1G0IA

Crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
252
structure length
252
Chain Sequence
MKWDEIGKNIAKEIEKEILPYFGRKDKSYVVGTSPSGDETEIFDKISEDIALKYLKSLNVNIVSEELGVIDNSSEWTVVIDPIDGSFNFINGIPFFAFCFGVFKNNEPYYGLTYEFLTKSFYEAYKGKGAYLNGRKIKVKDFNPNNIVISYYPSKKIDLEKLRNKVKRVRIFGAFGLEMCYVAKGTLDAVFDVRPKVRAVDIASSYIICKEAGALITDENGDELKFDLNATDRLNIIVANSKEMLDIILDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of the MJ0109 gene product: a bifunctional enzyme with inositol monophosphatase and fructose 1,6-bisphosphatase activities.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 69
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2000-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1g0iA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1g0iA02
1BK4A 2WBBA 4GBWA 5I3SA 1IMAA 1FJ6A 1FRPA 3BIHA 5EYGA 1SPIA 1INPA 1IMDA 3RPLA 1DCUA 5EYHA 1FBFA 5IZ3B 1LBVA 4G61A 5ET8A 4IR8A 2P3VA 1FJ9A 2Y5KA 1NV6A 5EQ9A 2FIXA 4GWZA 1DBZA 4AS5A 1AWBA 1NV1A 1FPEA 2CZHA 4H46A 4N81A 1IMFA 1FBCA 2QVUA 5J16A 3RPLB 2PCRA 1YZ0A 5EQAA 4MJOA 1FSAA 1NV5A 2F3BA 4QXDA 5IZ3A 1FBPA 1LBXA 1FPKA 2BJIA 2OX3A 2WBDA 4HXVA 3RYDA 1FPDA 1G0IA 1NV2A 1IMEA 2QVRA 1G0HA 1NV0A 1FBEA 4GWYA 1RDXA 5T3JA 4GBVA 1KA0A 1EYIA 1EYKA 3LV0A 1YXIA 4GX6A 1FPBA 3ROJA 5IZ1A 1NUZA 2VT5A 1NV4A 4O7IA 2CZIA 1FPGA 1NV7A 1FBDA 4H45A 3KC0A 4GWWA 1K9YA 2Y5LA 1NI9A 1K9ZA 3FBPA 4HE0A 4HE1A 1KZ8A 4GWSA 5DW8A 3LUZA 3B8BA 1NUWA 2WEFA 3KC1A 3T0JA 3KBZA 1LEVA 2GQ1A 1D9QA 3BIGA 4FBPA 1FPLA 2R8TA 3D1RA 1JP4A 2F3DA 1FPIA 2P3NA 4PTKA 1NV3A 1CNQA 5A5LA 1RDYA 1NUYA 4GX4A 5ET5A 1LBYA 4HE2A 1FTAA 4I3EA 4KXPA 5EQ7A 4I40A 1QGXA 1Q9DA 2DDKA 2FBPA 1LBWA 1EYJA 2JJKA 1FBHA 2FIEA 1KA1A 2QVVA 4I3YA 1FBGA 1IMBA 4GWUA 4AS4A 2FHYA 1XI6A 3IFCA 3QMFA 1LBZA 4GWXA 5FBPA 1IMCA 1VDWA 3A29A 1NUXA 1FPFA 4GX3A 1YYZA 5ET7A 2HHMA 2QFLA 2CZKA 2Q8MA 1FPJA 5F24A 1DK4A 2FVZA 5ESYA 3IFAA 5ET6A 5EQ8A 2Q74A 2OWZA 1RDZA 5LDZA
chains in the Genus database with same CATH superfamily
2WBBA 1BKAA 3KSJA 2DWIA 2GHBA 1FBFA 4NF5A 5I2KB 2UVJA 1MQHA 5H8NB 3VLVA 4LVQA 4DLDA 2H25A 1SW4A 2PYYA 5AA2D 3BFTA 4MNPA 2I3VA 2DS9A 2PCRA 1PBPA 1HSLA 4XXUA 4NF5B 5I2KA 2ONKE 1S9TA 1B5IA 4OTEA 2O69A 5ITOA 2DWJA 2XWVA 1FPBA 1B46A 1NV4A 3S9NC 4ZZAA 3S9LC 1SYIA 3O97A 4X8RA 1AH5A 1K9YA 4ZECA 4ISUA 1NI9A 3SEYA 3HN0A 1NL5A 1R1NA 2H99A 3CVGA 3B8BA 4OVJA 2MKZA 3KC1A 3T0JA 1N3WA 3KZGA 5BWJA 4ND9A 3FXUA 4ZDMA 3PPPA 4LZ7A 4F39A 4HE2A 5B70A 1LB9A 5AA2A 3CFLA 1EYJA 1FBHA 1IZ1A 4F1VA 4DZ1A 3MZBA 1I6AA 2D21A 4LUBA 3RGYA 1II5A 2XXTA 1FPFA 3G3HA 3TDJA 1ANFA 3PUWE 1NNTA 1NKXA 4L17A 1INPA 4YB5A 1XS5A 3FATA 4NF4A 5IZ3B 2RKMA 4OVRA 1QW0A 1ZU0A 4PP0A 3IX1A 1CE2A 1N84A 2QJEA 4NG7A 4PE3A 5DVFA 1H3DA 1SVXB 4OWDA 1P1OA 1LB8A 3RY3A 1Q1KA 1LBXA 4F18A 1AMFA 3OMBA 2F7CA 4KYEA 4MMPA 5J1DA 3TTMA 4KQPA 1PB9A 1QUKA 4GBVA 1BP5A 3E79A 1GVCA 3OOAA 3PD8A 4MCOA 3FVKA 3IL1B 4MX6A 3CRBA 3GYYA 3O66A 4LATA 5H8SA 2HFBA 4GWWA 3R7XA 1K9ZA 1PB7A 3BKIB 2FA7A 2ZYOA 2BJJX 2ZZVA 3SEUA 1NFTA 2NXOA 4FATA 3TFLA 1B58A 4KXPA 5F1QA 1UTBB 3MVXA 4OFOA 2THIA 1XI6A 5M2VA 3E3KA 4PBQA 1Y9UA 3VVFA 4BDLA 4LZ8A 2F78A 3TAJA 3IB0A 2Q74A 2OWZA 1ZMGA 4F2QA 3JYRA 4GBWA 1OMPA 2XXRA 3O6IA 1DCUA 3G3IA 4OFJA 4M4GA 3SDFA 3G7WA 1B3EA 3MWBA 5H8QA 1MXVA 3HHGA 4O3BA 4NF8B 4YKKA 4GQOA 5J16A 1Y3QA 4QXDA 1JW4A 2B3BA 3RYDA 4F19A 1TWYA 1G0IA 2O1LA 1B52A 1DPEA 1LSTA 1G0HA 1NNFA 1I6BA 3FUZA 4F3GA 3VVEA 1Y4CA 3PUZE 5JTYA 2WYPA 3IK6B 4EQ7A 1QKBA 3PUYE 2Z8FA 3KBZA 2V3UA 1BIYA 2DE3A 1FPIA 2CMOA 4DI3D 1LAHE 4UA8A 4IO7A 4JDFA 2WYKA 3OELA 4JSOA 4QRZA 1GR2A 1WODA 4EXKA 4OETA 4IY5A 3UORA 1LBZA 4LP2B 1Y1MA 3OO8A 3HV1A 4H1XA 2WKYA 5IZZA 4KI0E 2PX1A 4NTLA 1NH8A 4QFPA 4RK2A 5LDZA 4LA9A 2ZYMA 3CG3A 4E0WA 1OLCA 1BK4A 3L6GA 1IMDA 4G8HA 3LUYA 1NNPA 4QFNA 3TELA 1PC3A 2XHDA 3FD3A 3N94A 4NHBA 5ICTA 3C35A 4C0RA 2X26A 4OANA 2A5TB 4POXA 4PDDA 4JVIA 3IAZA 3SEXA 3DLNA 3CR9A 1Y1ZA 2NVUB 2X7QA 2VT5A 2QS3A 2Z8DA 3IJOB 4BDQA 4P3LA 1M5FA 3K2DA 3LUZA 4RXLA 1NUWA 3MP6A 2XXHA 4EDPA 4N91A 3D1RA 4I62A 2RCAA 2X7PA 1RDYA 3IORA 5CMKA 1QUIA 3HCQA 4NX1A 2I0CA 2R6GE 1RYOA 4I1DA 1FW0A 4ZE9A 5F7VA 2JJKA 4FE8A 4U4XA 4JVCA 4YU0A 1H45A 3MPLA 2KQZA 5KZTA 3QYTA 2OWSA 4EF1A 4YMAA 4NF4B 2R9JA 2DQVA 4Z7EA 2UYEA 5ELVA 2VD3A 1DK4A 3WAEA 5CRYA 1R9QA 2HZKA 1DSNA 