1G0IA

Crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
252
structure length
252
Chain Sequence
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Crystal structure and catalytic mechanism of the MJ0109 gene product: a bifunctional enzyme with inositol monophosphatase and fructose 1,6-bisphosphatase activities.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 69
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2000-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1g0iA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1g0iA02
1QGXA 2GQ1A 3KBZA 5A5LA 5EYGA 1BK4A 2WBBA 3RYDA 1LEVA 3T0JA 1FJ9A 1FPEA 1NV5A 2OWZA 2FBPA 4HE2A 1KA1A 5J16A 1FPKA 1LBXA 4GWWA 4HE1A 4GWYA 4GX4A 4GWZA 4I40A 2Q74A 4G61A 1CNQA 3FBPA 5ET5A 5IZ3A 3A29A 1NI9A 4GBVA 1VDWA 4GBWA 2Q8MA 1FPFA 3LUZA 4KXPA 2HHMA 5EQ7A 5EQ8A 1JP4A 5EQAA 1DCUA 2CZIA 2R8TA 1G0HA 4I3EA 1LBYA 1D9QA 1FBHA 2QVVA 3KC0A 1NUZA 1FSAA 1NUXA 4GX6A 1LBWA 2PCRA 2F3BA 1FBGA 4AS5A 5EYHA 2WEFA 1DBZA 1G0IA 1FBDA 2FIEA 1IMFA 1NUWA 1LBZA 1EYJA 2JJKA 5ET7A 1FTAA 1FPLA 2OX3A 2QFLA 1DK4A 4PTKA 3D1RA 1FPJA 3RPLB 1NV4A 1INPA 1NV3A 1FPBA 3LV0A 1K9YA 2QVRA 1NV6A 4I3YA 2P3VA 1KZ8A 4GWSA 4QXDA 3B8BA 1FBFA 3BIHA 1KA0A 1FJ6A 2F3DA 4O7IA 1FRPA 2FIXA 2QVUA 3ROJA 1IMCA 1RDYA 3QMFA 2CZKA 5EQ9A 5ET6A 1YYZA 1RDZA 5I3SA 5FBPA 1NV2A 1XI6A 2CZHA 2Y5LA 1NUYA 2P3NA 5IZ3B 3IFCA 4HE0A 5F24A 2WBDA 3KC1A 1NV1A 1IMDA 1FPDA 3IFAA 5IZ1A 1AWBA 4N81A 5LDZA 2BJIA 4H45A 1K9ZA 1NV7A 1SPIA 1NV0A 2FHYA 2DDKA 1FPIA 1FBPA 1EYIA 1FBCA 1FBEA 1Q9DA 1RDXA 1EYKA 3BIGA 2VT5A 4GWUA 1LBVA 4GWXA 1IMAA 1YZ0A 4IR8A 3RPLA 2Y5KA 5T3JA 4FBPA 4H46A 1IMEA 4AS4A 1FPGA 1YXIA 4GX3A 1IMBA 2FVZA 5ET8A 4HXVA 5DW8A 5ESYA 4MJOA
chains in the Genus database with same CATH superfamily
3FUZA 4YB5A 1Y3NA 1I6BA 1PB8A 1J1NA 4RXLA 3RGYA 5TU0A 3OO6A 2QPQA 4GWWA 4NMYA 4G61A 2Z22A 3E3KA 3KFMA 2I3VA 1FQFA 1B3HA 3A3CA 4P0IA 5I56A 1FBHA 1IXHA 3BFUA 2XX9A 2MKZA 3S9LC 1R9LA 3OXNA 3O2AA 4H8IA 4IO2A 5TP9A 4U4XA 1CB6A 2I4BA 5ET7A 1LAHE 2QFLA 1OLAA 3EN3A 2NVUB 4PQJA 3OEKA 3OSQA 4EXLA 1B32A 3FZVA 3G3JA 3RPWA 3CG1A 1B40A 5I58A 2VD2A 3QMFA 4MIJA 1CE2A 1NV2A 1XVXA 1D4NA 4OVTA 1SW4A 2ZNSA 1I6AA 4G8NA 1LFIA 5F24A 5CRYA 1B3GA 2F7CA 4OVQA 2Z23A 3IFAA 2O69A 2FA7A 4RK9A 2ZNUA 5F7VA 4PBQA 1UTBA 3IB1A 3MVWA 3BIGA 1PBQA 2Y7KA 1B51A 1Y20A 4MLQA 3RQTA 4O3BA 4DLDA 4YICA 4OANA 4OEVA 2X26A 3E78A 2ZMBA 4MJOA 5I57B 5EYGA 4GLIA 5L8DA 1P1WA 4F3PA 4P11A 3IX1A 3FXQA 4BDLA 5AA3A 3G3HA 5L9OA 4NAPA 4H6DA 1SW5A 3C36A 3FD3A 4N6KA 2QSXA 2RF1A 3SEVA 5ELVA 5H8FA 4OYVA 3UN6A 4JXIA 3U8QA 1NNKA 4IO5A 3KC0A 1LCFA 1LBWA 4LZ8A 4P9KA 5DEXA 1MRPA 4MNCA 4BDNA 5AA4B 3K6UA 1G0IA 3B6TA 4DXCA 4BDRA 2H98A 4QSCA 4WXJA 3BFTA 2Y84A 2XX7A 4FIMA 1JW5A 3UIFA 3FJGA 2BJJX 4K3FA 4R6HA 3BIHA 5CBRA 1YCJA 2VPNA 4O7MA 1UIVA 1DPEA 4PFWA 3RT6B 2HFBA 1DSNA 2WYPA 1YAEA 1USYH 1AWBA 3P7IA 3SEWA 4PGPA 3NOHA 4KFQA 4YMAA 3EHTA 2XXTA 2DDKA 3PPRA 4PCDA 1MXVA 5I59B 3TTNA 3K6WA 1O63A 4LQ2A 4YZZA 3K1MA 2DE2A 2Y5KA 2V3TA 3TQLA 4AS4A 2X7PA 2FVZA 5ET8A 3TQWA 4QFPA 4AB5A 2HZKA 3CVGA 2GH9A 4U1OA 1SVXB 1B7HA 3IB0A 4IY6A 1MQHA 2QL3A 3VLVA 2XD2A 4GX4A 3HSTA 1NH8A 5ET5A 3R6UA 4ZE9A 1QKBA 3PD8A 4P8BA 4GBWA 3LUZA 2PBWA 2ONRA 1JP4A 4NTLA 1II5A 1ZJLA 3V8XB 2XD3A 5I2NB 4XKQA 1FSAA 3B50A 2XXHA 1ZLQA 4NWCA 1DBZA 1P1UA 4EUOA 1Y4CA 4YU0A 3UA8A 4NF0A 2I3WA 3EPEA 3PPPA 2OX3A 1NNTA 2THIA 2V3QA 2XWKA 1NV3A 2ESNA 3FVKA 3TTLA 2UVIA 3CSGA 4LP2B 3O6HA 4NQ8A 4WEPA 4I1DA 3ZSFA 2W7YA 1FRPA 2A5TB 2UVHA 3SEUA 3T9UA 3FXBA 2Z8FA 1RDZA 4EQ7A 3BKIB 2B4LA 4ZDMA 1XVYA 4Z7EA 4C0RA 2Z8DA 1N3XA 3USDA 4ZZEA 3T93B 3I3VA 5ICQA 2DWHA 1B5HA 4ZE8A 3RTWB 5EHSA 1WVJA 2AL4A 1LBVA 1SI1A 1IMAA 2PFYA 4YKKA 4ELOA 4IB2A 2XXRA 1MY1A 2GQ1A 2V3UA 3O6GA 3O6IA 1NKXA 2FBPA 2CZLA 2GRVA 5H8NA 4H0WA 1DTZA 4ELRA 5I2KA 4XXUA 3D4GA 4MCOA 2VD3A 1TXFA 4GBVA 2AYSA 2D3IA 5DVIA 3KOSA 4OETA 4N15A 4RJZA 1SD3A 5AA2B 2UYFA 4ND9A 1GV8A 4FAJA 1FBGA 3M3KA 3H3GA 3OO7A 3EHSA 2GHAA 4O3CA 4HCWA 4DXBA 3FV1A 1HSLA 5K2YA 1BP5A 3ECRA 3S4UA 2DS9A 4LZ5A 1H76A 2OCUA 1R1NA 1D9YA 2QVUA 2DXRA 4GIZA 1XI6A 3VVDA 4PAFA 2Y5LA 4NE4A 1JEVA 2X7QA 4U22A 1SDXA 3MSTA 4F3GA 4RYAA 3QUJA 1SYIA 2DE4A 1NV7A 3W9WA 2ZYKA 1SPIA 1NV0A 1H43A 4L17A 4LA9A 4KI0E 1ELJA 1VFDA 1IQ7A 2H5YA 