1G0IA

Crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
252
structure length
252
Chain Sequence
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of the MJ0109 gene product: a bifunctional enzyme with inositol monophosphatase and fructose 1,6-bisphosphatase activities.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 69
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2000-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1g0iA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1g0iA02
2CZHA 1FPBA 2P3VA 1EYKA 1LEVA 2FIXA 5EQ9A 5EQ8A 5EYGA 1KA0A 5ET8A 1FBFA 3BIHA 1FRPA 1G0IA 1NV3A 1NV5A 3KC0A 1NUZA 5T3JA 1LBXA 3RPLB 2HHMA 4GWSA 1IMEA 1NUXA 5A5LA 1FPLA 1DK4A 4GWZA 1FBPA 4HE2A 3FBPA 5J16A 2WBBA 2FBPA 1BK4A 2JJKA 2PCRA 5ESYA 5IZ1A 1LBVA 5EYHA 1FPDA 5EQAA 5ET5A 1FPGA 1SPIA 1FPIA 2QVRA 1IMFA 1NUYA 1FJ6A 2Y5KA 5DW8A 1NUWA 1CNQA 1RDYA 1FBEA 1FSAA 4O7IA 1LBZA 1G0HA 1FTAA 1NV6A 4AS5A 2F3DA 1INPA 1NV4A 5I3SA 5EQ7A 1FBHA 1VDWA 1K9ZA 2P3NA 3RYDA 2WEFA 4I40A 4PTKA 2QVVA 4GX4A 1D9QA 4H46A 3B8BA 5F24A 1IMDA 1FBGA 4GBVA 4GWXA 2CZKA 4N81A 4GBWA 1FPFA 4HE1A 2BJIA 2VT5A 3LUZA 3QMFA 4GWWA 2GQ1A 3BIGA 4KXPA 5IZ3B 1YXIA 1RDXA 4IR8A 1NV0A 1NV7A 1NV1A 1XI6A 2R8TA 4HE0A 4HXVA 1FPKA 1FPJA 1RDZA 1AWBA 4AS4A 4G61A 2Q8MA 3T0JA 2QVUA 4GX6A 4I3EA 1QGXA 3ROJA 3KBZA 4GWYA 5IZ3A 5FBPA 2QFLA 2CZIA 4H45A 4GWUA 1IMAA 1FBCA 1NV2A 1KZ8A 2OX3A 3LV0A 3KC1A 1LBWA 3RPLA 5ET6A 2Y5LA 3IFCA 1IMBA 1IMCA 1Q9DA 4GX3A 1YZ0A 1JP4A 3A29A 1EYJA 4MJOA 3D1RA 4FBPA 2OWZA 1DCUA 1EYIA 5LDZA 1K9YA 2F3BA 1LBYA 2FIEA 1DBZA 5ET7A 2WBDA 2DDKA 2FVZA 1NI9A 1FBDA 1FJ9A 4I3YA 2FHYA 2Q74A 3IFAA 1FPEA 4QXDA 1YYZA 1KA1A
chains in the Genus database with same CATH superfamily
2Y7RA 3W9WA 1A55A 2Z8DA 1RYXA 1MY4A 2ZZWA 5I84A 4NE4A 1FRPA 1G0IA 2VD3A 5KDTA 5F1QA 2HPGA 3T66A 5T3JA 5H8QB 1NUXA 4OVPA 4GXSB 3O97A 4GWZA 3FZVA 3RPWA 2HAUA 3RTFB 2PCRA 2OLBA 4WKMA 2REJA 2UXAA 1IMFA 1P1OA 5LTCA 4MNCA 3EPEA 4FEDA 4X04A 3T93B 2UYEA 1H3DA 5I5PA 2XWVA 4JB7A 1A99A 4I40A 1VR5A 4I9DA 4BDMA 1MXUA 1JETA 1B5HA 1YAEA 4IGTA 2G93A 1BP5A 1UQWA 5DVJA 3LUZA 2PYYA 4OHNA 1ZLQA 1P1WA 3N26A 2DWHA 4LZ5A 1FPKA 2QMWA 2PT1A 3T0JA 4I3EA 4R6KA 5ISUA 3RUMA 2CZIA 3FVNA 4MLQA 2XXKA 4PFTA 1XVYA 5CRYA 3IFCA 5FHMA 2O7IA 1A8FA 2BJJX 4EF2A 1DCUA 2F7CA 1NNPA 2I48A 1OLAA 4QBAA 5JK4A 5K2YA 1MY3A 2FYIA 5CI5A 4XFEA 2XXYA 3K6XA 2XWOA 2Q74A 3O6IA 3IFAA 2Z23A 1YYZA 3PUVE 4Z0IA 3A09A 2ZZVA 1R1NA 1BIYA 5EYGA 3BIHA 3FJ7A 4Q5TA 2GH9A 3E13X 2THIA 3K0VA 5I59B 2NUVA 4MBPA 1DPPA 2NWJA 2OJTA 1MDP1 5ICTA 5FHNA 1XVXA 1B2HA 5CMMA 4KFQA 4R74A 1MDQA 2UVHA 1ZBMA 2AIXA 3T1BA 4ECFA 3DM0A 3U1OA 1N3WA 3MP6A 3B6TA 1Y20A 3FVGA 3IO6A 3Q25A 3HN0A 2VPNA 1OVTA 3R7XA 4GBWA 3BIGA 3HFUA 3OO6A 5H8NB 5I56B 5ICQA 1M5BA 4ZE9A 4RJZA 3K00A 4GX6A 5IM2A 4F22A 2VPOA 3KBRA 4ZEIA 4GWUA 2XX9A 1IMAA 1N76A 3FUZA 1IEJA 1GVCA 1AMFA 4UA8A 4YKPA 2P0SA 2HQ0A 4RPNA 4R2BA 1EYJA 3ODBA 4YMBA 3TEPA 2X7QA 1D9VA 2DYXA 1LLSA 2F7BA 1IXHA 3H03A 3T22A 1FTKA 4U1ZA 4GD5A 3HSTA 2MKZA 5M2VA 1OLCA 4F2QA 2DSFA 3PUYE 4M4GA 1NH8A 4PAFA 2OBGA 2O1MA 2D21A 2PX1A 3CG3A 2W7YA 4HE2A 1O7TA 4GL0A 4BDOA 4XEQA 1EH3A 3L6GA 5AA4B 3MVWA 1IZ1A 1ATGA 1IQ7A 2FA7A 5HM4B 4BDRA 4RY1A 3VFJA 2REGA 4IGRA 3TUSA 1PC3A 2OWTA 4AS5A 4GIZA 5AA4A 1NV4A 1R9LA 4OFLA 4P56A 1PB9A 1Y9UA 3KJ7A 2F6GA 4LONB 2QVVA 4MFIA 3KOSA 5H8FB 3TYHA 2DS9A 1LFHA 1IMDA 4NG7A 2DWAA 3CRBA 3C31A 3QMFA 3BBRA 3L6HA 4G8HA 3VDFA 5AA2B 3OXNA 1US4A 2A5TB 1FPJA 1QKAA 4RK9A 3CG1A 1Y4CA 4PF6A 1YTVA 4IY5A 1KZ8A 4EQBA 1IIWA 2RINA 3LSXA 1D4NA 3MP1A 4HW8A 4GX3A 2PBWA 4AB6A 1YCJA 4RXLA 1FQFA 3UIFA 4ELRA 4OERA 3EF7A 3HPIA 4JWYA 4AQ4A 1TFDA 5FTIA 4KYEA 1NFTA 2XHDA 5DVIA 5IAIA 2DDKA 1B3FA 1FTOA 3CVGA 4Q30B 4G77A 2HXRA 3IB2A 5I57A 4MLVA 1MY1A 3UORA 2F8DA 1ZKBA 1NV3A 3M3LA 3LSFB 2I4CA 1A7LA 3H06B 1N7XA 3G3JA 4JVDA 4RA1A 1JNFA 3EHTA 3K6UA 5A5XB 4F3PA 2VOZA 3VXCA 4OVJA 2KLFA 2I58A 2GHBA 5ITPA 2O68A 3KSJA 1UTBA 4BLAA 1AOVA 3OENA 4YICA 2XXVA 4LA9A 5BUUA 4U23A 3U93A 1B5IA 3OO9A 1MM6A 4OXVA 5JTYB 3TPAA 1XI6A 2P1SA 3OO8A 1B3LA 2B3BA 2QRYA 2Z22A 1BTJA 3N6TA 2XA5A 4OESA 5CMKA 5IGAA 2GRVA 3O2AA 2UVIA 1DMBA 4MF3A 3CFZA 1UIUA 2I3WA 3W9VA 3C4MA 1VFEA 1B58A 3EHSA 4YAHX 1FJ9A 4ZZEA 3U92A 1H45A 4KYSA 2X7PA 1DTZA 3EKIA 