1IMFA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
262
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 85
structure length 262
sequence length 272
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imfA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imfA02
1NV5A 4HE2A 1FPJA 1EYKA 5ET5A 4O7IA 4MJOA 4GWZA 1G0IA 1NV1A 2F3BA 5I3SA 1AWBA 1LBZA 3LUZA 4GWWA 1FPGA 1FPFA 4GX3A 4IR8A 4AS5A 1NV7A 3IFCA 2CZKA 5EYGA 2WEFA 4HE0A 1FJ6A 4GX6A 2FVZA 3D1RA 1KA0A 1FBDA 1INPA 1FPDA 2DDKA 5IZ3A 1SPIA 1LBYA 2P3VA 4HXVA 1D9QA 1IMDA 1KA1A 2WBBA 3A29A 3RPLB 1FPBA 1NV4A 5IZ3B 2R8TA 4GWYA 1EYIA 3FBPA 4G61A 4FBPA 3KC0A 2CZHA 1RDYA 1CNQA 5EQ7A 1FJ9A 2Y5KA 5EQ9A 1RDXA 4GWXA 1QGXA 2FIXA 5EYHA 2F3DA 3QMFA 2QFLA 3LV0A 1K9YA 1NUZA 3KC1A 1FTAA 1LBVA 4H45A 1FPLA 2Q74A 4GX4A 1G0HA 3B8BA 5J16A 3BIHA 1NI9A 1BK4A 1RDZA 1KZ8A 1NV2A 3IFAA 4I40A 2QVVA 4GWSA 4H46A 1FPIA 1FBHA 2FHYA 4I3YA 1IMFA 1DCUA 1FSAA 4PTKA 1FBCA 2GQ1A 3KBZA 1NV6A 5A5LA 3ROJA 1IMBA 1FPKA 1Q9DA 1YZ0A 2OX3A 4AS4A 2PCRA 2HHMA 1NUXA 2Y5LA 1IMEA 1IMAA 1FPEA 4GBWA 4HE1A 1LBXA 2VT5A 1IMCA 2P3NA 4N81A 1VDWA 1YXIA 5LDZA 1FRPA 1K9ZA 2FIEA 2QVUA 5ESYA 1FBGA 1FBPA 3BIGA 5ET8A 1DBZA 1NUWA 2JJKA 5ET6A 2FBPA 1JP4A 1DK4A 5EQAA 3RYDA 1NV0A 1NUYA 3T0JA 5FBPA 1LBWA 4GBVA 2QVRA 5EQ8A 5F24A 1LEVA 1EYJA 1YYZA 1NV3A 1XI6A 4KXPA 5T3JA 2Q8MA 2WBDA 2CZIA 1FBEA 2BJIA 4GWUA 5DW8A 5ET7A 4QXDA 4I3EA 3RPLA 5IZ1A 2OWZA 1FBFA
chains in the Genus database with same CATH superfamily
3ZKKA 3TPAA 1DTGA 1G0IA 4LP2B 3R6UA 1HSLA 5I3SA 3LUZA 2OZZA 1L5TA 4P1EA 2OJTA 4P11A 3C35A 5HBCA 3UN6A 4QFKA 1FBDA 3S2VA 5AA2D 2HQ0A 3T93B 4OENA 1FTOA 3FBPA 1Y3NA 1NL5A 2X7QA 3OXNA 4PDDA 3SKPA 4GWXA 2HAVA 4P56A 4HTGA 3N26A 2F3DA 5JEIA 4MHFA 1MDQA 1FTAA 2ZZWA 1G0HA 3KSXA 2QVVA 4GWSA 3C9HA 1Q1KA 3E3KA 2ZYNA 5ISUA 3OMBA 2DOJA 1CB6A 3ROJA 1NUXA 5AA1A 5EHMA 2ZZXA 5H8SA 4O8MA 4OA4A 4O3AA 3IOVA 2DWJA 1JP4A 3BBRA 4PGPA 1NUYA 1WVJA 2D21A 3PU5A 3CRBA 5H8QA 1USYE 3FIRA 3SDFA 2HCAA 2DQVA 1N84A 2VP1A 3OOAA 1IXCA 5M2VA 3TTLA 1VE4A 3MPLA 5IZ1A 2HXWA 4QSDA 3Q28A 4MJOA 3MPKA 2Z8EA 5CBRA 2PVUA 1I69A 4G4PA 1FPGA 4IR8A 4OEUA 4LZ8A 4ZEBA 4XTCQ 5I57B 3SERA 4KR5A 1MXYA 3H3GA 4FEBA 2B3FA 2XX9A 1P1OA 4HS7A 3CFLA 1EYIA 2XXPA 4G68B 4NF8A 1S50A 2Q2AA 1QGXA 1MQGA 2XX8A 2UVGA 3EN3A 4FATA 1N3XA 1B9JA 4M4GA 3TKDA 3VVEA 3PV0E 1LB9A 1ZMGA 5L8DA 1B0HA 2I4CA 3LSXA 1M5EA 3SEVA 1SDXA 1FSAA 1ZU0A 3OEMA 1LAXA 3KGCA 2H5YA 1B7ZA 1JEVA 4HE1A 1FPEA 1SYIA 3QYTA 5I2KB 4QSCA 1SQYA 4LQ5A 5AA2B 3K1PA 1DPEA 3CIJA 3G3KA 3PGFA 3KOTA 5I59A 1VFDA 4ZEKA 1YTVA 4YKPA 2PFYA 2F35A 5F24A 2Y7IA 1YYZA 1B6HA 1URDA 3O6IA 2BJIA 1ZKBA 4MNPA 1MXWA 1ZTYA 4JBZA 1SI1A 1P1QA 2F8DA 3MP6A 2DP8A 4FIMA 1NNKA 4P8BA 2DVCA 3QXMA 1OLCA 4GWWA 5AA3A 3KFMA 2PT2A 1UTHB 1FPDA 2BJJX 3CFZA 1D9VA 3RPLB 1OVBA 2GHAA 1QULA 2VPNA 1I6BA 1LAHE 2QMWA 4N07A 3EPEA 1NNTA 3Q29A 3QMFA 1B5JA 2QMXA 4MLVA 3IB1A 2Q74A 5L9MA 1LBCA 4PBQA 1MPCA 3AXFA 3RTWB 3IFAA 4U1ZA 1H43A 2CEXA 2DVZA 4JVCA 2XXWA 3MZ1A 4I3YA 2X26A 2MKZA 3KBZA 1J1NA 5I84A 2PT1A 1EZPA 2RC7A 5KZTA 4FECA 1MY3A 4F29A 5CI5A 5LDZA 4ZZEA 4OFOA 1FQAA 1DMBA 4HCYA 4NEDA 4R6KA 1MQDA 4RXLA 3W9VA 4OVTA 2ABHA 1LCTA 4JWXA 2AL5A 4PDHA 5KDTB 3H7MA 3EKIA 1MXVA 2Y7KA 3EHTA 4RK9A 2I0CA 5T3JA 3M3KA 3PMWA 4NTLA 2G93A 3EF7A 4H5GA 4AB6A 1M5FA 4ZE9A 4OXVA 4OTEA 4XKPA 1NV5A 1Y4CA 2ONSA 2VOZA 1MM7A 4GRKA 4YB7A 4ND9A 2H4IA 2XXTA 4AQ4A 3IOUA 3UIFA 4ELQA 5I2NA 5LOMA 4H5FA 1TFDA 1D3KA 4NGUA 3MJNA 1Y9UA 3RTFB 4OEVA 4H0WA 1IMDA 3A29A 2R8TA 5TPAB 4FJPA 3ZKLA 1LGBC 3LR1A 2HZLA 1ZIUA 4MMPA 1DPPA 1N76A 4LZ5A 3U65A 4GLIA 3RGYA 3I3VA 5TPAA 4F3SA 4Q30B 1FPLA 2QL3A 3B6TA 3IAZA 4QF9A 4DDDA 3GLBA 2ANJA 3B6WA 1PBQA 3KN8A 1MRPA 1NH8A 2ZNSA 3IO4A 1B1XA 4OVQA 1FBCA 4KFQA 2XXXA 5JTYB 1MXZA 4R6YA 1DSNA 1PB8A 3VXCA 1FRPA 3PUXE 3CVGA 3DP4A 1BTJA 5ELVA 4X9TA 4WXJA 1MXXA 3A3UA 3VLWA 5HM4B 4LONB 3VDFA 4K3FA 1FQBA 4X1DA 1FQEA 1FTLA 4G68A 1Z7ME 5FTIA 3RPLA 4OFJA 4PF8A 5FHNA 3OO6A 3CFXA 4U2RA 4PCDA 1FPJA 3PPRA 1PBPA 1P1NA 4IO3A 5CM6A 3E78A 3UP9A 3QUFA 1N0TA 4LA9A 2XWVA 1FPFA 3MYUA 1NV7A 1EU8A 3TCHA 3UA8A 2YJPA 2FVZA 4F3BA 1KA0A 2ZMBA 5I56B 1MQHA 2A5SA 2DS9A 2UYFA 3T9VA 1O63A 1SI0A 3FXUA 1SW2A 2XXHA 2F7CA 4DI4B 1SYHA 4NAPA 4BDOA 2X7PA 