;  5EQ8 A;  2WBB A;  4GVO A;  4ESX A;  4IGT A;  1TFD A;  3LUY A;  2REJ A;  3FJ7 A;  4NHB A;  2XHD A;  5EQA A;  2UXA A;  4THI A;  5I7I A;  3PUY E;  4KCC A;  1Y3N A;  4Z0I A;  5IZ3 B;  2XXI A;  4YMA A;  4GWS A;  1LAF E;  1XVX A;  3ZS6 A;  4H65 A;  1NV2 A;  3BIH A;  2UVJ A;  4Q8R A;  2AIX A;  3OEM A;  3S2V A;  3K1P A;  1MQH A;  2XX9 A;  1N7X A;  5EQ9 A;  3EHS A;  5CMB A;  1B1X A;  2CZH A;  4UA8 A;  4LZ7 A;  4TLL B;  4PET A;  3U92 A;  1MDP 1;  1S50 A;  4RK9 A;  1TFA A;  3K6W A;  4F1Y A;  2OWT A;  4NF6 A;  2XXV A;  4H46 A;  2WYK A;  5A5X A;  4TLM B;  1MQG A;  1L5T A;  4NF4 A;  1MXZ A;  2F3D A;  3U1O A;  5CMC A;  4NAP A;  4QXD A;  5F7V A;  4KQP A;  2I4B A;  4LAT A;  3TTM A;  3SKP A;  5ITO A;  3JZJ A;  3HHG A;  4F1U A;  2XXT A;  2B3B A;  1OQG A;  1DOT A;  4H6D A;  3TTR A;  2ZZX A;  1B1H A;  1IMC A;  1LBX A;  3CIJ A;  3A3C A;  2YPN A;  5AA4 B;  4ND9 A;  3U94 A;  3Q29 A;  5BUU A;  3FAS A;  1FPB A;  2D21 A;  4DCX A;  2O1L A;  3KJ7 A;  1H43 A;  1LST A;  1Y4T A;  5IAI A;  4N15 A;  2E0S A;  3K0V A;  3TQW A;  2XA5 A;  5I57 A;  3P7I A;  3CG3 A;  5DT6 A;  3SEU A;  3ZSF A;  3QYT A;  1MY3 A;  2OBG A;  2NWJ A;  1NNF A;  4LA9 A;  1SBP A;  1ZU0 A;  1FBG A;  3H6U A;  2L5V A;  1B51 A;  3ONM A;  4I9D A;  1D3K A;  5ET6 A;  1KWH A;  3MPL A;  2OCU A;  2V3U A;  2PYY A;  4HXV A;  4IB2 A;  1QW0 A;  1K9Y A;  1D9V A;  3HN0 A;  1YAE A;  1N04 A;  4RYA A;  4YKK A;  3G3H A;  1MQD A;  3KN8 A;  1MG1 A;  3MZ9 A;  1B58 A;  3O97 A;  3TKD A;  3Q25 A;  5L9O A;  1EZP A;  3ILU B;  3FJM A;  2XWI A;  1BIY A;  3D4G A;  5IM2 A;  2IEE A;  5AE4 A;  1GVC A;  4ZE9 A;  1FQD A;  1MXU A;  3QSL A;  1VFD A;  4G68 C;  4Q5T A;  4G8H A;  3E9X A;  2PVU A;  2RC8 A;  2A5S A;  1USY H;  2VPO A;  4DI3 D;  4ZDM A;  2O7I A;  2VPN A;  3FV2 A;  4H0W A;  5FTI A;  3SER A;  3DP6 A;  2CMO A;  3RYD A;  2CEY A;  4N4U A;  4RPO A;  4X8R A;  1EYK A;  2CZK A;  5CBR A;  1NV3 A;  2GFE A;  2DE2 A;  1T0K A;  2HQ0 A;  4FJP A;  1IIW A;  3QK6 A;  3G3K A;  4OAN A;  4WKM A;  4OER A;  4NGU A;  3Q27 A;  3TUS A;  4GWU A;  3TPA A;  4GX6 A;  1XVY A;  1MPB A;  1FW0 A;  2PX1 A;  5CM6 A;  3MVZ A;  3CFZ A;  1B4H A;  3PPR A;  1VFE A;  1P99 A;  1RDX A;  2R6G E;  4F3G A;  1TXF A;  1P1W A;  1SW2 A;  2ESN A;  4EF1 A;  3H03 A;  4U4X A;  2Y7I A;  1ANF A;  3R6U A;  1B5H A;  1LBY A;  4BDR A;  2DWH A;  3C34 A;  4N8G A;  3TYH A;  4EQB A;  2P3V A; 
#chains in the Genus database with same CATH homology
