1G0IA

Crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
252
structure length
252
Chain Sequence
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Crystal structure and catalytic mechanism of the MJ0109 gene product: a bifunctional enzyme with inositol monophosphatase and fructose 1,6-bisphosphatase activities.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 69
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2000-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1g0iA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1g0iA02
3IFAA 1NV5A 1G0HA 2FIXA 1FPDA 5LDZA 5EQ9A 1NV3A 1EYKA 2WBBA 1K9ZA 1LBXA 1NV6A 3IFCA 1RDYA 4GX6A 2HHMA 5DW8A 2CZHA 2Y5LA 5FBPA 1LBZA 2P3VA 4GWZA 1NV2A 1SPIA 1FBGA 3RYDA 4I3EA 3A29A 1NUWA 1FPBA 1D9QA 1FBHA 1FPKA 4H46A 1NV4A 1FBPA 5EYGA 1LEVA 4FBPA 4GWSA 4GBWA 2FIEA 4GWUA 1FPIA 1FBEA 5EQ8A 2WBDA 1XI6A 3ROJA 1QGXA 2QVUA 1NV0A 4I40A 3RPLA 1YYZA 1YZ0A 4MJOA 2DDKA 3RPLB 1FPJA 4G61A 3BIHA 1LBVA 1FPGA 4HE1A 1G0IA 2F3DA 5T3JA 1YXIA 3KC0A 4I3YA 1INPA 1FPEA 3KBZA 1FPLA 4HE0A 1EYJA 1FTAA 1DK4A 2CZIA 2CZKA 1FSAA 4AS5A 3T0JA 3KC1A 1NUXA 2FVZA 5ET8A 4QXDA 2Y5KA 1EYIA 4PTKA 1FBDA 1NV7A 4HXVA 4GX3A 1NUZA 1BK4A 3LUZA 2WEFA 2BJIA 1IMFA 1IMCA 1DCUA 1FJ6A 4HE2A 1LBWA 1RDXA 5IZ1A 1VDWA 3LV0A 1IMBA 2OWZA 5EQAA 1JP4A 2Q8MA 1LBYA 3D1RA 2OX3A 2QVRA 5EYHA 2F3BA 3FBPA 4KXPA 4N81A 1Q9DA 5EQ7A 1IMEA 4GWXA 4GWYA 1IMAA 1DBZA 4H45A 5ET5A 5IZ3A 4GBVA 1RDZA 3QMFA 5IZ3B 5A5LA 4GX4A 2QVVA 1NUYA 1FJ9A 2Q74A 2JJKA 1NV1A 2P3NA 1FBCA 2R8TA 1KA0A 5ET6A 1AWBA 4GWWA 2VT5A 5ET7A 2QFLA 1CNQA 3B8BA 3BIGA 2GQ1A 1IMDA 2PCRA 5F24A 5J16A 5I3SA 4IR8A 4AS4A 1FPFA 2FBPA 1FBFA 1NI9A 1K9YA 1KZ8A 1FRPA 5ESYA 4O7IA 2FHYA 1KA1A
chains in the Genus database with same CATH superfamily
5DEXA 5EQ9A 1ZIUA 3FZVA 4MX6A 1EYKA 1NKXA 4ZE8A 1US5A 2CZHA 2O6AA 1FPKA 4JVDA 4Z0IA 4GWSA 4KQPA 4NN3A 3TTRA 1Z7NE 2ESNA 3MJNA 1B5HA 4RPOA 1N7XA 4TOZA 5AA1A 3SEUA 4GF8A 4C1UA 2F6GA 1A40A 5DYHA 1OLCA 4FEDA 1VSOA 1MH3A 5H8NB 3LR1A 5ITOA 3K1NA 3MP6A 2Q89A 3TAJA 1XT8A 1P1WA 3UGWA 3BFUA 1GV8A 3K6XA 5CBSA 3LUZA 1I6BA 2AYSA 2UYFA 5EYFA 3PUVE 2V4CA 4EDPA 4R9FA 3OSQA 1N84A 2PT2A 4EF1A 3MVXA 4PFWA 3M3KA 5I57B 5CMMA 1A8FA 2Y7PA 1B5IA 1MG1A 2HAUA 4PF6A 2P2AA 4OA4A 2Q74A 3PGFA 4MNCA 1FBCA 3QUJA 3O6HA 1M5EA 2XX8A 3U65A 1DTZA 1NMUA 1Y9UA 1PEBA 1SW5A 3TCFA 2QMWA 2I49A 2QS4A 3H6WA 2VOZA 2KLFA 1JVYA 3H06B 5DVFA 4RY1A 4HCYA 4FIMA 2H99A 1D9VA 2GRVA 1TXFA 4GWZA 4JVIA 4PBQA 1FPBA 2XX7A 1FBHA 4KYDA 2Q88A 4QFPA 4OFJA 3RPLA 1YZ0A 2OWTA 3OENA 1B3EA 1JW5A 3DM0A 3MAMA 4RJZA 3IOTA 1G0IA 4IO7A 3TKDA 4I1DA 3MYUA 1H3DA 5I7IA 3EHUA 4MLQA 3KBZA 3SEVA 3NOHA 3IL1B 1FPLA 1BKAA 1BP5A 4Q30B 4KHZE 1ZKBA 3QAXA 1CE2A 3SESA 3N5LA 4NF8A 2GHAA 1MM7A 1Y4CA 3UIFA 1QUIA 4WXJA 3TFLA 1FJ6A 2VPOA 1XVYA 2VP1A 4NE4A 1IMBA 3LSWA 4G68B 1JP4A 4R9GA 2CZLA 3IOUA 1LBYA 2QS2A 3E78A 4P3LA 3MPLA 1IMEA 4GWYA 3VE1B 4IO6A 3JV9A 5EHMA 5I59A 1II5A 3VVEA 5I56A 3FXBA 3ZSFA 3DLNA 2RC7A 2RKMA 4F18A 4P8BA 3H7MA 1DPPA 1YTVA 1NH7A 1MPCA 3R6UA 3MP8A 3B8BA 3S2VA 4EQ9A 4M4GA 1KZ8A 2QL3A 4NQ8A 4F1VA 2ONKE 1MXVA 1NV3A 5TP9B 5KDTB 1MY2A 1CB6A 4GX6A 1NV6A 3G3FA 2Q8JA 3HFUA 4QFKA 5AA2B 5AA4A 1FBEA 2ZZVA 3B50A 1MQIA 4YZZA 5KCJA 3KSJA 2ONSA 4PDDA 4YB7A 3LC8A 4YB6A 1IEJA 2XXUA 3DELB 3VXCA 4OVTA 2O51A 3KJ7A 3V8XB 2RCAA 1O7TA 4PGPA 5H8QA 4AS5A 4KYSA 5JK4A 1R9QA 4LZ7A 2XXVA 2Y5KA 2DXRA 4JWOA 1IXGA 4WEPA 1NV7A 4NF6B 2F35A 3KEIA 4OVQA 1P99A 1DCUA 4DI3D 2F6PA 3LSXA 4X48A 2QSXA 3ILTB 4O3AA 3TPAA 1BLFA 1Q9DA 2ZYKA 4EXKA 2Y7KA 3ONMA 1OQGA 3PUXE 4GX4A 4ND9A 5K2YA 3G7WA 4XKNA 3FVOA 2ZMBA 3EHTA 1MQGA 3DP8A 2VT5A 4P9KA 4U22A 5J16A 1LCTA 2REJA 4Q0CA 5FHMA 2GFEA 3C4MA 3E3KA 4ZS9A 4OQOA 4F29A 1K9ZA 1MQJA 1T0KA 2XXYA 3FVKA 2KR0A 4NGUA 1LAFE 3HSTA 1OIBA 3I3VA 1FPIA 5EQ8A 2Q2AA 4AB5A 4ZE9A 4PAIA 3HCQA 3G3JA 2GHBA 2XD3A 4YU0A 1LBVA 2A5SA 4TLMB 1FQDA 1FCKA 1XVXA 4OMBA 3IB1A 1OVBA 4JB7A 1B4HA 4ZZEA 1P1NA 5FHNA 2CEYA 4XEQA 1MXWA 3EQ1A 1MDP1 4KPTA 4PTKA 4EF2A 4GWOA 3K00A 4MNPA 4HE2A 4E0XA 2I4CA 5A5XA 4IO4A 4RXLA 1NNPA 1MPBA 1B0HA 1IQ7A 2UVJA 3OOAA 2CEXA 1JW1A 3C32A 5I84A 2L5VA 2ZXTA 2PFZA 2BJJX 1YCJA 4DDDA 4PETA 4QF9A 4MCOA 5ET6A 2DWIA 3N6TA 4R2FA 3HV1A 3QXMA 1SW2A 2XXQA 1KWHA 3EF7A 4N6PA 5K2XA 5I3SA 3EPEA 4OFLA 