3FUZA 4F3PA 5EYFA 5ICQA 1P1UA 5A5XA 2Z8FA 2LAOA 4YKIA 4F2QA 2QFLA 2P1SA 3LV0A 2V4CA 4H8IA 4N6DA 3FVGA 1UTHA 4JWYA 3PUZE 3TTMA 4MLQA 1FQCA 1RDZA 4OANA 1FBHA 1XC1A 3TTRA 5TP9A 3QK6A 5I2NB 4Z7EA 2WX9A 2I48A 2R6GE 2OWSA 2XXRA 4BDRA 1IMEA 4GBWA 3T9HB 3TQLA 3VLVA 3CI8A 3T9UA 1US5A 3H6WA 3T0JA 1LBWA 4GBVA 4EQ7A 4OFLA 2B65A 2DWHA 4FEDA 3BKIB 3ILTB 3N5LA 2NWJA 5JK4A 3QIMA 4JDFA 2D3IA 1TXFA 4NF0A 3C31A 1MPBA 1P1WA 1GGGA 4DXUA 3K1MA 4XFEA 3WAEA 4AS5A 2I3VA 3V8XB 2F7AA 3H03A 3IFCA 5EYGA 1B46A 4LQ2A 5DEXB 3D1RA 3CSGA 3G3FA 4MX6A 2P3VA 4OVRA 4N6PA 1POTA 1TFAA 3MVXA 1HSEA 1B5IA 2B4MA 5I56A 2XXQA 4XXUA 4FBPA 2XXYA 3KC0A 4PP0A 1SBPA 2V25A 1GV8A 1FCKA 3C36A 2IEEA 4ELPA 4GVOA 3FXRA 3KG2A 5KDTA 4FORA 4NX1A 1R6ZA 3IB0A 3B8BA 1B3FA 3MBPA 3K00A 5DTBA 2OPEA 1LFGA 1A99A 1BLFA 4NE4A 4OWDA 1IMFA 4R9FA 5ICTA 2KQZA 4NWCA 1FPKA 1YZ0A 4Q8RA 2OX3A 1LB8A 1GTKA 1B2HA 3B7DA 4G8NA 3FXQA 2Q9TA 2P2AA 2PMSA 5H8FA 3K2DA 5FHMA 3MZ9A 1VSOA 1JVYA 3RT8A 4F3GA 1NV0A 4H8JA 2Z23A 4OERA 3S4UA 3TCFA 4N17A 3E13X 3RNNA 4IO4A 3PMXA 3LSWA 3QUJA 4MEVA 2HFBA 4XEQA 4DCYA 3KN3A 4R9GA 2ESNA 5I7IA 2QRYA 3W15C 4R2FA 4ZEFA 5IGAA 4R2BA 1LBZA 3PPOA 3C32A 3G3GA 4U23A 4OZ9A 4NF5B 3DLNA 1ATGA 4YZZA 4PE3A 5I57A 4QFNA 3OO8A 4ZEDA 3GXAA 1EZ9A 3MWBA 1ZBMA 2H25A 1B3LA 4GFRA 4N4UA 4G61A 4C1TA 1UTBB 4KI0E 1YPNA 5K2XA 1LLSA 3B50A 3RQTA 2E1SA 4JSDA 3TFLA 1MY2A 4X8RA 1B0LA 3IX1A 1OQHA 4LZ7A 1JVXA 4DI3D 3TELA 2NXOA 2I0BA 1MDP1 3T9XB 3PTYA 5ITOA 4TQUQ 2F5XA 3OEKA 3U93A 4Q5TA 4TLLB 4IY5A 1NMUA 3LC8A 5J1DA 3FZVA 4P1LA 4U22A 4H1XA 4I1DA 3BIGA 2I58A 3USDA 4POWA 2DE2A 2JJKA 5AA4B 4GL8A 4ZECA 1OQGA 1MQIA 2ALUA 1XI6A 4RPNA 4QFPA 2Q88A 3MSTA 3FD3A 1N04A 3HO7A 5DW8A 5ET7A 4IO7A 3A3CA 2RINA 1AOVA 3K0VA 3SEYA 2DSFA 4X48A 5DVJA 3R7XA 1AWBA 5IKBA 1B40A 4DCXA 4C0RA 3L6GA 4OHNA 4RPOA 2WEFA 3RPWA 5FTHA 4OESA 1Z7NE 1NNPA 5IZ3A 1SPIA 1LBYA 3K6XA 2PFZA 2Z22A 3M3FA 4R73A 4BDMA 3T66A 3U1OA 1UIUA 4XKNA 1R1NA 2V84A 4MH5A 4XIGQ 3H6VA 4MF3A 4JSOA 4R6HA 1RDYA 2XX7A 3HCQA 1FJ9A 2Y5KA 4PAFA 1ELJA 2V93A 5EYHA 4LUBA 4QSEA 5H8QB 3LBSA 4PFTA 1B05A 1Y20A 2Y84A 3A09A 3JZJA 3PPNA 3JV9A 1NI9A 3VXBA 3GBAA 1JNFA 3H6TA 5KCJB 3V83A 4PFRA 4RY1A 5CRYA 2QS1A 4NF8B 4O3CA 2VT5A 1IMCA 2Y7PA 1QVSA 5ESYA 2AYSA 4RYAA 1B3HA 3IO6A 5TU0A 5F7VA 5JTYA 4TLMB 2ZXTA 3RYDA 4DXCA 5FBPA 1Y3QA 3BFTA 1MY1A 1MXUA 3T96B 1LEVA 1A55A 5B7DA 1URSA 1DTZA 2Q8MA 3IORA 2HXRA 4GWUA 2F34A 3U72A 3Q25A 4PC9A 3THIA 1LCFA 5I2KA 4DLDA 2XWIA 2OK2A 1EYKA 4MAGA 4I62A 2RF1A 5EHSA 2QSXA 2YLNA 4PETA 4YB5A 1S7YA 3PPPA 3NOHA 3HFUA 4IGTA 4IO2A 1QKAA 3RT6B 4OVJA 5K2YA 4GWOA 4XF5A 1UQWA 4O7MA 4ELOA 1INPA 2DDKA 2KR0A 4RA1A 1TT1A 1D9QA 1B52A 4PAIA 3FATA 1FPBA 5IM2A 5IZ3B 3ECRA 3GBBA 3IK6B 4WKMA 3PPQA 5EQ7A 5CMMA 1IUDA 2CZLA 2HEUA 4EDPA 2YPNA 4ESXA 2O6AA 3R26A 4M1VA 5I5PA 4NN3A 1NUZA 2FA7A 1LBVA 4F31B 2OWTA 3O29A 1XS5A 1IQ7A 3M8UA 1DCUA 4OETA 1IMBA 3V5AA 3FV2A 1USYH 5KCJA 2O51A 4BDNA 1Y1ZA 4F22A 3TUSA 4MFIA 3VV5A 1P99A 1H3DA 2A5TB 1IXGA 1DK4A 4NF6A 1PDAA 1OLAA 2I4BA 4ZZAA 1FW0A 2H9BA 4OYVA 4PFBA 2RCBA 3HPIA 2B3BA 4HW8A 1XVXA 2Q8JA 4NF4B 4F1VA 4I3EA 3W9WA 2CEYA 3EHSA 4MNCA 5DEXA 3H6UA 1A8EA 3Q26A 4BLAA 4GWZA 4IO6A 4U4XA 2F3BA 3VE1B 2XD2A 4P0IA 1XHYA 2UYEA 3O6GA 1FJ6A 3IJXB 2NUVA 2REJA 1Y1MA 3M3LA 5DYHA 5F1QA 4KPTA 3UORA 2R9JA 3OD7A 5L9OA 3C4MA 1CNQA 4ZS9A 4AB5A 1TWYA 4NMYA 1M5BA 1O64A 2OLBA 4P3LA 3MVYA 3FJ7A 3C33A 5CMBA 3BIHA 4PQJA 1BK4A 4PAKA 4PFYA 4I40A 4YB6A 1D4NA 4I8CA 3ISPA 5I59B 1LSTA 2KLFA 1Q9DA 1SW5A 3K6UA 3E79A 2Y5LA 3HHFA 4KYSA 4RK2A 2UVIA 1B32A 2DE4A 2UXAA 4O94A 4ZE8A 2I3WA 5I58B 1YCJA 3FASA 5ITPA 2XHDA 4KQPA 2DXRA 2D5WA 1Y3PA 4U4SA 1MH3A 3FJMA 1EZOA 1LFIA 4G2ZA 4JVIA 2CZIA 2THIA 3CHGA 4DIGA 3TDJA 4OVPA 1FQDA 3IL1B 3G3IA 4EQ9A 4O7IA 5H8HA 2OCUA 2O1MA 3I5OA 1H44A 3IJOB 3N6TA 5L9SA 2O7UA 1JETA 2Y7RA 4PFUA 2RCAA 3SEWA 3KOSA 1US4A 5H8HB 4HXVA 1BP5A 2F6PA 3O97A 4P9KA 1B7HA 3KBRA 4PFWA 2I49A 2OPDA 4GXSB 5EQ9A 3H06B 3N6UA 2CMOA 1VFEA 1NFTA 3ZS6A 3S9EA 4THIA 1K9YA 3KC1A 4Z0IA 4N13A 5J16A 2Z8DA 1A40A 4JWOA 2RC9A 4QHQA 4NWDA 4PTKA 4F2OA 2PCRA 1IMAA 1YXIA 3SEUA 4H6DA 4IB2A 3K4UA 2H99A 4H65A 4EF2A 2QVRA 3RY3A 3MQ9A 2UVHA 1NV3A 1RKMA 3MUQA 2VPOA 1FBEA 3VVDA 4ZDMA 2R71A 4YKJA 5AA4A 4QXDA 1ZJLA 4JXIA 3LUYA 