1L5TA 1GGGA 2ESNA 3MP1A 1FRPA 2R71A 1SI0A 3IR1A 1B4HA 4IO4A 4FAJA 3TQWA 1N7XA 5DEXA 4IR8A 3MVYA 2KR0A 5EQ9A 3EHUA 2DYXA 5IKBA 5EHSA 3ZSFA 3HSTA 1AWBA 1IEJA 3Q27A 3G3FA 1UQWA 1B7UA 3SZPA 4PFBA 1MQIA 4O8MA 4ESWA 4FEBA 1P1NA 1YZ0A 5EQAA 3TUSA 1NV5A 2F3BA 3QUFA 5AE4A 1B7ZA 4FORA 5I5PA 4G68A 1R9LA 3Q29A 4PDHA 2I49A 2VD2A 1IMEA 3C32A 3I5OA 1JNFA 2DOJA 2HXRA 1LCTA 2YJPA 3DP8A 3VLUA 3HPIA 4IO6A 1UIUA 3O2AA 4THIA 4U21A 3SKPA 1PEBA 1FBDA 4JB7A 5JEIA 3QIMA 2ZNUA 1MM7A 2NUVA 5DW8A 1LFIA 1MY3A 4ELRA 5I56B 1EZPA 3Q26A 1US4A 1NV3A 3VLWA 4GD5A 1D9VA 1TFAA 1XHYA 4UABA 3W9WA 1LBBA 1FTKA 5FHOA 3K1MA 1JETA 2D3IA 1MQDA 3MUQA 1LBCA 3QMFA 4QSDA 4OQOA 3A3CA 3MVZA 2YPNA 4NN3A 2QFLA 4RY1A 5AA4A 5IAIA 3KFMA 5DVIA 4QFKA 3T9XB 3O6HA 2Z22A 3R26A 1ZTYA 4PBHA 1UIVA 3PUVE 1B0HA 3KN7A 5IM2A 4OA4A 1IMAA 1PB8A 1FJ6A 2I3WA 3V83A 3T93B 5AA4B 3O29A 4PAIA 1IXCA 4O94A 4GWZA 4XFEA 4M1VA 5CM6A 3LSFB 4U1OA 4ELQA 3I3VA 2PT1A 3C33A 1DTZA 3TQLA 1FPDA 3TPAA 1N04A 3KG2A 4U4SA 4PAKA 4R9GA 5I56A 1LFHA 3MC2A 2GRVA 2QRYA 3WAFA 3GBBA 3EF7A 4H45A 3TYHA 1MPCA 5HBCA 3BIGA 3S9MC 2Q89A 4DIGA 4NF8A 3RQTA 2H98A 2REJA 1FTMA 4R2BA 4N8YA 3OENA 3FV2A 4UACA 2Y7IA 3N26A 4R6KA 4PETA 3BFUA 4JVDA 3E9XA 4JBZA 4MHFA 4GFRA 4OESA 5L9OA 4ZE8A 1B4ZA 4KCCA 3B6QA 2HZLA 1B05A 1HSJA 2CZKA 5DYHA 2Q8MA 5DVJA 2FVZA 3H4ZA 5I2NA 3FVOA 2HAUA 3ISPA 4LZ5A 3IJXB 3PPRA 4DDDA 1EH3A 2Y7KA 2Z8EA 5EYGA 3IO6A 5H8FA 5KDTA 4PFUA 2UVGA 4DI4B 1TT1A 2P2AA 1IXIA 4RNSA 5TPAA 4N15A 3N6TA 4OHNA 1MXYA 4MJOA 2ANJA 2NOOA 5H8HA 3ILTB 2XXVA 1LLSA 4G8MA 3ILUB 5TPAB 3FJGA 4BDMA 1B1HA 2XXYA 1RDXA 5T3JA 4IGRA 1BLFA 4I9DA 4OYVA 2D5WA 1FPGA 1QULA 2I48A 2AIXA 2XXKA 1S50A 1WDNA 3TKDA 2XXQA 3S2VA 3U1OA 3V8XB 1TXFA 4OMBA 3RTWB 3HHFA 4G68B 1NUYA 1LAFE 2Q2AA 2W7YA 4PFRA 3H06B 3TTRA 1H44A 4PC9A 1OVBA 2OLBA 1MH4A 1IMCA 4GXAA 1KWHA 3DP6A 4DXBA 5HPQA 3TCHA 4QF9A 5EQ8A 4H5GA 4BDRA 1ZBMA 3KBRA 4XKNA 3FIRA 3QAXA 4NF0A 4R74A 3MZ9A 3FXBA 1LBVA 2XD2A 3T1BA 4P47A 2H9BA 1NV6A 4QHQA 2DE2A 3CSGA 3B6TA 2XXWA 2PFYA 5HM4B 1B1XA 2H5YA 1NV1A 1ATGA 3IOUA 3VDFA 4P8BA 4N81A 3SEVA 5L8DA 3RPLB 1URSA 5LOMA 2ZNTA 1USYH 1MDP1 2HCAA 4DXCA 4O3AA 1LCFA 2ZNSA 4POWA 1NV2A 2I4CA 3FVNA 3MJNA 3H6VA 1DPPA 1SW1A 3IB2A 4RK9A 4HTGA 3EHSA 1ELJA 4R72A 4P0GA 1NV7A 5A5XB 3P7IA 1M5EA 1B2HA 4MBPA 1LEVA 2GQ1A 1IXGA 1JP4A 5BUUA 4EXLA 4IO5A 1CNQA 1M5DA 1EZ9A 3CHGA 4HS7A 4IY6A 3GLBA 2QSXA 1MY0A 2OPDA 2O7IA 1FCKA 1B3LA 3BBRA 1B0LA 2OPEA 3TCGA 2F6PA 4P1EA 2UVIA 3QSLA 2I6EA 3UGWA 1VDWA 2F7AA 4DCYA 2XXIA 5A5XA 4KYSA 3TZAA 1JEVA 4PGPA 5I58A 3CI8A 3MPKA 4N4UA 2XA5A 2DP8A 2QPQA 1N76A 4NMYA 4YB7A 3K4UA 5AA2B 1FPEA 4H46A 4N8GA 4PF8A 2H4IA 3ZKLA 1LFGA 4F3PA 3KJTA 2UYFA 2BJIA 1XC1A 4NAPA 4KR5A 5FHMA 1RYXA 1UTHB 4H65A 4TLLB 1FBEA 1B3GA 1FQCA 1D3KA 5JK4A 4GX6A 4N6PA 3KOTA 4QFOA 1D9YA 4U22A 4MH5A 2OCUA 3EN3A 3CFXA 2V3QA 2XX8A 2RCBA 1SQYA 2AYSA 3DM0A 1SW2A 4OXVA 1JVXA 4PF6A 4OERA 3VVDA 4C1TA 2F35A 4PE5B 3MSTA 1OQGA 1Q35A 2QMWA 4YICA 2LAOA 1XVYA 3E78A 5K2XA 4X9TA 3LR1A 3PU5A 4AS4A 3KN3A 3IFCA 4GWXA 1H43A 2XD3A 3OEKA 3HFUA 5ISUA 3W15C 1MM6A 2V3TA 1VE4A 3M3FA 5B7DA 2Q2CA 1IIWA 1OVTA 3TEPA 3RTFB 4FEDA 1FQFA 1OLAA 4BDNA 4MLQA 3UN6A 2RC9A 5ET8A 1FJ9A 2XX9A 1XOCA 3TCFA 3FXQA 3K0VA 3I6VA 5EHMA 3TTLA 2B4LA 2I0BA 1IMFA 2QVUA 1URDA 1URGA 2L5VA 2Q8JA 4FJPA 3FJ7A 1O63A 1POTA 3CG1A 2AL4A 5K2YA 3SETA 1B32A 4U23A 1KA0A 4OVTA 1EYIA 3N5LA 3RUMA 2QS1A 4ECFA 5I7IA 2F7BA 3H7MA 4H8IA 2B4MA 4X04A 3RT8A 3U8QA 1O64A 3IO4A 3CIJA 1CB6A 4G68C 1B7HA 4NGUA 1LBYA 1MQJA 4FECA 3PTYA 4R73A 2VOZA 4YKPA 2I58A 4NWCA 4P1LA 4X48A 1F9BA 1MXUA 4PGNA 4KPTA 3ECRA 3C36A 1Y4TA 3C31A 1A8FA 3MYUA 1A99A 1NUXA 4YMBA 3QK6A 1SDXA 2NWJA 4Q5TA 4RYAA 3KEIA 1B40A 4WKMA 4DXUA 1YCJA 4ESXA 1QJMA 2ZZXA 4AQ4A 1J1NA 2PVUA 5I59A 3PPOA 4H6DA 1LAGE 4IO2A 3RPWA 1SPIA 4AB6A 4YAHX 4PFIA 5H8HB 4ZS9A 1P1QA 3S9EA 3USDA 1DBZA 4YZZA 1A40A 1IQ7A 5IZ3A 1FBPA 3FASA 5LTCA 1Z7NE 3B50A 5DT6A 1B3FA 3MW0A 1N3XA 3LSXA 4H67A 3FJMA 1POY1 4GRKA 3LSWA 5FTIA 2XWIA 1AL3A 3T9HB 2Y7WA 1EYKA 1YXIA 3IOVA 4QBAA 4QSEA 3PV0E 3AXFA 4ZEBA 2CZIA 2ZMBA 4ELOA 4N6KA 3FBPA 1FQEA 1KZ8A 4ZEKA 1P1UA 4G77A 4HCYA 4O3CA 3LBSA 3E13X 4GL8A 1D9QA 1VFDA 1FPLA 1FQDA 3MZ1A 2IA4A 1SW5A 4MNCA 4NEDA 3K01A 2HPGA 1OIBA 1A55A 2YLNA 5CMCA 4I3EA 2V93A 1UTHA 1S7YA 2XXXA 3PUXE 3S4UA 4G4PA 4I3YA 