1N3XA 1US5A 4EUOA 2RCAA 4ND9A 3K6VA 1LBXA 4PCDA 3MSTA 3MUQA 3FV1A 2ZNSA 5KCJA 1ZTYA 2L5VA 4N6DA 4OVTA 3BFUA 2Y7IA 3SZPA 3OD7A 1MQJA 1UTHA 4F19A 3UA8A 4NQ8A 4YB6A 4ZECA 2YJPA 5I58A 2XWIA 3DLNA 4TLMB 1FTJA 1H44A 1NV6A 3B6WA 3SEUA 4X1DA 5BWJA 4LZ8A 1SYIA 4NX1A 4NF6A 2QL3A 1OMPA 3SEXA 1B0LA 1TWYA 1B1XA 3ZKLA 4QSDA 3VVDA 3KSXA 1FQAA 3OEMA 3G3GA 2Y7WA 3E9XA 4HS7A 2WX9A 1Y1MA 1LBCA 3GZGA 2ZMBA 4MIJA 4OANA 1SYHA 5LOMA 5AA2A 4POXA 3D4CA 2OWZA 1SW4A 2XXUA 3S9LC 2XXXA 1QJMA 5H8FA 2I0BA 2Y7PA 2PMSA 3G3IA 1FPEA 2P3VA 5I2NA 1EYKA 1QULA 4DIGA 1UTHB 3MW0A 4PE5B 3TTRA 3MVYA 3FGSA 1B3EA 1FQEA 1SDXA 4O3AA 4WXJA 4XIGQ 3MPKA 4JWOA 3PMXA 1DK4A 4X9TA 1MQDA 1MQHA 1HSEA 5ITOA 1HSJA 2WKYA 3GBBA 2V3QA 3PD9A 1RYOA 1FPDA 3PPQA 5I57B 3FJMA 3O66A 3SKPA 4AB5A 1F9BA 1SPIA 1B3HA 4LVQA 1NUYA 1T0KA 4YMAA 1MY0A 3GBAA 1PB8A 3MWBA 4PAIA 2R71A 3TKDA 3QSLA 4NF8B 3UN6A 4DI3D 1B51A 3MPLA 4NWCA 2XXQA 4XF5A 4GBVA 3MZBA 1FQBA 3RNNA 3G3KA 1LGBC 1RDXA 1NV0A 1B5JA 4HE0A 1Y3PA 1DTGA 1SI1A 3T9VA 1MXVA 4LQ2A 3RT6B 2Q88A 2IA4A 4GWYA 2M8CA 2F78A 2V3TA 3MYUA 3NOHA 3IORA 1IITA 4OA4A 1EZ9A 3K4UA 2PFZA 4FBPA 3THIA 5AA3A 4N91A 1B6HA 4U4XA 2V93A 4G8NA 2O51A 4QXDA 5EQ9A 3OSRA 2A5SA 3IX1A 4XKNA 1YPNA 2VGQA 2RC9A 4R6YA 4YKKA 3FXBA 4C1UA 1FW0A 4P1LA 3S2VA 2OWSA 1FBPA 4OEVA 3TAJA 2WBBA 3N6UA 4TQUQ 3O9PA 2I49A 5F7VA 5I7IA 3C35A 2O7UA 2QPQA 1MRPA 2DXYA 5DW8A 4PF8A 5H8HA 2RC7A 1R9QA 5EQ7A 2XX8A 4MHFA 2I0CA 2WEFA 4NWDA 4PTKA 2WYKA 4JVCA 4GX4A 1JVXA 3FXRA 1B40A 2DVCA 2KR0A 2NOOA 3HO7A 5IZ3B 1AIVA 5DTBA 3RLFE 2R8TA 3B7DA 4RK2A 3ONMA 4EXKA 2V3UA 1MM7A 3QAXA 3IJOB 3TODA 1NNTA 5H8NA 3C36A 4QSCA 3VV5A 4H45A 4U4SA 4Z7EA 3MVZA 5EHSA 3PPNA 3KC1A 2ZXTA 1AH5A 1IMCA 2XD2A 1BLFA 4ELPA 1NL5A 1IXGA 1MS7A 4MJOA 3D1RA 4LQ5A 4U21A 2DXRA 3Q28A 4U1OA 1I6BA 1I6AA 4PFYA 3KOTA 1CB6A 2YPNA 3MP8A 3MVXA 1BKAA 1MQIA 3IB1A 1A40A 2XXWA 5ELVA 5K2XA 3IOWA 1KA0A 2F6PA 1A54A 4NGUA 4GRKA 2R6GE 3SESA 4XKRA 3KZGA 5AE4A 4GWSA 3H6VA 3SEWA 4N13A 1MPCA 1NKXA 4LUBA 1PEBA 2IEEA 2OZZA 3IOTA 1FPIA 2Y5KA 5AA1A 4BDQA 4KPTA 1FBEA 4DDDA 4WEDA 1MXWA 2QS1A 4PE3A 3M3FA 4C1TA 3HHFA 1GTKA 4ZE8A 5KZTA 3H6UA 4FORA 2Q8JA 1NH7A 1GR2A 1SD3A 3V8XB 3MQ9A 4F39A 4IO6A 1FTLA 3EQ1A 4OVRA 4HXVA 2UVGA 4GOTA 4ONYA 1SW2A 3KBZA 5IZ3A 1WVJA 1USYH 1NV2A 1JW1A 2DWIA 3WAFA 1WDNA 4LP2B 4JWXA 3GXAA 3H7MA 3QXMA 4R73A 2VD2A 2KQZA 4G4PA 4PFUA 3WAEA 4F1VA 3BFTA 1NI9A 4P11A 5FTHA 4TLLB 2CZHA 3RY3A 2F36A 5EHMA 4MCOA 4GWOA 5EQ8A 2G29A 1NV5A 2DE4A 3M3KA 4KCDA 2Q2CA 3RPLB 4H5FA 4UABA 5J16A 2FBPA 1FTMA 4O8MA 1LBVA 1LBBA 4O3CA 2WYPA 3PUZE 3LR1A 2PVUA 2F34A 1G0HA 2AL5A 1SW1A 5I3SA 3I3VA 3K1PA 1VDWA 2P3NA 1Z7NE 3BKIB 3TCHA 4H67A 4P8BA 3ILTB 5L9SA 1D9QA 2H98A 5FHOA 4RYAA 1KWHA 1D3KA 3P7IA 5H8QA 4EQ7A 1FQDA 3S9MC 3TCGA 2VT5A 5CBRA 1MG1A 4X48A 4QFPA 5I2KA 2Q8MA 3LSWA 4EQ9A 4MEVA 1VE4A 5AA2D 2Y5LA 2ALUA 4PBHA 5KCJB 1USYE 1B4HA 3TTMA 2Q9TA 5TPAA 1EYIA 4QRZA 4H8JA 3PPRA 3E79A 5I2KB 3K1MA 3FVOA 2RCBA 4GL8A 3U72A 3FXUA 3VE1B 4FJPA 2H25A 1LFGA 2Z8EA 1PDAA 1AL3A 3IR1A 2CEXA 4R2FA 5HBCA 1URGA 1MH4A 4QF9A 4GVOA 3I5OA 3Q26A 3TTKA 1QKBA 4O3BA 3KG2A 3FBPA 3MJNA 4QFNA 4K3FA 2JJKA 1B7ZA 5IZ1A 3OOAA 1N0TA 3TZAA 2DWJA 4H6DA 2QVRA 1DOTA 4KHZE 1NUWA 1CNQA 1FSAA 1LBZA 1FTAA 1QUJA 1H43A 1INPA 2D3IA 5JTYA 4U22A 1B0HA 4N6KA 4NF4A 2I6EA 4JBZA 4H46A 4QFOA 5DEXB 2ANJA 5TP9A 1A8EA 5IZZA 1UTBB 4XKPA 4PAKA 4YB5A 2QS4A 4P0IA 1Q35A 1J1NA 1I6QA 1Z7ME 1EZPA 2OPEA 3ROJA 3C32A 4DXCA 4MNPA 3FATA 4H65A 3O6GA 1FBCA 4F31B 1QW0A 3RPLA 4GFRA 1Q9DA 2GHAA 5CMCA 4F3GA 3SETA 4O94A 3K2DA 4GF8A 5LDZA 2FNCA 2R9JA 3PPOA 1M5EA 4U2RA 3PGFA 1JQFA 1D9YA 4WEPA 3ILUB 4N8YA 4OTEA 1QVSA 2Q2AA 1PBQA 3TDJA 1NMUA 4QFKA 1B7UA 2H9BA 5L8DA 4KYDA 3JYRA 4IO2A 3FJGA 4ZDMA 2DE2A 3OMBA 1NNKA 2QS3A 4OQOA 4I62A 4ISUA 1OQGA 3USDA 3G3FA 2DQVA 5DEXA 1O64A 1JVYA 4JDFA 4EF1A 4RPOA 2ESNA 2I4BA 1CE2A 2F5XA 3HHGA 3RTWB 2A5TA 3H6WA 4NN3A 4ELQA 3PU5A 1TXFA 4N17A 3T9HB 4F1UA 1QUKA 1IUDA 1L5TA 2XXIA 2HEUA 3U8QA 4HTGA 4G68B 2GQ1A 3T96B 1YXIA 3Q27A 4F1YA 1NV7A 3C9HA 3DP4A 4NMYA 5DVFA 2XXHA 3PMVA 1AWBA 1SVXB 3CFLA 3AXFA 1S50A 4YKJA 2AL4A 1SBPA 2ZYNA 3V5AA 3CIJA 3DP8A 4PFWA 4F2OA 4OWDA 5ET6A 3TMGA 2HZLA 4BDNA 3K02A 2LAOA 1PBPA 4NEDA 2DP8A 1LAXA 3CSBA 2FVZA 5TPAB 4HCWA 3PMWA 4LZ7A 2FHYA 3PUXE 1B32A 