1B51A 1N7WA 2XWOA 1NH7A 3V89B 1NV1A 3KSJA 3G3HA 4GQOA 1Y4TA 1QJMA 4KYDA 4PF6A 2DYXA 4G8MA 5CBSA 2F7BA 1QUIA 3I6VA 4OMBA 2QS3A 1R9QA 3FGSA 2HZKA 2VD2A 3VFJA 2WBBA 4PBHA 1LAFE 2W7YA 4MNIA 1VR5A 5A5XB 4RNSA 1D9YA 4N91A 1ZLQA 2XXUA 4KD5A 1RDXA 1BIYA 2VHAA 3OENA 3S9NC 3FVKA 3SETA 4XKRA 4NF6B 1UTBA 5H8FB 1N3WA 2V3UA 3CG3A 3DM0A 4MBPA 5TP9B 4H46A 3DP6A 3TTKA 1B4ZA 2XXKA 2GQ1A 4F19A 2PYYA 2QS2A 4TOZA 1B7UA 1OIBA 3IB2A 3O2AA 3CG1A 3ILUB 2V3TA 1IEJA 2M8CA 3DELB 3ZSFA 1A54A 4H67A 4X04A 4G77A 5FHOA 1AIVA 3PUVE 1QKBA 4C1UA 2QPQA 1JW1A 3WAFA 1YAEA 3E9XA 4N8GA 3EHUA 5DT6A 1EYJA 2NOOA 4P0GA 1RYXA 4FAJA 4NF4A 2OBGA 2WYKA 4F39A 2PX1A 2Q2CA 2PBWA 1II5A 4UACA 1IXIA 2REGA 3KEIA 2DWAA 3S9LC 4HE2A 2WKYA 3TQWA 3FV1A 2HPGA 3IOWA 5I58A 3FVNA 4F1UA 4NG7A 4GXAA 3TMGA 2H98A 2AL4A 2F36A 4ZEIA 4GL0A 1BKAA 1M5DA 4HE0A 1JQFA 4WEPA 3FJGA 2IA4A 3BFUA 3HV1A 3D4CA 4LN5A 1KA1A 3MAMA 1GVCA 4YAHX 1H45A 2GFEA 1B3GA 1GR2A 3F11A 2FIXA 3U8QA 4G68C 4ONYA 3UK4A 4NF5A 4DXBA 2ZNTA 1IIWA 1MQJA 4IY6A 1IZ1A 1KZ8A 1T0KA 2P0SA 4GF8A 4DZ1A 4ISUA 4JVDA 1Q35A 3LSFB 2DWIA 1B58A 1PB7A 3QSLA 1B1HA 5AA2A 2GHBA 2P3NA 3MVWA 2FIEA 1NUWA 5ET6A 3ODBA 3TODA 1A8FA 4LATA 5CC2A 3L6HA 3JYRA 2WYPA 5CMCA 3MP8A 4G8HA 1XVYA 3IOTA 2I6EA 4N6KA 4U21A 4EXKA 1H76A 2RKMA 3B6QA 1AL3A 3TCGA 2XXVA 2AIXA 1LFHA 4QFOA 5IZZA 3KZGA 3D4GA 3CSBA 3SZPA 3SESA 4XKQA 3MZBA 4BDLA 2F97A 1URGA 2HAUA 4BDQA 1RYOA 2VGQA 2V3QA 3N94A 4PE5B 1PC3A 5CMKA 1FTMA 2ZYOA 4KYEA 4GX6A 3VLUA 2O69A 2G29A 3IR1A 4UA8A 3KJ7A 3E4RA 2XA5A 1B3EA 2FYIA 3H4ZA 4N8YA 1JEUA 2ZZVA 1MH4A 1PEBA 4ESWA 2ONKE 1NNFA 3G7WA 1JW4A 3G3JA 1QW0A 4H45A 1R9LA 3FXBA 2GRVA 4KCCA 3KN7A 1MPDA 3ONMA 1FPIA 2ZYKA 2FHYA 1POY1 3OO9A 2O84X 3MP1A 5DVIA 1EH3A 1AMFA 4YMBA 4MIJA 1VDWA 4EXLA 1S9TA 1FBGA 1FBPA 4GD5A 4E0XA 1OVTA 2FBPA 4ELRA 5EQAA 4NHBA 4QRZA 3TTNA 5H8NB 2FNCA 1FQFA 2VD3A 1MY0A 3K6WA 4R75A 3HHGA 4JB7A 2GH9A 4YICA 2O1LA 5DVFA 3RUMA 1SD3A 5ET5A 1I6AA 4GIZA 2L5VA 4PGNA 1I6QA 4KCDA 4UABA 3U94A 1KWHA 4GX3A 3O9PA 1SW1A 3CR9A 2CZKA 2XD3A 4ECFA 1QUJA 4RJZA 4I9DA 4F1YA 2XXIA 3T22A 5IAIA 3K02A 2O7IA 4OQOA 4FE8A 1PB9A 2DXYA 1NV4A 4GWYA 1MY4A 4X1BA 1CE2A 2CZHA 3PMVA 2ZNUA 3QAXA 1DOTA 3TAJA 3LSLA 4N15A 1F9BA 1FTJA 1MM6A 2Y7WA 3O28A 4GX4A 3HN0A 1NV2A 4F18A 4NQ8A 2F6GA 3RLFE 3OSQA 4WEDA 1NV6A 4DE8A 2ZYMA 4HCWA 4AS4A 2HHMA 1M5CA 3OELA 4EUOA 1ANFA 3TZAA 4O3BA 3O66A 1XOCA 1K9ZA 2XWKA 1B5HA 5ET8A 3SEXA 4YU0A 4EF1A 3S9MC 1O7TA 3P7IA 1AH5A 4Q0CA 2ONRA 4P47A 3PD8A 1SVXB 3TEPA 1JW5A 4KXPA 1IXHA 3EQ1A 3RN8A 3GYYA 3K6VA 1SW4A 3PUWE 4R74A 2OWZA 1FBFA 4YKKA 3K1NA 4E0WA 2F78A 2A5TA 3Q27A 3VVFA 2O68A 3KJTA 3MVZA 5BUUA 3HSTA 4GOTA 1XT8A 5LTCA 5H8NA 4PFIA 4EQBA 3UGWA 1WDNA 1FTKA 1IITA 1OMPA 1N7XA 5B70A 2QS4A 3PD9A 4U1OA 2E0SA 2NVUB 3TYHA 5BWJA 3MW0A 2Q89A 4MCOA 3PUYE 1LBBA 4QFLA 5HPQA 1MS7A 4L17A 3OSRA 4QBAA 1MG1A 5A5LA 1LAGE 3GZGA 4LVQA 3O6HA 1LBXA 4N81A 1WODA 2QVUA 1UIVA 2B4LA 2QJEA 4IO5A 4YMAA 1DBZA 1NKXA 5AE4A 3K01A 1HSJA 5EQ8A 2DE3A 1B4HA 3DP8A 3MC2A 3FVOA 2WBDA 1A7LA 3OO7A 4R72A 4IGRA 3C34A 4OVSA 4KHZE 2RC8A 1QUKA 4POXA 2UVJA 3U92A 3T1BA
chains in the Genus database with same CATH topology
3W9WA 2CEYA 2XWIA 4MNCA 5IZZA 4P8BA 1NV5A 4HE2A 4PCDA 1FPJA 5I7IA 2XWOA 1EYKA 4MAGA 5ET5A 2HPGA 4O7IA 4MJOA 4F1UA 3SZPA 4GWZA 4XFEA 1G0IA 4NG7A 2L5VA 4OVQA 4PETA 1NV1A 2F3BA 5CM6A 4PGNA 5I3SA 3E78A 5IGAA 1AWBA 4UABA 1LBZA 2V3QA 3LUZA 3NOHA 4PF8A 4GWWA 3HFUA 1FPGA 1FPFA 4GX3A 4IR8A 4AS5A 2XWVA 3MYUA 4P1EA 4PFIA 4PF6A 1NV7A 3IFCA 2CZKA 5EYGA 2WEFA 4HE0A 1FJ6A 4XF5A 4GX6A 2FVZA 3D1RA 4O7MA 4YZZA 4MX6A 1KA0A 1FBDA 4PE3A 1INPA 1FPDA 2DDKA 5IZ3A 2KR0A 1SPIA 1LBYA 2P3VA 4NGUA 4OVRA 4HXVA 2PFZA 4OVPA 1D9QA 2HZKA 4LN5A 4PAIA 1IMDA 1KA1A 2WBBA 3A29A 3RPLB 4PBHA 1FPBA 1NV4A 5IZ3B 2B4MA 5IM2A 4P9KA 4DI4B 2R8TA 4GWYA 4NAPA 4MNIA 1EYIA 3FBPA 4G61A 2XA5A 4FBPA 4N4UA 2VPNA 3KC0A 2CZHA 4N91A 4F19A 1RDYA 2HZLA 1CNQA 5EQ7A 4N8YA 1FJ9A 2Y5KA 5EQ9A 4PAFA 1RDXA 2ZZVA 4PDDA 3B50A 4GWXA 4MMPA 1QGXA 4P56A 2FIXA 5EYHA 2F3DA 3QMFA 4MHFA 2QFLA 3U65A 4M1VA 3LV0A 4N15A 5I5PA 1K9YA 4NN3A 1NUZA 2V4CA 3KC1A 4P3LA 4X8RA 1FTAA 4NX1A 1LBVA 3T1BA 4H45A 2ZZWA 4N6DA 1FPLA 2Q74A 4GX4A 3FXBA 1G0HA 4MCOA 3B8BA 5J16A 3BIHA 4PBQA 1NI9A 4DI3D 1BK4A 1RDZA 