3T9HB 2X26A 4IO5A 5HM4B 4U21A 1K9YA 3GXAA 5FHOA 3Q26A 4YKKA 2XD2A 1G0HA 4PFRA 1J1NA 2ONRA 1LBCA 3SEWA 4DXBA 3LSFB 4OANA 4NF4A 2QRYA 5I2KA 5ITPA 3C34A 3IORA 3TODA 1O64A 3VVDA 2DE4A 3PU5A 4QFOA 3R7XA 5T3JA 4O7MA 3N26A 5JTYB 3MZ1A 3MZ9A 2ZNSA 5CBRA 3VDFA 3TZAA 4I8CA 3IOWA 2OCUA 4XXUA 2FVZA 3S9MC 1TWYA 4H67A 2Z8EA 2BJIA 4TQUQ 5I56B 4MNIA 1B3FA 4PFUA 4AQ4A 3S4UA 4Z7EA 4FORA 5CM6A 3TMGA 2R71A 1ZMGA 3V5AA 3FUZA 3FBPA 5IKBA 3O66A 1EH3A 4GWXA 1UIVA 4G8HA 4YB5A 2O68A 5CC2A 1N76A 1B7HA 3T66A 4DCXA 3MVYA 2WYPA 4KR5A 1I6QA 4YICA 3MWBA 1FRPA 1FTOA 3IOVA 1SYIA 2HXWA 5KCJB 3KOSA 3QYTA 4YMBA 2H98A 5H8FA 2VHAA 4GQOA 1YPNA 1B58A 2Q9TA 3ODBA 3PV0E 4NTLA 4I3EA 3A29A 3FV2A 4BDLA 5LTCA 4H46A 3E9XA 2XWVA 3I5OA 3RGYA 5L8DA 3CVGA 3PD8A 4LZ5A 3BIHA 4LQ2A 1FQEA 2I58A 3A09A 3SZPA 4AB6A 2Y7RA 4HE0A 2V25A 1FTAA 2CZKA 4F31B 3TUSA 1IXIA 1URSA 3D4GA 1XOCA 2HEUA 3PTYA 4QRZA 3CSGA 2Q2CA 3IB2A 3KOTA 1B52A 2X7PA 4GX3A 1B2HA 4THIA 1Q1KA 1Y4TA 3KJTA 1IMCA 3HHFA 5IM2A 1JQFA 3FASA 1PB9A 4OENA 4P1LA 5AE4A 3C9HA 1B46A 3OEMA 4F1YA 1HSJA 2YLNA 5TPAB 1NFTA 2XXWA 2F7BA 4LONB 5A5LA 3OO7A 2QVVA 2FYIA 1TT1A 1R1NA 3MZBA 1D4NA 1FTJA 1FBFA 1DOTA 4PE5B 2XXTA 3USDA 4ESWA 1LLSA 3IR1A 2FIXA 3T1BA 3MBPA 2WBBA 3LBSA 4NWDA 3PUWE 3TYHA 2HHMA 4OERA 2H5YA 3OXNA 4JWYA 4X9TA 4YKIA 4PGNA 2O84X 1FBPA 5L9OA 4EXLA 1GGGA 4PFYA 1FW0A 1IUDA 4ESXA 3T93B 1M5DA 4ZDMA 1YYZA 4P11A 2ZNTA 1ZLQA 1O63A 5HPQA 1YXIA 1AOVA 4PAKA 1SW1A 5JEIA 3MPKA 1UTHA 1LAHE 4KCCA 5A5XB 1FQCA 2PVUA 2HZLA 5BUUA 1R9LA 4BDOA 4EQBA 1B51A 2PMSA 2R6GE 3CFXA 4F3GA 1Y3PA 2H4IA 4N8YA 4ZEFA 4X8RA 1VR5A 1LSTA 1PB7A 4I62A 4GXAA 5DVJA 5CRYA 2XWOA 4N81A 1PDAA 4U23A 2B3FA 1PC3A 3KN3A 2HFBA 1LFIA 3CSBA 3QMFA 5IZ3B 3PD9A 2VD3A 4G4PA 4NX1A 4R2BA 4IGRA 4N17A 1R6ZA 1MRPA 4PQJA 1AWBA 4GWWA 3FATA 4FE8A 3IX1A 4XKPA 1PBQA 3VXBA 5I2KB 4O7IA 1B4ZA 2DVCA 3RTWB 3GZGA 5I58A 2PX1A 2XXRA 2I6EA 3CR9A 3RNNA 1NUWA 3KN7A 2DOJA 4F39A 2B4LA 3RT8A 2ABHA 4OETA 4X1BA 2OBGA 2B4MA 2ZZXA 4JXIA 3M3LA 1GVCA 1FPJA 4YKJA 4G61A 4UA8A 4QSEA 1H44A 3UK4A 3ILUB 5CMBA 5HBCA 2I48A 4X1DA 3B6WA 1QUKA 1ZJLA 3UN6A 5H8HA 1B05A 4DIGA 1POY1 3GBBA 2G93A 4OFOA 3U93A 1LAXA 4PC9A 4U1ZA 3K4UA 2F97A 2VD2A 2XX9A 4UABA 4JSDA 4K3FA 1P1UA 1MY0A 3OMBA 4WKMA 3RN8A 3C35A 3Q28A 2R9JA 4OVPA 5FTIA 2F34A 1TFAA 2QVRA 4C0RA 3OD7A 2DSFA 2QMXA 3K6WA 1RYOA 2MKZA 1IMAA 4ISUA 5DVIA 3R26A 2G29A 3UA8A 3S9EA 4RNSA 5L9SA 5H8FB 1B3GA 2HZKA 1KA0A 3E79A 4LA9A 2QFLA 2B3BA 1CNQA 4O3CA 1B1XA 2HCAA 4NF0A 3KGCA 4QSDA 5DEXB 2XXPA 2WKYA 2REGA 3IFCA 5DW8A 1EZPA 1LBZA 1LGBC 3O28A 1Y3QA 4P0GA 3FGSA 2FIEA 4F2OA 1MY4A 4FATA 4RK9A 1IZ1A 4DI4B 5BWJA 1B5JA 4MJOA 4QFNA 3H6TA 5H8NA 2XWKA 2XXHA 1MXYA 3TQWA 1FPEA 3FJGA 3LUYA 2M8CA 3SEXA 4OEVA 3K6UA 1FSAA 1B1HA 3D4CA 4HS7A 4ONYA 4GRKA 1EYIA 4NAPA 1MPDA 2P1SA 3CG1A 1RYXA 2WEFA 2IEEA 2DVZA 3FVNA 1ZBMA 1LBBA 5IZ1A 3LV0A 2AIXA 5ISUA 1FQFA 4U4XA 1QVSA 4MMPA 2OX3A 1SQYA 5CMKA 1NL5A 3V83A 4PFIA 4O94A 3PPOA 4ZEIA 1FJ9A 1IXHA 1NV1A 1DMBA 4ZECA 2D5WA 3IB0A 4IY5A 5KZTA 2NOOA 4XTCQ 3EHSA 3BIGA 1FPFA 4IGTA 1FTLA 3FXQA 3U1OA 3N6UA 4KYEA 1Y1ZA 3GYYA 3OO9A 1LBXA 1DTGA 4R6KA 1NV2A 4C1TA 1D9QA 1SI1A 2RF1A 1QW0A 3C31A 4O3BA 4PBHA 4I40A 2OLBA 3ZS6A 1NNFA 3K1MA 3RPLB 3H03A 4GLIA 1Y1MA 3RQTA 4GD5A 3HO7A 5AA2D 1FTKA 3SDFA 1INPA 4NWCA 2AL5A 1EYJA 3K2DA 4GIZA 2CZIA 1Z7ME 2WYKA 1SW4A 4N6DA 3MUQA 4OVJA 3TTMA 1GTKA 3EN3A 2HXRA 3K01A 1NUZA 2UXAA 1MS7A 4NF8B 2F7AA 1LBWA 2V3UA 4H0WA 3WAEA 2HAVA 3OELA 4TLLB 2OK2A 3IO4A 4OYVA 3IK6B 3PPPA 5ET5A 4BDNA 1WODA 3BFTA 3M3FA 1NUYA 5I59B 5FTHA 2DWJA 3CHGA 1QKBA 4BDMA 1EZ9A 1BTJA 2XHDA 4R74A 4N8GA 2GH9A 5F24A 2GQ1A 2PCRA 4F22A 3Q27A 4Q8RA 1SDXA 4KD5A 5B70A 1A8EA 3IFAA 4MBPA 4P0IA 4QSCA 5KDTA 1JNFA 3RUMA 5CMCA 4F3BA 2I0BA 2H25A 1RDYA 2Y5LA 3B6QA 3RT6B 1LB9A 2P3VA 1B3HA 4JDFA 1PB8A 3GLBA 1M5BA 3MP1A 1MH4A 4FBPA 1H76A 1SD3A 4L17A 2NXOA 3L6HA 3T9VA 3CFZA 5AA4B 2ALUA 1N3XA 1ATGA 2V84A 1XC1A 2D3IA 3ECRA 4HTGA 3T96B 1MY3A 4RK2A 4IO2A 4F3PA 2I4BA 1B7UA 5H8QB 4JBZA 4ZEDA 4DZ1A 4QXDA 2KQZA 4YMAA 3K0VA 1FBDA 2Y7WA 1FTMA 3QIMA 2F78A 1IMFA 1Q35A 3RPWA 3TDJA 3CRBA 5EQAA 3PPQA 2RC8A 5M2VA 4H5GA 3DP4A 1H43A 2F3BA 4KXPA 1UTBA 5ICQA 4N6KA 3P7IA 2P0SA 4KI0E 4MEVA 3CFLA 4PCDA 1AL3A 3KN8A 4KCDA 4GL8A 1S7YA 1AH5A 3HHGA 1JW4A 1USYE 2VPNA 