1T0KA 2QVVA 2RC7A 1IMBA 3K6WA 2RINA 3T66A 2B3FA 4G8NA 1LAXA 2ONRA 3MQ9A 3H6WA 3C9HA 2F97A 3IFAA 4RPNA 1IXHA 4NQ8A 2I4BA 4EQ9A 4PFYA 4QFLA 5I3SA 4JWOA 3VXBA 3TMGA 1US5A 3BIHA 4N07A 3PGFA 3RPLA 1EZOA 1A8EA 2DWAA 2F34A 4F31B 4Z0IA 3U93A 3CSBA 3KN8A 3RN8A 3MAMA 3MVWA 3V89B 3T96B 4OVSA 3H3GA 2DSFA 4OVQA 3IOTA 1BTJA 4F2OA 4WEDA 3GBAA 2P0SA 2XWOA 4P11A 4KFQA 4GWYA 3LV0A 4GL0A 4DE8A 4F3SA 4F22A 2CEXA 4DCXA 5I57A 1VR5A 3Q28A 3KC0A 4XKQA 3UK4A 2V84A 3K6VA 2PMSA 2OBGA 4X1DA 1PDAA 4RPOA 4BLAA 4EQBA 2UVHA 1B51A 3FGSA 1VFEA 4H5FA 4XEQA 4PFTA 4YKJA 4GLIA 1I6QA 5ICQA 3C4MA 3M3LA 3KSXA 5EQ7A 3H6TA 4I40A 3L6HA 4OFLA 4YKIA 5CBSA 1A7LA 1MY1A 4LONB 2VHAA 4P9KA 2FBPA 2E1SA 4NWDA 2FHYA 2ONSA 2UXAA 3T9VA 4PCDA 4GX3A 3CFZA 1FPJA 4HW8A 4OENA 2A5SA 4PFWA 1EU8A 2F5XA 1TFDA 3VXCA 2GFEA 3T22A 3N6UA 2O6AA 2Q88A 1B6HA 1FTOA 2VGQA 4RJZA 3U94A 1B3HA 4R6HA 4G61A 5CMBA 3MP8A 4BDOA 4R2FA 4I8CA 1JW1A 2CZHA 4MEVA 3RT6B 1FBCA 2Y7RA 1MXZA 4MFIA 1FPKA 3OEMA 2OWTA 2AL5A 5TP9A 5CMMA 1MG1A 3MBPA 1JQFA 3LC8A 3K1PA 4JSDA 5I58B 3H6UA 3OXNA 3OO7A 3QUJA 3G3GA 4PAFA 3VE1B 4KYDA 5IZ1A 4N17A 2RC8A 2ZZWA 4GOTA 2O51A 4OEVA 2Y5LA 1MS7A 4IGTA 2DVCA 4GXSB 4O7MA 5L9SA 4GWOA 1O7TA 2WX9A 1ZIUA 2WEFA 3EPEA 4XF5A 4FBPA 4OEUA 3SESA 4LQ5A 4PQJA 4PTKA 2F8DA 3OSRA 2PFZA 2V25A 3PPQA 2DDKA 1LBWA 2B65A 3T9UA 3PMVA 1FBGA 4GIZA 2GH9A 2Q9TA 3NOHA 3OO9A 2KLFA 5H8FB 2HHMA 5F24A 2VPOA 2O1MA 2VP1A 1XVXA 1RKMA 4LQ2A 1GV8A 1AOVA 4K3FA 2Z23A 2QMXA 5TP9B 4MNIA 5EYHA 4EUOA 2O68A 1FQAA 2XX7A 1Y3NA 3IB1A 1Z7ME 3QXMA 2OJTA 3OD7A 4ZZEA 2OX3A 4HXVA 4OZ9A 4IB2A 1HSEA 2RF1A 4TQUQ 5KCJB 1M5BA 4MAGA 5I59B 3ROJA 3A3UA 3VV5A 1NUZA 1R6ZA 1JEUA 5AA3A 1MQGA 4ONYA 2O7UA 3OSQA 4P0IA 3K6XA 3M3KA 5IGAA 4HE1A 3GZGA 1YPNA 2Y84A 2ZYNA 1SBPA 3G3KA 1JW5A 1MDQA 3TTNA 3O6GA 2P3NA 2F36A 3TTKA 1QVSA 4EF2A 1Q9DA 5DEXB 5KCJA 1MY2A 3FZVA 2FIEA 5I84A 1AIVA 3O28A 3PMWA 4GWUA 4GF8A 1N7WA 1B5HA 2DXYA 4N6DA 1SYHA 1YYZA 2ZXTA 1D4NA 5ET7A 4C1UA 2VPNA 1MXWA 5ESYA 2ABHA 5TU0A 5ET6A 3DELB 3UIFA 1ZJLA 1SI1A 1DMBA 3SERA 2CZLA 3VFJA 1NMUA 4AB5A 2HXWA 3OO6A 1I69A 1M5CA 1QKAA 3THIA 4GVOA 4LN5A 4E0XA 4P56A 1B5JA 4WXJA 4HCWA 3D4CA 3LSLA 3O9PA 3B7DA 3FV1A 2OK2A 2DE4A 2G29A 3M8UA 1NNKA 2XXUA 3SEWA 2HEUA 3UP9A 3IOWA 5AA1A 2PT2A 3HO7A 3RNNA 1ZLQA 4WEPA 1FSAA 1UTBA 3U72A 1QUJA 3EKIA 1IITA 4ZEDA 1USYE 1MPDA 5H8NA 2HQ0A 2QVRA 1NV0A 4MF3A 3Q25A 4Q8RA 1B9JA 1FTLA 4O7IA 3UA8A 1P1WA 2PBWA 3TODA 4F1UA 4F29A 3V5AA 4GWSA 4RA1A 2CEYA 4ZEFA 2F6GA 3JZJA 4H8JA 3PMXA 2O84X 2ZYKA 2R8TA 1JVYA 2F3DA 4Q30B 3F11A 5A5LA 1N0TA 2E0SA 5ET5A 1IUDA 4JXIA 1FTAA 1Y20A 1FTJA 1QGXA 3C34A 3R6UA 4G2ZA 2OZZA 4MLVA 4U1ZA 4XTCQ 3KOSA 3EHTA 3RLFE 2M8CA 5FBPA 3H03A 4Q0CA 5I57B 3B6WA 1YAEA 3KJ7A 4YB6A 3FXRA 1MXXA 3GXAA 4JWYA 4JWXA 4R6YA 3U65A 2XXPA 3G3JA 1FQBA 4NE4A 1GTKA 5JTYB 1NH7A 2G93A 4IO3A 1PBQA 4KHZE 1XT8A 2DWHA 2IEEA 2Y7PA 2ALUA 1OQHA 5FTHA 2P3VA 2Y5KA 3EQ1A 2FIXA 4XKPA 3ZS6A 4MIJA 3KGCA 4AS5A 5DTBA 3ODBA 1DTGA 4U2RA 4KCDA 2FNCA 5CI5A 3W9VA 3D4GA 1MRPA 1YTVA 1DOTA 2WBDA 2QS4A 2XWKA 1LGBC 3K00A 3K02A 4NF6B 4FIMA 1H76A 2HAVA 5L9MA 4R75A 4R9FA 3A09A 4XKRA 1MY4A 1Y3PA 2QS2A 3U92A 5KDTB 2V4CA 3PD9A 4XIGQ 4HE0A 1MH3A 3K6UA 4NF6A 4X1BA 2FYIA 5ITPA 2DVZA 1ZKBA 4H0WA 3ZKKA 3PPNA 5CBRA 1SD3A 4KD5A 4GX4A 3E4RA 4TLMB 4OVPA 1A54A 4TOZA 4F3BA 1VSOA 1WVJA 4ELPA 1P99A 1KA1A 5FHNA 2DXRA 4N13A 2A5TA 2QL3A 4ZEIA 4F1YA 3DP4A 5H8QB 3JV9A 4QSCA 3A29A 3K1NA 3ONMA 2P1SA 3FVGA 5I2NB 2GHAA 5EYFA 2REGA 5CC2A 1MPBA 1RDZA
chains in the Genus database with same CATH topology
2ZZXA 1BK4A 2WBBA 5IM2A 4GBWA 5I3SA 4OA4A 1IMAA 1FJ6A 1FRPA 3BIHA 5EYGA 1SPIA 1INPA 1IMDA 3RPLA 4MNIA 4NF0A 4P9KA 4LN5A 1DCUA 4PFIA 5EYHA 1FBFA 5IZ3B 2QPQA 4OVRA 3FXBA 4P56A 4DI4B 1LBVA 4HCWA 4G61A 3T1BA 5ET8A 4NHBA 4P47A 4IR8A 4N15A 2P3VA 1FJ9A 2Y5KA 2KR0A 1NV6A 5EQ9A 2DE2A 2FIXA 2DE4A 4O94A 4PAIA 4GWZA 1DBZA 4YZZA 4MIJA 4MNPA 4OVSA 4AS5A 1AWBA 2PFYA 4M1VA 4XFEA 1NV1A 4NG7A 5LTCA 4PE3A 1FPEA 2CZHA 4MEVA 4P8BA 4H46A 4OVQA 2B4LA 4N8GA 4N81A 4OANA 4PF8A 3SZPA 1IMFA 1FBCA 4PFBA 2QVUA 4O8MA 5J16A 3RPLB 2PCRA 1YZ0A 3W9VA 5EQAA 4MJOA 1FSAA 1NV5A 2F3BA 4QXDA 5IZ3A 1FBPA 1LBXA 1FPKA 2BJIA 4F18A 4NAPA 2OX3A 2WBDA 4HXVA 2L5VA 3RYDA 3B50A 3EKIA 1FPDA 4F19A 5CM6A 4PDDA 5I5PA 4JVIA 1G0IA 4PDHA 1NV2A 2XWKA 4MMPA 2XWOA 5J1DA 