1IMFA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
262
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 262
sequence length 272
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imfA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imfA02
4N81A 5A5LA 4I3YA 5EQ7A 1CNQA 1IMFA 1KA1A 4H45A 1K9ZA 2QVUA 1DK4A 3A29A 5LDZA 2Y5KA 1RDXA 4GX6A 3IFCA 5ESYA 1FRPA 1FPKA 4FBPA 1LBVA 2OWZA 2Y5LA 5FBPA 1NUYA 4GWYA 5ET8A 1INPA 1G0IA 4KXPA 1Q9DA 3KBZA 1KZ8A 2DDKA 1NI9A 1LBXA 4GBWA 5IZ3A 1NV6A 1RDYA 3BIGA 4GX3A 1FJ9A 1FPEA 1FBEA 1NV2A 1RDZA 1FPJA 3LV0A 3KC1A 2QVRA 3RYDA 4GBVA 1EYJA 1DCUA 4HE2A 5ET5A 4QXDA 1FPIA 5DW8A 3RPLA 4HXVA 1FPLA 5EQAA 4I3EA 2FBPA 5ET7A 2QVVA 1IMEA 2HHMA 5F24A 1FBFA 2FVZA 1EYKA 1FSAA 2JJKA 1NV1A 5ET6A 1FJ6A 1YYZA 1FTAA 1LBWA 5IZ3B 1DBZA 1LBZA 3LUZA 5I3SA 2Q8MA 5EQ9A 2VT5A 5EYHA 1VDWA 1NUZA 4HE1A 1G0HA 1IMBA 1JP4A 4HE0A 1FBPA 5EYGA 2BJIA 2Q74A 5J16A 2FHYA 1FBCA 1NV7A 3B8BA 2OX3A 4GWSA 1K9YA 3BIHA 1FBHA 3RPLB 4GWUA 2CZHA 1FPGA 4GWZA 1IMCA 4PTKA 1NV0A 1XI6A 2P3VA 2F3BA 4I40A 3KC0A 1IMDA 1NV5A 1QGXA 2QFLA 2WBDA 3D1RA 3FBPA 2GQ1A 4MJOA 4IR8A 3T0JA 1SPIA 4H46A 1FPFA 1NUXA 3ROJA 2PCRA 5IZ1A 1LBYA 1AWBA 1NV4A 4GX4A 1FPBA 2CZIA 4AS5A 1KA0A 1FBGA 1FPDA 1EYIA 2FIEA 4GWWA 1NV3A 2P3NA 4G61A 2FIXA 2CZKA 1YZ0A 1BK4A 4AS4A 3QMFA 1LEVA 1D9QA 4O7IA 5T3JA 1NUWA 3IFAA 2R8TA 4GWXA 1FBDA 1YXIA 2F3DA 2WEFA 1IMAA 2WBBA 5EQ8A
chains in the Genus database with same CATH superfamily
4LA9A 2F6GA 2V93A 4GX6A 4MNPA 5I5PA 1NMUA 1LBVA 1I6QA 2Y5LA 5ET8A 3OMBA 1RYXA 4EXLA 3VVFA 1D9YA 5B7DA 5L9MA 2OZZA 3MSTA 4OVSA 2W7YA 4OEVA 5IKBA 2UYEA 3OO7A 4OWDA 3T66A 4GXAA 1FQAA 4R2BA 4IB2A 1EZOA 2UVHA 3I5OA 2ONSA 3ZKLA 2Q9TA 4P47A 1EYKA 4LONB 1SI0A 3E3KA 4MAGA 1A8FA 3C34A 3JV9A 4KI0E 4R9GA 3S2VA 1R6ZA 1DTZA 3IOTA 3ECRA 3H6VA 4O3BA 4UA8A 2O69A 5AA2B 1LCTA 3FJ7A 2I3WA 2IA4A 4EF2A 3FVNA 1H76A 2THIA 2ALUA 3OEKA 4N8YA 2WBDA 4O7MA 2GFEA 3K6XA 4MF3A 3FBPA 1P1QA 3TAJA 3TZAA 4EF1A 4O3CA 2QSXA 3VFJA 5TP9A 4M1VA 4MIJA 1B1HA 2O6AA 2I6EA 2LAOA 1B5JA 3QMFA 1FQCA 3MZ9A 3FXBA 4Q0CA 1DSNA 4WEDA 1P1UA 2WBBA 1OQHA 4NF5B 4ZZEA 5A5XA 3S9LC 4NF4B 4AQ4A 3KEIA 1B51A 1GGGA 2ESNA 2CMOA 4OEUA 2HAUA 1NL5A 2DE4A 3H6TA 3QYTA 4OANA 1FPJA 2O1MA 4H65A 3LV0A 3TODA 4GBVA 5JK4A 2H25A 5ET5A 1QUIA 3ILTB 1MXWA 1LB8A 1B05A 2V3UA 4DXUA 1PEBA 1FSAA 1N0TA 4PFTA 5I2NB 4X48A 1M5DA 2XX9A 2RINA 4HE1A 4HE0A 2GRVA 3CG1A 4FJPA 4I9DA 4R2FA 3PMVA 2PX1A 2VD2A 4ELPA 1MY4A 4DZ1A 4ZE8A 