4PFTA 3G3HA 3H4ZA 2W7YA 3SEYA 3TTNA 4AS4A 1VFDA 4H8IA 1ANFA 4H6DA 1SBPA 4ELQA 1WDNA 3L6GA 4N13A 4OVRA 4ZZAA 2Z23A 5IZZA 2DQVA 4LP2B 2OPDA 3W9VA 5F1QA 4JVCA 3RYDA 2E1SA 2V3TA 4LN5A 1A99A 2XA5A 1LEVA 4BDRA 3QSLA 2OZZA 4OEUA 2WBDA 4XF5A 1XI6A 4FAJA 4MHFA 4O8MA 4PDHA 4XIGQ 5H8SA 4WEDA 4R6HA 1OLAA 4IO3A 3MQ9A 4I3YA 4RPNA 5DTBA 1H45A 2A5TA 1URGA 3H3GA 2UYEA 3TELA 4DXUA 4GFRA 1AIVA 4BDQA 4U4SA 1P1QA 4GXSB 2ZZWA 1JETA 5LOMA 2B65A 3FXUA 3SETA 2O7UA 3D1RA 3IAZA 3O6IA 4EQ7A 4KFQA 1QUJA 3K02A 3IO6A 4MLVA 5F7VA 5I2NA 4GBVA 4XKRA 1S9TA 3O29A 1N7WA 3H6VA 1OQHA 2R8TA 3S9NC 4NMYA 3B6TA 4FECA 5ET7A 4LUBA 2RC9A 1IMDA 1D3KA 4IR8A 2QS1A 3T22A 1NNTA 2DE3A 3QUFA 4NF5A 3BBRA 1NV5A 1A54A 2WX9A 3VV5A 1FQAA 3Q29A 2O7IA 3SKPA 1LAGE 5DT6A 3KG2A 2Y7IA 1SPIA 2QJEA 2Z8DA 3C36A 3DP6A 1NNKA 3RTFB 2FA7A 5EYGA 2PT1A 4M1VA 3AXFA 4NF4B 3WAFA 1B6HA 3ZKKA 3W9WA 1FQBA 1BIYA 1B7ZA 1B0LA 3OEKA 2DDKA 1MXXA 1EU8A 4OTEA 4PFBA 4PP0A 5JTYA 4G8NA 4MF3A 1HSEA 3T9XB 4ECFA 3VFJA 4P47A 4E0WA 3OSRA 4YKPA 3U94A 5AA3A 2F5XA 3A3CA 3A3UA 1MQDA 5ELVA 3KFMA 3N94A 4JSOA 1A55A 4ELRA 2OWZA 2V3QA 3H6UA 4H1XA 1P1OA 2PYYA 3FV1A 3U8QA 5I5PA 2V93A 2F36A 3G3KA 4PE3A 5EYHA 3PMXA 3O9PA 5L9MA 4H45A 1OVTA 3CI8A 4N15A 4DCYA 2YPNA 4MIJA 2I3VA 3G3IA 3CIJA 3JZJA 3U92A 3HN0A 2XXIA 2ZYMA 1I6AA 3FJ7A 1GR2A 1QULA 2OJTA 3QK6A 4MH5A 1M5FA 1KA1A 1MXUA 4R72A 4X04A 4G77A 4F3SA 3UORA 1RKMA 1HSLA 4H65A 2UVHA 3ZKLA 2Z8FA 4POWA 1IXCA 4R6YA 2RCBA 3B7DA 3RY3A 1L5TA 3OO6A 3TEPA 1US4A 2ZNUA 1NV4A 1B9JA 4NHBA 3GBAA 4GWUA 2Z22A 1I69A 3ROJA 4UACA 4P1EA 4HE1A 4G2ZA 2F3DA 4QHQA 3JYRA 4OXVA 4OVSA 4QFLA 4OHNA 3VVFA 4HW8A 1DK4A 5B7DA 3E13X 1UTBB 3K6VA 2OPEA 4R75A 4OWDA 3PPRA 1A7LA 1JVXA 1B3LA 1VFEA 1XS5A 2DWAA 4HXVA 3IJOB 4U1OA 3TTLA 2UVGA 4R73A 1RDXA 3PMVA 4G8MA 4N4UA 5TPAA 2HPGA 4ZEKA 2E0SA 3SERA 2F8DA 4U2RA 3VLWA 5EQ7A 3PMWA 1IITA 2OWSA 3FD3A 3FJMA 2DS9A 4Q5TA 3T9UA 4GL0A 1DSNA 1PBPA 1MY1A 3F11A 1NH8A 4P56A 3MSTA 2FBPA 5I57A 1NI9A 3I6VA 1MDQA 1JEUA 4N07A 4QBAA 2H9BA 1TFDA 1N3WA 5TU0A 2FNCA 4F1UA 5FBPA 2X7QA 4NG7A 4F19A 2O69A 3ISPA 1FBGA 3W15C 1SYHA 1USYH 2THIA 4JWXA 4H5FA 4GOTA 5J1DA 2DYXA 1NV0A 2A5TB 2QPQA 4EUOA 1EZOA 2ANJA 2DP8A 3FXRA 1FPGA 3MW0A 3RLFE 2PFYA 1MXZA 4RA1A 1Y20A 4POXA 1UTHB 2LAOA 1MM6A 1URDA 3TTKA 3T0JA 5I2NB 4FJPA 4MFIA 3KC1A 3Q25A 1QKAA 2O1MA 4RYAA 2NUVA 4NEDA 3FIRA 3C33A 3MC2A 1D9YA 3V89B 3IJXB 1S50A 1VDWA 4H8JA 4DXCA 1MQHA 4LQ5A 5IZ3A 1ELJA 1ZTYA 3EKIA 3MVZA 2O1LA 4NF5B 2XXXA 4DLDA 1Y3NA 5EHSA 3TCGA 4XKQA 2I3WA 2P3NA 4G68A 3E4RA 1N0TA 1OMPA 3KSXA 3TQLA 1POTA 5ESYA 2FHYA 2DE2A 2ZYOA 3PUYE 3UP9A 3FVGA 4OESA 1FPDA 5LDZA 5CI5A 5I58B 1AMFA 5ICTA 2UVIA 3THIA 1UQWA 4DE8A 4OZ9A 1B32A 2CMOA 3O2AA 4GBWA 4G68C 3VLUA 3VLVA 1LCFA 1QGXA 2QVUA 2PBWA 4N91A 3S9LC 3KBRA 5TP9A 2AL4A 5IAIA 4PF8A 4MAGA 4ZEBA 4FEBA 3KC0A 2DWHA 1DPEA 1VE4A 1IIWA 2QS3A 3G3GA 5AA2A 2DXYA 2F7CA 1SI0A 3PUZE 1M5CA 4I9DA 5H8HB 4GVOA 2IA4A 1NUXA 2YJPA 5ET8A 2XXKA 4IB2A 2NVUB 2RINA 1BK4A 3HPIA 4BLAA 3BKIB 1XHYA 3K1PA 2ZYNA 4LVQA 4YAHX 1ZU0A 1N04A 4F2QA 2Q8MA 3U72A 2HQ0A 1UIUA 2VGQA 3PPNA 4LZ8A 4XFEA 1WVJA 3M8UA 2XWIA 3CG3A 3O6GA 1QJMA 1DBZA 1LB8A 4IY6A 4NF6A 1LFHA 1RDZA 2D21A 3TCHA 1B40A 1YAEA 3KZGA 2JJKA 1JEVA 5IGAA 4HCWA 4ELOA 2Y84A 2I0CA 4PAFA 3LSLA 2NWJA 1SVXB 4LATA 3O97A 3MVWA 1F9BA 4ELPA 3OO8A 1LFGA
chains in the Genus database with same CATH topology
1NV5A 2WX9A 1G0HA 4PFRA 5EQ9A 4MX6A 1EYKA 3IFCA 5DW8A 2CZHA 1LBZA 1SPIA 4OANA 1FPKA 5EYGA 4JVDA 4M1VA 4GWSA 2FIEA 4NN3A 3W9WA 4DI4B 4MJOA 2DDKA 2DE4A 4PFBA 5T3JA 4O7MA 2XWKA 1FPEA 4P47A 1FSAA 2FVZA 1EYIA 2F5XA 4NAPA 3LUZA 2WEFA 2BJIA 2DVZA 4MNIA 5IZ1A 3LV0A 2V4CA 5CM6A 2OWZA 2V3QA 5I5PA 4MMPA 4PE3A 2OX3A 5EYHA 3FBPA 4GWXA 4H45A 4N15A 4PFIA 4O94A 4MIJA 4PF6A 1FJ9A 4OA4A 2Q74A 1NV1A 4MNCA 1FBCA 2WYPA 3U65A 4YICA 3BIGA 1FPFA 1FRPA 1KA1A 4X04A 3GYYA 4HCYA 1LBXA 2Q9TA 4GWZA 1NV2A 4I3EA 3A29A 4JVIA 4PBQA 1FPBA 1D9QA 5LTCA 1FBHA 4H46A 1NV4A 2XWVA 4NHBA 4GWUA 4PBHA 3ROJA 4I40A 3RPLA 1YZ0A 3RPLB 3BIHA 4P1EA 4HE1A 1G0IA 2F3DA 3MYUA 5I7IA 3SZPA 4OVSA 1INPA 3KBZA 3NOHA 1FPLA 4HE0A 1EYJA 1FTAA 1DK4A 2CZIA 2CZKA 2WYKA 4N6DA 3PTYA 4HXVA 4GX3A 2HXRA 1NUZA 1IMCA 5IM2A 1FJ6A 1LBWA 2VPOA 1RDXA 1IMBA 4P1LA 1JP4A 4N4UA 1LBYA 2HPGA 3E78A 4P3LA 5EQ7A 1IMEA 4GWYA 