2F7AA 4DXUA 2F97A 1M5DA 4ZEFA 1FPBA 2V4CA 4P1EA 3SERA 3VLUA 4F29A 1POTA 1QUIA 2Q89A 3KEIA 2O69A 5I2NB 3PUWE 3PV0E 4PBQA 5A5LA 2PFYA 1B7HA 2DOJA 2E1SA 2UYFA 3IOVA 3TQWA 1MQGA 4OZ9A 4NF6B 4IB2A 4ZEDA 3IAZA 2ZYKA 4IO7A 2B4MA 4C0RA 2AYSA 3S9EA 4F3SA 2RKMA 3FXQA 4HE1A 3IJXB 3QIMA 4GWWA 5B7DA 5I58B 5L9MA 5DT6A 1JEVA 3T9XB 4NHBA 3FIRA 3FVKA 1LAHE 3KN7A 2NXOA 1M5FA 2PT2A 4KD5A 4PP0A 3RGYA 4IO5A 3LV0A 2D5WA 4FIMA 3ZS6A 4TOZA 1JW4A 2X26A 2ZZXA 4XTCQ 1VFDA 4LATA 1DBZA 3VVEA 4NF4B 5EYFA 2XX7A 4JVIA 3MZ1A 3G3HA 3A3UA 4G68C 4OFJA 3G7WA 4ZEBA 4PC9A 3KN3A 1XT8A 2FIXA 4YU0A 2XD3A 3TQLA 1WODA 3VVFA 3W15C 1XOCA 3JV9A 1EZOA 4OMBA 1MPDA 4P0GA 3CI8A 3LBSA 1MH3A 3UK4A 5TU0A 3TTLA 1LCFA 2VHAA 3CFXA 5ESYA 2Z8FA 5EQAA 1LB9A 3U94A 3RN8A 5CMBA 3MAMA 4H5GA 3E3KA 2F3DA 2V84A 3HCQA 1LFIA 4DCXA 3T9UA 1K9ZA 1P99A 3IK6B 4DCYA 4PETA 4F18A 4ESXA 2Y7KA 4IO4A 1MXYA 1FBGA 5KDTB 3MZ9A 2CZKA 2F35A 4R6HA 4I1DA 4RNSA 2OK2A 4NF5A 4OENA 4R75A 1POY1 1MPBA 4PQJA 2ONSA 2NVUB 4G61A 2QVUA 4BDLA 3ISPA 3TFLA 3QUJA 1B3GA 4HCYA 2O84X 3ZKKA 1RKMA 1MXZA 3ECRA 3K6WA 3R26A 1Y1ZA 3O6HA 4PGPA 3A29A 1LCTA 3JZJA 4QFLA 1B4ZA 4Q8RA 2DVZA 3OELA 3QK6A 3F11A 2DE3A 3PTYA 2I3VA 2ZYOA 1ANFA 4ZS9A 4P47A 2ONKE 2XXPA 1KA1A 3CSGA 4N4UA 3O29A 1GGGA 1FBFA 3OO7A 1SI0A 1B05A 3KC0A 1DSNA 2OCUA 3O28A 1URDA 4R72A 3S4UA 1IMEA 3GYYA 4PFRA 2CZLA 4P9KA 3IO4A 1ZMGA 3U65A 3KFMA 5L9OA 4IO3A 4X8RA 1H76A 3QYTA 4OYVA 4KQPA 1S9TA 3I6VA 3V89B 3M8UA 5CC2A 3E78A 4O7IA 1URSA 1SQYA 1FBHA 1Y4TA 5H8HB 5HPQA 3RYDA 3LC8A 4N8GA 3B8BA 5F24A 5J1DA 4KR5A 4GWXA 1JEUA 1PB7A 1MY2A 4UACA 2ABHA 3CR9A 2BJIA 2B3FA 1B1HA 3IB0A 3VXBA 4KXPA 3DELB 5JEIA 2B65A 4XXUA 4YZZA 3RT8A 1Y3QA 2CEYA 4LN5A 4AS4A 4MX6A 1GV8A 3SEVA 1Q1KA 5FBPA 5CBSA 2VP1A 5A5XA 3EN3A 3TTNA 2OX3A 1LBWA 5H8SA 1P1UA 4YKIA 3S9NC 1HSLA 3V83A 2HFBA 3B50A 1R6ZA 1XC1A 1NNFA 4E0XA 1S7YA 4M1VA 4YB7A 1IXIA 4H8IA 4QSEA 1N84A 3R6UA 2HZKA 4NF0A 3K01A 4ZZAA 3TELA 1FCKA 2QS2A 2V25A 2H99A 1XHYA 1LEVA 4FATA 1II5A 3FASA 3IL1B 4FEBA 1TFAA 3PPPA 3GLBA 1NUZA 2ZNTA 4NTLA 1EU8A 4G68A 4FAJA 3FD3A 1B9JA 4MMPA 4DXBA 2HHMA 2ZYMA 1FPLA 4ELOA 3OEKA 3H3GA 4DLDA 4OVQA 1XS5A 4MAGA 1SW5A 2OPDA 5ET5A 4EXLA 1DPEA 1N7WA 3CHGA 2E0SA 5DYHA 4EDPA 5CM6A 3QUFA 3C33A 3LUYA 3SEYA 3MBPA 3HV1A 4H0WA 4E0WA 2Y84A 2P2AA 3H6TA 2HXWA 4N81A 1FPFA 2HCAA 4THIA 4R9GA 1OIBA 1ZJLA 3PD8A 4PGNA 3VLWA 1RDZA 4FE8A 4PFBA 2RF1A 4H1XA 1ELJA 4GXAA 4OVSA 1QGXA 4XKQA 2GFEA 4N07A 1IXCA 2CMOA 1YZ0A 4G2ZA 1Y3NA 2YLNA 2FIEA 1LAFE 2H4IA 2QSXA 3UP9A 4JSOA 1P1NA 1UIVA 3TCFA 3C34A 2XWKA 1ZIUA 3SDFA 1ZU0A 4OFOA 3DP6A 5ET8A 2HAVA 2RC8A 4L17A 4JSDA 2O6AA 2ZNUA 3IOUA 1VSOA 2XXRA 1O63A 4PDDA 4MNIA 1LSTA 3A3CA 5B70A 4KCCA 4Q0CA 1BK4A 4I8CA 1B52A 5EYHA 3UGWA 5IKBA 2H5YA 3D4GA 1FPGA 4ESWA 3OSQA 4NF5B 1OQHA 1FJ6A 4N15A 3RQTA 4IY6A 1RDYA 4QHQA 4OEUA 1I69A 4PFIA 4JXIA 5I56A 3N94A 3N5LA 4O7MA 4R9FA 2XXTA 3LSLA 4GQOA 2QJEA 3MC2A 3KGCA 2QMXA 4DZ1A 4IR8A 4NAPA 3H4ZA 4DI4B 1NV1A 3FV2A 3Q29A 4POWA 1OVBA 4P3LA 4N6PA 4X1BA 1P1QA 4NF8A 2QFLA 4FECA 3B6QA 1MXXA 2ONRA 1M5CA 1LAGE 1IMBA 3EHUA 3KJTA 3VLVA 2B4LA 1LB8A 2O1LA 4G8MA 1JP4A 4GLIA 4ZEKA 3KN8A 5TP9B 3E4RA 4F3BA 1K9YA 2F3BA 1LBYA 5I59A 2UVJA 4OETA 5ET7A 2WBDA 1N04A 3K1NA 1FBDA 4PDHA 1FQCA 3ZSFA 4KI0E 4MH5A 4I3YA 1JW5A 1B46A 1TT1A 4DE8A
chains in the Genus database with same CATH topology
4PC9A 4N8YA 2CZHA 2CEXA 1FPBA 3W9WA 2P3VA 1EYKA 2V4CA 4N4UA 1LEVA 2FIXA 5EQ9A 4P1EA 2ZZVA 3EKIA 4MCOA 2HXRA 2MKZA 5EQ8A 5EYGA 1KA0A 5ET8A 2ZZWA 1FBFA 3BIHA 4PGNA 4NGUA 1FRPA 1G0IA 1NV3A 1NV5A 2DE4A 3KC0A 4PAFA 1NUZA 2HPGA 5T3JA 3FXBA 1LBXA 3RPLB 4MMPA 4PCDA 2HHMA 4GWSA 1IMEA 2DE2A 3GYYA 1NUXA 3MSTA 4P1LA 5A5LA 4PBQA 1FPLA 2PFYA 4P9KA 4OVPA 4JVDA 1DK4A 4GWZA 1FBPA 4PDDA 4X9TA 2L5VA 4MNIA 4HE2A 4N6DA 3FBPA 5J16A 4UABA 2WBBA 4OVTA 2FBPA 1BK4A 4OVQA 2V3QA 3U65A 2JJKA 3SZPA 2PCRA 5ESYA 5IZ1A 4MAGA 4O8MA 1LBVA 4XEQA 5I7IA 5EYHA 4X8RA 1FPDA 5EQAA 5LTCA 5ET5A 2QPQA 4F19A 1FPGA 4NQ8A 2WYPA 1SPIA 1FPIA 2QVRA 3T1BA 1IMFA 1NUYA 1FJ6A 2Y5KA 5DW8A 2F5XA 3CHGA 1NUWA 1CNQA 1RDYA 2XWIA 4MNCA 4PF8A 1FBEA 1FSAA 5CM6A 3E78A 4O7IA 4X04A 1LBZA 1G0HA 1FTAA 1NV6A 4NN3A 4AS5A 4PFIA 2F3DA 1INPA 1NV4A 2B4MA 5I5PA 5I3SA 2XWVA 5EQ7A 4PE3A 1FBHA 4P56A 4MHFA 4N17A 1VDWA 1K9ZA 2P3NA 3RYDA 4PAIA 