1IMEA 4PAKA 4MAGA 2QVRA 1G0HA 1NV0A 1FBEA 4GWYA 1RDXA 5T3JA 2XWIA 4GBVA 1KA0A 4OVTA 2XWVA 1EYIA 2HXRA 1EYKA 3E79A 5JK4A 3LV0A 1YXIA 4QBAA 4PAFA 4GX6A 1FPBA 3ROJA 4MCOA 5IZ1A 1NUZA 2VT5A 4N17A 2CEXA 1NV4A 4MX6A 4O7IA 2ZZWA 2CZIA 3GYYA 1FPGA 5I7IA 4P3LA 1NV7A 1FBDA 4H45A 2V4CA 3KC0A 4GWWA 4X8RA 1K9YA 2Y5LA 4F1UA 1NI9A 1K9ZA 4N6KA 5IGAA 3FBPA 4HE0A 2B4MA 4HE1A 4O7MA 2WYPA 1KZ8A 2XXKA 4GWSA 5DW8A 3LUZA 2V3QA 2WX9A 4HCYA 3B8BA 2CEYA 1NUWA 4X04A 2WEFA 2MKZA 4XF5A 3KC1A 3T0JA 3KBZA 1LEVA 2GQ1A 1D9QA 3BIGA 4FBPA 1FPLA 2R8TA 3D1RA 2DVZA 1JP4A 4N91A 4MNCA 2F3DA 2DE3A 2ZZVA 1FPIA 4PF6A 2P3NA 4PTKA 2HPGA 4UABA 4XEQA 1NV3A 3W9WA 1CNQA 5A5LA 1RDYA 1NUYA 4GX4A 4DI3D 5ET5A 3CHGA 4NGUA 4NX1A 4N8YA 1LBYA 4HE2A 1FTAA 4I3EA 4KXPA 5EQ7A 2PFZA 3MSTA 3PTYA 4I40A 1QGXA 4OVPA 2WYKA 4PFRA 1Q9DA 4YICA 4P1LA 2DDKA 2FBPA 1LBWA 1EYJA 2JJKA 1FBHA 2FIEA 1KA1A 2QVVA 4I3YA 4JVDA 3E78A 4X9TA 4PGNA 4JVCA 1FBGA 4MHFA 4F1VA 4PC9A 1IMBA 4GWUA 4AS4A 2KQZA 2Q9TA 2FHYA 1XI6A 3IFCA 3QMFA 3NOHA 1LBZA 4P1EA 4GWXA 5FBPA 4N6DA 3MYUA 4PCDA 1IMCA 1VDWA 3HFUA 3A29A 2HZLA 1NUXA 1FPFA 4GX3A 1YYZA 4PBQA 4NN3A 5ET7A 2HHMA 2QFLA 2CZKA 2Q8MA 1FPJA 2VPNA 5F24A 4PETA 1DK4A 2FVZA 5IZZA 2VPOA 5ESYA 4PGPA 3IFAA 3ISPA 2F5XA 4NQ8A 5ET6A 5EQ8A 2Q74A 2OWZA 3U65A 1RDZA 5LDZA 4PBHA 2HZKA 4N4UA 2XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BK4 A;  2WBB A;  4GBW A;  5I3S A;  1IMA A;  1FJ6 A;  1FRP A;  3BIH A;  5EYG A;  1SPI A;  1INP A;  1IMD A;  3RPL A;  1DCU A;  5EYH A;  1FBF A;  5IZ3 B;  1LBV A;  4G61 A;  5ET8 A;  4IR8 A;  2P3V A;  1FJ9 A;  2Y5K A;  1NV6 A;  5EQ9 A;  2FIX A;  4GWZ A;  1DBZ A;  4AS5 A;  1AWB A;  1NV1 A;  1FPE A;  2CZH A;  4H46 A;  4N81 A;  1IMF A;  1FBC A;  2QVU A;  5J16 A;  3RPL B;  2PCR A;  1YZ0 A;  5EQA A;  4MJO A;  1FSA A;  1NV5 A;  2F3B A;  4QXD A;  5IZ3 A;  1FBP A;  1LBX A;  1FPK A;  2BJI A;  2OX3 A;  2WBD A;  4HXV A;  3RYD A;  1FPD A;  1G0I A;  1NV2 A;  1IME A;  2QVR A;  1G0H A;  1NV0 A;  1FBE A;  4GWY A;  1RDX A;  5T3J A;  4GBV A;  1KA0 A;  1EYI A;  1EYK A;  3LV0 A;  1YXI A;  4GX6 A;  1FPB A;  3ROJ A;  5IZ1 A;  1NUZ A;  2VT5 A;  1NV4 A;  4O7I A;  2CZI A;  1FPG A;  1NV7 A;  1FBD A;  4H45 A;  3KC0 A;  4GWW A;  1K9Y A;  2Y5L A;  1NI9 A;  1K9Z A;  3FBP A;  4HE0 A;  4HE1 A;  1KZ8 A;  4GWS A;  5DW8 A;  3LUZ A;  3B8B A;  1NUW A;  2WEF A;  3KC1 A;  3T0J A;  3KBZ A;  1LEV A;  2GQ1 A;  1D9Q A;  3BIG A;  4FBP A;  1FPL A;  2R8T A;  3D1R A;  1JP4 A;  2F3D A;  1FPI A;  2P3N A;  4PTK A;  1NV3 A;  1CNQ A;  5A5L A;  1RDY A;  1NUY A;  4GX4 A;  5ET5 A;  1LBY A;  4HE2 A;  1FTA A;  4I3E A;  4KXP A;  5EQ7 A;  4I40 A;  1QGX A;  1Q9D A;  2DDK A;  2FBP A;  1LBW A;  1EYJ A;  2JJK A;  1FBH A;  2FIE A;  1KA1 A;  2QVV A;  4I3Y A;  1FBG A;  1IMB A;  4GWU A;  4AS4 A;  2FHY A;  1XI6 A;  3IFC A;  3QMF A;  1LBZ A;  4GWX A;  5FBP A;  1IMC A;  1VDW A;  3A29 A;  1NUX A;  1FPF A;  4GX3 A;  1YYZ A;  5ET7 A;  2HHM A;  2QFL A;  2CZK A;  2Q8M A;  1FPJ A;  5F24 A;  1DK4 A;  2FVZ A;  5ESY A;  3IFA A;  5ET6 A;  5EQ8 A;  2Q74 A;  2OWZ A;  1RDZ A;  5LDZ A; 
#chains in the Genus database with same CATH topology
 2WBB A;  1BKA A;  3KSJ A;  2DWI A;  2GHB A;  1FBF A;  4NF5 A;  5I2K B;  2UVJ A;  1MQH A;  5H8N B;  3VLV A;  4LVQ A;  4DLD A;  2H25 A;  1SW4 A;  2PYY A;  5AA2 D;  3BFT A;  4MNP A;  2I3V A;  2DS9 A;  2PCR A;  1PBP A;  1HSL A;  4XXU A;  4NF5 B;  5I2K A;  2ONK E;  1S9T A;  1B5I A;  4OTE A;  2O69 A;  5ITO A;  2DWJ A;  2XWV A;  1FPB A;  1B46 A;  1NV4 A;  3S9N C;  4ZZA A;  3S9L C;  1SYI A;  3O97 A;  4X8R A;  1AH5 A;  1K9Y A;  4ZEC A;  4ISU A;  1NI9 A;  3SEY A;  3HN0 A;  1NL5 A;  1R1N A;  2H99 A;  3CVG A;  3B8B A;  4OVJ A;  2MKZ A;  3KC1 A;  3T0J A;  1N3W A;  3KZG A;  5BWJ A;  4ND9 A;  3FXU A;  4ZDM A;  3PPP A;  4LZ7 A;  4F39 A;  4HE2 A;  5B70 A;  1LB9 A;  5AA2 A;  3CFL A;  1EYJ A;  1FBH A;  1IZ1 A;  4F1V A;  4DZ1 A;  3MZB A;  1I6A A;  2D21 A;  4LUB A;  3RGY A;  1II5 A;  2XXT A;  1FPF A;  3G3H A;  3TDJ A;  1ANF A;  3PUW E;  1NNT A;  1NKX A;  4L17 A;  1INP A;  4YB5 A;  1XS5 A;  3FAT A;  4NF4 A;  5IZ3 B;  2RKM A;  4OVR A;  1QW0 A;  1ZU0 A;  4PP0 A;  3IX1 A;  1CE2 A;  1N84 A;  2QJE A;  4NG7 A;  4PE3 A;  5DVF A;  1H3D A;  1SVX B;  4OWD A;  1P1O A;  1LB8 A;  3RY3 A;  1Q1K A;  