5ET5A 5A5LA 2QVVA 3FXBA 1NUYA 3CHGA 4F18A 4P8BA 4N8GA 3B8BA 5F24A 2GQ1A 2PCRA 4P56A 3MSTA 2FBPA 1FBFA 1NI9A 1KZ8A 4NQ8A 3IFAA 4QBAA 4F1VA 2FIXA 3T1BA 1NV3A 4F1UA 2WBBA 4GX6A 1NV6A 5FBPA 1RDYA 2HHMA 4NG7A 2Y5LA 4F19A 2P3VA 3ISPA 3HFUA 1FBGA 4X9TA 4PGNA 1FBPA 4FBPA 1FBEA 2ZZVA 3B50A 5J1DA 1NV0A 4YZZA 2QPQA 1YYZA 4PDDA 1FPGA 2PFYA 1YXIA 4PAKA 4OVTA 2HZLA 4PGPA 4AS5A 3T0JA 5JK4A 3KC1A 4QXDA 2KQZA 2Y5KA 1FBDA 1NV7A 4OVQA 4N8YA 1IMFA 4X8RA 1DCUA 4DI3D 1VDWA 5EQAA 2XWOA 2F3BA 4KXPA 4N81A 1Q9DA 4N6KA 5IZ3A 3EKIA 3QMFA 5IZ3B 4MEVA 4GX4A 4PCDA 4NX1A 4N17A 2P3NA 1AWBA 4GWWA 2VT5A 2VPNA 4P9KA 5J16A 4AS4A 5ESYA 4O7IA 2FHYA 2DE2A 4OVRA 1FPDA 5LDZA 5IZZA 1K9ZA 3W9VA 4JVCA 2KR0A 3RYDA 1NUWA 4LN5A 4NGUA 2XA5A 1LEVA 2B4LA 4GBWA 1FPIA 5EQ8A 2WBDA 4XF5A 1XI6A 1QGXA 2QVUA 2B4MA 2ZZXA 4N91A 4MHFA 4O8MA 4PAIA 1FPJA 4G61A 4PDHA 4PF8A 1LBVA 4MAGA 4I3YA 3KC0A 2CEYA 4XEQA 1NUXA 4PC9A 5ET8A 4PTKA 2XXKA 1BK4A 4UABA 4MNPA 4HE2A 2ZZWA 2Q8MA 3D1RA 4OVPA 4XFEA 2QVRA 2XWIA 2MKZA 1IMAA 1DBZA 2CEXA 4GBVA 1RDZA 2L5VA 2PFZA 2JJKA 2HZKA 2R8TA 1KA0A 5IGAA 4PETA 4MCOA 5ET6A 4HCWA 3E79A 5ET7A 2QFLA 1CNQA 4PAFA 1IMDA 5I3SA 4IR8A 2DE3A 1K9YA 4NF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFA A;  1NV5 A;  1G0H A;  2FIX A;  1FPD A;  5LDZ A;  5EQ9 A;  1NV3 A;  1EYK A;  2WBB A;  1K9Z A;  1LBX A;  1NV6 A;  3IFC A;  1RDY A;  4GX6 A;  2HHM A;  5DW8 A;  2CZH A;  2Y5L A;  5FBP A;  1LBZ A;  2P3V A;  4GWZ A;  1NV2 A;  1SPI A;  1FBG A;  3RYD A;  4I3E A;  3A29 A;  1NUW A;  1FPB A;  1D9Q A;  1FBH A;  1FPK A;  4H46 A;  1NV4 A;  1FBP A;  5EYG A;  1LEV A;  4FBP A;  4GWS A;  4GBW A;  2FIE A;  4GWU A;  1FPI A;  1FBE A;  5EQ8 A;  2WBD A;  1XI6 A;  3ROJ A;  1QGX A;  2QVU A;  1NV0 A;  4I40 A;  3RPL A;  1YYZ A;  1YZ0 A;  4MJO A;  2DDK A;  3RPL B;  1FPJ A;  4G61 A;  3BIH A;  1LBV A;  1FPG A;  4HE1 A;  1G0I A;  2F3D A;  5T3J A;  1YXI A;  3KC0 A;  4I3Y A;  1INP A;  1FPE A;  3KBZ A;  1FPL A;  4HE0 A;  1EYJ A;  1FTA A;  1DK4 A;  2CZI A;  2CZK A;  1FSA A;  4AS5 A;  3T0J A;  3KC1 A;  1NUX A;  2FVZ A;  5ET8 A;  4QXD A;  2Y5K A;  1EYI A;  4PTK A;  1FBD A;  1NV7 A;  4HXV A;  4GX3 A;  1NUZ A;  1BK4 A;  3LUZ A;  2WEF A;  2BJI A;  1IMF A;  1IMC A;  1DCU A;  1FJ6 A;  4HE2 A;  1LBW A;  1RDX A;  5IZ1 A;  1VDW A;  3LV0 A;  1IMB A;  2OWZ A;  5EQA A;  1JP4 A;  2Q8M A;  1LBY A;  3D1R A;  2OX3 A;  2QVR A;  5EYH A;  2F3B A;  3FBP A;  4KXP A;  4N81 A;  1Q9D A;  5EQ7 A;  1IME A;  4GWX A;  4GWY A;  1IMA A;  1DBZ A;  4H45 A;  5ET5 A;  5IZ3 A;  4GBV A;  1RDZ A;  3QMF A;  5IZ3 B;  5A5L A;  4GX4 A;  2QVV A;  1NUY A;  1FJ9 A;  2Q74 A;  2JJK A;  1NV1 A;  2P3N A;  1FBC A;  2R8T A;  1KA0 A;  5ET6 A;  1AWB A;  4GWW A;  2VT5 A;  5ET7 A;  2QFL A;  1CNQ A;  3B8B A;  3BIG A;  2GQ1 A;  1IMD A;  2PCR A;  5F24 A;  5J16 A;  5I3S A;  4IR8 A;  4AS4 A;  1FPF A;  2FBP A;  1FBF A;  1NI9 A;  1K9Y A;  1KZ8 A;  1FRP A;  5ESY A;  4O7I A;  2FHY A;  1KA1 A; 
#chains in the Genus database with same CATH topology
 5DEX A;  5EQ9 A;  1ZIU A;  3FZV A;  4MX6 A;  1EYK A;  1NKX A;  4ZE8 A;  1US5 A;  2CZH A;  2O6A A;  1FPK A;  4JVD A;  4Z0I A;  4GWS A;  4KQP A;  4NN3 A;  3TTR A;  1Z7N E;  2ESN A;  3MJN A;  1B5H A;  4RPO A;  1N7X A;  4TOZ A;  5AA1 A;  3SEU A;  4GF8 A;  4C1U A;  2F6G A;  1A40 A;  5DYH A;  1OLC A;  4FED A;  1VSO A;  1MH3 A;  5H8N B;  3LR1 A;  5ITO A;  3K1N A;  3MP6 A;  2Q89 A;  3TAJ A;  1XT8 A;  1P1W A;  3UGW A;  3BFU A;  1GV8 A;  3K6X A;  5CBS A;  3LUZ A;  1I6B A;  2AYS A;  2UYF A;  5EYF A;  3PUV E;  2V4C A;  4EDP A;  4R9F A;  3OSQ A;  1N84 A;  2PT2 A;  4EF1 A;  3MVX A;  4PFW A;  3M3K A;  5I57 B;  5CMM A;  1A8F A;  2Y7P A;  1B5I A;  1MG1 A;  2HAU A;  4PF6 A;  2P2A A;  4OA4 A;  2Q74 A;  3PGF A;  4MNC A;  1FBC A;  3QUJ A;  3O6H A;  1M5E A;  2XX8 A;  3U65 A;  1DTZ A;  1NMU A;  1Y9U A;  1PEB A;  1SW5 A;  3TCF A;  2QMW A;  2I49 A;  2QS4 A;  3H6W A;  2VOZ A;  2KLF A;  1JVY A;  3H06 B;  5DVF A;  4RY1 A;  4HCY A;  4FIM A;  2H99 A;  1D9V A;  2GRV A;  1TXF A;  4GWZ A;  4JVI A;  4PBQ A;  1FPB A;  2XX7 A;  1FBH A;  4KYD A;  2Q88 A;  4QFP A;  4OFJ A;  3RPL A;  1YZ0 A;  2OWT A;  3OEN A;  1B3E A;  1JW5 A;  3DM0 A;  3MAM A;  4RJZ A;  3IOT A;  1G0I A;  4IO7 A;  3TKD A;  4I1D A;  3MYU