2WEFA 4I40A 4N6KA 4PTKA 2WYKA 4F1UA 4PETA 2QVVA 4JVCA 4GX4A 4DI3D 4P8BA 2VPNA 4O7MA 4F18A 1D9QA 4N8GA 4H46A 4NX1A 3B8BA 4YICA 5F24A 1IMDA 5J1DA 1FBGA 4GBVA 4XF5A 4NG7A 2KR0A 4GWXA 2CZKA 4N81A 5IZZA 4GBWA 1FPFA 4HE1A 2BJIA 2VT5A 3LUZA 3QMFA 4GWWA 2GQ1A 3BIGA 4KXPA 5IZ3B 1YXIA 1RDXA 4IR8A 4NAPA 4PAKA 3HFUA 4YZZA 4NHBA 4DI4B 4OVRA 1NV0A 1NV7A 1NV1A 1XI6A 2R8TA 4HE0A 4HXVA 1FPKA 1FPJA 2CEYA 1RDZA 1AWBA 4LN5A 4AS4A 4G61A 2Q8MA 4MX6A 4PFBA 4P3LA 3T0JA 4OVSA 2QVUA 4GX6A 4I3EA 5IM2A 1QGXA 3ISPA 2VPOA 2WX9A 4PF6A 3ROJA 3KBZA 4GWYA 5IZ3A 5FBPA 4N15A 2QFLA 4MEVA 2CZIA 4H45A 2XA5A 4GWUA 4HCYA 4MNPA 3MYUA 1IMAA 1FBCA 1NV2A 2XXKA 1KZ8A 2OX3A 3NOHA 3LV0A 4PFRA 4MIJA 3KC1A 1LBWA 3RPLA 5ET6A 4OANA 2Y5LA 3IFCA 1IMBA 1IMCA 4OA4A 1Q9DA 4GX3A 2HZLA 2B4LA 5IGAA 4PBHA 4PGPA 1YZ0A 1JP4A 3A29A 2PFZA 1EYJA 2ZZXA 4MJOA 4O94A 3D1RA 2Q9TA 3B50A 4FBPA 2OWZA 1DCUA 1EYIA 5LDZA 2KQZA 2DVZA 1K9YA 2F3BA 1LBYA 2FIEA 1DBZA 4N91A 3E79A 2DE3A 4QBAA 4M1VA 3PTYA 5ET7A 4F1VA 2WBDA 2DDKA 5JK4A 2FVZA 3W9VA 1NI9A 4JVIA 4HCWA 1FBDA 4P47A 4PDHA 4XFEA 1FJ9A 4I3YA 2HZKA 2XWKA 2FHYA 2Q74A 2XWOA 4NF0A 3IFAA 1FPEA 4QXDA 1YYZA 1KA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZH A;  1FPB A;  2P3V A;  1EYK A;  1LEV A;  2FIX A;  5EQ9 A;  5EQ8 A;  5EYG A;  1KA0 A;  5ET8 A;  1FBF A;  3BIH A;  1FRP A;  1G0I A;  1NV3 A;  1NV5 A;  3KC0 A;  1NUZ A;  5T3J A;  1LBX A;  3RPL B;  2HHM A;  4GWS A;  1IME A;  1NUX A;  5A5L A;  1FPL A;  1DK4 A;  4GWZ A;  1FBP A;  4HE2 A;  3FBP A;  5J16 A;  2WBB A;  2FBP A;  1BK4 A;  2JJK A;  2PCR A;  5ESY A;  5IZ1 A;  1LBV A;  5EYH A;  1FPD A;  5EQA A;  5ET5 A;  1FPG A;  1SPI A;  1FPI A;  2QVR A;  1IMF A;  1NUY A;  1FJ6 A;  2Y5K A;  5DW8 A;  1NUW A;  1CNQ A;  1RDY A;  1FBE A;  1FSA A;  4O7I A;  1LBZ A;  1G0H A;  1FTA A;  1NV6 A;  4AS5 A;  2F3D A;  1INP A;  1NV4 A;  5I3S A;  5EQ7 A;  1FBH A;  1VDW A;  1K9Z A;  2P3N A;  3RYD A;  2WEF A;  4I40 A;  4PTK A;  2QVV A;  4GX4 A;  1D9Q A;  4H46 A;  3B8B A;  5F24 A;  1IMD A;  1FBG A;  4GBV A;  4GWX A;  2CZK A;  4N81 A;  4GBW A;  1FPF A;  4HE1 A;  2BJI A;  2VT5 A;  3LUZ A;  3QMF A;  4GWW A;  2GQ1 A;  3BIG A;  4KXP A;  5IZ3 B;  1YXI A;  1RDX A;  4IR8 A;  1NV0 A;  1NV7 A;  1NV1 A;  1XI6 A;  2R8T A;  4HE0 A;  4HXV A;  1FPK A;  1FPJ A;  1RDZ A;  1AWB A;  4AS4 A;  4G61 A;  2Q8M A;  3T0J A;  2QVU A;  4GX6 A;  4I3E A;  1QGX A;  3ROJ A;  3KBZ A;  4GWY A;  5IZ3 A;  5FBP A;  2QFL A;  2CZI A;  4H45 A;  4GWU A;  1IMA A;  1FBC A;  1NV2 A;  1KZ8 A;  2OX3 A;  3LV0 A;  3KC1 A;  1LBW A;  3RPL A;  5ET6 A;  2Y5L A;  3IFC A;  1IMB A;  1IMC A;  1Q9D A;  4GX3 A;  1YZ0 A;  1JP4 A;  3A29 A;  1EYJ A;  4MJO A;  3D1R A;  4FBP A;  2OWZ A;  1DCU A;  1EYI A;  5LDZ A;  1K9Y A;  2F3B A;  1LBY A;  2FIE A;  1DBZ A;  5ET7 A;  2WBD A;  2DDK A;  2FVZ A;  1NI9 A;  1FBD A;  1FJ9 A;  4I3Y A;  2FHY A;  2Q74 A;  3IFA A;  1FPE A;  4QXD A;  1YYZ A;  1KA1 A; 
#chains in the Genus database with same CATH topology
 2Y7R A;  3W9W A;  1A55 A;  2Z8D A;  1RYX A;  1MY4 A;  2ZZW A;  5I84 A;  4NE4 A;  1FRP A;  1G0I A;  2VD3 A;  5KDT A;  5F1Q A;  2HPG A;  3T66 A;  5T3J A;  5H8Q B;  1NUX A;  4OVP A;  4GXS B;  3O97 A;  4GWZ A;  3FZV A;  3RPW A;  2HAU A;  3RTF B;  2PCR A;  2OLB A;  4WKM A;  2REJ A;  2UXA A;  1IMF A;  1P1O A;  5LTC A;  4MNC A;  3EPE A;  4FED A;  4X04 A;  3T93 B;  2UYE A;  1H3D A;  5I5P A;  2XWV A;  4JB7 A;  1A99 A;  4I40 A;  1VR5 A;  4I9D A;  4BDM A;  1MXU A;  1JET A;  1B5H A;  1YAE A;  4IGT A;  2G93 A;  1BP5 A;  1UQW A;  5DVJ A;  3LUZ A;  2PYY A;  4OHN A;  1ZLQ A;  1P1W A;  3N26 A;  2DWH A;  4LZ5 A;  1FPK A;  2QMW A;  2PT1 A;  3T0J A;  4I3E A;  4R6K A;  5ISU A;  3RUM A;  2CZI A;  3FVN A;  4MLQ A;  2XXK A;  4PFT A;  1XVY A;  5CRY A;  3IFC A;  5FHM A;  2O7I A;  1A8F A;  2BJJ X;  4EF2 A;  1DCU A;  2F7C A;  1NNP A;  2I48 A;  1OLA A;  4QBA A;  5JK4 A;  5K2Y A;  1MY3 A;  2FYI A;  5CI5 A;  4XFE A;  2XXY A;  3K6X A;  2XWO A;  2Q74 A;  3O6I A;  3IFA A;  2Z23 A;  1YYZ A;  3PUV E;  4Z0I A;  3A09 A;  2ZZV A;  1R1N A;  1BIY A;  5EYG A;  3BIH A;  3FJ7 A;  4Q5T A;  2GH9 A;  3E13 X;  2THI A;  3K0V A;  5I59 B;  2NUV A;  4MBP A;  1DPP A;  2NWJ A;  2OJT A;  1MDP 1;  5ICT A;  5FHN A;  1XVX A;  1B2H A;  5CMM A;  