1LBX A;  4F18 A;  1AMF A;  3OMB A;  2F7C A;  4KYE A;  4MMP A;  5J1D A;  3TTM A;  4KQP A;  1PB9 A;  1QUK A;  4GBV A;  1BP5 A;  3E79 A;  1GVC A;  3OOA A;  3PD8 A;  4MCO A;  3FVK A;  3IL1 B;  4MX6 A;  3CRB A;  3GYY A;  3O66 A;  4LAT A;  5H8S A;  2HFB A;  4GWW A;  3R7X A;  1K9Z A;  1PB7 A;  3BKI B;  2FA7 A;  2ZYO A;  2BJJ X;  2ZZV A;  3SEU A;  1NFT A;  2NXO A;  4FAT A;  3TFL A;  1B58 A;  4KXP A;  5F1Q A;  1UTB B;  3MVX A;  4OFO A;  2THI A;  1XI6 A;  5M2V A;  3E3K A;  4PBQ A;  1Y9U A;  3VVF A;  4BDL A;  4LZ8 A;  2F78 A;  3TAJ A;  3IB0 A;  2Q74 A;  2OWZ A;  1ZMG A;  4F2Q A;  3JYR A;  4GBW A;  1OMP A;  2XXR A;  3O6I A;  1DCU A;  3G3I A;  4OFJ A;  4M4G A;  3SDF A;  3G7W A;  1B3E A;  3MWB A;  5H8Q A;  1MXV A;  3HHG A;  4O3B A;  4NF8 B;  4YKK A;  4GQO A;  5J16 A;  1Y3Q A;  4QXD A;  1JW4 A;  2B3B A;  3RYD A;  4F19 A;  1TWY A;  1G0I A;  2O1L A;  1B52 A;  1DPE A;  1LST A;  1G0H A;  1NNF A;  1I6B A;  3FUZ A;  4F3G A;  3VVE A;  1Y4C A;  3PUZ E;  5JTY A;  2WYP A;  3IK6 B;  4EQ7 A;  1QKB A;  3PUY E;  2Z8F A;  3KBZ A;  2V3U A;  1BIY A;  2DE3 A;  1FPI A;  2CMO A;  4DI3 D;  1LAH E;  4UA8 A;  4IO7 A;  4JDF A;  2WYK A;  3OEL A;  4JSO A;  4QRZ A;  1GR2 A;  1WOD A;  4EXK A;  4OET A;  4IY5 A;  3UOR A;  1LBZ A;  4LP2 B;  1Y1M A;  3OO8 A;  3HV1 A;  4H1X A;  2WKY A;  5IZZ A;  4KI0 E;  2PX1 A;  4NTL A;  1NH8 A;  4QFP A;  4RK2 A;  5LDZ A;  4LA9 A;  2ZYM A;  3CG3 A;  4E0W A;  1OLC A;  1BK4 A;  3L6G A;  1IMD A;  4G8H A;  3LUY A;  1NNP A;  4QFN A;  3TEL A;  1PC3 A;  2XHD A;  3FD3 A;  3N94 A;  4NHB A;  5ICT A;  3C35 A;  4C0R A;  2X26 A;  4OAN A;  2A5T B;  4POX A;  4PDD A;  4JVI A;  3IAZ A;  3SEX A;  3DLN A;  3CR9 A;  1Y1Z A;  2NVU B;  2X7Q A;  2VT5 A;  2QS3 A;  2Z8D A;  3IJO B;  4BDQ A;  4P3L A;  1M5F A;  3K2D A;  3LUZ A;  4RXL A;  1NUW A;  3MP6 A;  2XXH A;  4EDP A;  4N91 A;  3D1R A;  4I62 A;  2RCA A;  2X7P A;  1RDY A;  3IOR A;  5CMK A;  1QUI A;  3HCQ A;  4NX1 A;  2I0C A;  2R6G E;  1RYO A;  4I1D A;  1FW0 A;  4ZE9 A;  5F7V A;  2JJK A;  4FE8 A;  4U4X A;  4JVC A;  4YU0 A;  1H45 A;  3MPL A;  2KQZ A;  5KZT A;  3QYT A;  2OWS A;  4EF1 A;  4YMA A;  4NF4 B;  2R9J A;  2DQV A;  4Z7E A;  2UYE A;  5ELV A;  2VD3 A;  1DK4 A;  3WAE A;  5CRY A;  1R9Q A;  2HZK A;  1DSN A;  1L5T A;  1GGG A;  2ESN A;  3MP1 A;  1FRP A;  2R71 A;  1SI0 A;  3IR1 A;  1B4H A;  4IO4 A;  4FAJ A;  3TQW A;  1N7X A;  5DEX A;  4IR8 A;  3MVY A;  2KR0 A;  5EQ9 A;  3EHU A;  2DYX A;  5IKB A;  5EHS A;  3ZSF A;  3HST A;  1AWB A;  1IEJ A;  3Q27 A;  3G3F A;  1UQW A;  1B7U A;  3SZP A;  4PFB A;  1MQI A;  4O8M A;  4ESW A;  4FEB A;  1P1N A;  1YZ0 A;  5EQA A;  3TUS A;  1NV5 A;  2F3B A;  3QUF A;  5AE4 A;  1B7Z A;  4FOR A;  5I5P A;  4G68 A;  1R9L A;  3Q29 A;  4PDH A;  2I49 A;  2VD2 A;  1IME A;  3C32 A;  3I5O A;  1JNF A;  2DOJ A;  2HXR A;  1LCT A;  2YJP A;  3DP8 A;  3VLU A;  3HPI A;  4IO6 A;  1UIU A;  3O2A A;  4THI A;  4U21 A;  3SKP A;  1PEB A;  1FBD A;  4JB7 A;  5JEI A;  3QIM A;  2ZNU A;  1MM7 A;  2NUV A;  5DW8 A;  1LFI A;  1MY3 A;  4ELR A;  5I56 B;  1EZP A;  3Q26 A;  1US4 A;  1NV3 A;  3VLW A;  4GD5 A;  1D9V A;  1TFA A;  1XHY A;  4UAB A;  3W9W A;  1LBB A;  1FTK A;  5FHO A;  3K1M A;  1JET A;  2D3I A;  1MQD A;  3MUQ A;  1LBC A;  3QMF A;  4QSD A;  4OQO A;  3A3C A;  3MVZ A;  2YPN A;  4NN3 A;  2QFL A;  4RY1 A;  5AA4 A;  5IAI A;  3KFM A;  5DVI A;  4QFK A;  3T9X B;  3O6H A;  2Z22 A;  3R26 A;  1ZTY A;  4PBH A;  1UIV A;  3PUV E;  1B0H A;  3KN7 A;  5IM2 A;  4OA4 A;  1IMA A;  1PB8 A;  1FJ6 A;  2I3W A;  3V83 A;  3T93 B;  5AA4 B;  3O29 A;  4PAI A;  1IXC A;  4O94 A;  4GWZ A;  4XFE A;  4M1V A;  5CM6 A;  3LSF B;  4U1O A;  4ELQ A;  3I3V A;  2PT1 A;  3C33 A;  1DTZ A;  3TQL A;  1FPD A;  3TPA A;  1N04 A;  3KG2 A;  4U4S A;  4PAK A;  4R9G A;  5I56 A;  1LFH A;  3MC2 A;  2GRV A;  2QRY A;  3WAF A;  3GBB A;  3EF7 A;  4H45 A;  3TYH A;  1MPC A;  5HBC A;  3BIG A;  3S9M C;  2Q89 A;  4DIG A;  4NF8 A;  3RQT A;  2H98 A;  2REJ A;  1FTM A;  4R2B A;  4N8Y A;  3OEN A;  3FV2 A;  4UAC A;  2Y7I A;  3N26 A;  4R6K A;  4PET A;  3BFU A;  4JVD A;  3E9X A;  4JBZ A;  4MHF A;  4GFR A;  4OES A;  5L9O A;  4ZE8 A;  1B4Z A;  4KCC A;  3B6Q A;  2HZL A;  1B05 A;  1HSJ A;  2CZK A;  5DYH A;  2Q8M A;  5DVJ A;  2FVZ A;  3H4Z A;  5I2N A;  3FVO A;  