1KZ8A 1NV2A 4PAKA 4OANA 3IFAA 2DVZA 4F18A 2CEXA 4I40A 3PTYA 2QVVA 4GWSA 4H46A 4JVCA 4NQ8A 1FPIA 1FBHA 2FHYA 4I3YA 1IMFA 1DCUA 1FSAA 2F5XA 2WX9A 4PTKA 1FBCA 2GQ1A 3KBZA 2MKZA 2XXKA 3ISPA 2KQZA 4JVDA 1NV6A 4PFRA 4QBAA 5A5LA 5LTCA 3ROJA 1IMBA 1FPKA 1Q9DA 1YZ0A 2OX3A 4AS4A 2PCRA 4HCWA 2HHMA 1NUXA 5J1DA 3E79A 2Y5LA 1IMEA 4P1LA 1IMAA 1FPEA 4GBWA 4HE1A 1LBXA 2VT5A 4MIJA 1IMCA 2P3NA 4N81A 1VDWA 2Q9TA 1YXIA 5LDZA 2DE4A 2ZZXA 1FRPA 1K9ZA 2FIEA 2QVUA 5ESYA 1FBGA 1FBPA 3BIGA 5ET8A 2B4LA 2XWKA 4HCYA 4O94A 4O8MA 4OA4A 1DBZA 1NUWA 2JJKA 5ET6A 2FBPA 2DE2A 1JP4A 1DK4A 5EQAA 2QPQA 4X9TA 3W9VA 3RYDA 4NHBA 4OVTA 4PGPA 1NV0A 1NUYA 3T0JA 4P47A 5FBPA 1LBWA 4GBVA 2PFYA 4N8GA 4PDHA 2QVRA 5EQ8A 2DE3A 4PFBA 3EKIA 5F24A 1LEVA 1EYJA 1YYZA 1NV3A 1XI6A 2WYPA 4KXPA 5T3JA 4N17A 4X04A 2VPOA 2Q8MA 2WYKA 3MSTA 4JVIA 5JK4A 2WBDA 2CZIA 2HXRA 1FBEA 2BJIA 4N6KA 4GWUA 4OVSA 4PC9A 3GYYA 4F1VA 5DW8A 4MNPA 5ET7A 4YICA 4QXDA 3CHGA 4MEVA 4I3EA 3RPLA 4NF0A 4XEQA 5IZ1A 2OWZA 1FBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV5 A;  4HE2 A;  1FPJ A;  1EYK A;  5ET5 A;  4O7I A;  4MJO A;  4GWZ A;  1G0I A;  1NV1 A;  2F3B A;  5I3S A;  1AWB A;  1LBZ A;  3LUZ A;  4GWW A;  1FPG A;  1FPF A;  4GX3 A;  4IR8 A;  4AS5 A;  1NV7 A;  3IFC A;  2CZK A;  5EYG A;  2WEF A;  4HE0 A;  1FJ6 A;  4GX6 A;  2FVZ A;  3D1R A;  1KA0 A;  1FBD A;  1INP A;  1FPD A;  2DDK A;  5IZ3 A;  1SPI A;  1LBY A;  2P3V A;  4HXV A;  1D9Q A;  1IMD A;  1KA1 A;  2WBB A;  3A29 A;  3RPL B;  1FPB A;  1NV4 A;  5IZ3 B;  2R8T A;  4GWY A;  1EYI A;  3FBP A;  4G61 A;  4FBP A;  3KC0 A;  2CZH A;  1RDY A;  1CNQ A;  5EQ7 A;  1FJ9 A;  2Y5K A;  5EQ9 A;  1RDX A;  4GWX A;  1QGX A;  2FIX A;  5EYH A;  2F3D A;  3QMF A;  2QFL A;  3LV0 A;  1K9Y A;  1NUZ A;  3KC1 A;  1FTA A;  1LBV A;  4H45 A;  1FPL A;  2Q74 A;  4GX4 A;  1G0H A;  3B8B A;  5J16 A;  3BIH A;  1NI9 A;  1BK4 A;  1RDZ A;  1KZ8 A;  1NV2 A;  3IFA A;  4I40 A;  2QVV A;  4GWS A;  4H46 A;  1FPI A;  1FBH A;  2FHY A;  4I3Y A;  1IMF A;  1DCU A;  1FSA A;  4PTK A;  1FBC A;  2GQ1 A;  3KBZ A;  1NV6 A;  5A5L A;  3ROJ A;  1IMB A;  1FPK A;  1Q9D A;  1YZ0 A;  2OX3 A;  4AS4 A;  2PCR A;  2HHM A;  1NUX A;  2Y5L A;  1IME A;  1IMA A;  1FPE A;  4GBW A;  4HE1 A;  1LBX A;  2VT5 A;  1IMC A;  2P3N A;  4N81 A;  1VDW A;  1YXI A;  5LDZ A;  1FRP A;  1K9Z A;  2FIE A;  2QVU A;  5ESY A;  1FBG A;  1FBP A;  3BIG A;  5ET8 A;  1DBZ A;  1NUW A;  2JJK A;  5ET6 A;  2FBP A;  1JP4 A;  1DK4 A;  5EQA A;  3RYD A;  1NV0 A;  1NUY A;  3T0J A;  5FBP A;  1LBW A;  4GBV A;  2QVR A;  5EQ8 A;  5F24 A;  1LEV A;  1EYJ A;  1YYZ A;  1NV3 A;  1XI6 A;  4KXP A;  5T3J A;  2Q8M A;  2WBD A;  2CZI A;  1FBE A;  2BJI A;  4GWU A;  5DW8 A;  5ET7 A;  4QXD A;  4I3E A;  3RPL A;  5IZ1 A;  2OWZ A;  1FBF A; 
#chains in the Genus database with same CATH topology
 3ZKK A;  3TPA A;  1DTG A;  1G0I A;  4LP2 B;  3R6U A;  1HSL A;  5I3S A;  3LUZ A;  2OZZ A;  1L5T A;  4P1E A;  2OJT A;  4P11 A;  3C35 A;  5HBC A;  3UN6 A;  4QFK A;  1FBD A;  3S2V A;  5AA2 D;  2HQ0 A;  3T93 B;  4OEN A;  1FTO A;  3FBP A;  1Y3N A;  1NL5 A;  2X7Q A;  3OXN A;  4PDD A;  3SKP A;  4GWX A;  2HAV A;  4P56 A;  4HTG A;  3N26 A;  2F3D A;  5JEI A;  4MHF A;  1MDQ A;  1FTA A;  2ZZW A;  1G0H A;  3KSX A;  2QVV A;  4GWS A;  3C9H A;  1Q1K A;  3E3K A;  2ZYN A;  5ISU A;  3OMB A;  2DOJ A;  1CB6 A;  3ROJ A;  1NUX A;  5AA1 A;  5EHM A;  2ZZX A;  5H8S A;  4O8M A;  4OA4 A;  4O3A A;  3IOV A;  2DWJ A;  1JP4 A;  3BBR A;  4PGP A;  1NUY A;  1WVJ A;  2D21 A;  3PU5 A;  3CRB A;  5H8Q A;  1USY E;  3FIR A;  3SDF A;  2HCA A;  2DQV A;  1N84 A;  2VP1 A;  3OOA A;  1IXC A;  5M2V A;  3TTL A;  1VE4 A;  3MPL A;  5IZ1 A;  2HXW A;  4QSD A;  3Q28 A;  4MJO A;  3MPK A;  2Z8E A;  5CBR A;  2PVU A;  1I69 A;  4G4P A;  1FPG A;  4IR8 A;  4OEU A;  4LZ8 A;  4ZEB A;  4XTC Q;  5I57 B;  3SER A;  4KR5 A;  1MXY A;  3H3G A;  4FEB A;  2B3F A;  2XX9 A;  1P1O A;  4HS7 A;  3CFL A;  1EYI A;  2XXP A;  4G68 B;  4NF8 A;  1S50 A;  2Q2A A;  1QGX A;  1MQG A;  2XX8 A;  2UVG A;  3EN3 A;  4FAT A;  1N3X A;  1B9J A;  4M4G A;  3TKD A;  3VVE A;  3PV0 E;  1LB9 A;  1ZMG A;  5L8D A;  1B0H A;  2I4C A;  3LSX A;  1M5E A;  3SEV A;  1SDX A;  1FSA A;  1ZU0 A;  3OEM A;  1LAX A;  