4KFQ A;  4R74 A;  1MDQ A;  2UVH A;  1ZBM A;  2AIX A;  3T1B A;  4ECF A;  3DM0 A;  3U1O A;  1N3W A;  3MP6 A;  3B6T A;  1Y20 A;  3FVG A;  3IO6 A;  3Q25 A;  3HN0 A;  2VPN A;  1OVT A;  3R7X A;  4GBW A;  3BIG A;  3HFU A;  3OO6 A;  5H8N B;  5I56 B;  5ICQ A;  1M5B A;  4ZE9 A;  4RJZ A;  3K00 A;  4GX6 A;  5IM2 A;  4F22 A;  2VPO A;  3KBR A;  4ZEI A;  4GWU A;  2XX9 A;  1IMA A;  1N76 A;  3FUZ A;  1IEJ A;  1GVC A;  1AMF A;  4UA8 A;  4YKP A;  2P0S A;  2HQ0 A;  4RPN A;  4R2B A;  1EYJ A;  3ODB A;  4YMB A;  3TEP A;  2X7Q A;  1D9V A;  2DYX A;  1LLS A;  2F7B A;  1IXH A;  3H03 A;  3T22 A;  1FTK A;  4U1Z A;  4GD5 A;  3HST A;  2MKZ A;  5M2V A;  1OLC A;  4F2Q A;  2DSF A;  3PUY E;  4M4G A;  1NH8 A;  4PAF A;  2OBG A;  2O1M A;  2D21 A;  2PX1 A;  3CG3 A;  2W7Y A;  4HE2 A;  1O7T A;  4GL0 A;  4BDO A;  4XEQ A;  1EH3 A;  3L6G A;  5AA4 B;  3MVW A;  1IZ1 A;  1ATG A;  1IQ7 A;  2FA7 A;  5HM4 B;  4BDR A;  4RY1 A;  3VFJ A;  2REG A;  4IGR A;  3TUS A;  1PC3 A;  2OWT A;  4AS5 A;  4GIZ A;  5AA4 A;  1NV4 A;  1R9L A;  4OFL A;  4P56 A;  1PB9 A;  1Y9U A;  3KJ7 A;  2F6G A;  4LON B;  2QVV A;  4MFI A;  3KOS A;  5H8F B;  3TYH A;  2DS9 A;  1LFH A;  1IMD A;  4NG7 A;  2DWA A;  3CRB A;  3C31 A;  3QMF A;  3BBR A;  3L6H A;  4G8H A;  3VDF A;  5AA2 B;  3OXN A;  1US4 A;  2A5T B;  1FPJ A;  1QKA A;  4RK9 A;  3CG1 A;  1Y4C A;  4PF6 A;  1YTV A;  4IY5 A;  1KZ8 A;  4EQB A;  1IIW A;  2RIN A;  3LSX A;  1D4N A;  3MP1 A;  4HW8 A;  4GX3 A;  2PBW A;  4AB6 A;  1YCJ A;  4RXL A;  1FQF A;  3UIF A;  4ELR A;  4OER A;  3EF7 A;  3HPI A;  4JWY A;  4AQ4 A;  1TFD A;  5FTI A;  4KYE A;  1NFT A;  2XHD A;  5DVI A;  5IAI A;  2DDK A;  1B3F A;  1FTO A;  3CVG A;  4Q30 B;  4G77 A;  2HXR A;  3IB2 A;  5I57 A;  4MLV A;  1MY1 A;  3UOR A;  2F8D A;  1ZKB A;  1NV3 A;  3M3L A;  3LSF B;  2I4C A;  1A7L A;  3H06 B;  1N7X A;  3G3J A;  4JVD A;  4RA1 A;  1JNF A;  3EHT A;  3K6U A;  5A5X B;  4F3P A;  2VOZ A;  3VXC A;  4OVJ A;  2KLF A;  2I58 A;  2GHB A;  5ITP A;  2O68 A;  3KSJ A;  1UTB A;  4BLA A;  1AOV A;  3OEN A;  4YIC A;  2XXV A;  4LA9 A;  5BUU A;  4U23 A;  3U93 A;  1B5I A;  3OO9 A;  1MM6 A;  4OXV A;  5JTY B;  3TPA A;  1XI6 A;  2P1S A;  3OO8 A;  1B3L A;  2B3B A;  2QRY A;  2Z22 A;  1BTJ A;  3N6T A;  2XA5 A;  4OES A;  5CMK A;  5IGA A;  2GRV A;  3O2A A;  2UVI A;  1DMB A;  4MF3 A;  3CFZ A;  1UIU A;  2I3W A;  3W9V A;  3C4M A;  1VFE A;  1B58 A;  3EHS A;  4YAH X;  1FJ9 A;  4ZZE A;  3U92 A;  1H45 A;  4KYS A;  2X7P A;  1DTZ A;  3EKI A;  1N3X A;  1US5 A;  4EUO A;  2RCA A;  4ND9 A;  3K6V A;  1LBX A;  4PCD A;  3MST A;  3MUQ A;  3FV1 A;  2ZNS A;  5KCJ A;  1ZTY A;  2L5V A;  4N6D A;  4OVT A;  3BFU A;  2Y7I A;  3SZP A;  3OD7 A;  1MQJ A;  1UTH A;  4F19 A;  3UA8 A;  4NQ8 A;  4YB6 A;  4ZEC A;  2YJP A;  5I58 A;  2XWI A;  3DLN A;  4TLM B;  1FTJ A;  1H44 A;  1NV6 A;  3B6W A;  3SEU A;  4X1D A;  5BWJ A;  4LZ8 A;  1SYI A;  4NX1 A;  4NF6 A;  2QL3 A;  1OMP A;  3SEX A;  1B0L A;  1TWY A;  1B1X A;  3ZKL A;  4QSD A;  3VVD A;  3KSX A;  1FQA A;  3OEM A;  3G3G A;  2Y7W A;  3E9X A;  4HS7 A;  2WX9 A;  1Y1M A;  1LBC A;  3GZG A;  2ZMB A;  4MIJ A;  4OAN A;  1SYH A;  5LOM A;  5AA2 A;  4POX A;  3D4C A;  2OWZ A;  1SW4 A;  2XXU A;  3S9L C;  2XXX A;  1QJM A;  5H8F A;  2I0B A;  2Y7P A;  2PMS A;  3G3I A;  1FPE A;  2P3V A;  5I2N A;  1EYK A;  1QUL A;  4DIG A;  1UTH B;  3MW0 A;  4PE5 B;  3TTR A;  3MVY A;  3FGS A;  1B3E A;  1FQE A;  1SDX A;  4O3A A;  4WXJ A;  4XIG Q;  3MPK A;  4JWO A;  3PMX A;  1DK4 A;  4X9T A;  1MQD A;  1MQH A;  1HSE A;  5ITO A;  1HSJ A;  2WKY A;  3GBB A;  2V3Q A;  3PD9 A;  1RYO A;  1FPD A;  3PPQ A;  5I57 B;  3FJM A;  3O66 A;  3SKP A;  4AB5 A;  1F9B A;  1SPI A;  1B3H A;  4LVQ A;  1NUY A;  1T0K A;  4YMA A;  1MY0 A;  3GBA A;  1PB8 A;  3MWB A;  4PAI A;  2R71 A;  3TKD A;  3QSL A;  4NF8 B;  3UN6 A;  4DI3 D;  1B51 A;  3MPL A;  4NWC A;  2XXQ A;  4XF5 A;  4GBV A;  3MZB A;  1FQB A;  3RNN A;  3G3K A;  1LGB C;  1RDX A;  1NV0 A;  1B5J A;  4HE0 A;  1Y3P A;  1DTG A;  1SI1 A;  3T9V A;  1MXV A;  4LQ2 A;  3RT6 B;  2Q88 A;  2IA4 A;  4GWY A;  2M8C A;  2F78 A;  2V3T A;  3MYU A;  3NOH A;  3IOR A;  1IIT A;  4OA4 A;  1EZ9 A;  3K4U A;  2PFZ A;  4FBP A;  3THI A;  5AA3 A;  4N91 A;  1B6H A;  4U4X A;  2V93 A;  4G8N A;  2O51 