2HAU A;  3ISP A;  4LZ5 A;  3IJX B;  3PPR A;  4DDD A;  1EH3 A;  2Y7K A;  2Z8E A;  5EYG A;  3IO6 A;  5H8F A;  5KDT A;  4PFU A;  2UVG A;  4DI4 B;  1TT1 A;  2P2A A;  1IXI A;  4RNS A;  5TPA A;  4N15 A;  3N6T A;  4OHN A;  1MXY A;  4MJO A;  2ANJ A;  2NOO A;  5H8H A;  3ILT B;  2XXV A;  1LLS A;  4G8M A;  3ILU B;  5TPA B;  3FJG A;  4BDM A;  1B1H A;  2XXY A;  1RDX A;  5T3J A;  4IGR A;  1BLF A;  4I9D A;  4OYV A;  2D5W A;  1FPG A;  1QUL A;  2I48 A;  2AIX A;  2XXK A;  1S50 A;  1WDN A;  3TKD A;  2XXQ A;  3S2V A;  3U1O A;  3V8X B;  1TXF A;  4OMB A;  3RTW B;  3HHF A;  4G68 B;  1NUY A;  1LAF E;  2Q2A A;  2W7Y A;  4PFR A;  3H06 B;  3TTR A;  1H44 A;  4PC9 A;  1OVB A;  2OLB A;  1MH4 A;  1IMC A;  4GXA A;  1KWH A;  3DP6 A;  4DXB A;  5HPQ A;  3TCH A;  4QF9 A;  5EQ8 A;  4H5G A;  4BDR A;  1ZBM A;  3KBR A;  4XKN A;  3FIR A;  3QAX A;  4NF0 A;  4R74 A;  3MZ9 A;  3FXB A;  1LBV A;  2XD2 A;  3T1B A;  4P47 A;  2H9B A;  1NV6 A;  4QHQ A;  2DE2 A;  3CSG A;  3B6T A;  2XXW A;  2PFY A;  5HM4 B;  1B1X A;  2H5Y A;  1NV1 A;  1ATG A;  3IOU A;  3VDF A;  4P8B A;  4N81 A;  3SEV A;  5L8D A;  3RPL B;  1URS A;  5LOM A;  2ZNT A;  1USY H;  1MDP 1;  2HCA A;  4DXC A;  4O3A A;  1LCF A;  2ZNS A;  4POW A;  1NV2 A;  2I4C A;  3FVN A;  3MJN A;  3H6V A;  1DPP A;  1SW1 A;  3IB2 A;  4RK9 A;  4HTG A;  3EHS A;  1ELJ A;  4R72 A;  4P0G A;  1NV7 A;  5A5X B;  3P7I A;  1M5E A;  1B2H A;  4MBP A;  1LEV A;  2GQ1 A;  1IXG A;  1JP4 A;  5BUU A;  4EXL A;  4IO5 A;  1CNQ A;  1M5D A;  1EZ9 A;  3CHG A;  4HS7 A;  4IY6 A;  3GLB A;  2QSX A;  1MY0 A;  2OPD A;  2O7I A;  1FCK A;  1B3L A;  3BBR A;  1B0L A;  2OPE A;  3TCG A;  2F6P A;  4P1E A;  2UVI A;  3QSL A;  2I6E A;  3UGW A;  1VDW A;  2F7A A;  4DCY A;  2XXI A;  5A5X A;  4KYS A;  3TZA A;  1JEV A;  4PGP A;  5I58 A;  3CI8 A;  3MPK A;  4N4U A;  2XA5 A;  2DP8 A;  2QPQ A;  1N76 A;  4NMY A;  4YB7 A;  3K4U A;  5AA2 B;  1FPE A;  4H46 A;  4N8G A;  4PF8 A;  2H4I A;  3ZKL A;  1LFG A;  4F3P A;  3KJT A;  2UYF A;  2BJI A;  1XC1 A;  4NAP A;  4KR5 A;  5FHM A;  1RYX A;  1UTH B;  4H65 A;  4TLL B;  1FBE A;  1B3G A;  1FQC A;  1D3K A;  5JK4 A;  4GX6 A;  4N6P A;  3KOT A;  4QFO A;  1D9Y A;  4U22 A;  4MH5 A;  2OCU A;  3EN3 A;  3CFX A;  2V3Q A;  2XX8 A;  2RCB A;  1SQY A;  2AYS A;  3DM0 A;  1SW2 A;  4OXV A;  1JVX A;  4PF6 A;  4OER A;  3VVD A;  4C1T A;  2F35 A;  4PE5 B;  3MST A;  1OQG A;  1Q35 A;  2QMW A;  4YIC A;  2LAO A;  1XVY A;  3E78 A;  5K2X A;  4X9T A;  3LR1 A;  3PU5 A;  4AS4 A;  3KN3 A;  3IFC A;  4GWX A;  1H43 A;  2XD3 A;  3OEK A;  3HFU A;  5ISU A;  3W15 C;  1MM6 A;  2V3T A;  1VE4 A;  3M3F A;  5B7D A;  2Q2C A;  1IIW A;  1OVT A;  3TEP A;  3RTF B;  4FED A;  1FQF A;  1OLA A;  4BDN A;  4MLQ A;  3UN6 A;  2RC9 A;  5ET8 A;  1FJ9 A;  2XX9 A;  1XOC A;  3TCF A;  3FXQ A;  3K0V A;  3I6V A;  5EHM A;  3TTL A;  2B4L A;  2I0B A;  1IMF A;  2QVU A;  1URD A;  1URG A;  2L5V A;  2Q8J A;  4FJP A;  3FJ7 A;  1O63 A;  1POT A;  3CG1 A;  2AL4 A;  5K2Y A;  3SET A;  1B32 A;  4U23 A;  1KA0 A;  4OVT A;  1EYI A;  3N5L A;  3RUM A;  2QS1 A;  4ECF A;  5I7I A;  2F7B A;  3H7M A;  4H8I A;  2B4M A;  4X04 A;  3RT8 A;  3U8Q A;  1O64 A;  3IO4 A;  3CIJ A;  1CB6 A;  4G68 C;  1B7H A;  4NGU A;  1LBY A;  1MQJ A;  4FEC A;  3PTY A;  4R73 A;  2VOZ A;  4YKP A;  2I58 A;  4NWC A;  4P1L A;  4X48 A;  1F9B A;  1MXU A;  4PGN A;  4KPT A;  3ECR A;  3C36 A;  1Y4T A;  3C31 A;  1A8F A;  3MYU A;  1A99 A;  1NUX A;  4YMB A;  3QK6 A;  1SDX A;  2NWJ A;  4Q5T A;  4RYA A;  3KEI A;  1B40 A;  4WKM A;  4DXU A;  1YCJ A;  4ESX A;  1QJM A;  2ZZX A;  4AQ4 A;  1J1N A;  2PVU A;  5I59 A;  3PPO A;  4H6D A;  1LAG E;  4IO2 A;  3RPW A;  1SPI A;  4AB6 A;  4YAH X;  4PFI A;  5H8H B;  4ZS9 A;  1P1Q A;  3S9E A;  3USD A;  1DBZ A;  4YZZ A;  1A40 A;  1IQ7 A;  5IZ3 A;  1FBP A;  3FAS A;  5LTC A;  1Z7N E;  3B50 A;  5DT6 A;  1B3F A;  3MW0 A;  1N3X A;  3LSX A;  4H67 A;  3FJM A;  1POY 1;  4GRK A;  3LSW A;  5FTI A;  2XWI A;  1AL3 A;  3T9H B;  2Y7W A;  1EYK A;  1YXI A;  3IOV A;  4QBA A;  4QSE A;  3PV0 E;  3AXF A;  4ZEB A;  2CZI A;  2ZMB A;  4ELO A;  4N6K A;  3FBP A;  1FQE A;  1KZ8 A;  4ZEK A;  1P1U A;  4G77 A;  4HCY A;  4O3C A;  3LBS A;  3E13 X;  4GL8 A;  1D9Q A;  1VFD A;  1FPL A;  1FQD A;  3MZ1 A;  2IA4 A;  1SW5 A;  4MNC A;  4NED A;  3K01 A;  