3KGC A;  2H5Y A;  1B7Z A;  1JEV A;  4HE1 A;  1FPE A;  1SYI A;  3QYT A;  5I2K B;  4QSC A;  1SQY A;  4LQ5 A;  5AA2 B;  3K1P A;  1DPE A;  3CIJ A;  3G3K A;  3PGF A;  3KOT A;  5I59 A;  1VFD A;  4ZEK A;  1YTV A;  4YKP A;  2PFY A;  2F35 A;  5F24 A;  2Y7I A;  1YYZ A;  1B6H A;  1URD A;  3O6I A;  2BJI A;  1ZKB A;  4MNP A;  1MXW A;  1ZTY A;  4JBZ A;  1SI1 A;  1P1Q A;  2F8D A;  3MP6 A;  2DP8 A;  4FIM A;  1NNK A;  4P8B A;  2DVC A;  3QXM A;  1OLC A;  4GWW A;  5AA3 A;  3KFM A;  2PT2 A;  1UTH B;  1FPD A;  2BJJ X;  3CFZ A;  1D9V A;  3RPL B;  1OVB A;  2GHA A;  1QUL A;  2VPN A;  1I6B A;  1LAH E;  2QMW A;  4N07 A;  3EPE A;  1NNT A;  3Q29 A;  3QMF A;  1B5J A;  2QMX A;  4MLV A;  3IB1 A;  2Q74 A;  5L9M A;  1LBC A;  4PBQ A;  1MPC A;  3AXF A;  3RTW B;  3IFA A;  4U1Z A;  1H43 A;  2CEX A;  2DVZ A;  4JVC A;  2XXW A;  3MZ1 A;  4I3Y A;  2X26 A;  2MKZ A;  3KBZ A;  1J1N A;  5I84 A;  2PT1 A;  1EZP A;  2RC7 A;  5KZT A;  4FEC A;  1MY3 A;  4F29 A;  5CI5 A;  5LDZ A;  4ZZE A;  4OFO A;  1FQA A;  1DMB A;  4HCY A;  4NED A;  4R6K A;  1MQD A;  4RXL A;  3W9V A;  4OVT A;  2ABH A;  1LCT A;  4JWX A;  2AL5 A;  4PDH A;  5KDT B;  3H7M A;  3EKI A;  1MXV A;  2Y7K A;  3EHT A;  4RK9 A;  2I0C A;  5T3J A;  3M3K A;  3PMW A;  4NTL A;  2G93 A;  3EF7 A;  4H5G A;  4AB6 A;  1M5F A;  4ZE9 A;  4OXV A;  4OTE A;  4XKP A;  1NV5 A;  1Y4C A;  2ONS A;  2VOZ A;  1MM7 A;  4GRK A;  4YB7 A;  4ND9 A;  2H4I A;  2XXT A;  4AQ4 A;  3IOU A;  3UIF A;  4ELQ A;  5I2N A;  5LOM A;  4H5F A;  1TFD A;  1D3K A;  4NGU A;  3MJN A;  1Y9U A;  3RTF B;  4OEV A;  4H0W A;  1IMD A;  3A29 A;  2R8T A;  5TPA B;  4FJP A;  3ZKL A;  1LGB C;  3LR1 A;  2HZL A;  1ZIU A;  4MMP A;  1DPP A;  1N76 A;  4LZ5 A;  3U65 A;  4GLI A;  3RGY A;  3I3V A;  5TPA A;  4F3S A;  4Q30 B;  1FPL A;  2QL3 A;  3B6T A;  3IAZ A;  4QF9 A;  4DDD A;  3GLB A;  2ANJ A;  3B6W A;  1PBQ A;  3KN8 A;  1MRP A;  1NH8 A;  2ZNS A;  3IO4 A;  1B1X A;  4OVQ A;  1FBC A;  4KFQ A;  2XXX A;  5JTY B;  1MXZ A;  4R6Y A;  1DSN A;  1PB8 A;  3VXC A;  1FRP A;  3PUX E;  3CVG A;  3DP4 A;  1BTJ A;  5ELV A;  4X9T A;  4WXJ A;  1MXX A;  3A3U A;  3VLW A;  5HM4 B;  4LON B;  3VDF A;  4K3F A;  1FQB A;  4X1D A;  1FQE A;  1FTL A;  4G68 A;  1Z7M E;  5FTI A;  3RPL A;  4OFJ A;  4PF8 A;  5FHN A;  3OO6 A;  3CFX A;  4U2R A;  4PCD A;  1FPJ A;  3PPR A;  1PBP A;  1P1N A;  4IO3 A;  5CM6 A;  3E78 A;  3UP9 A;  3QUF A;  1N0T A;  4LA9 A;  2XWV A;  1FPF A;  3MYU A;  1NV7 A;  1EU8 A;  3TCH A;  3UA8 A;  2YJP A;  2FVZ A;  4F3B A;  1KA0 A;  2ZMB A;  5I56 B;  1MQH A;  2A5S A;  2DS9 A;  2UYF A;  3T9V A;  1O63 A;  1SI0 A;  3FXU A;  1SW2 A;  2XXH A;  2F7C A;  4DI4 B;  1SYH A;  4NAP A;  4BDO A;  2X7P A;  3FUZ A;  4F3P A;  5EYF A;  5ICQ A;  1P1U A;  5A5X A;  2Z8F A;  2LAO A;  4YKI A;  4F2Q A;  2QFL A;  2P1S A;  3LV0 A;  2V4C A;  4H8I A;  4N6D A;  3FVG A;  1UTH A;  4JWY A;  3PUZ E;  3TTM A;  4MLQ A;  1FQC A;  1RDZ A;  4OAN A;  1FBH A;  1XC1 A;  3TTR A;  5TP9 A;  3QK6 A;  5I2N B;  4Z7E A;  2WX9 A;  2I48 A;  2R6G E;  2OWS A;  2XXR A;  4BDR A;  1IME A;  4GBW A;  3T9H B;  3TQL A;  3VLV A;  3CI8 A;  3T9U A;  1US5 A;  3H6W A;  3T0J A;  1LBW A;  4GBV A;  4EQ7 A;  4OFL A;  2B65 A;  2DWH A;  4FED A;  3BKI B;  3ILT B;  3N5L A;  2NWJ A;  5JK4 A;  3QIM A;  4JDF A;  2D3I A;  1TXF A;  4NF0 A;  3C31 A;  1MPB A;  1P1W A;  1GGG A;  4DXU A;  3K1M A;  4XFE A;  3WAE A;  4AS5 A;  2I3V A;  3V8X B;  2F7A A;  3H03 A;  3IFC A;  5EYG A;  1B46 A;  4LQ2 A;  5DEX B;  3D1R A;  3CSG A;  3G3F A;  4MX6 A;  2P3V A;  4OVR A;  4N6P A;  1POT A;  1TFA A;  3MVX A;  1HSE A;  1B5I A;  2B4M A;  5I56 A;  2XXQ A;  4XXU A;  4FBP A;  2XXY A;  3KC0 A;  4PP0 A;  1SBP A;  2V25 A;  1GV8 A;  1FCK A;  3C36 A;  2IEE A;  4ELP A;  4GVO A;  3FXR A;  3KG2 A;  5KDT A;  4FOR A;  4NX1 A;  1R6Z A;  3IB0 A;  3B8B A;  1B3F A;  3MBP A;  3K00 A;  5DTB A;  2OPE A;  1LFG A;  1A99 A;  1BLF A;  4NE4 A;  4OWD A;  1IMF A;  4R9F A;  5ICT A;  2KQZ A;  4NWC A;  1FPK A;  1YZ0 A;  4Q8R A;  2OX3 A;  1LB8 A;  1GTK A;  1B2H A;  3B7D A;  4G8N A;  3FXQ A;  2Q9T A;  2P2A A;  2PMS A;  5H8F A;  3K2D A;  5FHM A;  3MZ9 A;  1VSO A;  1JVY A;  3RT8 A;  4F3G A;  1NV0 A;  4H8J A;  2Z23 A;  4OER A;  3S4U A;  3TCF A;  