A;  4QXD A;  5EQ9 A;  3OSR A;  2A5S A;  3IX1 A;  4XKN A;  1YPN A;  2VGQ A;  2RC9 A;  4R6Y A;  4YKK A;  3FXB A;  4C1U A;  1FW0 A;  4P1L A;  3S2V A;  2OWS A;  1FBP A;  4OEV A;  3TAJ A;  2WBB A;  3N6U A;  4TQU Q;  3O9P A;  2I49 A;  5F7V A;  5I7I A;  3C35 A;  2O7U A;  2QPQ A;  1MRP A;  2DXY A;  5DW8 A;  4PF8 A;  5H8H A;  2RC7 A;  1R9Q A;  5EQ7 A;  2XX8 A;  4MHF A;  2I0C A;  2WEF A;  4NWD A;  4PTK A;  2WYK A;  4JVC A;  4GX4 A;  1JVX A;  3FXR A;  1B40 A;  2DVC A;  2KR0 A;  2NOO A;  3HO7 A;  5IZ3 B;  1AIV A;  5DTB A;  3RLF E;  2R8T A;  3B7D A;  4RK2 A;  3ONM A;  4EXK A;  2V3U A;  1MM7 A;  3QAX A;  3IJO B;  3TOD A;  1NNT A;  5H8N A;  3C36 A;  4QSC A;  3VV5 A;  4H45 A;  4U4S A;  4Z7E A;  3MVZ A;  5EHS A;  3PPN A;  3KC1 A;  2ZXT A;  1AH5 A;  1IMC A;  2XD2 A;  1BLF A;  4ELP A;  1NL5 A;  1IXG A;  1MS7 A;  4MJO A;  3D1R A;  4LQ5 A;  4U21 A;  2DXR A;  3Q28 A;  4U1O A;  1I6B A;  1I6A A;  4PFY A;  3KOT A;  1CB6 A;  2YPN A;  3MP8 A;  3MVX A;  1BKA A;  1MQI A;  3IB1 A;  1A40 A;  2XXW A;  5ELV A;  5K2X A;  3IOW A;  1KA0 A;  2F6P A;  1A54 A;  4NGU A;  4GRK A;  2R6G E;  3SES A;  4XKR A;  3KZG A;  5AE4 A;  4GWS A;  3H6V A;  3SEW A;  4N13 A;  1MPC A;  1NKX A;  4LUB A;  1PEB A;  2IEE A;  2OZZ A;  3IOT A;  1FPI A;  2Y5K A;  5AA1 A;  4BDQ A;  4KPT A;  1FBE A;  4DDD A;  4WED A;  1MXW A;  2QS1 A;  4PE3 A;  3M3F A;  4C1T A;  3HHF A;  1GTK A;  4ZE8 A;  5KZT A;  3H6U A;  4FOR A;  2Q8J A;  1NH7 A;  1GR2 A;  1SD3 A;  3V8X B;  3MQ9 A;  4F39 A;  4IO6 A;  1FTL A;  3EQ1 A;  4OVR A;  4HXV A;  2UVG A;  4GOT A;  4ONY A;  1SW2 A;  3KBZ A;  5IZ3 A;  1WVJ A;  1USY H;  1NV2 A;  1JW1 A;  2DWI A;  3WAF A;  1WDN A;  4LP2 B;  4JWX A;  3GXA A;  3H7M A;  3QXM A;  4R73 A;  2VD2 A;  2KQZ A;  4G4P A;  4PFU A;  3WAE A;  4F1V A;  3BFT A;  1NI9 A;  4P11 A;  5FTH A;  4TLL B;  2CZH A;  3RY3 A;  2F36 A;  5EHM A;  4MCO A;  4GWO A;  5EQ8 A;  2G29 A;  1NV5 A;  2DE4 A;  3M3K A;  4KCD A;  2Q2C A;  3RPL B;  4H5F A;  4UAB A;  5J16 A;  2FBP A;  1FTM A;  4O8M A;  1LBV A;  1LBB A;  4O3C A;  2WYP A;  3PUZ E;  3LR1 A;  2PVU A;  2F34 A;  1G0H A;  2AL5 A;  1SW1 A;  5I3S A;  3I3V A;  3K1P A;  1VDW A;  2P3N A;  1Z7N E;  3BKI B;  3TCH A;  4H67 A;  4P8B A;  3ILT B;  5L9S A;  1D9Q A;  2H98 A;  5FHO A;  4RYA A;  1KWH A;  1D3K A;  3P7I A;  5H8Q A;  4EQ7 A;  1FQD A;  3S9M C;  3TCG A;  2VT5 A;  5CBR A;  1MG1 A;  4X48 A;  4QFP A;  5I2K A;  2Q8M A;  3LSW A;  4EQ9 A;  4MEV A;  1VE4 A;  5AA2 D;  2Y5L A;  2ALU A;  4PBH A;  5KCJ B;  1USY E;  1B4H A;  3TTM A;  2Q9T A;  5TPA A;  1EYI A;  4QRZ A;  4H8J A;  3PPR A;  3E79 A;  5I2K B;  3K1M A;  3FVO A;  2RCB A;  4GL8 A;  3U72 A;  3FXU A;  3VE1 B;  4FJP A;  2H25 A;  1LFG A;  2Z8E A;  1PDA A;  1AL3 A;  3IR1 A;  2CEX A;  4R2F A;  5HBC A;  1URG A;  1MH4 A;  4QF9 A;  4GVO A;  3I5O A;  3Q26 A;  3TTK A;  1QKB A;  4O3B A;  3KG2 A;  3FBP A;  3MJN A;  4QFN A;  4K3F A;  2JJK A;  1B7Z A;  5IZ1 A;  3OOA A;  1N0T A;  3TZA A;  2DWJ A;  4H6D A;  2QVR A;  1DOT A;  4KHZ E;  1NUW A;  1CNQ A;  1FSA A;  1LBZ A;  1FTA A;  1QUJ A;  1H43 A;  1INP A;  2D3I A;  5JTY A;  4U22 A;  1B0H A;  4N6K A;  4NF4 A;  2I6E A;  4JBZ A;  4H46 A;  4QFO A;  5DEX B;  2ANJ A;  5TP9 A;  1A8E A;  5IZZ A;  1UTB B;  4XKP A;  4PAK A;  4YB5 A;  2QS4 A;  4P0I A;  1Q35 A;  1J1N A;  1I6Q A;  1Z7M E;  1EZP A;  2OPE A;  3ROJ A;  3C32 A;  4DXC A;  4MNP A;  3FAT A;  4H65 A;  3O6G A;  1FBC A;  4F31 B;  1QW0 A;  3RPL A;  4GFR A;  1Q9D A;  2GHA A;  5CMC A;  4F3G A;  3SET A;  4O94 A;  3K2D A;  4GF8 A;  5LDZ A;  2FNC A;  2R9J A;  3PPO A;  1M5E A;  4U2R A;  3PGF A;  1JQF A;  1D9Y A;  4WEP A;  3ILU B;  4N8Y A;  4OTE A;  1QVS A;  2Q2A A;  1PBQ A;  3TDJ A;  1NMU A;  4QFK A;  1B7U A;  2H9B A;  5L8D A;  4KYD A;  3JYR A;  4IO2 A;  3FJG A;  4ZDM A;  2DE2 A;  3OMB A;  1NNK A;  2QS3 A;  4OQO A;  4I62 A;  4ISU A;  1OQG A;  3USD A;  3G3F A;  2DQV A;  5DEX A;  1O64 A;  1JVY A;  4JDF A;  4EF1 A;  4RPO A;  2ESN A;  2I4B A;  1CE2 A;  2F5X A;  3HHG A;  3RTW B;  2A5T A;  3H6W A;  4NN3 A;  4ELQ A;  3PU5 A;  1TXF A;  4N17 A;  3T9H B;  4F1U A;  1QUK A;  1IUD A;  1L5T A;  2XXI A;  2HEU A;  3U8Q A;  4HTG A;  4G68 B;  2GQ1 A;  3T96 B;  1YXI A;  3Q27 A;  4F1Y A;  1NV7 A;  3C9H A;  3DP4 A;  