1UTHB 4LN5A 2HCAA 1MH3A 2I49A 3KBZA 1FJ9A 1S9TA 1B5JA 1QW0A 4MEVA 3E79A 1TT1A 3OELA 4PBHA 2PT2A 2ANJA 4F19A 2WKYA 1PEBA 4XKNA 4GRKA 4MLVA 1FPFA 4RK2A 2UVJA 1GTKA 4MH5A 1M5FA 4N8GA 5AA2D 2QVVA 4NWDA 1MDQA 3AXFA 5EYHA 3MPKA 1JETA 1Q1KA 4Z0IA 4NG7A 2VPOA 4I62A 2JJKA 2Y7PA 2O84X 3PPNA 3SEYA 1OVTA 4GWSA 2HEUA 1KWHA 1B2HA 1MQDA 1FJ6A 3QAXA 4G77A 4I9DA 2CZKA 5ET6A 3WAFA 3K01A 1MM7A 5BUUA 3Q29A 4TOZA 1NUYA 3QSLA 1MY4A 3FASA 5IZ3B 2R9JA 4AQ4A 2HPGA 1LB8A 2O6AA 2H25A 4OVSA 2PX1A 3MZ9A 1FQEA 5B7DA 2XWOA 1XHYA 1B4HA 4XKPA 2OWSA 1A40A 3IO6A 3ILTB 4GWXA 4OHNA 3FJ7A 1B0LA 1MY2A 2P2AA 1FTMA 3EF7A 1MQIA 1OIBA 1TFDA 2ABHA 5I7IA 1B46A 5KDTA 3TODA 4HE1A 1POTA 3TEPA 2D5WA 4OERA 5CM6A 4FE8A 1MXYA 1IIWA 4F39A 1MY0A 3TTKA 1Y3PA 3VE1B 5KCJA 5EQ8A 4NN3A 4HS7A 1G0HA 1LBYA 2XXXA 3CHGA 2V4CA 1B05A 1PC3A 1FTLA 2F8DA 5JTYB 1GR2A 2P0SA 2UXAA 4OXVA 2FIEA 2XHDA 3PMVA 2PVUA 3B6WA 2CEXA 1VE4A 4I8CA 3R7XA 2KQZA 3FVNA 1P1QA 3T1BA 4U23A 1JEUA 5H8QA 4ZS9A 3B8BA 5HBCA 4MNIA 5L9SA 1VR5A 2ZXTA 4H65A 4YAHX 3E4RA 2B4MA 4NF5A 4IO6A 1N7XA 4H5FA 3OMBA 3K6XA 1LBCA 3MAMA 3V5AA 4KPTA 5H8HA 1IMDA 4X1DA 1M5CA 5DYHA 4XIGQ 4GQOA 2Y7RA 5I56B 4F3BA 1RDXA 1MXXA 1XC1A 2VT5A 2OK2A 4N4UA 5LOMA 2DP8A 4KCCA 2YLNA 5TP9B 1BKAA 5IGAA 1GGGA 1ZBMA 5A5LA 4M4GA 4MFIA 3T0JA 2HXRA 3H6VA 3O9PA 5DVJA 3Q27A 3O97A 3JV9A 5M2VA 1CNQA 1N0TA 5IAIA 4P56A 3H6WA 4HW8A 1N7WA 2H99A 2ZNTA 5B70A 4OESA 4BDMA 5I58B 3LBSA 3T9HB 3DLNA 4EF2A 3MP6A 4R2BA 5DTBA 4MHFA 2I0BA 1UTBB 4IY5A 2A5SA 1NV4A 2HXWA 3KN7A 4I3YA 2Y7WA 2DOJA 3VLWA 3LSWA 3RN8A 4NX1A 1QUKA 3PPQA 4MX6A 4ONYA 2V25A 1NL5A 3FXUA 4UABA 2V84A 1VFEA 1FPDA 3G3GA 1QJMA 1B3EA 2BJIA 5H8FB 2OPDA 3H6TA 1OLCA 2B65A 1BLFA 1EYIA 2HAVA 1B52A 1FBEA 2XXKA 4ZEKA 5DEXB 4KYEA 4R9GA 3VVEA 3TFLA 4KYDA 3FVGA 4GXAA 3CG3A 3GXAA 2QMWA 5EHMA 2VOZA 3B6QA 1QUJA 3C9HA 2PYYA 5ISUA 5CMKA 4DDDA 4QBAA 4HE2A 5IM2A 2RC9A 1KA1A 3HHGA 4FATA 2Q2CA 2Q74A 3MVYA 4FORA 1Y1MA 2GFEA 4DXUA 1NI9A 2CMOA 1NMUA 2Q8MA 1L5TA 5ITPA 1DCUA 3FXRA 3K4UA 3QXMA 2R8TA 1LAFE 4YKIA 2PFZA 4MF3A 4JSDA 4GWOA 4F2OA 1A8EA 3WAEA 4G8MA 2RKMA 3L6GA 2F6GA 4P1EA 2XA5A 4LONB 4Q30B 4EDPA 3MP8A 5A5XA 1DK4A 1FPBA 3IOWA 4RPNA 1NV6A 3A3UA 2OBGA 1POY1 3H03A 3EHUA 2I0CA 3KSXA 3C32A 3PGFA 4IO3A 3IL1B 1YYZA 3OOAA 2REGA 4ESWA 3HV1A 4PFTA 4JWOA 1OMPA 1AMFA 3MC2A 4KCDA 3FGSA 1S50A 2FHYA 1B58A 2KLFA 1N04A 1DMBA 2IA4A 4OWDA 4ESXA 4GWUA 4NF8A 2OZZA 4OVPA 2DWIA 3F11A 5F1QA 4JSOA 2RINA 3N26A 3ZS6A 4PFUA 3DM0A 5FTIA 3D4CA 2OWZA 4PFIA 5J16A 4WKMA 4R74A 4GWYA 3Q25A 3U94A 3O28A 3FBPA 3S2VA 5BWJA 4G4PA 3KN3A 1TWYA 5H8SA 1B3LA 3HFUA 4KXPA 3LUYA 4G2ZA 5EQAA 4DZ1A 4YKJA 4OVJA 2HZLA 1MQGA 4QFNA 1QKAA 4BDOA 3N94A 1HSJA 4F29A 4M1VA 5LTCA 2F78A 4GVOA 1H45A 1SBPA 1XS5A 1ZMGA 4OA4A 3QIMA 1LLSA 3PUWE 2R6GE 3S9EA 1Y4TA 2IEEA 3HCQA 2HQ0A 3H4ZA 2Q9TA 5FTHA 3KG2A 1LBBA 3HHFA 5H8NB 4GL8A 3G3KA 5I2KB 4QFLA 2QMXA 1JQFA 3OEMA 4G68C 1ZU0A 2WBDA 3S9MC 1M5DA 5LDZA 4H45A 3PUYE 4N13A 3QYTA 1WDNA 1FPIA 3G3IA 1Q9DA 3Q26A 3RPLA 4JVIA 4N91A 3KN8A 1Z7NE 1VSOA 1YXIA 3H06B 3K2DA 1FTKA 3FJMA 2OPEA 3PD9A 1BK4A 2WBBA 3T9XB 3CFLA 3DELB 4GF8A 3M3FA 1QULA 3S9NC 4GXSB 3KEIA 1OQHA 4PE3A 4R72A 4FECA 3IORA 1OQGA 3A29A 4DI3D 1AIVA 2E1SA 1VDWA 5AA1A 4YKPA 4XFEA 4JVCA 2O1LA 3U65A 4Q5TA 3TKDA 5CMBA 4N6PA 3UK4A 3MZ1A 1H3DA 2I4CA 2QS4A 1B0HA 3UGWA 3MBPA 2O51A 1IZ1A 4GOTA 1USYE 1ZTYA 4PF8A 1FPJA 1INPA 3R26A 4LQ5A 4ZEIA 4C1TA 2P3VA 1KZ8A 3TUSA 1B1XA 2F6PA 4ECFA 3PMXA 3TTRA 3VFJA 3RNNA 1SW1A 2L5VA 1IMCA 1FCKA 3BBRA 1JVYA 4P47A 4XF5A 2NXOA 1PB7A 4F18A 1M5EA 5I84A 1QUIA 2P3NA 4YMBA 4U21A 4HE0A 4PDDA 4LATA 1EH3A 5TPAA 3PMWA 4NHBA 4X04A 3EQ1A 3U72A 3G3FA 2Q89A 2RC7A 3TCFA 1MXWA 2OWTA 3CFZA 1D9VA 1AL3A 1JW4A 2ZZVA 4GX3A 2ZZWA 3GZGA 3OD7A 1FQBA 4THIA 4OMBA 5DW8A 5ESYA 2ALUA 2YJPA 2P1SA 3FATA 1FTOA 3C31A 5I5PA 4MNPA 1A8FA 4P3LA 4RA1A 4PFYA 3MVZA 3SKPA 4GWZA 1MPDA 3K0VA 1B1HA 4NEDA 2F34A 4QFKA 4DCYA 3E13X 1RKMA 2DXYA 3T9VA 3RUMA 3V83A 5EQ7A 4N17A 2CZIA 2XWIA 3ZKKA 3IB2A 3IOVA 3MP1A 4JVDA 1LAGE 2FNCA 4KYSA 3N5LA 5AE4A 1O64A 1MQJA 4AS5A 2NOOA 4NF6A 4PFBA 4OZ9A 1MH4A 1IXCA 1XOCA 4G68A 4EF1A 5HM4B 2XXYA 5CI5A 1NUWA 4KQPA 3SERA 2O7IA 5EYFA 4EQBA 1B7ZA 3TCHA 1B6HA 3LV0A 4ELPA 1IITA 3N6TA 5JK4A 3TELA 1KA0A 3GLBA 3K02A 3RT8A 3PPOA 5EQ9A 1N84A 5I3SA 