A;  1H3D A;  5I7I A;  3EHU A;  4MLQ A;  3KBZ A;  3SEV A;  3NOH A;  3IL1 B;  1FPL A;  1BKA A;  1BP5 A;  4Q30 B;  4KHZ E;  1ZKB A;  3QAX A;  1CE2 A;  3SES A;  3N5L A;  4NF8 A;  2GHA A;  1MM7 A;  1Y4C A;  3UIF A;  1QUI A;  4WXJ A;  3TFL A;  1FJ6 A;  2VPO A;  1XVY A;  2VP1 A;  4NE4 A;  1IMB A;  3LSW A;  4G68 B;  1JP4 A;  4R9G A;  2CZL A;  3IOU A;  1LBY A;  2QS2 A;  3E78 A;  4P3L A;  3MPL A;  1IME A;  4GWY A;  3VE1 B;  4IO6 A;  3JV9 A;  5EHM A;  5I59 A;  1II5 A;  3VVE A;  5I56 A;  3FXB A;  3ZSF A;  3DLN A;  2RC7 A;  2RKM A;  4F18 A;  4P8B A;  3H7M A;  1DPP A;  1YTV A;  1NH7 A;  1MPC A;  3R6U A;  3MP8 A;  3B8B A;  3S2V A;  4EQ9 A;  4M4G A;  1KZ8 A;  2QL3 A;  4NQ8 A;  4F1V A;  2ONK E;  1MXV A;  1NV3 A;  5TP9 B;  5KDT B;  1MY2 A;  1CB6 A;  4GX6 A;  1NV6 A;  3G3F A;  2Q8J A;  3HFU A;  4QFK A;  5AA2 B;  5AA4 A;  1FBE A;  2ZZV A;  3B50 A;  1MQI A;  4YZZ A;  5KCJ A;  3KSJ A;  2ONS A;  4PDD A;  4YB7 A;  3LC8 A;  4YB6 A;  1IEJ A;  2XXU A;  3DEL B;  3VXC A;  4OVT A;  2O51 A;  3KJ7 A;  3V8X B;  2RCA A;  1O7T A;  4PGP A;  5H8Q A;  4AS5 A;  4KYS A;  5JK4 A;  1R9Q A;  4LZ7 A;  2XXV A;  2Y5K A;  2DXR A;  4JWO A;  1IXG A;  4WEP A;  1NV7 A;  4NF6 B;  2F35 A;  3KEI A;  4OVQ A;  1P99 A;  1DCU A;  4DI3 D;  2F6P A;  3LSX A;  4X48 A;  2QSX A;  3ILT B;  4O3A A;  3TPA A;  1BLF A;  1Q9D A;  2ZYK A;  4EXK A;  2Y7K A;  3ONM A;  1OQG A;  3PUX E;  4GX4 A;  4ND9 A;  5K2Y A;  3G7W A;  4XKN A;  3FVO A;  2ZMB A;  3EHT A;  1MQG A;  3DP8 A;  2VT5 A;  4P9K A;  4U22 A;  5J16 A;  1LCT A;  2REJ A;  4Q0C A;  5FHM A;  2GFE A;  3C4M A;  3E3K A;  4ZS9 A;  4OQO A;  4F29 A;  1K9Z A;  1MQJ A;  1T0K A;  2XXY A;  3FVK A;  2KR0 A;  4NGU A;  1LAF E;  3HST A;  1OIB A;  3I3V A;  1FPI A;  5EQ8 A;  2Q2A A;  4AB5 A;  4ZE9 A;  4PAI A;  3HCQ A;  3G3J A;  2GHB A;  2XD3 A;  4YU0 A;  1LBV A;  2A5S A;  4TLM B;  1FQD A;  1FCK A;  1XVX A;  4OMB A;  3IB1 A;  1OVB A;  4JB7 A;  1B4H A;  4ZZE A;  1P1N A;  5FHN A;  2CEY A;  4XEQ A;  1MXW A;  3EQ1 A;  1MDP 1;  4KPT A;  4PTK A;  4EF2 A;  4GWO A;  3K00 A;  4MNP A;  4HE2 A;  4E0X A;  2I4C A;  5A5X A;  4IO4 A;  4RXL A;  1NNP A;  1MPB A;  1B0H A;  1IQ7 A;  2UVJ A;  3OOA A;  2CEX A;  1JW1 A;  3C32 A;  5I84 A;  2L5V A;  2ZXT A;  2PFZ A;  2BJJ X;  1YCJ A;  4DDD A;  4PET A;  4QF9 A;  4MCO A;  5ET6 A;  2DWI A;  3N6T A;  4R2F A;  3HV1 A;  3QXM A;  1SW2 A;  2XXQ A;  1KWH A;  3EF7 A;  4N6P A;  5K2X A;  5I3S A;  3EPE A;  4OFL A;  3T9H B;  2X26 A;  4IO5 A;  5HM4 B;  4U21 A;  1K9Y A;  3GXA A;  5FHO A;  3Q26 A;  4YKK A;  2XD2 A;  1G0H A;  4PFR A;  1J1N A;  2ONR A;  1LBC A;  3SEW A;  4DXB A;  3LSF B;  4OAN A;  4NF4 A;  2QRY A;  5I2K A;  5ITP A;  3C34 A;  3IOR A;  3TOD A;  1O64 A;  3VVD A;  2DE4 A;  3PU5 A;  4QFO A;  3R7X A;  5T3J A;  4O7M A;  3N26 A;  5JTY B;  3MZ1 A;  3MZ9 A;  2ZNS A;  5CBR A;  3VDF A;  3TZA A;  4I8C A;  3IOW A;  2OCU A;  4XXU A;  2FVZ A;  3S9M C;  1TWY A;  4H67 A;  2Z8E A;  2BJI A;  4TQU Q;  5I56 B;  4MNI A;  1B3F A;  4PFU A;  4AQ4 A;  3S4U A;  4Z7E A;  4FOR A;  5CM6 A;  3TMG A;  2R71 A;  1ZMG A;  3V5A A;  3FUZ A;  3FBP A;  5IKB A;  3O66 A;  1EH3 A;  4GWX A;  1UIV A;  4G8H A;  4YB5 A;  2O68 A;  5CC2 A;  1N76 A;  1B7H A;  3T66 A;  4DCX A;  3MVY A;  2WYP A;  4KR5 A;  1I6Q A;  4YIC A;  3MWB A;  1FRP A;  1FTO A;  3IOV A;  1SYI A;  2HXW A;  5KCJ B;  3KOS A;  3QYT A;  4YMB A;  2H98 A;  5H8F A;  2VHA A;  4GQO A;  1YPN A;  1B58 A;  2Q9T A;  3ODB A;  3PV0 E;  4NTL A;  4I3E A;  3A29 A;  3FV2 A;  4BDL A;  5LTC A;  4H46 A;  3E9X A;  2XWV A;  3I5O A;  3RGY A;  5L8D A;  3CVG A;  3PD8 A;  4LZ5 A;  3BIH A;  4LQ2 A;  1FQE A;  2I58 A;  3A09 A;  3SZP A;  4AB6 A;  2Y7R A;  4HE0 A;  2V25 A;  1FTA A;  2CZK A;  4F31 B;  3TUS A;  1IXI A;  1URS A;  3D4G A;  1XOC A;  2HEU A;  3PTY A;  4QRZ A;  3CSG A;  2Q2C A;  3IB2 A;  3KOT A;  1B52 A;  2X7P A;  4GX3 A;  1B2H A;  4THI A;  1Q1K A;  1Y4T A;  3KJT A;  1IMC A;  3HHF A;  5IM2 A;  1JQF A;  3FAS A;  1PB9 A;  4OEN A;  4P1L A;  5AE4 A;  3C9H A;  1B46 A;  3OEM A;  4F1Y A;  1HSJ A;  2YLN A;  5TPA B;  1NFT A;  2XXW A;  2F7B A;  4LON B;  5A5L A;  3OO7 A;  2QVV A;  2FYI A;  1TT1 A;  1R1N A;  3MZB A;  1D4N A;  1FTJ A;  1FBF A;  1DOT A;  4PE5 B;  2XXT A;  3USD A;  4ESW A;  1LLS