4NMY A;  5DVF A;  2XXH A;  3PMV A;  1AWB A;  1SVX B;  3CFL A;  3AXF A;  1S50 A;  4YKJ A;  2AL4 A;  1SBP A;  2ZYN A;  3V5A A;  3CIJ A;  3DP8 A;  4PFW A;  4F2O A;  4OWD A;  5ET6 A;  3TMG A;  2HZL A;  4BDN A;  3K02 A;  2LAO A;  1PBP A;  4NED A;  2DP8 A;  1LAX A;  3CSB A;  2FVZ A;  5TPA B;  4HCW A;  3PMW A;  4LZ7 A;  2FHY A;  3PUX E;  1B32 A;  2F7A A;  4DXU A;  2F97 A;  1M5D A;  4ZEF A;  1FPB A;  2V4C A;  4P1E A;  3SER A;  3VLU A;  4F29 A;  1POT A;  1QUI A;  2Q89 A;  3KEI A;  2O69 A;  5I2N B;  3PUW E;  3PV0 E;  4PBQ A;  5A5L A;  2PFY A;  1B7H A;  2DOJ A;  2E1S A;  2UYF A;  3IOV A;  3TQW A;  1MQG A;  4OZ9 A;  4NF6 B;  4IB2 A;  4ZED A;  3IAZ A;  2ZYK A;  4IO7 A;  2B4M A;  4C0R A;  2AYS A;  3S9E A;  4F3S A;  2RKM A;  3FXQ A;  4HE1 A;  3IJX B;  3QIM A;  4GWW A;  5B7D A;  5I58 B;  5L9M A;  5DT6 A;  1JEV A;  3T9X B;  4NHB A;  3FIR A;  3FVK A;  1LAH E;  3KN7 A;  2NXO A;  1M5F A;  2PT2 A;  4KD5 A;  4PP0 A;  3RGY A;  4IO5 A;  3LV0 A;  2D5W A;  4FIM A;  3ZS6 A;  4TOZ A;  1JW4 A;  2X26 A;  2ZZX A;  4XTC Q;  1VFD A;  4LAT A;  1DBZ A;  3VVE A;  4NF4 B;  5EYF A;  2XX7 A;  4JVI A;  3MZ1 A;  3G3H A;  3A3U A;  4G68 C;  4OFJ A;  3G7W A;  4ZEB A;  4PC9 A;  3KN3 A;  1XT8 A;  2FIX A;  4YU0 A;  2XD3 A;  3TQL A;  1WOD A;  3VVF A;  3W15 C;  1XOC A;  3JV9 A;  1EZO A;  4OMB A;  1MPD A;  4P0G A;  3CI8 A;  3LBS A;  1MH3 A;  3UK4 A;  5TU0 A;  3TTL A;  1LCF A;  2VHA A;  3CFX A;  5ESY A;  2Z8F A;  5EQA A;  1LB9 A;  3U94 A;  3RN8 A;  5CMB A;  3MAM A;  4H5G A;  3E3K A;  2F3D A;  2V84 A;  3HCQ A;  1LFI A;  4DCX A;  3T9U A;  1K9Z A;  1P99 A;  3IK6 B;  4DCY A;  4PET A;  4F18 A;  4ESX A;  2Y7K A;  4IO4 A;  1MXY A;  1FBG A;  5KDT B;  3MZ9 A;  2CZK A;  2F35 A;  4R6H A;  4I1D A;  4RNS A;  2OK2 A;  4NF5 A;  4OEN A;  4R75 A;  1POY 1;  1MPB A;  4PQJ A;  2ONS A;  2NVU B;  4G61 A;  2QVU A;  4BDL A;  3ISP A;  3TFL A;  3QUJ A;  1B3G A;  4HCY A;  2O84 X;  3ZKK A;  1RKM A;  1MXZ A;  3ECR A;  3K6W A;  3R26 A;  1Y1Z A;  3O6H A;  4PGP A;  3A29 A;  1LCT A;  3JZJ A;  4QFL A;  1B4Z A;  4Q8R A;  2DVZ A;  3OEL A;  3QK6 A;  3F11 A;  2DE3 A;  3PTY A;  2I3V A;  2ZYO A;  1ANF A;  4ZS9 A;  4P47 A;  2ONK E;  2XXP A;  1KA1 A;  3CSG A;  4N4U A;  3O29 A;  1GGG A;  1FBF A;  3OO7 A;  1SI0 A;  1B05 A;  3KC0 A;  1DSN A;  2OCU A;  3O28 A;  1URD A;  4R72 A;  3S4U A;  1IME A;  3GYY A;  4PFR A;  2CZL A;  4P9K A;  3IO4 A;  1ZMG A;  3U65 A;  3KFM A;  5L9O A;  4IO3 A;  4X8R A;  1H76 A;  3QYT A;  4OYV A;  4KQP A;  1S9T A;  3I6V A;  3V89 B;  3M8U A;  5CC2 A;  3E78 A;  4O7I A;  1URS A;  1SQY A;  1FBH A;  1Y4T A;  5H8H B;  5HPQ A;  3RYD A;  3LC8 A;  4N8G A;  3B8B A;  5F24 A;  5J1D A;  4KR5 A;  4GWX A;  1JEU A;  1PB7 A;  1MY2 A;  4UAC A;  2ABH A;  3CR9 A;  2BJI A;  2B3F A;  1B1H A;  3IB0 A;  3VXB A;  4KXP A;  3DEL B;  5JEI A;  2B65 A;  4XXU A;  4YZZ A;  3RT8 A;  1Y3Q A;  2CEY A;  4LN5 A;  4AS4 A;  4MX6 A;  1GV8 A;  3SEV A;  1Q1K A;  5FBP A;  5CBS A;  2VP1 A;  5A5X A;  3EN3 A;  3TTN A;  2OX3 A;  1LBW A;  5H8S A;  1P1U A;  4YKI A;  3S9N C;  1HSL A;  3V83 A;  2HFB A;  3B50 A;  1R6Z A;  1XC1 A;  1NNF A;  4E0X A;  1S7Y A;  4M1V A;  4YB7 A;  1IXI A;  4H8I A;  4QSE A;  1N84 A;  3R6U A;  2HZK A;  4NF0 A;  3K01 A;  4ZZA A;  3TEL A;  1FCK A;  2QS2 A;  2V25 A;  2H99 A;  1XHY A;  1LEV A;  4FAT A;  1II5 A;  3FAS A;  3IL1 B;  4FEB A;  1TFA A;  3PPP A;  3GLB A;  1NUZ A;  2ZNT A;  4NTL A;  1EU8 A;  4G68 A;  4FAJ A;  3FD3 A;  1B9J A;  4MMP A;  4DXB A;  2HHM A;  2ZYM A;  1FPL A;  4ELO A;  3OEK A;  3H3G A;  4DLD A;  4OVQ A;  1XS5 A;  4MAG A;  1SW5 A;  2OPD A;  5ET5 A;  4EXL A;  1DPE A;  1N7W A;  3CHG A;  2E0S A;  5DYH A;  4EDP A;  5CM6 A;  3QUF A;  3C33 A;  3LUY A;  3SEY A;  3MBP A;  3HV1 A;  4H0W A;  4E0W A;  2Y84 A;  2P2A A;  3H6T A;  2HXW A;  4N81 A;  1FPF A;  2HCA A;  4THI A;  4R9G A;  1OIB A;  1ZJL A;  3PD8 A;  4PGN A;  3VLW A;  1RDZ A;  4FE8 A;  4PFB A;  2RF1 A;  4H1X A;  1ELJ A;  4GXA A;  4OVS A;  1QGX A;  4XKQ A;  2GFE A;  4N07 A;  1IXC A;  2CMO A;  1YZ0 A;  4G2Z A;  1Y3N A;  2YLN A;  2FIE A;  1LAF E;  2H4I A;  2QSX A;  3UP9 A;  4JSO A;  1P1N A;  1UIV A;  3TCF A;  3C34 A;  2XWK A;  1ZIU A;  3SDF A;  1ZU0 A;  4OFO A;  3DP6 A;  5ET8 A;  2HAV A;  2RC8 A;  