5KDTB 3QUFA 3JYRA 5DVFA 1Y1ZA 2ZYNA 1R9QA 5ITOA 1ANFA 3PUVE 3CIJA 2ONSA 3KOTA 3V89B 3KC1A 4POWA 2XXUA 4ZECA 5KCJB 1K9ZA 2WYKA 4BDQA 1SYHA 1FBPA 1GVCA 4ZEFA 4O8MA 3CRBA 2B3FA 5CMCA 4PAIA 1IMBA 2DSFA 4HXVA 3ILUB 2F5XA 1QGXA 1N3WA 3IAZA 1UQWA 4F1VA 1LBXA 4JWYA 5J1DA 4OQOA 5H8QB 1BTJA 4FEDA 1FQAA 1LCTA 5L9MA 4G8HA 2H9BA 4PC9A 5CBSA 3C35A 2HHMA 1MPCA 4C1UA 4NF5B 4TQUQ 2F36A 1NNPA 1PBPA 1D9QA 3I5OA 4FEBA 5H8HB 3MJNA 2CEYA 4ZZAA 3DP8A 3OENA 4LZ7A 3U92A 2F7AA 3CSBA 3K00A 5I57A 3T66A 4UACA 4EQ9A 1EZ9A 3KJTA 4JBZA 4PTKA 2DYXA 1EU8A 4QSDA 4QSEA 1RYOA 4O3AA 1FBFA 2F3DA 4QRZA 2FIXA 3MYUA 3KZGA 3T22A 4GD5A 3PV0E 2CZHA 3HPIA 1MDP1 2DQVA 1EZPA 4H8JA 3IOUA 4N81A 3MW0A 1A55A 5AA4A 4LUBA 2VP1A 4GL0A 4QFOA 2FYIA 4DIGA 3VDFA 4ISUA 2REJA 2I6EA 5FHNA 3M3LA 2B3BA 3W9VA 4FBPA 3VLUA 2QRYA 3EKIA 4OEUA 3TAJA 1Z7ME 4PETA 2VGQA 4N8YA 1URSA 1EZOA 1UIUA 1B4ZA 4N6DA 3RYDA 1LEVA 3GBAA 4HCYA 4N07A 2YPNA 4I40A 2O68A 5FHOA 3HO7A 2RCBA 2DVCA 4X8RA 3A09A 2Q8JA 4BLAA 1DPPA 4YB6A 3TCGA 2AIXA 3T96B 1NUZA 5I59A 3ONMA 4XEQA 3LSLA 1IXIA 3E9XA 2WEFA 2QS3A 4RNSA 3C4MA 2NUVA 3TDJA 3PUXE 1XT8A 1MS7A 1FTAA 1N76A 1Y9UA 3D1RA 2PMSA 3MZBA 3VV5A 3KJ7A 4JDFA 3IK6B 2QS1A 3K6VA 1JNFA 4H5GA 2NWJA 4KR5A 1A54A 2UYEA 4PE5B 2M8CA 1URDA 5FBPA 5I2NA 3W15C 4P1LA 1ZIUA 4XTCQ 3IFCA 3H6UA 4GFRA 4F1UA 1JVXA 4NF4A 4O94A 1LFGA 3SESA 2LAOA 1IXGA 4TLLB 3OO8A 2O1MA 3MPLA 1JW1A 2XWVA 1H44A 1AH5A 1IUDA 1AOVA 4QHQA 3K1NA 1MG1A 2KR0A 4JWXA 3HN0A 4Q0CA 2A5TA 3C33A 4HTGA 3THIA 1LGBC 5A5XB 4MAGA 4OTEA 1B3FA 2G29A 4PFRA 1NNFA 2DWJA 4X9TA 1R6ZA 4NF4B 1BIYA 4ZEBA 1MXUA 3L6HA 1DTGA 1MM6A 3LC8A 5CMMA 4PAKA 1DOTA 4MMPA 4R9FA 3VXBA 4JB7A 5JEIA 1T0KA 3K1PA 2ONKE 3VVFA 4TLMB 3MWBA 1LB9A 1NUXA 4FJPA 2PCRA 1MPBA 3GYYA 3MUQA 1YTVA 1I6QA 3ODBA 3IR1A 1LBZA 1LSTA 3CFXA 2VHAA 1FPLA 3TPAA 1YPNA 3PTYA 4NF8B 1RYXA 1B7UA 2QVRA 1SQYA 3LR1A 4F1YA 2I58A 1URGA 3SZPA 2XXVA 4O7IA 3IJOB 4YB7A 1PDAA 4PP0A 1RDYA 1IEJA 2Y7IA 3ISPA 2I48A 2DWAA 3PU5A 1LAXA 2O7UA 2G93A 5AA2A 3FV2A 4R75A 1Q35A 1S7YA 1ATGA 1NV1A 4X1BA 4F2QA 4POXA 4WEDA 4U2RA 1FQCA 1US4A 5HPQA 4IO4A 4R6YA 1FW0A 2D21A 2Q88A 4E0XA 4QF9A 1YZ0A 4IR8A 2XXQA 5FHMA 3SEXA 4H67A 3IOTA 5DT6A 2XX8A 4R6KA 2ZYOA 3TMGA 1M5BA 2RC8A 1SI0A 4OFJA 1NV5A 4H1XA 4OVRA 2GHBA 2ZZXA 5IKBA 1SW2A 4F31B 1US5A 4ZEDA 4F3SA 4KD5A 2PT1A 4UA8A 4I3EA 3O66A 4F22A 4AB6A 2RCAA 2F7BA 2OJTA 1F9BA 2F3BA 3QK6A 1UTHA 4IO7A 3U1OA 1FBDA 3UORA 2Q2AA 3Q28A 2XXWA 1A99A 3RPLB 3OSRA 1P1NA 4PDHA 3M8UA 1K9YA 1WODA 3RY3A 3RLFE 4QXDA 2F35A 1NH7A 4X48A 5KZTA 4Q8RA 1MY3A 2R71A 3ROJA 3IO4A 3SETA 3VXCA 2E0SA 4EXKA 3DP6A 2HAUA 2WX9A 2OLBA 2DE3A 4R2FA 3IJXB 3UP9A 1P1OA 5CC2A 1FBCA 5K2XA 1EYKA 3SDFA 3KSJA 4E0WA 1FQDA 3OO9A 1MXZA 1A7LA 1NFTA 2ZYMA 3TYHA 5T3JA 1FPGA 1TFAA 1P99A 1FPEA 4U1ZA 3DP4A 3TZAA 3C34A 4XKRA 2AL5A 1FPKA 4DE8A 4LVQA 2V93A 1ZKBA 4OFOA 3PUZE 5IZ3A 3N6UA 1Y3QA 1OVBA 2DVZA 2XXPA 4OENA 3O29A 1D3KA 1B5IA 4OFLA 4GX6A 5TPAB 1I69A 2F97A 4R73A 4MBPA 1FTJA 3G7WA 3CI8A 3LSXA 3GBBA 3CR9A 1IMFA 3JZJA 3LSFB 2XXIA 4RY1A 1EYJA 3H7MA 2UVGA 3I6VA 2QJEA 3FVOA 1B9JA 3FIRA 3ZKLA 3KGCA 1O7TA 4NGUA 3RTFB 4KHZE 4DI4B 4PF6A 2Z8EA 1LFHA 4PGNA 3B7DA 4U4SA 4P0GA 4DCXA 3TTMA 1QVSA 5IZ1A 2H4IA 3MQ9A 4ELQA 5JTYA 3MVXA 5ICTA 5IZZA 4IGTA 4IGRA 1PB9A 4NF6B 4RPOA 2QS2A 1HSEA 4H46A 1IMEA 4G68B 3U93A 3KBRA
chains in the Genus database with same CATH topology
3KBZA 4N6DA 3RYDA 1LEVA 1FJ9A 2OWZA 4HCYA 4PFIA 5J16A 4MEVA 2QPQA 4GWWA 3E79A 4GWYA 4I40A 4G61A 3FBPA 4X8RA 4PBHA 4F19A 1FPFA 3HFUA 4KXPA 5EQAA 2HZLA 4N8GA 1FBHA 2QVVA 1NUZA 2MKZA 4XEQA 5EYHA 2WEFA 4M1VA 5LTCA 4NG7A 2VPOA 2JJKA 5ET7A 1FTAA 2QFLA 3D1RA 4OA4A 4GWSA 1FJ6A 2Q9TA 3QMFA 2CZKA 5ET6A 4MIJA 5FBPA 1NV2A 4OVTA 1NUYA 4P1LA 5IZ3B 3IFCA 2HPGA 5F24A 2WBDA 4F1UA 4OVQA 3IFAA 4O94A 5LDZA 4OVSA 4H45A 2XWOA 4PBQA 1FPIA 1Q9DA 3BIGA 4GWXA 4YICA 2XWVA 3RPLA 4JVIA 4N91A 4OANA 1YXIA 2KR0A 3E78A 4MJOA 5EYGA 1BK4A 2WBBA 4MAGA 5I7IA 4PFRA 4X9TA 4HE1A 4PE3A 5CM6A 3A29A 4DI3D 4NAPA 1VDWA 4N6KA 4PAKA 4MMPA 5EQ8A 4NN3A 4XFEA 4JVCA 1G0HA 1LBYA 3U65A 3KC0A 3CHGA 2V4CA 1NUXA 1LBWA 2PCRA 4P9KA 4MNCA 3GYYA 1G0IA 2FIEA 1LBZA 1FPLA 2CEXA 3PTYA 4PF8A 1FPJA 1INPA 2KQZA 2QVRA 3T1BA 2P3VA 1KZ8A 3B8BA 3SZPA 3BIHA 4O7IA 4MNIA 2VPNA 4O7MA 2L5VA 1IMCA 1RDYA 2B4MA 3ISPA 