4N17 A;  3E13 X;  3RNN A;  4IO4 A;  3PMX A;  3LSW A;  3QUJ A;  4MEV A;  2HFB A;  4XEQ A;  4DCY A;  3KN3 A;  4R9G A;  2ESN A;  5I7I A;  2QRY A;  3W15 C;  4R2F A;  4ZEF A;  5IGA A;  4R2B A;  1LBZ A;  3PPO A;  3C32 A;  3G3G A;  4U23 A;  4OZ9 A;  4NF5 B;  3DLN A;  1ATG A;  4YZZ A;  4PE3 A;  5I57 A;  4QFN A;  3OO8 A;  4ZED A;  3GXA A;  1EZ9 A;  3MWB A;  1ZBM A;  2H25 A;  1B3L A;  4GFR A;  4N4U A;  4G61 A;  4C1T A;  1UTB B;  4KI0 E;  1YPN A;  5K2X A;  1LLS A;  3B50 A;  3RQT A;  2E1S A;  4JSD A;  3TFL A;  1MY2 A;  4X8R A;  1B0L A;  3IX1 A;  1OQH A;  4LZ7 A;  1JVX A;  4DI3 D;  3TEL A;  2NXO A;  2I0B A;  1MDP 1;  3T9X B;  3PTY A;  5ITO A;  4TQU Q;  2F5X A;  3OEK A;  3U93 A;  4Q5T A;  4TLL B;  4IY5 A;  1NMU A;  3LC8 A;  5J1D A;  3FZV A;  4P1L A;  4U22 A;  4H1X A;  4I1D A;  3BIG A;  2I58 A;  3USD A;  4POW A;  2DE2 A;  2JJK A;  5AA4 B;  4GL8 A;  4ZEC A;  1OQG A;  1MQI A;  2ALU A;  1XI6 A;  4RPN A;  4QFP A;  2Q88 A;  3MST A;  3FD3 A;  1N04 A;  3HO7 A;  5DW8 A;  5ET7 A;  4IO7 A;  3A3C A;  2RIN A;  1AOV A;  3K0V A;  3SEY A;  2DSF A;  4X48 A;  5DVJ A;  3R7X A;  1AWB A;  5IKB A;  1B40 A;  4DCX A;  4C0R A;  3L6G A;  4OHN A;  4RPO A;  2WEF A;  3RPW A;  5FTH A;  4OES A;  1Z7N E;  1NNP A;  5IZ3 A;  1SPI A;  1LBY A;  3K6X A;  2PFZ A;  2Z22 A;  3M3F A;  4R73 A;  4BDM A;  3T66 A;  3U1O A;  1UIU A;  4XKN A;  1R1N A;  2V84 A;  4MH5 A;  4XIG Q;  3H6V A;  4MF3 A;  4JSO A;  4R6H A;  1RDY A;  2XX7 A;  3HCQ A;  1FJ9 A;  2Y5K A;  4PAF A;  1ELJ A;  2V93 A;  5EYH A;  4LUB A;  4QSE A;  5H8Q B;  3LBS A;  4PFT A;  1B05 A;  1Y20 A;  2Y84 A;  3A09 A;  3JZJ A;  3PPN A;  3JV9 A;  1NI9 A;  3VXB A;  3GBA A;  1JNF A;  3H6T A;  5KCJ B;  3V83 A;  4PFR A;  4RY1 A;  5CRY A;  2QS1 A;  4NF8 B;  4O3C A;  2VT5 A;  1IMC A;  2Y7P A;  1QVS A;  5ESY A;  2AYS A;  4RYA A;  1B3H A;  3IO6 A;  5TU0 A;  5F7V A;  5JTY A;  4TLM B;  2ZXT A;  3RYD A;  4DXC A;  5FBP A;  1Y3Q A;  3BFT A;  1MY1 A;  1MXU A;  3T96 B;  1LEV A;  1A55 A;  5B7D A;  1URS A;  1DTZ A;  2Q8M A;  3IOR A;  2HXR A;  4GWU A;  2F34 A;  3U72 A;  3Q25 A;  4PC9 A;  3THI A;  1LCF A;  5I2K A;  4DLD A;  2XWI A;  2OK2 A;  1EYK A;  4MAG A;  4I62 A;  2RF1 A;  5EHS A;  2QSX A;  2YLN A;  4PET A;  4YB5 A;  1S7Y A;  3PPP A;  3NOH A;  3HFU A;  4IGT A;  4IO2 A;  1QKA A;  3RT6 B;  4OVJ A;  5K2Y A;  4GWO A;  4XF5 A;  1UQW A;  4O7M A;  4ELO A;  1INP A;  2DDK A;  2KR0 A;  4RA1 A;  1TT1 A;  1D9Q A;  1B52 A;  4PAI A;  3FAT A;  1FPB A;  5IM2 A;  5IZ3 B;  3ECR A;  3GBB A;  3IK6 B;  4WKM A;  3PPQ A;  5EQ7 A;  5CMM A;  1IUD A;  2CZL A;  2HEU A;  4EDP A;  2YPN A;  4ESX A;  2O6A A;  3R26 A;  4M1V A;  5I5P A;  4NN3 A;  1NUZ A;  2FA7 A;  1LBV A;  4F31 B;  2OWT A;  3O29 A;  1XS5 A;  1IQ7 A;  3M8U A;  1DCU A;  4OET A;  1IMB A;  3V5A A;  3FV2 A;  1USY H;  5KCJ A;  2O51 A;  4BDN A;  1Y1Z A;  4F22 A;  3TUS A;  4MFI A;  3VV5 A;  1P99 A;  1H3D A;  2A5T B;  1IXG A;  1DK4 A;  4NF6 A;  1PDA A;  1OLA A;  2I4B A;  4ZZA A;  1FW0 A;  2H9B A;  4OYV A;  4PFB A;  2RCB A;  3HPI A;  2B3B A;  4HW8 A;  1XVX A;  2Q8J A;  4NF4 B;  4F1V A;  4I3E A;  3W9W A;  2CEY A;  3EHS A;  4MNC A;  5DEX A;  3H6U A;  1A8E A;  3Q26 A;  4BLA A;  4GWZ A;  4IO6 A;  4U4X A;  2F3B A;  3VE1 B;  2XD2 A;  4P0I A;  1XHY A;  2UYE A;  3O6G A;  1FJ6 A;  3IJX B;  2NUV A;  2REJ A;  1Y1M A;  3M3L A;  5DYH A;  5F1Q A;  4KPT A;  3UOR A;  2R9J A;  3OD7 A;  5L9O A;  3C4M A;  1CNQ A;  4ZS9 A;  4AB5 A;  1TWY A;  4NMY A;  1M5B A;  1O64 A;  2OLB A;  4P3L A;  3MVY A;  3FJ7 A;  3C33 A;  5CMB A;  3BIH A;  4PQJ A;  1BK4 A;  4PAK A;  4PFY A;  4I40 A;  4YB6 A;  1D4N A;  4I8C A;  3ISP A;  5I59 B;  1LST A;  2KLF A;  1Q9D A;  1SW5 A;  3K6U A;  3E79 A;  2Y5L A;  3HHF A;  4KYS A;  4RK2 A;  2UVI A;  1B32 A;  2DE4 A;  2UXA A;  4O94 A;  4ZE8 A;  2I3W A;  5I58 B;  1YCJ A;  3FAS A;  5ITP A;  2XHD A;  4KQP A;  2DXR A;  2D5W A;  1Y3P A;  4U4S A;  1MH3 A;  3FJM A;  1EZO A;  1LFI A;  4G2Z A;  4JVI A;  2CZI A;  2THI A;  3CHG A;  4DIG A;  3TDJ A;  4OVP A;  1FQD A;  3IL1 B;  3G3I A;  4EQ9 A;  4O7I A;  5H8H A;  2OCU A;  2O1M A;  3I5O A;  1H44 A;  3IJO B;  3N6T A;  5L9S A;  2O7U A;  1JET A;  2Y7R A;  4PFU A;  2RCA A;  3SEW A;  3KOS A;  1US4 A;  5H8H