4L17 A;  4JSD A;  2O6A A;  2ZNU A;  3IOU A;  1VSO A;  2XXR A;  1O63 A;  4PDD A;  4MNI A;  1LST A;  3A3C A;  5B70 A;  4KCC A;  4Q0C A;  1BK4 A;  4I8C A;  1B52 A;  5EYH A;  3UGW A;  5IKB A;  2H5Y A;  3D4G A;  1FPG A;  4ESW A;  3OSQ A;  4NF5 B;  1OQH A;  1FJ6 A;  4N15 A;  3RQT A;  4IY6 A;  1RDY A;  4QHQ A;  4OEU A;  1I69 A;  4PFI A;  4JXI A;  5I56 A;  3N94 A;  3N5L A;  4O7M A;  4R9F A;  2XXT A;  3LSL A;  4GQO A;  2QJE A;  3MC2 A;  3KGC A;  2QMX A;  4DZ1 A;  4IR8 A;  4NAP A;  3H4Z A;  4DI4 B;  1NV1 A;  3FV2 A;  3Q29 A;  4POW A;  1OVB A;  4P3L A;  4N6P A;  4X1B A;  1P1Q A;  4NF8 A;  2QFL A;  4FEC A;  3B6Q A;  1MXX A;  2ONR A;  1M5C A;  1LAG E;  1IMB A;  3EHU A;  3KJT A;  3VLV A;  2B4L A;  1LB8 A;  2O1L A;  4G8M A;  1JP4 A;  4GLI A;  4ZEK A;  3KN8 A;  5TP9 B;  3E4R A;  4F3B A;  1K9Y A;  2F3B A;  1LBY A;  5I59 A;  2UVJ A;  4OET A;  5ET7 A;  2WBD A;  1N04 A;  3K1N A;  1FBD A;  4PDH A;  1FQC A;  3ZSF A;  4KI0 E;  4MH5 A;  4I3Y A;  1JW5 A;  1B46 A;  1TT1 A;  4DE8 A; 
#chains in the Genus database with same CATH homology
 4PC9 A;  4N8Y A;  2CZH A;  2CEX A;  1FPB A;  3W9W A;  2P3V A;  1EYK A;  2V4C A;  4N4U A;  1LEV A;  2FIX A;  5EQ9 A;  4P1E A;  2ZZV A;  3EKI A;  4MCO A;  2HXR A;  2MKZ A;  5EQ8 A;  5EYG A;  1KA0 A;  5ET8 A;  2ZZW A;  1FBF A;  3BIH A;  4PGN A;  4NGU A;  1FRP A;  1G0I A;  1NV3 A;  1NV5 A;  2DE4 A;  3KC0 A;  4PAF A;  1NUZ A;  2HPG A;  5T3J A;  3FXB A;  1LBX A;  3RPL B;  4MMP A;  4PCD A;  2HHM A;  4GWS A;  1IME A;  2DE2 A;  3GYY A;  1NUX A;  3MST A;  4P1L A;  5A5L A;  4PBQ A;  1FPL A;  2PFY A;  4P9K A;  4OVP A;  4JVD A;  1DK4 A;  4GWZ A;  1FBP A;  4PDD A;  4X9T A;  2L5V A;  4MNI A;  4HE2 A;  4N6D A;  3FBP A;  5J16 A;  4UAB A;  2WBB A;  4OVT A;  2FBP A;  1BK4 A;  4OVQ A;  2V3Q A;  3U65 A;  2JJK A;  3SZP A;  2PCR A;  5ESY A;  5IZ1 A;  4MAG A;  4O8M A;  1LBV A;  4XEQ A;  5I7I A;  5EYH A;  4X8R A;  1FPD A;  5EQA A;  5LTC A;  5ET5 A;  2QPQ A;  4F19 A;  1FPG A;  4NQ8 A;  2WYP A;  1SPI A;  1FPI A;  2QVR A;  3T1B A;  1IMF A;  1NUY A;  1FJ6 A;  2Y5K A;  5DW8 A;  2F5X A;  3CHG A;  1NUW A;  1CNQ A;  1RDY A;  2XWI A;  4MNC A;  4PF8 A;  1FBE A;  1FSA A;  5CM6 A;  3E78 A;  4O7I A;  4X04 A;  1LBZ A;  1G0H A;  1FTA A;  1NV6 A;  4NN3 A;  4AS5 A;  4PFI A;  2F3D A;  1INP A;  1NV4 A;  2B4M A;  5I5P A;  5I3S A;  2XWV A;  5EQ7 A;  4PE3 A;  1FBH A;  4P56 A;  4MHF A;  4N17 A;  1VDW A;  1K9Z A;  2P3N A;  3RYD A;  4PAI A;  2WEF A;  4I40 A;  4N6K A;  4PTK A;  2WYK A;  4F1U A;  4PET A;  2QVV A;  4JVC A;  4GX4 A;  4DI3 D;  4P8B A;  2VPN A;  4O7M A;  4F18 A;  1D9Q A;  4N8G A;  4H46 A;  4NX1 A;  3B8B A;  4YIC A;  5F24 A;  1IMD A;  5J1D A;  1FBG A;  4GBV A;  4XF5 A;  4NG7 A;  2KR0 A;  4GWX A;  2CZK A;  4N81 A;  5IZZ A;  4GBW A;  1FPF A;  4HE1 A;  2BJI A;  2VT5 A;  3LUZ A;  3QMF A;  4GWW A;  2GQ1 A;  3BIG A;  4KXP A;  5IZ3 B;  1YXI A;  1RDX A;  4IR8 A;  4NAP A;  4PAK A;  3HFU A;  4YZZ A;  4NHB A;  4DI4 B;  4OVR A;  1NV0 A;  1NV7 A;  1NV1 A;  1XI6 A;  2R8T A;  4HE0 A;  4HXV A;  1FPK A;  1FPJ A;  2CEY A;  1RDZ A;  1AWB A;  4LN5 A;  4AS4 A;  4G61 A;  2Q8M A;  4MX6 A;  4PFB A;  4P3L A;  3T0J A;  4OVS A;  2QVU A;  4GX6 A;  4I3E A;  5IM2 A;  1QGX A;  3ISP A;  2VPO A;  2WX9 A;  4PF6 A;  3ROJ A;  3KBZ A;  4GWY A;  5IZ3 A;  5FBP A;  4N15 A;  2QFL A;  4MEV A;  2CZI A;  4H45 A;  2XA5 A;  4GWU A;  4HCY A;  4MNP A;  3MYU A;  1IMA A;  1FBC A;  1NV2 A;  2XXK A;  1KZ8 A;  2OX3 A;  3NOH A;  3LV0 A;  4PFR A;  4MIJ A;  3KC1 A;  1LBW A;  3RPL A;  5ET6 A;  4OAN A;  2Y5L A;  3IFC A;  1IMB A;  1IMC A;  4OA4 A;  1Q9D A;  4GX3 A;  2HZL A;  2B4L A;  5IGA A;  4PBH A;  4PGP A;  1YZ0 A;  1JP4 A;  3A29 A;  2PFZ A;  1EYJ A;  2ZZX A;  4MJO A;  4O94 A;  3D1R A;  2Q9T A;  3B50 A;  4FBP A;  2OWZ A;  1DCU A;  1EYI A;  5LDZ A;  2KQZ A;  2DVZ A;  1K9Y A;  2F3B A;  1LBY A;  2FIE A;  1DBZ A;  4N91 A;  3E79 A;  2DE3 A;  4QBA A;  4M1V A;  3PTY A;  5ET7 A;  4F1V A;  2WBD A;  2DDK A;  5JK4 A;  2FVZ A;  3W9V A;  1NI9 A;  4JVI A;  4HCW A;  1FBD A;  4P47 A;  4PDH A;  4XFE A;  1FJ9 A;  4I3Y A;  2HZK A;  2XWK A;  2FHY A;  2Q74 A;  2XWO A;  4NF0 A;  3IFA A;  1FPE A;  4QXD A;  1YYZ A;  1KA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...