4P47A 4XF5A 4F18A 2P3NA 2WYPA 4HE0A 4PDDA 1NV1A 1IMDA 1AWBA 4PGPA 3NOHA 4NHBA 4X04A 2DDKA 4PCDA 1RDXA 2VT5A 4N4UA 4YZZA 2ZZVA 1YZ0A 4IR8A 2DE2A 2Y5KA 4AS4A 4GX3A 2ZZWA 2FVZA 5ET8A 5DW8A 5ESYA 5IGAA 5I5PA 4MNPA 5A5LA 2HZKA 4P3LA 3T0JA 1NV5A 4OVRA 2HXRA 2ZZXA 4GX4A 4GWZA 1CNQA 5ET5A 4P56A 4P8BA 4GBWA 3LUZA 5EQ7A 4N17A 1JP4A 2CZIA 2XWIA 4I3EA 4JVDA 1FSAA 3B50A 2F3BA 4AS5A 4PFBA 1DBZA 1FBDA 4NF0A 1NUWA 4MHFA 2OX3A 2V3QA 3RPLB 2XWKA 1NV4A 1NV3A 4PDHA 3LV0A 1K9YA 4I3YA 4NQ8A 4QXDA 5JK4A 1KA0A 1FRPA 4NX1A 3FXBA 3ROJA 4MX6A 5EQ9A 5I3SA 1RDZA 2B4LA 4UABA 3KC1A 1FPDA 2WX9A 2BJIA 2DE3A 1K9ZA 2WYKA 1FBPA 1EYIA 1FBCA 1FBEA 4O8MA 1EYKA 2XXKA 1LBVA 1IMAA 2PFYA 5T3JA 1FPGA 4PAIA 1IMBA 4HXVA 2F5XA 1QGXA 2GQ1A 1FPEA 2FBPA 4QBAA 4F1VA 4HE2A 5IM2A 1KA1A 1FPKA 1LBXA 5J1DA 2Q74A 5IZ3A 4MCOA 1NI9A 4PC9A 4GBVA 2DVZA 2Q8MA 2HHMA 1DCUA 4N15A 2R8TA 1D9QA 2PFZA 4GX6A 1FBGA 2CEYA 1IMFA 4HCWA 4P1EA 2XA5A 1EYJA 1DK4A 4PTKA 1FPBA 1NV6A 4NGUA 1FBFA 2F3DA 4DI4B 2FIXA 4PF6A 3MYUA 4PGNA 2QVUA 1YYZA 1XI6A 2CZHA 4PAFA 2Y5LA 3MSTA 5IZ1A 4N81A 2DE4A 1NV7A 3W9WA 1SPIA 1NV0A 2FHYA 5IZZA 4GWUA 4OVPA 3W9VA 4FBPA 4H46A 1IMEA 3EKIA 4LN5A 4PETA 4N8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGX A;  2GQ1 A;  3KBZ A;  5A5L A;  5EYG A;  1BK4 A;  2WBB A;  3RYD A;  1LEV A;  3T0J A;  1FJ9 A;  1FPE A;  1NV5 A;  2OWZ A;  2FBP A;  4HE2 A;  1KA1 A;  5J16 A;  1FPK A;  1LBX A;  4GWW A;  4HE1 A;  4GWY A;  4GX4 A;  4GWZ A;  4I40 A;  2Q74 A;  4G61 A;  1CNQ A;  3FBP A;  5ET5 A;  5IZ3 A;  3A29 A;  1NI9 A;  4GBV A;  1VDW A;  4GBW A;  2Q8M A;  1FPF A;  3LUZ A;  4KXP A;  2HHM A;  5EQ7 A;  5EQ8 A;  1JP4 A;  5EQA A;  1DCU A;  2CZI A;  2R8T A;  1G0H A;  4I3E A;  1LBY A;  1D9Q A;  1FBH A;  2QVV A;  3KC0 A;  1NUZ A;  1FSA A;  1NUX A;  4GX6 A;  1LBW A;  2PCR A;  2F3B A;  1FBG A;  4AS5 A;  5EYH A;  2WEF A;  1DBZ A;  1G0I A;  1FBD A;  2FIE A;  1IMF A;  1NUW A;  1LBZ A;  1EYJ A;  2JJK A;  5ET7 A;  1FTA A;  1FPL A;  2OX3 A;  2QFL A;  1DK4 A;  4PTK A;  3D1R A;  1FPJ A;  3RPL B;  1NV4 A;  1INP A;  1NV3 A;  1FPB A;  3LV0 A;  1K9Y A;  2QVR A;  1NV6 A;  4I3Y A;  2P3V A;  1KZ8 A;  4GWS A;  4QXD A;  3B8B A;  1FBF A;  3BIH A;  1KA0 A;  1FJ6 A;  2F3D A;  4O7I A;  1FRP A;  2FIX A;  2QVU A;  3ROJ A;  1IMC A;  1RDY A;  3QMF A;  2CZK A;  5EQ9 A;  5ET6 A;  1YYZ A;  1RDZ A;  5I3S A;  5FBP A;  1NV2 A;  1XI6 A;  2CZH A;  2Y5L A;  1NUY A;  2P3N A;  5IZ3 B;  3IFC A;  4HE0 A;  5F24 A;  2WBD A;  3KC1 A;  1NV1 A;  1IMD A;  1FPD A;  3IFA A;  5IZ1 A;  1AWB A;  4N81 A;  5LDZ A;  2BJI A;  4H45 A;  1K9Z A;  1NV7 A;  1SPI A;  1NV0 A;  2FHY A;  2DDK A;  1FPI A;  1FBP A;  1EYI A;  1FBC A;  1FBE A;  1Q9D A;  1RDX A;  1EYK A;  3BIG A;  2VT5 A;  4GWU A;  1LBV A;  4GWX A;  1IMA A;  1YZ0 A;  4IR8 A;  3RPL A;  2Y5K A;  5T3J A;  4FBP A;  4H46 A;  1IME A;  4AS4 A;  1FPG A;  1YXI A;  4GX3 A;  1IMB A;  2FVZ A;  5ET8 A;  4HXV A;  5DW8 A;  5ESY A;  4MJO A; 
#chains in the Genus database with same CATH topology
 3FUZ A;  4YB5 A;  1Y3N A;  1I6B A;  1PB8 A;  1J1N A;  4RXL A;  3RGY A;  5TU0 A;  3OO6 A;  2QPQ A;  4GWW A;  4NMY A;  4G61 A;  2Z22 A;  3E3K A;  3KFM A;  2I3V A;  1FQF A;  1B3H A;  3A3C A;  4P0I A;  5I56 A;  1FBH A;  1IXH A;  3BFU A;  2XX9 A;  2MKZ A;  3S9L C;  1R9L A;  3OXN A;  3O2A A;  4H8I A;  4IO2 A;  5TP9 A;  4U4X A;  1CB6 A;  2I4B A;  5ET7 A;  1LAH E;  2QFL A;  1OLA A;  3EN3 A;  2NVU B;  4PQJ A;  3OEK A;  3OSQ A;  4EXL A;  1B32 A;  3FZV A;  3G3J A;  3RPW A;  3CG1 A;  1B40 A;  5I58 A;  2VD2 A;  3QMF A;  4MIJ A;  1CE2 A;  1NV2 A;  1XVX A;  1D4N A;  4OVT A;  1SW4 A;  2ZNS A;  1I6A A;  4G8N A;  1LFI A;  5F24 A;  5CRY A;  1B3G A;  2F7C A;  4OVQ A;  2Z23 A;  3IFA A;  2O69 A;  2FA7 A;  4RK9 A;  2ZNU A;  5F7V A;  4PBQ A;  1UTB A;  3IB1 A;  3MVW A;  3BIG A;  1PBQ A;  2Y7K A;  1B51 A;  1Y20 A;  4MLQ A;  3RQT A;  4O3B A;  4DLD A;  4YIC A;  4OAN A;  4OEV A;  2X26 A;  3E78 A;  2ZMB A;  4MJO A;  5I57 B;  5EYG A;  4GLI A;  5L8D A;  1P1W A;  4F3P A;  4P11 A;  3IX1 A;  3FXQ A;  4BDL A;  5AA3 A;  3G3H A;  5L9O A;  4NAP A;  4H6D A;  1SW5 A;  3C36 A;  3FD3 A;  4N6K A;  2QSX A;  2RF1 A;  3SEV A;  5ELV A;  5H8F A;  4OYV A;  3UN6 A;  4JXI A;  3U8Q A;  1NNK A;  4IO5 A;  3KC0 A;  1LCF