B;  4HXV A;  1BP5 A;  2F6P A;  3O97 A;  4P9K A;  1B7H A;  3KBR A;  4PFW A;  2I49 A;  2OPD A;  4GXS B;  5EQ9 A;  3H06 B;  3N6U A;  2CMO A;  1VFE A;  1NFT A;  3ZS6 A;  3S9E A;  4THI A;  1K9Y A;  3KC1 A;  4Z0I A;  4N13 A;  5J16 A;  2Z8D A;  1A40 A;  4JWO A;  2RC9 A;  4QHQ A;  4NWD A;  4PTK A;  4F2O A;  2PCR A;  1IMA A;  1YXI A;  3SEU A;  4H6D A;  4IB2 A;  3K4U A;  2H99 A;  4H65 A;  4EF2 A;  2QVR A;  3RY3 A;  3MQ9 A;  2UVH A;  1NV3 A;  1RKM A;  3MUQ A;  2VPO A;  1FBE A;  3VVD A;  4ZDM A;  2R71 A;  4YKJ A;  5AA4 A;  4QXD A;  1ZJL A;  4JXI A;  3LUY A;  1B51 A;  1N7W A;  2XWO A;  1NH7 A;  3V89 B;  1NV1 A;  3KSJ A;  3G3H A;  4GQO A;  1Y4T A;  1QJM A;  4KYD A;  4PF6 A;  2DYX A;  4G8M A;  5CBS A;  2F7B A;  1QUI A;  3I6V A;  4OMB A;  2QS3 A;  1R9Q A;  3FGS A;  2HZK A;  2VD2 A;  3VFJ A;  2WBB A;  4PBH A;  1LAF E;  2W7Y A;  4MNI A;  1VR5 A;  5A5X B;  4RNS A;  1D9Y A;  4N91 A;  1ZLQ A;  2XXU A;  4KD5 A;  1RDX A;  1BIY A;  2VHA A;  3OEN A;  3S9N C;  3FVK A;  3SET A;  4XKR A;  4NF6 B;  1UTB A;  5H8F B;  1N3W A;  2V3U A;  3CG3 A;  3DM0 A;  4MBP A;  5TP9 B;  4H46 A;  3DP6 A;  3TTK A;  1B4Z A;  2XXK A;  2GQ1 A;  4F19 A;  2PYY A;  2QS2 A;  4TOZ A;  1B7U A;  1OIB A;  3IB2 A;  3O2A A;  3CG1 A;  3ILU B;  2V3T A;  1IEJ A;  2M8C A;  3DEL B;  3ZSF A;  1A54 A;  4H67 A;  4X04 A;  4G77 A;  5FHO A;  1AIV A;  3PUV E;  1QKB A;  4C1U A;  2QPQ A;  1JW1 A;  3WAF A;  1YAE A;  3E9X A;  4N8G A;  3EHU A;  5DT6 A;  1EYJ A;  2NOO A;  4P0G A;  1RYX A;  4FAJ A;  4NF4 A;  2OBG A;  2WYK A;  4F39 A;  2PX1 A;  2Q2C A;  2PBW A;  1II5 A;  4UAC A;  1IXI A;  2REG A;  3KEI A;  2DWA A;  3S9L C;  4HE2 A;  2WKY A;  3TQW A;  3FV1 A;  2HPG A;  3IOW A;  5I58 A;  3FVN A;  4F1U A;  4NG7 A;  4GXA A;  3TMG A;  2H98 A;  2AL4 A;  2F36 A;  4ZEI A;  4GL0 A;  1BKA A;  1M5D A;  4HE0 A;  1JQF A;  4WEP A;  3FJG A;  2IA4 A;  3BFU A;  3HV1 A;  3D4C A;  4LN5 A;  1KA1 A;  3MAM A;  1GVC A;  4YAH X;  1H45 A;  2GFE A;  1B3G A;  1GR2 A;  3F11 A;  2FIX A;  3U8Q A;  4G68 C;  4ONY A;  3UK4 A;  4NF5 A;  4DXB A;  2ZNT A;  1IIW A;  1MQJ A;  4IY6 A;  1IZ1 A;  1KZ8 A;  1T0K A;  2P0S A;  4GF8 A;  4DZ1 A;  4ISU A;  4JVD A;  1Q35 A;  3LSF B;  2DWI A;  1B58 A;  1PB7 A;  3QSL A;  1B1H A;  5AA2 A;  2GHB A;  2P3N A;  3MVW A;  2FIE A;  1NUW A;  5ET6 A;  3ODB A;  3TOD A;  1A8F A;  4LAT A;  5CC2 A;  3L6H A;  3JYR A;  2WYP A;  5CMC A;  3MP8 A;  4G8H A;  1XVY A;  3IOT A;  2I6E A;  4N6K A;  4U21 A;  4EXK A;  1H76 A;  2RKM A;  3B6Q A;  1AL3 A;  3TCG A;  2XXV A;  2AIX A;  1LFH A;  4QFO A;  5IZZ A;  3KZG A;  3D4G A;  3CSB A;  3SZP A;  3SES A;  4XKQ A;  3MZB A;  4BDL A;  2F97 A;  1URG A;  2HAU A;  4BDQ A;  1RYO A;  2VGQ A;  2V3Q A;  3N94 A;  4PE5 B;  1PC3 A;  5CMK A;  1FTM A;  2ZYO A;  4KYE A;  4GX6 A;  3VLU A;  2O69 A;  2G29 A;  3IR1 A;  4UA8 A;  3KJ7 A;  3E4R A;  2XA5 A;  1B3E A;  2FYI A;  3H4Z A;  4N8Y A;  1JEU A;  2ZZV A;  1MH4 A;  1PEB A;  4ESW A;  2ONK E;  1NNF A;  3G7W A;  1JW4 A;  3G3J A;  1QW0 A;  4H45 A;  1R9L A;  3FXB A;  2GRV A;  4KCC A;  3KN7 A;  1MPD A;  3ONM A;  1FPI A;  2ZYK A;  2FHY A;  1POY 1;  3OO9 A;  2O84 X;  3MP1 A;  5DVI A;  1EH3 A;  1AMF A;  4YMB A;  4MIJ A;  1VDW A;  4EXL A;  1S9T A;  1FBG A;  1FBP A;  4GD5 A;  4E0X A;  1OVT A;  2FBP A;  4ELR A;  5EQA A;  4NHB A;  4QRZ A;  3TTN A;  5H8N B;  2FNC A;  1FQF A;  2VD3 A;  1MY0 A;  3K6W A;  4R75 A;  3HHG A;  4JB7 A;  2GH9 A;  4YIC A;  2O1L A;  5DVF A;  3RUM A;  1SD3 A;  5ET5 A;  1I6A A;  4GIZ A;  2L5V A;  4PGN A;  1I6Q A;  4KCD A;  4UAB A;  3U94 A;  1KWH A;  4GX3 A;  3O9P A;  1SW1 A;  3CR9 A;  2CZK A;  2XD3 A;  4ECF A;  1QUJ A;  4RJZ A;  4I9D A;  4F1Y A;  2XXI A;  3T22 A;  5IAI A;  3K02 A;  2O7I A;  4OQO A;  4FE8 A;  1PB9 A;  2DXY A;  1NV4 A;  4GWY A;  1MY4 A;  4X1B A;  1CE2 A;  2CZH A;  3PMV A;  2ZNU A;  3QAX A;  1DOT A;  3TAJ A;  3LSL A;  4N15 A;  1F9B A;  1FTJ A;  1MM6 A;  2Y7W A;  3O28 A;  4GX4 A;  3HN0 A;  1NV2 A;  4F18 A;  4NQ8 A;  2F6G A;  3RLF E;  3OSQ A;  4WED A;  1NV6 A;  4DE8 A;  2ZYM A;  4HCW A;  4AS4 A;  2HHM A;  1M5C A;  3OEL A;  4EUO A;  1ANF A;  3TZA A;  4O3B A;  3O66 A;  1XOC A;  1K9Z A;  2XWK A;  1B5H A;  5ET8 A;  3SEX A;  4YU0 A;  4EF1 A;  3S9M