2HPG A;  1OIB A;  1A55 A;  2YLN A;  5CMC A;  4I3E A;  2V93 A;  1UTH A;  1S7Y A;  2XXX A;  3PUX E;  3S4U A;  4G4P A;  4I3Y A;  1T0K A;  2QVV A;  2RC7 A;  1IMB A;  3K6W A;  2RIN A;  3T66 A;  2B3F A;  4G8N A;  1LAX A;  2ONR A;  3MQ9 A;  3H6W A;  3C9H A;  2F97 A;  3IFA A;  4RPN A;  1IXH A;  4NQ8 A;  2I4B A;  4EQ9 A;  4PFY A;  4QFL A;  5I3S A;  4JWO A;  3VXB A;  3TMG A;  1US5 A;  3BIH A;  4N07 A;  3PGF A;  3RPL A;  1EZO A;  1A8E A;  2DWA A;  2F34 A;  4F31 B;  4Z0I A;  3U93 A;  3CSB A;  3KN8 A;  3RN8 A;  3MAM A;  3MVW A;  3V89 B;  3T96 B;  4OVS A;  3H3G A;  2DSF A;  4OVQ A;  3IOT A;  1BTJ A;  4F2O A;  4WED A;  3GBA A;  2P0S A;  2XWO A;  4P11 A;  4KFQ A;  4GWY A;  3LV0 A;  4GL0 A;  4DE8 A;  4F3S A;  4F22 A;  2CEX A;  4DCX A;  5I57 A;  1VR5 A;  3Q28 A;  3KC0 A;  4XKQ A;  3UK4 A;  2V84 A;  3K6V A;  2PMS A;  2OBG A;  4X1D A;  1PDA A;  4RPO A;  4BLA A;  4EQB A;  2UVH A;  1B51 A;  3FGS A;  1VFE A;  4H5F A;  4XEQ A;  4PFT A;  4YKJ A;  4GLI A;  1I6Q A;  5ICQ A;  3C4M A;  3M3L A;  3KSX A;  5EQ7 A;  3H6T A;  4I40 A;  3L6H A;  4OFL A;  4YKI A;  5CBS A;  1A7L A;  1MY1 A;  4LON B;  2VHA A;  4P9K A;  2FBP A;  2E1S A;  4NWD A;  2FHY A;  2ONS A;  2UXA A;  3T9V A;  4PCD A;  4GX3 A;  3CFZ A;  1FPJ A;  4HW8 A;  4OEN A;  2A5S A;  4PFW A;  1EU8 A;  2F5X A;  1TFD A;  3VXC A;  2GFE A;  3T22 A;  3N6U A;  2O6A A;  2Q88 A;  1B6H A;  1FTO A;  2VGQ A;  4RJZ A;  3U94 A;  1B3H A;  4R6H A;  4G61 A;  5CMB A;  3MP8 A;  4BDO A;  4R2F A;  4I8C A;  1JW1 A;  2CZH A;  4MEV A;  3RT6 B;  1FBC A;  2Y7R A;  1MXZ A;  4MFI A;  1FPK A;  3OEM A;  2OWT A;  2AL5 A;  5TP9 A;  5CMM A;  1MG1 A;  3MBP A;  1JQF A;  3LC8 A;  3K1P A;  4JSD A;  5I58 B;  3H6U A;  3OXN A;  3OO7 A;  3QUJ A;  3G3G A;  4PAF A;  3VE1 B;  4KYD A;  5IZ1 A;  4N17 A;  2RC8 A;  2ZZW A;  4GOT A;  2O51 A;  4OEV A;  2Y5L A;  1MS7 A;  4IGT A;  2DVC A;  4GXS B;  4O7M A;  5L9S A;  4GWO A;  1O7T A;  2WX9 A;  1ZIU A;  2WEF A;  3EPE A;  4XF5 A;  4FBP A;  4OEU A;  3SES A;  4LQ5 A;  4PQJ A;  4PTK A;  2F8D A;  3OSR A;  2PFZ A;  2V25 A;  3PPQ A;  2DDK A;  1LBW A;  2B65 A;  3T9U A;  3PMV A;  1FBG A;  4GIZ A;  2GH9 A;  2Q9T A;  3NOH A;  3OO9 A;  2KLF A;  5H8F B;  2HHM A;  5F24 A;  2VPO A;  2O1M A;  2VP1 A;  1XVX A;  1RKM A;  4LQ2 A;  1GV8 A;  1AOV A;  4K3F A;  2Z23 A;  2QMX A;  5TP9 B;  4MNI A;  5EYH A;  4EUO A;  2O68 A;  1FQA A;  2XX7 A;  1Y3N A;  3IB1 A;  1Z7M E;  3QXM A;  2OJT A;  3OD7 A;  4ZZE A;  2OX3 A;  4HXV A;  4OZ9 A;  4IB2 A;  1HSE A;  2RF1 A;  4TQU Q;  5KCJ B;  1M5B A;  4MAG A;  5I59 B;  3ROJ A;  3A3U A;  3VV5 A;  1NUZ A;  1R6Z A;  1JEU A;  5AA3 A;  1MQG A;  4ONY A;  2O7U A;  3OSQ A;  4P0I A;  3K6X A;  3M3K A;  5IGA A;  4HE1 A;  3GZG A;  1YPN A;  2Y84 A;  2ZYN A;  1SBP A;  3G3K A;  1JW5 A;  1MDQ A;  3TTN A;  3O6G A;  2P3N A;  2F36 A;  3TTK A;  1QVS A;  4EF2 A;  1Q9D A;  5DEX B;  5KCJ A;  1MY2 A;  3FZV A;  2FIE A;  5I84 A;  1AIV A;  3O28 A;  3PMW A;  4GWU A;  4GF8 A;  1N7W A;  1B5H A;  2DXY A;  4N6D A;  1SYH A;  1YYZ A;  2ZXT A;  1D4N A;  5ET7 A;  4C1U A;  2VPN A;  1MXW A;  5ESY A;  2ABH A;  5TU0 A;  5ET6 A;  3DEL B;  3UIF A;  1ZJL A;  1SI1 A;  1DMB A;  3SER A;  2CZL A;  3VFJ A;  1NMU A;  4AB5 A;  2HXW A;  3OO6 A;  1I69 A;  1M5C A;  1QKA A;  3THI A;  4GVO A;  4LN5 A;  4E0X A;  4P56 A;  1B5J A;  4WXJ A;  4HCW A;  3D4C A;  3LSL A;  3O9P A;  3B7D A;  3FV1 A;  2OK2 A;  2DE4 A;  2G29 A;  3M8U A;  1NNK A;  2XXU A;  3SEW A;  2HEU A;  3UP9 A;  3IOW A;  5AA1 A;  2PT2 A;  3HO7 A;  3RNN A;  1ZLQ A;  4WEP A;  1FSA A;  1UTB A;  3U72 A;  1QUJ A;  3EKI A;  1IIT A;  4ZED A;  1USY E;  1MPD A;  5H8N A;  2HQ0 A;  2QVR A;  1NV0 A;  4MF3 A;  3Q25 A;  4Q8R A;  1B9J A;  1FTL A;  4O7I A;  3UA8 A;  1P1W A;  2PBW A;  3TOD A;  4F1U A;  4F29 A;  3V5A A;  4GWS A;  4RA1 A;  2CEY A;  4ZEF A;  2F6G A;  3JZJ A;  4H8J A;  3PMX A;  2O84 X;  2ZYK A;  2R8T A;  1JVY A;  2F3D A;  4Q30 B;  3F11 A;  5A5L A;  1N0T A;  2E0S A;  5ET5 A;  1IUD A;  4JXI A;  1FTA A;  1Y20 A;  1FTJ A;  1QGX A;  3C34 A;  3R6U A;  4G2Z A;  2OZZ A;  4MLV A;  4U1Z A;  4XTC Q;  3KOS A;  3EHT A;  3RLF E;  2M8C A;  5FBP A;  3H03 A;  4Q0C A;  5I57 B;  3B6W A;  1YAE A;  3KJ7 A;  4YB6 A;  3FXR A;  1MXX A;  3GXA A;  4JWY A;  4JWX A;  4R6Y A;  3U65 A;  2XXP