A;  1LBW A;  4LZ8 A;  4P9K A;  5DEX A;  1MRP A;  4MNC A;  4BDN A;  5AA4 B;  3K6U A;  1G0I A;  3B6T A;  4DXC A;  4BDR A;  2H98 A;  4QSC A;  4WXJ A;  3BFT A;  2Y84 A;  2XX7 A;  4FIM A;  1JW5 A;  3UIF A;  3FJG A;  2BJJ X;  4K3F A;  4R6H A;  3BIH A;  5CBR A;  1YCJ A;  2VPN A;  4O7M A;  1UIV A;  1DPE A;  4PFW A;  3RT6 B;  2HFB A;  1DSN A;  2WYP A;  1YAE A;  1USY H;  1AWB A;  3P7I A;  3SEW A;  4PGP A;  3NOH A;  4KFQ A;  4YMA A;  3EHT A;  2XXT A;  2DDK A;  3PPR A;  4PCD A;  1MXV A;  5I59 B;  3TTN A;  3K6W A;  1O63 A;  4LQ2 A;  4YZZ A;  3K1M A;  2DE2 A;  2Y5K A;  2V3T A;  3TQL A;  4AS4 A;  2X7P A;  2FVZ A;  5ET8 A;  3TQW A;  4QFP A;  4AB5 A;  2HZK A;  3CVG A;  2GH9 A;  4U1O A;  1SVX B;  1B7H A;  3IB0 A;  4IY6 A;  1MQH A;  2QL3 A;  3VLV A;  2XD2 A;  4GX4 A;  3HST A;  1NH8 A;  5ET5 A;  3R6U A;  4ZE9 A;  1QKB A;  3PD8 A;  4P8B A;  4GBW A;  3LUZ A;  2PBW A;  2ONR A;  1JP4 A;  4NTL A;  1II5 A;  1ZJL A;  3V8X B;  2XD3 A;  5I2N B;  4XKQ A;  1FSA A;  3B50 A;  2XXH A;  1ZLQ A;  4NWC A;  1DBZ A;  1P1U A;  4EUO A;  1Y4C A;  4YU0 A;  3UA8 A;  4NF0 A;  2I3W A;  3EPE A;  3PPP A;  2OX3 A;  1NNT A;  2THI A;  2V3Q A;  2XWK A;  1NV3 A;  2ESN A;  3FVK A;  3TTL A;  2UVI A;  3CSG A;  4LP2 B;  3O6H A;  4NQ8 A;  4WEP A;  4I1D A;  3ZSF A;  2W7Y A;  1FRP A;  2A5T B;  2UVH A;  3SEU A;  3T9U A;  3FXB A;  2Z8F A;  1RDZ A;  4EQ7 A;  3BKI B;  2B4L A;  4ZDM A;  1XVY A;  4Z7E A;  4C0R A;  2Z8D A;  1N3X A;  3USD A;  4ZZE A;  3T93 B;  3I3V A;  5ICQ A;  2DWH A;  1B5H A;  4ZE8 A;  3RTW B;  5EHS A;  1WVJ A;  2AL4 A;  1LBV A;  1SI1 A;  1IMA A;  2PFY A;  4YKK A;  4ELO A;  4IB2 A;  2XXR A;  1MY1 A;  2GQ1 A;  2V3U A;  3O6G A;  3O6I A;  1NKX A;  2FBP A;  2CZL A;  2GRV A;  5H8N A;  4H0W A;  1DTZ A;  4ELR A;  5I2K A;  4XXU A;  3D4G A;  4MCO A;  2VD3 A;  1TXF A;  4GBV A;  2AYS A;  2D3I A;  5DVI A;  3KOS A;  4OET A;  4N15 A;  4RJZ A;  1SD3 A;  5AA2 B;  2UYF A;  4ND9 A;  1GV8 A;  4FAJ A;  1FBG A;  3M3K A;  3H3G A;  3OO7 A;  3EHS A;  2GHA A;  4O3C A;  4HCW A;  4DXB A;  3FV1 A;  1HSL A;  5K2Y A;  1BP5 A;  3ECR A;  3S4U A;  2DS9 A;  4LZ5 A;  1H76 A;  2OCU A;  1R1N A;  1D9Y A;  2QVU A;  2DXR A;  4GIZ A;  1XI6 A;  3VVD A;  4PAF A;  2Y5L A;  4NE4 A;  1JEV A;  2X7Q A;  4U22 A;  1SDX A;  3MST A;  4F3G A;  4RYA A;  3QUJ A;  1SYI A;  2DE4 A;  1NV7 A;  3W9W A;  2ZYK A;  1SPI A;  1NV0 A;  1H43 A;  4L17 A;  4LA9 A;  4KI0 E;  1ELJ A;  1VFD A;  1IQ7 A;  2H5Y A;  1UTH B;  4LN5 A;  2HCA A;  1MH3 A;  2I49 A;  3KBZ A;  1FJ9 A;  1S9T A;  1B5J A;  1QW0 A;  4MEV A;  3E79 A;  1TT1 A;  3OEL A;  4PBH A;  2PT2 A;  2ANJ A;  4F19 A;  2WKY A;  1PEB A;  4XKN A;  4GRK A;  4MLV A;  1FPF A;  4RK2 A;  2UVJ A;  1GTK A;  4MH5 A;  1M5F A;  4N8G A;  5AA2 D;  2QVV A;  4NWD A;  1MDQ A;  3AXF A;  5EYH A;  3MPK A;  1JET A;  1Q1K A;  4Z0I A;  4NG7 A;  2VPO A;  4I62 A;  2JJK A;  2Y7P A;  2O84 X;  3PPN A;  3SEY A;  1OVT A;  4GWS A;  2HEU A;  1KWH A;  1B2H A;  1MQD A;  1FJ6 A;  3QAX A;  4G77 A;  4I9D A;  2CZK A;  5ET6 A;  3WAF A;  3K01 A;  1MM7 A;  5BUU A;  3Q29 A;  4TOZ A;  1NUY A;  3QSL A;  1MY4 A;  3FAS A;  5IZ3 B;  2R9J A;  4AQ4 A;  2HPG A;  1LB8 A;  2O6A A;  2H25 A;  4OVS A;  2PX1 A;  3MZ9 A;  1FQE A;  5B7D A;  2XWO A;  1XHY A;  1B4H A;  4XKP A;  2OWS A;  1A40 A;  3IO6 A;  3ILT B;  4GWX A;  4OHN A;  3FJ7 A;  1B0L A;  1MY2 A;  2P2A A;  1FTM A;  3EF7 A;  1MQI A;  1OIB A;  1TFD A;  2ABH A;  5I7I A;  1B46 A;  5KDT A;  3TOD A;  4HE1 A;  1POT A;  3TEP A;  2D5W A;  4OER A;  5CM6 A;  4FE8 A;  1MXY A;  1IIW A;  4F39 A;  1MY0 A;  3TTK A;  1Y3P A;  3VE1 B;  5KCJ A;  5EQ8 A;  4NN3 A;  4HS7 A;  1G0H A;  1LBY A;  2XXX A;  3CHG A;  2V4C A;  1B05 A;  1PC3 A;  1FTL A;  2F8D A;  5JTY B;  1GR2 A;  2P0S A;  2UXA A;  4OXV A;  2FIE A;  2XHD A;  3PMV A;  2PVU A;  3B6W A;  2CEX A;  1VE4 A;  4I8C A;  3R7X A;  2KQZ A;  3FVN A;  1P1Q A;  3T1B A;  4U23 A;  1JEU A;  5H8Q A;  4ZS9 A;  3B8B A;  5HBC A;  4MNI A;  5L9S A;  1VR5 A;  2ZXT A;  4H65 A;  4YAH X;  3E4R A;  2B4M A;  4NF5 A;  4IO6 A;  1N7X A;  4H5F A;  3OMB A;  3K6X A;  1LBC A;  3MAM A;  3V5A A;  4KPT A;  5H8H A;  1IMD A;  4X1D A;  1M5C A;  5DYH A;  4XIG Q;  4GQO A;  2Y7R A;  5I56 B;  4F3B A;  1RDX A;  1MXX A;  1XC1 A;  2VT5 A;  2OK2 