 1FPK A;  3T0J A;  4OVQ A;  2F3B A;  1NI9 A;  4MIJ A;  5EQ7 A;  1FBP A;  4NF0 A;  4NN3 A;  2VT5 A;  4MJO A;  1LBZ A;  4JVD A;  4PF6 A;  1SPI A;  4N17 A;  4OA4 A;  4I3Y A;  3B50 A;  2BJI A;  4MHF A;  5ET8 A;  1G0H A;  4I3E A;  4P1E A;  4M1V A;  2B4M A;  1EYI A;  3HFU A;  5DW8 A;  4HE0 A;  4OVS A;  2QVU A;  4OVT A;  4X9T A;  4IR8 A;  3T1B A;  3PTY A;  3ROJ A;  5IZ3 A;  4PFB A;  5JK4 A;  3D1R A;  1DBZ A;  2ZZV A;  2FVZ A;  1DCU A;  2QPQ A;  4PC9 A;  4O7M A;  4PF8 A;  2XWV A;  1KA0 A;  3MYU A;  2XWK A;  4P56 A;  1FBC A;  2PFZ A;  4OVR A;  1FJ6 A;  4P47 A;  5ET5 A;  1EYJ A;  1LEV A;  4QBA A;  1FTA A;  1IMD A;  4PBH A;  5LTC A;  4NQ8 A;  2XWO A;  1Q9D A;  3A29 A;  1IMB A;  4MAG A;  4MX6 A;  1NV7 A;  2ZZW A;  5EYH A;  4OVP A;  4HE1 A;  1G0I A;  5T3J A;  4HE2 A;  4I40 A;  5EYG A;  1FPD A;  4F18 A;  1NUZ A;  2DE4 A;  2OWZ A;  4O8M A;  5EQ8 A;  2WBB A;  3KC0 A;  2CZI A;  1LBW A;  4NHB A;  5EQA A;  4GWX A;  4GWW A;  4MCO A;  4LN5 A;  5I7I A;  2GQ1 A;  3RPL A;  4N6D A;  3U65 A;  5IZ3 B;  1FBE A;  3IFA A;  2FBP A;  4GWS A;  4PCD A;  1NV2 A;  1NUX A;  5I3S A;  1XI6 A;  3BIH A;  1CNQ A;  3NOH A;  2WEF A;  2V4C A;  1FRP A;  2WBD A;  1INP A;  3BIG A;  2KR0 A;  4MNI A;  5EQ9 A;  2FIE A;  2F5X A;  2CZH A;  4UAB A;  4P3L A;  3EKI A;  1AWB A;  1FPL A;  1FPG A;  4XFE A;  4DI4 B;  2B4L A;  4MMP A;  4PET A;  4JVC A;  4H45 A;  3QMF A;  4KXP A;  1FPF A;  4MNC A;  5IZ1 A;  1NUY A;  4H46 A;  2WYK A;  1NV1 A;  1RDZ A;  4NX1 A;  4HCW A;  2F3D A;  5IGA A;  5J1D A;  4NAP A;  4QXD A;  4MNP A;  3GYY A;  1IMF A;  1VDW A;  3SZP A;  2PCR A;  2HZL A;  1FBH A;  4AS4 A;  2XXK A;  2HPG A;  4F1U A;  1YXI A;  2ZZX A;  1IMA A;  2FHY A;  4O94 A;  1IMC A;  1YZ0 A;  2Q9T A;  2R8T A;  1LBX A;  3RPL B;  4PAF A;  4HCY A;  4YZZ A;  5ESY A;  5F24 A;  3B8B A;  1FPB A;  4F19 A;  2JJK A;  2DE3 A;  1FPJ A;  1FJ9 A;  4PAI A;  5J16 A;  2KQZ A;  3CHG A;  4N15 A;  4G61 A;  1FBF A;  3KBZ A;  2XA5 A;  3W9V A;  4X04 A;  2Q74 A;  1QGX A;  4GX4 A;  2FIX A;  5A5L A;  4JVI A;  1FBG A;  2L5V A;  4N91 A;  4GX3 A;  2OX3 A;  1LBV A;  5ET6 A;  2MKZ A;  1D9Q A;  4HXV A;  1KZ8 A;  1K9Y A;  4P8B A;  3KC1 A;  1RDY A;  4PAK A;  4GBV A;  5ET7 A;  3FXB A;  2Y5L A;  2XWI A;  3E78 A;  1DK4 A;  3IFC A;  2DDK A;  2HXR A;  2HHM A;  5IM2 A;  1NV6 A;  4XF5 A;  1FPE A;  1IME A;  1FBD A;  4GWZ A;  4PFR A;  2P3N A;  5FBP A;  4AS5 A;  1BK4 A;  2V3Q A;  2Q8M A;  2WX9 A;  4PGN A;  1JP4 A;  1K9Z A;  4FBP A;  2VPO A;  4PDH A;  4DI3 D;  4N6K A;  2VPN A;  1KA1 A;  4P9K A;  2PFY A;  3W9W A;  3RYD A;  2CEY A;  4N4U A;  4X8R A;  1EYK A;  2CZK A;  4N8Y A;  1NV4 A;  3LV0 A;  3LUZ A;  2HZK A;  1NV3 A;  2DE2 A;  2WYP A;  4NG7 A;  4OAN A;  4O7I A;  2QVR A;  2CEX A;  4PDD A;  4PFI A;  4GBW A;  5IZZ A;  4NGU A;  3FBP A;  2QFL A;  1FSA A;  4PTK A;  3E79 A;  4YIC A;  4GWU A;  4MEV A;  4GX6 A;  5LDZ A;  4N81 A;  4XEQ A;  4F1V A;  5CM6 A;  3MST A;  1NV5 A;  1RDX A;  4PGP A;  2DVZ A;  3ISP A;  2QVV A;  1NUW A;  4GWY A;  4P1L A;  1FPI A;  2Y5K A;  1YYZ A;  4PE3 A;  5I5P A;  1LBY A;  4PBQ A;  4N8G A;  1NV0 A;  2P3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...