A;  3IR1 A;  2FIX A;  3T1B A;  3MBP A;  2WBB A;  3LBS A;  4NWD A;  3PUW E;  3TYH A;  2HHM A;  4OER A;  2H5Y A;  3OXN A;  4JWY A;  4X9T A;  4YKI A;  4PGN A;  2O84 X;  1FBP A;  5L9O A;  4EXL A;  1GGG A;  4PFY A;  1FW0 A;  1IUD A;  4ESX A;  3T93 B;  1M5D A;  4ZDM A;  1YYZ A;  4P11 A;  2ZNT A;  1ZLQ A;  1O63 A;  5HPQ A;  1YXI A;  1AOV A;  4PAK A;  1SW1 A;  5JEI A;  3MPK A;  1UTH A;  1LAH E;  4KCC A;  5A5X B;  1FQC A;  2PVU A;  2HZL A;  5BUU A;  1R9L A;  4BDO A;  4EQB A;  1B51 A;  2PMS A;  2R6G E;  3CFX A;  4F3G A;  1Y3P A;  2H4I A;  4N8Y A;  4ZEF A;  4X8R A;  1VR5 A;  1LST A;  1PB7 A;  4I62 A;  4GXA A;  5DVJ A;  5CRY A;  2XWO A;  4N81 A;  1PDA A;  4U23 A;  2B3F A;  1PC3 A;  3KN3 A;  2HFB A;  1LFI A;  3CSB A;  3QMF A;  5IZ3 B;  3PD9 A;  2VD3 A;  4G4P A;  4NX1 A;  4R2B A;  4IGR A;  4N17 A;  1R6Z A;  1MRP A;  4PQJ A;  1AWB A;  4GWW A;  3FAT A;  4FE8 A;  3IX1 A;  4XKP A;  1PBQ A;  3VXB A;  5I2K B;  4O7I A;  1B4Z A;  2DVC A;  3RTW B;  3GZG A;  5I58 A;  2PX1 A;  2XXR A;  2I6E A;  3CR9 A;  3RNN A;  1NUW A;  3KN7 A;  2DOJ A;  4F39 A;  2B4L A;  3RT8 A;  2ABH A;  4OET A;  4X1B A;  2OBG A;  2B4M A;  2ZZX A;  4JXI A;  3M3L A;  1GVC A;  1FPJ A;  4YKJ A;  4G61 A;  4UA8 A;  4QSE A;  1H44 A;  3UK4 A;  3ILU B;  5CMB A;  5HBC A;  2I48 A;  4X1D A;  3B6W A;  1QUK A;  1ZJL A;  3UN6 A;  5H8H A;  1B05 A;  4DIG A;  1POY 1;  3GBB A;  2G93 A;  4OFO A;  3U93 A;  1LAX A;  4PC9 A;  4U1Z A;  3K4U A;  2F97 A;  2VD2 A;  2XX9 A;  4UAB A;  4JSD A;  4K3F A;  1P1U A;  1MY0 A;  3OMB A;  4WKM A;  3RN8 A;  3C35 A;  3Q28 A;  2R9J A;  4OVP A;  5FTI A;  2F34 A;  1TFA A;  2QVR A;  4C0R A;  3OD7 A;  2DSF A;  2QMX A;  3K6W A;  1RYO A;  2MKZ A;  1IMA A;  4ISU A;  5DVI A;  3R26 A;  2G29 A;  3UA8 A;  3S9E A;  4RNS A;  5L9S A;  5H8F B;  1B3G A;  2HZK A;  1KA0 A;  3E79 A;  4LA9 A;  2QFL A;  2B3B A;  1CNQ A;  4O3C A;  1B1X A;  2HCA A;  4NF0 A;  3KGC A;  4QSD A;  5DEX B;  2XXP A;  2WKY A;  2REG A;  3IFC A;  5DW8 A;  1EZP A;  1LBZ A;  1LGB C;  3O28 A;  1Y3Q A;  4P0G A;  3FGS A;  2FIE A;  4F2O A;  1MY4 A;  4FAT A;  4RK9 A;  1IZ1 A;  4DI4 B;  5BWJ A;  1B5J A;  4MJO A;  4QFN A;  3H6T A;  5H8N A;  2XWK A;  2XXH A;  1MXY A;  3TQW A;  1FPE A;  3FJG A;  3LUY A;  2M8C A;  3SEX A;  4OEV A;  3K6U A;  1FSA A;  1B1H A;  3D4C A;  4HS7 A;  4ONY A;  4GRK A;  1EYI A;  4NAP A;  1MPD A;  2P1S A;  3CG1 A;  1RYX A;  2WEF A;  2IEE A;  2DVZ A;  3FVN A;  1ZBM A;  1LBB A;  5IZ1 A;  3LV0 A;  2AIX A;  5ISU A;  1FQF A;  4U4X A;  1QVS A;  4MMP A;  2OX3 A;  1SQY A;  5CMK A;  1NL5 A;  3V83 A;  4PFI A;  4O94 A;  3PPO A;  4ZEI A;  1FJ9 A;  1IXH A;  1NV1 A;  1DMB A;  4ZEC A;  2D5W A;  3IB0 A;  4IY5 A;  5KZT A;  2NOO A;  4XTC Q;  3EHS A;  3BIG A;  1FPF A;  4IGT A;  1FTL A;  3FXQ A;  3U1O A;  3N6U A;  4KYE A;  1Y1Z A;  3GYY A;  3OO9 A;  1LBX A;  1DTG A;  4R6K A;  1NV2 A;  4C1T A;  1D9Q A;  1SI1 A;  2RF1 A;  1QW0 A;  3C31 A;  4O3B A;  4PBH A;  4I40 A;  2OLB A;  3ZS6 A;  1NNF A;  3K1M A;  3RPL B;  3H03 A;  4GLI A;  1Y1M A;  3RQT A;  4GD5 A;  3HO7 A;  5AA2 D;  1FTK A;  3SDF A;  1INP A;  4NWC A;  2AL5 A;  1EYJ A;  3K2D A;  4GIZ A;  2CZI A;  1Z7M E;  2WYK A;  1SW4 A;  4N6D A;  3MUQ A;  4OVJ A;  3TTM A;  1GTK A;  3EN3 A;  2HXR A;  3K01 A;  1NUZ A;  2UXA A;  1MS7 A;  4NF8 B;  2F7A A;  1LBW A;  2V3U A;  4H0W A;  3WAE A;  2HAV A;  3OEL A;  4TLL B;  2OK2 A;  3IO4 A;  4OYV A;  3IK6 B;  3PPP A;  5ET5 A;  4BDN A;  1WOD A;  3BFT A;  3M3F A;  1NUY A;  5I59 B;  5FTH A;  2DWJ A;  3CHG A;  1QKB A;  4BDM A;  1EZ9 A;  1BTJ A;  2XHD A;  4R74 A;  4N8G A;  2GH9 A;  5F24 A;  2GQ1 A;  2PCR A;  4F22 A;  3Q27 A;  4Q8R A;  1SDX A;  4KD5 A;  5B70 A;  1A8E A;  3IFA A;  4MBP A;  4P0I A;  4QSC A;  5KDT A;  1JNF A;  3RUM A;  5CMC A;  4F3B A;  2I0B A;  2H25 A;  1RDY A;  2Y5L A;  3B6Q A;  3RT6 B;  1LB9 A;  2P3V A;  1B3H A;  4JDF A;  1PB8 A;  3GLB A;  1M5B A;  3MP1 A;  1MH4 A;  4FBP A;  1H76 A;  1SD3 A;  4L17 A;  2NXO A;  3L6H A;  3T9V A;  3CFZ A;  5AA4 B;  2ALU A;  1N3X A;  1ATG A;  2V84 A;  1XC1 A;  2D3I A;  3ECR A;  4HTG A;  3T96 B;  1MY3 A;  4RK2 A;  4IO2 A;  4F3P A;  2I4B A;  1B7U A;  5H8Q B;  4JBZ A;  4ZED A;  4DZ1 A;  4QXD A;  2KQZ A;  4YMA A;  3K0V A;  1FBD A;  2Y7W A;  1FTM A;  3QIM