A;  4N4U A;  5LOM A;  2DP8 A;  4KCC A;  2YLN A;  5TP9 B;  1BKA A;  5IGA A;  1GGG A;  1ZBM A;  5A5L A;  4M4G A;  4MFI A;  3T0J A;  2HXR A;  3H6V A;  3O9P A;  5DVJ A;  3Q27 A;  3O97 A;  3JV9 A;  5M2V A;  1CNQ A;  1N0T A;  5IAI A;  4P56 A;  3H6W A;  4HW8 A;  1N7W A;  2H99 A;  2ZNT A;  5B70 A;  4OES A;  4BDM A;  5I58 B;  3LBS A;  3T9H B;  3DLN A;  4EF2 A;  3MP6 A;  4R2B A;  5DTB A;  4MHF A;  2I0B A;  1UTB B;  4IY5 A;  2A5S A;  1NV4 A;  2HXW A;  3KN7 A;  4I3Y A;  2Y7W A;  2DOJ A;  3VLW A;  3LSW A;  3RN8 A;  4NX1 A;  1QUK A;  3PPQ A;  4MX6 A;  4ONY A;  2V25 A;  1NL5 A;  3FXU A;  4UAB A;  2V84 A;  1VFE A;  1FPD A;  3G3G A;  1QJM A;  1B3E A;  2BJI A;  5H8F B;  2OPD A;  3H6T A;  1OLC A;  2B65 A;  1BLF A;  1EYI A;  2HAV A;  1B52 A;  1FBE A;  2XXK A;  4ZEK A;  5DEX B;  4KYE A;  4R9G A;  3VVE A;  3TFL A;  4KYD A;  3FVG A;  4GXA A;  3CG3 A;  3GXA A;  2QMW A;  5EHM A;  2VOZ A;  3B6Q A;  1QUJ A;  3C9H A;  2PYY A;  5ISU A;  5CMK A;  4DDD A;  4QBA A;  4HE2 A;  5IM2 A;  2RC9 A;  1KA1 A;  3HHG A;  4FAT A;  2Q2C A;  2Q74 A;  3MVY A;  4FOR A;  1Y1M A;  2GFE A;  4DXU A;  1NI9 A;  2CMO A;  1NMU A;  2Q8M A;  1L5T A;  5ITP A;  1DCU A;  3FXR A;  3K4U A;  3QXM A;  2R8T A;  1LAF E;  4YKI A;  2PFZ A;  4MF3 A;  4JSD A;  4GWO A;  4F2O A;  1A8E A;  3WAE A;  4G8M A;  2RKM A;  3L6G A;  2F6G A;  4P1E A;  2XA5 A;  4LON B;  4Q30 B;  4EDP A;  3MP8 A;  5A5X A;  1DK4 A;  1FPB A;  3IOW A;  4RPN A;  1NV6 A;  3A3U A;  2OBG A;  1POY 1;  3H03 A;  3EHU A;  2I0C A;  3KSX A;  3C32 A;  3PGF A;  4IO3 A;  3IL1 B;  1YYZ A;  3OOA A;  2REG A;  4ESW A;  3HV1 A;  4PFT A;  4JWO A;  1OMP A;  1AMF A;  3MC2 A;  4KCD A;  3FGS A;  1S50 A;  2FHY A;  1B58 A;  2KLF A;  1N04 A;  1DMB A;  2IA4 A;  4OWD A;  4ESX A;  4GWU A;  4NF8 A;  2OZZ A;  4OVP A;  2DWI A;  3F11 A;  5F1Q A;  4JSO A;  2RIN A;  3N26 A;  3ZS6 A;  4PFU A;  3DM0 A;  5FTI A;  3D4C A;  2OWZ A;  4PFI A;  5J16 A;  4WKM A;  4R74 A;  4GWY A;  3Q25 A;  3U94 A;  3O28 A;  3FBP A;  3S2V A;  5BWJ A;  4G4P A;  3KN3 A;  1TWY A;  5H8S A;  1B3L A;  3HFU A;  4KXP A;  3LUY A;  4G2Z A;  5EQA A;  4DZ1 A;  4YKJ A;  4OVJ A;  2HZL A;  1MQG A;  4QFN A;  1QKA A;  4BDO A;  3N94 A;  1HSJ A;  4F29 A;  4M1V A;  5LTC A;  2F78 A;  4GVO A;  1H45 A;  1SBP A;  1XS5 A;  1ZMG A;  4OA4 A;  3QIM A;  1LLS A;  3PUW E;  2R6G E;  3S9E A;  1Y4T A;  2IEE A;  3HCQ A;  2HQ0 A;  3H4Z A;  2Q9T A;  5FTH A;  3KG2 A;  1LBB A;  3HHF A;  5H8N B;  4GL8 A;  3G3K A;  5I2K B;  4QFL A;  2QMX A;  1JQF A;  3OEM A;  4G68 C;  1ZU0 A;  2WBD A;  3S9M C;  1M5D A;  5LDZ A;  4H45 A;  3PUY E;  4N13 A;  3QYT A;  1WDN A;  1FPI A;  3G3I A;  1Q9D A;  3Q26 A;  3RPL A;  4JVI A;  4N91 A;  3KN8 A;  1Z7N E;  1VSO A;  1YXI A;  3H06 B;  3K2D A;  1FTK A;  3FJM A;  2OPE A;  3PD9 A;  1BK4 A;  2WBB A;  3T9X B;  3CFL A;  3DEL B;  4GF8 A;  3M3F A;  1QUL A;  3S9N C;  4GXS B;  3KEI A;  1OQH A;  4PE3 A;  4R72 A;  4FEC A;  3IOR A;  1OQG A;  3A29 A;  4DI3 D;  1AIV A;  2E1S A;  1VDW A;  5AA1 A;  4YKP A;  4XFE A;  4JVC A;  2O1L A;  3U65 A;  4Q5T A;  3TKD A;  5CMB A;  4N6P A;  3UK4 A;  3MZ1 A;  1H3D A;  2I4C A;  2QS4 A;  1B0H A;  3UGW A;  3MBP A;  2O51 A;  1IZ1 A;  4GOT A;  1USY E;  1ZTY A;  4PF8 A;  1FPJ A;  1INP A;  3R26 A;  4LQ5 A;  4ZEI A;  4C1T A;  2P3V A;  1KZ8 A;  3TUS A;  1B1X A;  2F6P A;  4ECF A;  3PMX A;  3TTR A;  3VFJ A;  3RNN A;  1SW1 A;  2L5V A;  1IMC A;  1FCK A;  3BBR A;  1JVY A;  4P47 A;  4XF5 A;  2NXO A;  1PB7 A;  4F18 A;  1M5E A;  5I84 A;  1QUI A;  2P3N A;  4YMB A;  4U21 A;  4HE0 A;  4PDD A;  4LAT A;  1EH3 A;  5TPA A;  3PMW A;  4NHB A;  4X04 A;  3EQ1 A;  3U72 A;  3G3F A;  2Q89 A;  2RC7 A;  3TCF A;  1MXW A;  2OWT A;  3CFZ A;  1D9V A;  1AL3 A;  1JW4 A;  2ZZV A;  4GX3 A;  2ZZW A;  3GZG A;  3OD7 A;  1FQB A;  4THI A;  4OMB A;  5DW8 A;  5ESY A;  2ALU A;  2YJP A;  2P1S A;  3FAT A;  1FTO A;  3C31 A;  5I5P A;  4MNP A;  1A8F A;  4P3L A;  4RA1 A;  4PFY A;  3MVZ A;  3SKP A;  4GWZ A;  1MPD A;  3K0V A;  1B1H A;  4NED A;  2F34 A;  4QFK A;  4DCY A;  3E13 X;  1RKM A;  2DXY A;  3T9V A;  3RUM A;  3V83 A;  5EQ7 A;  4N17 A;  2CZI A;  2XWI A;  3ZKK A;  3IB2 A;  3IOV A;  3MP1 A;  4JVD A;  1LAG E;  2FNC A;  4KYS A;  3N5L A;  5AE4 A;  1O64 A;  1MQJ A;  4AS5 A;  2NOO