A;  3G3J A;  1FQB A;  4NE4 A;  1GTK A;  5JTY B;  1NH7 A;  2G93 A;  4IO3 A;  1PBQ A;  4KHZ E;  1XT8 A;  2DWH A;  2IEE A;  2Y7P A;  2ALU A;  1OQH A;  5FTH A;  2P3V A;  2Y5K A;  3EQ1 A;  2FIX A;  4XKP A;  3ZS6 A;  4MIJ A;  3KGC A;  4AS5 A;  5DTB A;  3ODB A;  1DTG A;  4U2R A;  4KCD A;  2FNC A;  5CI5 A;  3W9V A;  3D4G A;  1MRP A;  1YTV A;  1DOT A;  2WBD A;  2QS4 A;  2XWK A;  1LGB C;  3K00 A;  3K02 A;  4NF6 B;  4FIM A;  1H76 A;  2HAV A;  5L9M A;  4R75 A;  4R9F A;  3A09 A;  4XKR A;  1MY4 A;  1Y3P A;  2QS2 A;  3U92 A;  5KDT B;  2V4C A;  3PD9 A;  4XIG Q;  4HE0 A;  1MH3 A;  3K6U A;  4NF6 A;  4X1B A;  2FYI A;  5ITP A;  2DVZ A;  1ZKB A;  4H0W A;  3ZKK A;  3PPN A;  5CBR A;  1SD3 A;  4KD5 A;  4GX4 A;  3E4R A;  4TLM B;  4OVP A;  1A54 A;  4TOZ A;  4F3B A;  1VSO A;  1WVJ A;  4ELP A;  1P99 A;  1KA1 A;  5FHN A;  2DXR A;  4N13 A;  2A5T A;  2QL3 A;  4ZEI A;  4F1Y A;  3DP4 A;  5H8Q B;  3JV9 A;  4QSC A;  3A29 A;  3K1N A;  3ONM A;  2P1S A;  3FVG A;  5I2N B;  2GHA A;  5EYF A;  2REG A;  5CC2 A;  1MPB A;  1RDZ A; 
#chains in the Genus database with same CATH homology
 2ZZX A;  1BK4 A;  2WBB A;  5IM2 A;  4GBW A;  5I3S A;  4OA4 A;  1IMA A;  1FJ6 A;  1FRP A;  3BIH A;  5EYG A;  1SPI A;  1INP A;  1IMD A;  3RPL A;  4MNI A;  4NF0 A;  4P9K A;  4LN5 A;  1DCU A;  4PFI A;  5EYH A;  1FBF A;  5IZ3 B;  2QPQ A;  4OVR A;  3FXB A;  4P56 A;  4DI4 B;  1LBV A;  4HCW A;  4G61 A;  3T1B A;  5ET8 A;  4NHB A;  4P47 A;  4IR8 A;  4N15 A;  2P3V A;  1FJ9 A;  2Y5K A;  2KR0 A;  1NV6 A;  5EQ9 A;  2DE2 A;  2FIX A;  2DE4 A;  4O94 A;  4PAI A;  4GWZ A;  1DBZ A;  4YZZ A;  4MIJ A;  4MNP A;  4OVS A;  4AS5 A;  1AWB A;  2PFY A;  4M1V A;  4XFE A;  1NV1 A;  4NG7 A;  5LTC A;  4PE3 A;  1FPE A;  2CZH A;  4MEV A;  4P8B A;  4H46 A;  4OVQ A;  2B4L A;  4N8G A;  4N81 A;  4OAN A;  4PF8 A;  3SZP A;  1IMF A;  1FBC A;  4PFB A;  2QVU A;  4O8M A;  5J16 A;  3RPL B;  2PCR A;  1YZ0 A;  3W9V A;  5EQA A;  4MJO A;  1FSA A;  1NV5 A;  2F3B A;  4QXD A;  5IZ3 A;  1FBP A;  1LBX A;  1FPK A;  2BJI A;  4F18 A;  4NAP A;  2OX3 A;  2WBD A;  4HXV A;  2L5V A;  3RYD A;  3B50 A;  3EKI A;  1FPD A;  4F19 A;  5CM6 A;  4PDD A;  5I5P A;  4JVI A;  1G0I A;  4PDH A;  1NV2 A;  2XWK A;  4MMP A;  2XWO A;  5J1D A;  1IME A;  4PAK A;  4MAG A;  2QVR A;  1G0H A;  1NV0 A;  1FBE A;  4GWY A;  1RDX A;  5T3J A;  2XWI A;  4GBV A;  1KA0 A;  4OVT A;  2XWV A;  1EYI A;  2HXR A;  1EYK A;  3E79 A;  5JK4 A;  3LV0 A;  1YXI A;  4QBA A;  4PAF A;  4GX6 A;  1FPB A;  3ROJ A;  4MCO A;  5IZ1 A;  1NUZ A;  2VT5 A;  4N17 A;  2CEX A;  1NV4 A;  4MX6 A;  4O7I A;  2ZZW A;  2CZI A;  3GYY A;  1FPG A;  5I7I A;  4P3L A;  1NV7 A;  1FBD A;  4H45 A;  2V4C A;  3KC0 A;  4GWW A;  4X8R A;  1K9Y A;  2Y5L A;  4F1U A;  1NI9 A;  1K9Z A;  4N6K A;  5IGA A;  3FBP A;  4HE0 A;  2B4M A;  4HE1 A;  4O7M A;  2WYP A;  1KZ8 A;  2XXK A;  4GWS A;  5DW8 A;  3LUZ A;  2V3Q A;  2WX9 A;  4HCY A;  3B8B A;  2CEY A;  1NUW A;  4X04 A;  2WEF A;  2MKZ A;  4XF5 A;  3KC1 A;  3T0J A;  3KBZ A;  1LEV A;  2GQ1 A;  1D9Q A;  3BIG A;  4FBP A;  1FPL A;  2R8T A;  3D1R A;  2DVZ A;  1JP4 A;  4N91 A;  4MNC A;  2F3D A;  2DE3 A;  2ZZV A;  1FPI A;  4PF6 A;  2P3N A;  4PTK A;  2HPG A;  4UAB A;  4XEQ A;  1NV3 A;  3W9W A;  1CNQ A;  5A5L A;  1RDY A;  1NUY A;  4GX4 A;  4DI3 D;  5ET5 A;  3CHG A;  4NGU A;  4NX1 A;  4N8Y A;  1LBY A;  4HE2 A;  1FTA A;  4I3E A;  4KXP A;  5EQ7 A;  2PFZ A;  3MST A;  3PTY A;  4I40 A;  1QGX A;  4OVP A;  2WYK A;  4PFR A;  1Q9D A;  4YIC A;  4P1L A;  2DDK A;  2FBP A;  1LBW A;  1EYJ A;  2JJK A;  1FBH A;  2FIE A;  1KA1 A;  2QVV A;  4I3Y A;  4JVD A;  3E78 A;  4X9T A;  4PGN A;  4JVC A;  1FBG A;  4MHF A;  4F1V A;  4PC9 A;  1IMB A;  4GWU A;  4AS4 A;  2KQZ A;  2Q9T A;  2FHY A;  1XI6 A;  3IFC A;  3QMF A;  3NOH A;  1LBZ A;  4P1E A;  4GWX A;  5FBP A;  4N6D A;  3MYU A;  4PCD A;  1IMC A;  1VDW A;  3HFU A;  3A29 A;  2HZL A;  1NUX A;  1FPF A;  4GX3 A;  1YYZ A;  4PBQ A;  4NN3 A;  5ET7 A;  2HHM A;  2QFL A;  2CZK A;  2Q8M A;  1FPJ A;  2VPN A;  5F24 A;  4PET A;  1DK4 A;  2FVZ A;  5IZZ A;  2VPO A;  5ESY A;  4PGP A;  3IFA A;  3ISP A;  2F5X A;  4NQ8 A;  5ET6 A;  5EQ8 A;  2Q74 A;  2OWZ A;  3U65 A;  1RDZ A;  5LDZ A;  4PBH A;  2HZK A;  4N4U A;  2XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...