A;  2F78 A;  1IMF A;  1Q35 A;  3RPW A;  3TDJ A;  3CRB A;  5EQA A;  3PPQ A;  2RC8 A;  5M2V A;  4H5G A;  3DP4 A;  1H43 A;  2F3B A;  4KXP A;  1UTB A;  5ICQ A;  4N6K A;  3P7I A;  2P0S A;  4KI0 E;  4MEV A;  3CFL A;  4PCD A;  1AL3 A;  3KN8 A;  4KCD A;  4GL8 A;  1S7Y A;  1AH5 A;  3HHG A;  1JW4 A;  1USY E;  2VPN A;  4PFT A;  3G3H A;  3H4Z A;  2W7Y A;  3SEY A;  3TTN A;  4AS4 A;  1VFD A;  4H8I A;  1ANF A;  4H6D A;  1SBP A;  4ELQ A;  1WDN A;  3L6G A;  4N13 A;  4OVR A;  4ZZA A;  2Z23 A;  5IZZ A;  2DQV A;  4LP2 B;  2OPD A;  3W9V A;  5F1Q A;  4JVC A;  3RYD A;  2E1S A;  2V3T A;  4LN5 A;  1A99 A;  2XA5 A;  1LEV A;  4BDR A;  3QSL A;  2OZZ A;  4OEU A;  2WBD A;  4XF5 A;  1XI6 A;  4FAJ A;  4MHF A;  4O8M A;  4PDH A;  4XIG Q;  5H8S A;  4WED A;  4R6H A;  1OLA A;  4IO3 A;  3MQ9 A;  4I3Y A;  4RPN A;  5DTB A;  1H45 A;  2A5T A;  1URG A;  3H3G A;  2UYE A;  3TEL A;  4DXU A;  4GFR A;  1AIV A;  4BDQ A;  4U4S A;  1P1Q A;  4GXS B;  2ZZW A;  1JET A;  5LOM A;  2B65 A;  3FXU A;  3SET A;  2O7U A;  3D1R A;  3IAZ A;  3O6I A;  4EQ7 A;  4KFQ A;  1QUJ A;  3K02 A;  3IO6 A;  4MLV A;  5F7V A;  5I2N A;  4GBV A;  4XKR A;  1S9T A;  3O29 A;  1N7W A;  3H6V A;  1OQH A;  2R8T A;  3S9N C;  4NMY A;  3B6T A;  4FEC A;  5ET7 A;  4LUB A;  2RC9 A;  1IMD A;  1D3K A;  4IR8 A;  2QS1 A;  3T22 A;  1NNT A;  2DE3 A;  3QUF A;  4NF5 A;  3BBR A;  1NV5 A;  1A54 A;  2WX9 A;  3VV5 A;  1FQA A;  3Q29 A;  2O7I A;  3SKP A;  1LAG E;  5DT6 A;  3KG2 A;  2Y7I A;  1SPI A;  2QJE A;  2Z8D A;  3C36 A;  3DP6 A;  1NNK A;  3RTF B;  2FA7 A;  5EYG A;  2PT1 A;  4M1V A;  3AXF A;  4NF4 B;  3WAF A;  1B6H A;  3ZKK A;  3W9W A;  1FQB A;  1BIY A;  1B7Z A;  1B0L A;  3OEK A;  2DDK A;  1MXX A;  1EU8 A;  4OTE A;  4PFB A;  4PP0 A;  5JTY A;  4G8N A;  4MF3 A;  1HSE A;  3T9X B;  4ECF A;  3VFJ A;  4P47 A;  4E0W A;  3OSR A;  4YKP A;  3U94 A;  5AA3 A;  2F5X A;  3A3C A;  3A3U A;  1MQD A;  5ELV A;  3KFM A;  3N94 A;  4JSO A;  1A55 A;  4ELR A;  2OWZ A;  2V3Q A;  3H6U A;  4H1X A;  1P1O A;  2PYY A;  3FV1 A;  3U8Q A;  5I5P A;  2V93 A;  2F36 A;  3G3K A;  4PE3 A;  5EYH A;  3PMX A;  3O9P A;  5L9M A;  4H45 A;  1OVT A;  3CI8 A;  4N15 A;  4DCY A;  2YPN A;  4MIJ A;  2I3V A;  3G3I A;  3CIJ A;  3JZJ A;  3U92 A;  3HN0 A;  2XXI A;  2ZYM A;  1I6A A;  3FJ7 A;  1GR2 A;  1QUL A;  2OJT A;  3QK6 A;  4MH5 A;  1M5F A;  1KA1 A;  1MXU A;  4R72 A;  4X04 A;  4G77 A;  4F3S A;  3UOR A;  1RKM A;  1HSL A;  4H65 A;  2UVH A;  3ZKL A;  2Z8F A;  4POW A;  1IXC A;  4R6Y A;  2RCB A;  3B7D A;  3RY3 A;  1L5T A;  3OO6 A;  3TEP A;  1US4 A;  2ZNU A;  1NV4 A;  1B9J A;  4NHB A;  3GBA A;  4GWU A;  2Z22 A;  1I69 A;  3ROJ A;  4UAC A;  4P1E A;  4HE1 A;  4G2Z A;  2F3D A;  4QHQ A;  3JYR A;  4OXV A;  4OVS A;  4QFL A;  4OHN A;  3VVF A;  4HW8 A;  1DK4 A;  5B7D A;  3E13 X;  1UTB B;  3K6V A;  2OPE A;  4R75 A;  4OWD A;  3PPR A;  1A7L A;  1JVX A;  1B3L A;  1VFE A;  1XS5 A;  2DWA A;  4HXV A;  3IJO B;  4U1O A;  3TTL A;  2UVG A;  4R73 A;  1RDX A;  3PMV A;  4G8M A;  4N4U A;  5TPA A;  2HPG A;  4ZEK A;  2E0S A;  3SER A;  2F8D A;  4U2R A;  3VLW A;  5EQ7 A;  3PMW A;  1IIT A;  2OWS A;  3FD3 A;  3FJM A;  2DS9 A;  4Q5T A;  3T9U A;  4GL0 A;  1DSN A;  1PBP A;  1MY1 A;  3F11 A;  1NH8 A;  4P56 A;  3MST A;  2FBP A;  5I57 A;  1NI9 A;  3I6V A;  1MDQ A;  1JEU A;  4N07 A;  4QBA A;  2H9B A;  1TFD A;  1N3W A;  5TU0 A;  2FNC A;  4F1U A;  5FBP A;  2X7Q A;  4NG7 A;  4F19 A;  2O69 A;  3ISP A;  1FBG A;  3W15 C;  1SYH A;  1USY H;  2THI A;  4JWX A;  4H5F A;  4GOT A;  5J1D A;  2DYX A;  1NV0 A;  2A5T B;  2QPQ A;  4EUO A;  1EZO A;  2ANJ A;  2DP8 A;  3FXR A;  1FPG A;  3MW0 A;  3RLF E;  2PFY A;  1MXZ A;  4RA1 A;  1Y20 A;  4POX A;  1UTH B;  2LAO A;  1MM6 A;  1URD A;  3TTK A;  3T0J A;  5I2N B;  4FJP A;  4MFI A;  3KC1 A;  3Q25 A;  1QKA A;  2O1M A;  4RYA A;  2NUV A;  4NED A;  3FIR A;  3C33 A;  3MC2 A;  1D9Y A;  3V89 B;  3IJX B;  1S50 A;  1VDW A;  4H8J A;  4DXC A;  1MQH A;  4LQ5 A;  5IZ3 A;  1ELJ A;  1ZTY A;  3EKI A;  3MVZ A;  2O1L A;  4NF5 B;  2XXX A;  4DLD A;  1Y3N A;  5EHS A;  3TCG A;  4XKQ A;  2I3W A;  2P3N A;  4G68 A;  3E4R A;  1N0T A;  1OMP A;  3KSX A;  3TQL A;  1POT A;  5ESY A;  2FHY A;  2DE2 A;  2ZYO A;  3PUY E;  3UP9 A;  3FVG A;  4OES A;  1FPD A;  5LDZ A;  5CI5 