A;  4NF6 A;  4PFB A;  4OZ9 A;  1MH4 A;  1IXC A;  1XOC A;  4G68 A;  4EF1 A;  5HM4 B;  2XXY A;  5CI5 A;  1NUW A;  4KQP A;  3SER A;  2O7I A;  5EYF A;  4EQB A;  1B7Z A;  3TCH A;  1B6H A;  3LV0 A;  4ELP A;  1IIT A;  3N6T A;  5JK4 A;  3TEL A;  1KA0 A;  3GLB A;  3K02 A;  3RT8 A;  3PPO A;  5EQ9 A;  1N84 A;  5I3S A;  5KDT B;  3QUF A;  3JYR A;  5DVF A;  1Y1Z A;  2ZYN A;  1R9Q A;  5ITO A;  1ANF A;  3PUV E;  3CIJ A;  2ONS A;  3KOT A;  3V89 B;  3KC1 A;  4POW A;  2XXU A;  4ZEC A;  5KCJ B;  1K9Z A;  2WYK A;  4BDQ A;  1SYH A;  1FBP A;  1GVC A;  4ZEF A;  4O8M A;  3CRB A;  2B3F A;  5CMC A;  4PAI A;  1IMB A;  2DSF A;  4HXV A;  3ILU B;  2F5X A;  1QGX A;  1N3W A;  3IAZ A;  1UQW A;  4F1V A;  1LBX A;  4JWY A;  5J1D A;  4OQO A;  5H8Q B;  1BTJ A;  4FED A;  1FQA A;  1LCT A;  5L9M A;  4G8H A;  2H9B A;  4PC9 A;  5CBS A;  3C35 A;  2HHM A;  1MPC A;  4C1U A;  4NF5 B;  4TQU Q;  2F36 A;  1NNP A;  1PBP A;  1D9Q A;  3I5O A;  4FEB A;  5H8H B;  3MJN A;  2CEY A;  4ZZA A;  3DP8 A;  3OEN A;  4LZ7 A;  3U92 A;  2F7A A;  3CSB A;  3K00 A;  5I57 A;  3T66 A;  4UAC A;  4EQ9 A;  1EZ9 A;  3KJT A;  4JBZ A;  4PTK A;  2DYX A;  1EU8 A;  4QSD A;  4QSE A;  1RYO A;  4O3A A;  1FBF A;  2F3D A;  4QRZ A;  2FIX A;  3MYU A;  3KZG A;  3T22 A;  4GD5 A;  3PV0 E;  2CZH A;  3HPI A;  1MDP 1;  2DQV A;  1EZP A;  4H8J A;  3IOU A;  4N81 A;  3MW0 A;  1A55 A;  5AA4 A;  4LUB A;  2VP1 A;  4GL0 A;  4QFO A;  2FYI A;  4DIG A;  3VDF A;  4ISU A;  2REJ A;  2I6E A;  5FHN A;  3M3L A;  2B3B A;  3W9V A;  4FBP A;  3VLU A;  2QRY A;  3EKI A;  4OEU A;  3TAJ A;  1Z7M E;  4PET A;  2VGQ A;  4N8Y A;  1URS A;  1EZO A;  1UIU A;  1B4Z A;  4N6D A;  3RYD A;  1LEV A;  3GBA A;  4HCY A;  4N07 A;  2YPN A;  4I40 A;  2O68 A;  5FHO A;  3HO7 A;  2RCB A;  2DVC A;  4X8R A;  3A09 A;  2Q8J A;  4BLA A;  1DPP A;  4YB6 A;  3TCG A;  2AIX A;  3T96 B;  1NUZ A;  5I59 A;  3ONM A;  4XEQ A;  3LSL A;  1IXI A;  3E9X A;  2WEF A;  2QS3 A;  4RNS A;  3C4M A;  2NUV A;  3TDJ A;  3PUX E;  1XT8 A;  1MS7 A;  1FTA A;  1N76 A;  1Y9U A;  3D1R A;  2PMS A;  3MZB A;  3VV5 A;  3KJ7 A;  4JDF A;  3IK6 B;  2QS1 A;  3K6V A;  1JNF A;  4H5G A;  2NWJ A;  4KR5 A;  1A54 A;  2UYE A;  4PE5 B;  2M8C A;  1URD A;  5FBP A;  5I2N A;  3W15 C;  4P1L A;  1ZIU A;  4XTC Q;  3IFC A;  3H6U A;  4GFR A;  4F1U A;  1JVX A;  4NF4 A;  4O94 A;  1LFG A;  3SES A;  2LAO A;  1IXG A;  4TLL B;  3OO8 A;  2O1M A;  3MPL A;  1JW1 A;  2XWV A;  1H44 A;  1AH5 A;  1IUD A;  1AOV A;  4QHQ A;  3K1N A;  1MG1 A;  2KR0 A;  4JWX A;  3HN0 A;  4Q0C A;  2A5T A;  3C33 A;  4HTG A;  3THI A;  1LGB C;  5A5X B;  4MAG A;  4OTE A;  1B3F A;  2G29 A;  4PFR A;  1NNF A;  2DWJ A;  4X9T A;  1R6Z A;  4NF4 B;  1BIY A;  4ZEB A;  1MXU A;  3L6H A;  1DTG A;  1MM6 A;  3LC8 A;  5CMM A;  4PAK A;  1DOT A;  4MMP A;  4R9F A;  3VXB A;  4JB7 A;  5JEI A;  1T0K A;  3K1P A;  2ONK E;  3VVF A;  4TLM B;  3MWB A;  1LB9 A;  1NUX A;  4FJP A;  2PCR A;  1MPB A;  3GYY A;  3MUQ A;  1YTV A;  1I6Q A;  3ODB A;  3IR1 A;  1LBZ A;  1LST A;  3CFX A;  2VHA A;  1FPL A;  3TPA A;  1YPN A;  3PTY A;  4NF8 B;  1RYX A;  1B7U A;  2QVR A;  1SQY A;  3LR1 A;  4F1Y A;  2I58 A;  1URG A;  3SZP A;  2XXV A;  4O7I A;  3IJO B;  4YB7 A;  1PDA A;  4PP0 A;  1RDY A;  1IEJ A;  2Y7I A;  3ISP A;  2I48 A;  2DWA A;  3PU5 A;  1LAX A;  2O7U A;  2G93 A;  5AA2 A;  3FV2 A;  4R75 A;  1Q35 A;  1S7Y A;  1ATG A;  1NV1 A;  4X1B A;  4F2Q A;  4POX A;  4WED A;  4U2R A;  1FQC A;  1US4 A;  5HPQ A;  4IO4 A;  4R6Y A;  1FW0 A;  2D21 A;  2Q88 A;  4E0X A;  4QF9 A;  1YZ0 A;  4IR8 A;  2XXQ A;  5FHM A;  3SEX A;  4H67 A;  3IOT A;  5DT6 A;  2XX8 A;  4R6K A;  2ZYO A;  3TMG A;  1M5B A;  2RC8 A;  1SI0 A;  4OFJ A;  1NV5 A;  4H1X A;  4OVR A;  2GHB A;  2ZZX A;  5IKB A;  1SW2 A;  4F31 B;  1US5 A;  4ZED A;  4F3S A;  4KD5 A;  2PT1 A;  4UA8 A;  4I3E A;  3O66 A;  4F22 A;  4AB6 A;  2RCA A;  2F7B A;  2OJT A;  1F9B A;  2F3B A;  3QK6 A;  1UTH A;  4IO7 A;  3U1O A;  1FBD A;  3UOR A;  2Q2A A;  3Q28 A;  2XXW A;  1A99 A;  3RPL B;  3OSR A;  1P1N A;  4PDH A;  3M8U A;  1K9Y A;  1WOD A;  3RY3 A;  3RLF E;  4QXD A;  2F35 A;  1NH7 A;  4X48 A;  5KZT A;  4Q8R A;  1MY3 A;  2R71 A;  3ROJ A;  3IO4 A;  3SET A;  3VXC A;  2E0S A;  4EXK A;  3DP6 A;  2HAU A;  2WX9 A;  2OLB A;  2DE3 A;  4R2F