C;  1O7T A;  3P7I A;  1AH5 A;  4Q0C A;  2ONR A;  4P47 A;  3PD8 A;  1SVX B;  3TEP A;  1JW5 A;  4KXP A;  1IXH A;  3EQ1 A;  3RN8 A;  3GYY A;  3K6V A;  1SW4 A;  3PUW E;  4R74 A;  2OWZ A;  1FBF A;  4YKK A;  3K1N A;  4E0W A;  2F78 A;  2A5T A;  3Q27 A;  3VVF A;  2O68 A;  3KJT A;  3MVZ A;  5BUU A;  3HST A;  4GOT A;  1XT8 A;  5LTC A;  5H8N A;  4PFI A;  4EQB A;  3UGW A;  1WDN A;  1FTK A;  1IIT A;  1OMP A;  1N7X A;  5B70 A;  2QS4 A;  3PD9 A;  4U1O A;  2E0S A;  2NVU B;  3TYH A;  5BWJ A;  3MW0 A;  2Q89 A;  4MCO A;  3PUY E;  1LBB A;  4QFL A;  5HPQ A;  1MS7 A;  4L17 A;  3OSR A;  4QBA A;  1MG1 A;  5A5L A;  1LAG E;  3GZG A;  4LVQ A;  3O6H A;  1LBX A;  4N81 A;  1WOD A;  2QVU A;  1UIV A;  2B4L A;  2QJE A;  4IO5 A;  4YMA A;  1DBZ A;  1NKX A;  5AE4 A;  3K01 A;  1HSJ A;  5EQ8 A;  2DE3 A;  1B4H A;  3DP8 A;  3MC2 A;  3FVO A;  2WBD A;  1A7L A;  3OO7 A;  4R72 A;  4IGR A;  3C34 A;  4OVS A;  4KHZ E;  2RC8 A;  1QUK A;  4POX A;  2UVJ A;  3U92 A;  3T1B A; 
#chains in the Genus database with same CATH homology
 3W9W A;  2CEY A;  2XWI A;  4MNC A;  5IZZ A;  4P8B A;  1NV5 A;  4HE2 A;  4PCD A;  1FPJ A;  5I7I A;  2XWO A;  1EYK A;  4MAG A;  5ET5 A;  2HPG A;  4O7I A;  4MJO A;  4F1U A;  3SZP A;  4GWZ A;  4XFE A;  1G0I A;  4NG7 A;  2L5V A;  4OVQ A;  4PET A;  1NV1 A;  2F3B A;  5CM6 A;  4PGN A;  5I3S A;  3E78 A;  5IGA A;  1AWB A;  4UAB A;  1LBZ A;  2V3Q A;  3LUZ A;  3NOH A;  4PF8 A;  4GWW A;  3HFU A;  1FPG A;  1FPF A;  4GX3 A;  4IR8 A;  4AS5 A;  2XWV A;  3MYU A;  4P1E A;  4PFI A;  4PF6 A;  1NV7 A;  3IFC A;  2CZK A;  5EYG A;  2WEF A;  4HE0 A;  1FJ6 A;  4XF5 A;  4GX6 A;  2FVZ A;  3D1R A;  4O7M A;  4YZZ A;  4MX6 A;  1KA0 A;  1FBD A;  4PE3 A;  1INP A;  1FPD A;  2DDK A;  5IZ3 A;  2KR0 A;  1SPI A;  1LBY A;  2P3V A;  4NGU A;  4OVR A;  4HXV A;  2PFZ A;  4OVP A;  1D9Q A;  2HZK A;  4LN5 A;  4PAI A;  1IMD A;  1KA1 A;  2WBB A;  3A29 A;  3RPL B;  4PBH A;  1FPB A;  1NV4 A;  5IZ3 B;  2B4M A;  5IM2 A;  4P9K A;  4DI4 B;  2R8T A;  4GWY A;  4NAP A;  4MNI A;  1EYI A;  3FBP A;  4G61 A;  2XA5 A;  4FBP A;  4N4U A;  2VPN A;  3KC0 A;  2CZH A;  4N91 A;  4F19 A;  1RDY A;  2HZL A;  1CNQ A;  5EQ7 A;  4N8Y A;  1FJ9 A;  2Y5K A;  5EQ9 A;  4PAF A;  1RDX A;  2ZZV A;  4PDD A;  3B50 A;  4GWX A;  4MMP A;  1QGX A;  4P56 A;  2FIX A;  5EYH A;  2F3D A;  3QMF A;  4MHF A;  2QFL A;  3U65 A;  4M1V A;  3LV0 A;  4N15 A;  5I5P A;  1K9Y A;  4NN3 A;  1NUZ A;  2V4C A;  3KC1 A;  4P3L A;  4X8R A;  1FTA A;  4NX1 A;  1LBV A;  3T1B A;  4H45 A;  2ZZW A;  4N6D A;  1FPL A;  2Q74 A;  4GX4 A;  3FXB A;  1G0H A;  4MCO A;  3B8B A;  5J16 A;  3BIH A;  4PBQ A;  1NI9 A;  4DI3 D;  1BK4 A;  1RDZ A;  1KZ8 A;  1NV2 A;  4PAK A;  4OAN A;  3IFA A;  2DVZ A;  4F18 A;  2CEX A;  4I40 A;  3PTY A;  2QVV A;  4GWS A;  4H46 A;  4JVC A;  4NQ8 A;  1FPI A;  1FBH A;  2FHY A;  4I3Y A;  1IMF A;  1DCU A;  1FSA A;  2F5X A;  2WX9 A;  4PTK A;  1FBC A;  2GQ1 A;  3KBZ A;  2MKZ A;  2XXK A;  3ISP A;  2KQZ A;  4JVD A;  1NV6 A;  4PFR A;  4QBA A;  5A5L A;  5LTC A;  3ROJ A;  1IMB A;  1FPK A;  1Q9D A;  1YZ0 A;  2OX3 A;  4AS4 A;  2PCR A;  4HCW A;  2HHM A;  1NUX A;  5J1D A;  3E79 A;  2Y5L A;  1IME A;  4P1L A;  1IMA A;  1FPE A;  4GBW A;  4HE1 A;  1LBX A;  2VT5 A;  4MIJ A;  1IMC A;  2P3N A;  4N81 A;  1VDW A;  2Q9T A;  1YXI A;  5LDZ A;  2DE4 A;  2ZZX A;  1FRP A;  1K9Z A;  2FIE A;  2QVU A;  5ESY A;  1FBG A;  1FBP A;  3BIG A;  5ET8 A;  2B4L A;  2XWK A;  4HCY A;  4O94 A;  4O8M A;  4OA4 A;  1DBZ A;  1NUW A;  2JJK A;  5ET6 A;  2FBP A;  2DE2 A;  1JP4 A;  1DK4 A;  5EQA A;  2QPQ A;  4X9T A;  3W9V A;  3RYD A;  4NHB A;  4OVT A;  4PGP A;  1NV0 A;  1NUY A;  3T0J A;  4P47 A;  5FBP A;  1LBW A;  4GBV A;  2PFY A;  4N8G A;  4PDH A;  2QVR A;  5EQ8 A;  2DE3 A;  4PFB A;  3EKI A;  5F24 A;  1LEV A;  1EYJ A;  1YYZ A;  1NV3 A;  1XI6 A;  2WYP A;  4KXP A;  5T3J A;  4N17 A;  4X04 A;  2VPO A;  2Q8M A;  2WYK A;  3MST A;  4JVI A;  5JK4 A;  2WBD A;  2CZI A;  2HXR A;  1FBE A;  2BJI A;  4N6K A;  4GWU A;  4OVS A;  4PC9 A;  3GYY A;  4F1V A;  5DW8 A;  4MNP A;  5ET7 A;  4YIC A;  4QXD A;  3CHG A;  4MEV A;  4I3E A;  3RPL A;  4NF0 A;  4XEQ A;  5IZ1 A;  2OWZ A;  1FBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...