A;  5I58 B;  1AMF A;  5ICT A;  2UVI A;  3THI A;  1UQW A;  4DE8 A;  4OZ9 A;  1B32 A;  2CMO A;  3O2A A;  4GBW A;  4G68 C;  3VLU A;  3VLV A;  1LCF A;  1QGX A;  2QVU A;  2PBW A;  4N91 A;  3S9L C;  3KBR A;  5TP9 A;  2AL4 A;  5IAI A;  4PF8 A;  4MAG A;  4ZEB A;  4FEB A;  3KC0 A;  2DWH A;  1DPE A;  1VE4 A;  1IIW A;  2QS3 A;  3G3G A;  5AA2 A;  2DXY A;  2F7C A;  1SI0 A;  3PUZ E;  1M5C A;  4I9D A;  5H8H B;  4GVO A;  2IA4 A;  1NUX A;  2YJP A;  5ET8 A;  2XXK A;  4IB2 A;  2NVU B;  2RIN A;  1BK4 A;  3HPI A;  4BLA A;  3BKI B;  1XHY A;  3K1P A;  2ZYN A;  4LVQ A;  4YAH X;  1ZU0 A;  1N04 A;  4F2Q A;  2Q8M A;  3U72 A;  2HQ0 A;  1UIU A;  2VGQ A;  3PPN A;  4LZ8 A;  4XFE A;  1WVJ A;  3M8U A;  2XWI A;  3CG3 A;  3O6G A;  1QJM A;  1DBZ A;  1LB8 A;  4IY6 A;  4NF6 A;  1LFH A;  1RDZ A;  2D21 A;  3TCH A;  1B40 A;  1YAE A;  3KZG A;  2JJK A;  1JEV A;  5IGA A;  4HCW A;  4ELO A;  2Y84 A;  2I0C A;  4PAF A;  3LSL A;  2NWJ A;  1SVX B;  4LAT A;  3O97 A;  3MVW A;  1F9B A;  4ELP A;  3OO8 A;  1LFG A; 
#chains in the Genus database with same CATH homology
 1NV5 A;  2WX9 A;  1G0H A;  4PFR A;  5EQ9 A;  4MX6 A;  1EYK A;  3IFC A;  5DW8 A;  2CZH A;  1LBZ A;  1SPI A;  4OAN A;  1FPK A;  5EYG A;  4JVD A;  4M1V A;  4GWS A;  2FIE A;  4NN3 A;  3W9W A;  4DI4 B;  4MJO A;  2DDK A;  2DE4 A;  4PFB A;  5T3J A;  4O7M A;  2XWK A;  1FPE A;  4P47 A;  1FSA A;  2FVZ A;  1EYI A;  2F5X A;  4NAP A;  3LUZ A;  2WEF A;  2BJI A;  2DVZ A;  4MNI A;  5IZ1 A;  3LV0 A;  2V4C A;  5CM6 A;  2OWZ A;  2V3Q A;  5I5P A;  4MMP A;  4PE3 A;  2OX3 A;  5EYH A;  3FBP A;  4GWX A;  4H45 A;  4N15 A;  4PFI A;  4O94 A;  4MIJ A;  4PF6 A;  1FJ9 A;  4OA4 A;  2Q74 A;  1NV1 A;  4MNC A;  1FBC A;  2WYP A;  3U65 A;  4YIC A;  3BIG A;  1FPF A;  1FRP A;  1KA1 A;  4X04 A;  3GYY A;  4HCY A;  1LBX A;  2Q9T A;  4GWZ A;  1NV2 A;  4I3E A;  3A29 A;  4JVI A;  4PBQ A;  1FPB A;  1D9Q A;  5LTC A;  1FBH A;  4H46 A;  1NV4 A;  2XWV A;  4NHB A;  4GWU A;  4PBH A;  3ROJ A;  4I40 A;  3RPL A;  1YZ0 A;  3RPL B;  3BIH A;  4P1E A;  4HE1 A;  1G0I A;  2F3D A;  3MYU A;  5I7I A;  3SZP A;  4OVS A;  1INP A;  3KBZ A;  3NOH A;  1FPL A;  4HE0 A;  1EYJ A;  1FTA A;  1DK4 A;  2CZI A;  2CZK A;  2WYK A;  4N6D A;  3PTY A;  4HXV A;  4GX3 A;  2HXR A;  1NUZ A;  1IMC A;  5IM2 A;  1FJ6 A;  1LBW A;  2VPO A;  1RDX A;  1IMB A;  4P1L A;  1JP4 A;  4N4U A;  1LBY A;  2HPG A;  3E78 A;  4P3L A;  5EQ7 A;  1IME A;  4GWY A;  5ET5 A;  5A5L A;  2QVV A;  3FXB A;  1NUY A;  3CHG A;  4F18 A;  4P8B A;  4N8G A;  3B8B A;  5F24 A;  2GQ1 A;  2PCR A;  4P56 A;  3MST A;  2FBP A;  1FBF A;  1NI9 A;  1KZ8 A;  4NQ8 A;  3IFA A;  4QBA A;  4F1V A;  2FIX A;  3T1B A;  1NV3 A;  4F1U A;  2WBB A;  4GX6 A;  1NV6 A;  5FBP A;  1RDY A;  2HHM A;  4NG7 A;  2Y5L A;  4F19 A;  2P3V A;  3ISP A;  3HFU A;  1FBG A;  4X9T A;  4PGN A;  1FBP A;  4FBP A;  1FBE A;  2ZZV A;  3B50 A;  5J1D A;  1NV0 A;  4YZZ A;  2QPQ A;  1YYZ A;  4PDD A;  1FPG A;  2PFY A;  1YXI A;  4PAK A;  4OVT A;  2HZL A;  4PGP A;  4AS5 A;  3T0J A;  5JK4 A;  3KC1 A;  4QXD A;  2KQZ A;  2Y5K A;  1FBD A;  1NV7 A;  4OVQ A;  4N8Y A;  1IMF A;  4X8R A;  1DCU A;  4DI3 D;  1VDW A;  5EQA A;  2XWO A;  2F3B A;  4KXP A;  4N81 A;  1Q9D A;  4N6K A;  5IZ3 A;  3EKI A;  3QMF A;  5IZ3 B;  4MEV A;  4GX4 A;  4PCD A;  4NX1 A;  4N17 A;  2P3N A;  1AWB A;  4GWW A;  2VT5 A;  2VPN A;  4P9K A;  5J16 A;  4AS4 A;  5ESY A;  4O7I A;  2FHY A;  2DE2 A;  4OVR A;  1FPD A;  5LDZ A;  5IZZ A;  1K9Z A;  3W9V A;  4JVC A;  2KR0 A;  3RYD A;  1NUW A;  4LN5 A;  4NGU A;  2XA5 A;  1LEV A;  2B4L A;  4GBW A;  1FPI A;  5EQ8 A;  2WBD A;  4XF5 A;  1XI6 A;  1QGX A;  2QVU A;  2B4M A;  2ZZX A;  4N91 A;  4MHF A;  4O8M A;  4PAI A;  1FPJ A;  4G61 A;  4PDH A;  4PF8 A;  1LBV A;  4MAG A;  4I3Y A;  3KC0 A;  2CEY A;  4XEQ A;  1NUX A;  4PC9 A;  5ET8 A;  4PTK A;  2XXK A;  1BK4 A;  4UAB A;  4MNP A;  4HE2 A;  2ZZW A;  2Q8M A;  3D1R A;  4OVP A;  4XFE A;  2QVR A;  2XWI A;  2MKZ A;  1IMA A;  1DBZ A;  2CEX A;  4GBV A;  1RDZ A;  2L5V A;  2PFZ A;  2JJK A;  2HZK A;  2R8T A;  1KA0 A;  5IGA A;  4PET A;  4MCO A;  5ET6 A;  4HCW A;  3E79 A;  5ET7 A;  2QFL A;  1CNQ A;  4PAF A;  1IMD A;  5I3S A;  4IR8 A;  2DE3 A;  1K9Y A;  4NF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...