A;  3IJX B;  3UP9 A;  1P1O A;  5CC2 A;  1FBC A;  5K2X A;  1EYK A;  3SDF A;  3KSJ A;  4E0W A;  1FQD A;  3OO9 A;  1MXZ A;  1A7L A;  1NFT A;  2ZYM A;  3TYH A;  5T3J A;  1FPG A;  1TFA A;  1P99 A;  1FPE A;  4U1Z A;  3DP4 A;  3TZA A;  3C34 A;  4XKR A;  2AL5 A;  1FPK A;  4DE8 A;  4LVQ A;  2V93 A;  1ZKB A;  4OFO A;  3PUZ E;  5IZ3 A;  3N6U A;  1Y3Q A;  1OVB A;  2DVZ A;  2XXP A;  4OEN A;  3O29 A;  1D3K A;  1B5I A;  4OFL A;  4GX6 A;  5TPA B;  1I69 A;  2F97 A;  4R73 A;  4MBP A;  1FTJ A;  3G7W A;  3CI8 A;  3LSX A;  3GBB A;  3CR9 A;  1IMF A;  3JZJ A;  3LSF B;  2XXI A;  4RY1 A;  1EYJ A;  3H7M A;  2UVG A;  3I6V A;  2QJE A;  3FVO A;  1B9J A;  3FIR A;  3ZKL A;  3KGC A;  1O7T A;  4NGU A;  3RTF B;  4KHZ E;  4DI4 B;  4PF6 A;  2Z8E A;  1LFH A;  4PGN A;  3B7D A;  4U4S A;  4P0G A;  4DCX A;  3TTM A;  1QVS A;  5IZ1 A;  2H4I A;  3MQ9 A;  4ELQ A;  5JTY A;  3MVX A;  5ICT A;  5IZZ A;  4IGT A;  4IGR A;  1PB9 A;  4NF6 B;  4RPO A;  2QS2 A;  1HSE A;  4H46 A;  1IME A;  4G68 B;  3U93 A;  3KBR A; 
#chains in the Genus database with same CATH homology
 3KBZ A;  4N6D A;  3RYD A;  1LEV A;  1FJ9 A;  2OWZ A;  4HCY A;  4PFI A;  5J16 A;  4MEV A;  2QPQ A;  4GWW A;  3E79 A;  4GWY A;  4I40 A;  4G61 A;  3FBP A;  4X8R A;  4PBH A;  4F19 A;  1FPF A;  3HFU A;  4KXP A;  5EQA A;  2HZL A;  4N8G A;  1FBH A;  2QVV A;  1NUZ A;  2MKZ A;  4XEQ A;  5EYH A;  2WEF A;  4M1V A;  5LTC A;  4NG7 A;  2VPO A;  2JJK A;  5ET7 A;  1FTA A;  2QFL A;  3D1R A;  4OA4 A;  4GWS A;  1FJ6 A;  2Q9T A;  3QMF A;  2CZK A;  5ET6 A;  4MIJ A;  5FBP A;  1NV2 A;  4OVT A;  1NUY A;  4P1L A;  5IZ3 B;  3IFC A;  2HPG A;  5F24 A;  2WBD A;  4F1U A;  4OVQ A;  3IFA A;  4O94 A;  5LDZ A;  4OVS A;  4H45 A;  2XWO A;  4PBQ A;  1FPI A;  1Q9D A;  3BIG A;  4GWX A;  4YIC A;  2XWV A;  3RPL A;  4JVI A;  4N91 A;  4OAN A;  1YXI A;  2KR0 A;  3E78 A;  4MJO A;  5EYG A;  1BK4 A;  2WBB A;  4MAG A;  5I7I A;  4PFR A;  4X9T A;  4HE1 A;  4PE3 A;  5CM6 A;  3A29 A;  4DI3 D;  4NAP A;  1VDW A;  4N6K A;  4PAK A;  4MMP A;  5EQ8 A;  4NN3 A;  4XFE A;  4JVC A;  1G0H A;  1LBY A;  3U65 A;  3KC0 A;  3CHG A;  2V4C A;  1NUX A;  1LBW A;  2PCR A;  4P9K A;  4MNC A;  3GYY A;  1G0I A;  2FIE A;  1LBZ A;  1FPL A;  2CEX A;  3PTY A;  4PF8 A;  1FPJ A;  1INP A;  2KQZ A;  2QVR A;  3T1B A;  2P3V A;  1KZ8 A;  3B8B A;  3SZP A;  3BIH A;  4O7I A;  4MNI A;  2VPN A;  4O7M A;  2L5V A;  1IMC A;  1RDY A;  2B4M A;  3ISP A;  4P47 A;  4XF5 A;  4F18 A;  2P3N A;  2WYP A;  4HE0 A;  4PDD A;  1NV1 A;  1IMD A;  1AWB A;  4PGP A;  3NOH A;  4NHB A;  4X04 A;  2DDK A;  4PCD A;  1RDX A;  2VT5 A;  4N4U A;  4YZZ A;  2ZZV A;  1YZ0 A;  4IR8 A;  2DE2 A;  2Y5K A;  4AS4 A;  4GX3 A;  2ZZW A;  2FVZ A;  5ET8 A;  5DW8 A;  5ESY A;  5IGA A;  5I5P A;  4MNP A;  5A5L A;  2HZK A;  4P3L A;  3T0J A;  1NV5 A;  4OVR A;  2HXR A;  2ZZX A;  4GX4 A;  4GWZ A;  1CNQ A;  5ET5 A;  4P56 A;  4P8B A;  4GBW A;  3LUZ A;  5EQ7 A;  4N17 A;  1JP4 A;  2CZI A;  2XWI A;  4I3E A;  4JVD A;  1FSA A;  3B50 A;  2F3B A;  4AS5 A;  4PFB A;  1DBZ A;  1FBD A;  4NF0 A;  1NUW A;  4MHF A;  2OX3 A;  2V3Q A;  3RPL B;  2XWK A;  1NV4 A;  1NV3 A;  4PDH A;  3LV0 A;  1K9Y A;  4I3Y A;  4NQ8 A;  4QXD A;  5JK4 A;  1KA0 A;  1FRP A;  4NX1 A;  3FXB A;  3ROJ A;  4MX6 A;  5EQ9 A;  5I3S A;  1RDZ A;  2B4L A;  4UAB A;  3KC1 A;  1FPD A;  2WX9 A;  2BJI A;  2DE3 A;  1K9Z A;  2WYK A;  1FBP A;  1EYI A;  1FBC A;  1FBE A;  4O8M A;  1EYK A;  2XXK A;  1LBV A;  1IMA A;  2PFY A;  5T3J A;  1FPG A;  4PAI A;  1IMB A;  4HXV A;  2F5X A;  1QGX A;  2GQ1 A;  1FPE A;  2FBP A;  4QBA A;  4F1V A;  4HE2 A;  5IM2 A;  1KA1 A;  1FPK A;  1LBX A;  5J1D A;  2Q74 A;  5IZ3 A;  4MCO A;  1NI9 A;  4PC9 A;  4GBV A;  2DVZ A;  2Q8M A;  2HHM A;  1DCU A;  4N15 A;  2R8T A;  1D9Q A;  2PFZ A;  4GX6 A;  1FBG A;  2CEY A;  1IMF A;  4HCW A;  4P1E A;  2XA5 A;  1EYJ A;  1DK4 A;  4PTK A;  1FPB A;  1NV6 A;  4NGU A;  1FBF A;  2F3D A;  4DI4 B;  2FIX A;  4PF6 A;  3MYU A;  4PGN A;  2QVU A;  1YYZ A;  1XI6 A;  2CZH A;  4PAF A;  2Y5L A;  3MST A;  5IZ1 A;  4N81 A;  2DE4 A;  1NV7 A;  3W9W A;  1SPI A;  1NV0 A;  2FHY A;  5IZZ A;  4GWU A;  4OVP A;  3W9V A;  4FBP A;  4H46 A;  1IME A;  3EKI A;  4LN5 A;  4PET A;  4N8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...