1SVXB 3MVXA 5H8FB 5HBCA 2DE3A 1ZMGA 3OO6A 4PFYA 4ECFA 3EHSA 1JEVA 1MM7A 3AXFA 2L5VA 3IK6B 3ZS6A 5IZ1A 3EHTA 3O9PA 3IOVA 5TPAA 4U4SA 1Z7NE 3K6WA 3CSBA 1S50A 2F5XA 3H6WA 3C33A 4GRKA 1LEVA 2VHAA 5ISUA 3MVYA 1ZLQA 5KDTB 3IOWA 4X1BA 2OLBA 2HEUA 3CRBA 4POWA 4I3YA 1KA1A 4JWYA 1F9BA 1B3HA 4FEDA 1USYH 2B65A 2XXXA 1PBPA 5IAIA 1SBPA 4O3AA 4GWYA 4O8MA 1Q9DA 3KBZA 4N17A 2I48A 4N6KA 5I57B 3KSJA 1A55A 2A5TB 3HV1A 2XXQA 3FUZA 4BDMA 4MX6A 3QXMA 1B40A 2DXYA 4FE8A 4R74A 1N7XA 3OXNA 4DCYA 4XEQA 2D5WA 4BDQA 5F24A 1H45A 2WKYA 1WVJA 2HAVA 1FTAA 4PAKA 2UVIA 1AIVA 4P8BA 2WYKA 1QUJA 4AB6A 5IM2A 1UTBB 5EHSA 1QVSA 1US4A 3U65A 2E1SA 1S7YA 2PT2A 3BIHA 3RPLB 1XS5A 4KYSA 2HPGA 3N6UA 3RQTA 4RA1A 5DEXA 4JXIA 2GHAA 2QPQA 4R75A 1LAXA 3H03A 4YKPA 2QRYA 4GD5A 1AWBA 3K02A 2P1SA 3L6HA 4RK2A 4AS5A 4PAIA 1USYE 4XKQA 1Q1KA 1MXUA 4O7IA 2OJTA 1NH8A 2R8TA 2WEFA 1MXZA 2MKZA 2QVUA 2DXRA 1RDXA 2F97A 3R26A 1Y4TA 2F35A 1XT8A 2X7PA 4G68B 4PGPA 1B6HA 1ZU0A 1D9VA 1NUYA 4XFEA 3PPNA 4NN3A 5EYFA 3B7DA 1B7ZA 3PD9A 1JW1A 3G3HA 4E0WA 5I59B 1RDYA 4R6YA 1FBEA 3Q26A 1MPCA 2E0SA 4NWDA 2REJA 3BFTA 1Q35A 2Q89A 2ZYNA 1DMBA 3RTWB 3V8XB 1EU8A 1XOCA 3RYDA 1EYJA 1TXFA 1T0KA 4JDFA 1BIYA 1POY1 2QVVA 2ZYKA 2H5YA 2QL3A 1SW1A 1VE4A 5AA3A 1MDP1 2VPNA 3SZPA 2ZZVA 2XXVA 3CIJA 4N13A 1VDWA 5L9OA 4IGTA 3RTFB 3VVDA 3O6HA 3DLNA 2BJIA 2RCBA 2NXOA 2DP8A 3V83A 2O51A 2DWJA 1NKXA 5I56A 2FNCA 2VP1A 1B5HA 5CMBA 4GIZA 2P3VA 2F7AA 4M4GA 1NV5A 4YB7A 1LFGA 4PBHA 4F18A 4DDDA 3F11A 3U1OA 3U93A 5EHMA 1JNFA 4EQBA 4U1OA 2NUVA 2XD2A 1EYIA 1PB9A 4GFRA 3KOSA 2CZLA 3IJOB 3SDFA 3IFAA 1FBDA 4P3LA 2RC9A 2PMSA 4F3BA 3MC2A 2D3IA 5EQ8A 1FQEA 4NF6B 3Q25A 4U4XA 3SESA 3WAEA 1IZ1A 2NOOA 3I3VA 2NVUB 2I4CA 4P1LA 3PUVE 1OLAA 2OWZA 5KCJA 4QHQA 2IEEA 4PE5B 1NNPA 1NNKA 2VGQA 4ZEKA 1RYOA 4N8GA 1I69A 2ZNSA 5CMKA 1Z7ME 2PFYA 1FJ9A 4F39A 3EF7A 4MLVA 2DWIA 2XX7A 4G2ZA 1P1WA 1NH7A 2CEYA 5AA2D 3T9VA 5CRYA 1P99A 5FHMA 3H3GA 4LZ7A 2ZYMA 4MH5A 3K0VA 1LB9A 1DPEA 4OFOA 4ZE9A 4IO3A 5IZ3B 5F1QA 5HM4B 2OPEA 3LUZA 2VT5A 2XXYA 3HFUA 2XXHA 1G0HA 4H8JA 1D4NA 5H8QA 4MFIA 1R1NA 5ICTA 1FPGA 4OA4A 4PTKA 1MXXA 3QUFA 1ZIUA 3BBRA 3H4ZA 4BDNA 4OZ9A 3FD3A 2DYXA 3ROJA 5LOMA 1LAHE 1FPDA 1AL3A 4K3FA 1JQFA 1YZ0A 1B1XA 2XA5A 1A99A 3PPOA 4ONYA 2B4MA 1OLCA 3CI8A 1UIVA 1K9ZA 4MNIA 5LDZA 1US5A 3TQWA 5AA2A 3R6UA 4X04A 5ESYA 1FRPA 2AL4A 4RPOA 3G3KA 4LP2B 1CE2A 2Y7WA 1NI9A 2V84A 1ZKBA 2P2AA 4NG7A 3EN3A 1RDZA 3TFLA 1LBBA 3CFLA 4E0XA 2OCUA 4QFOA 3KC1A 1BP5A 2OK2A 3S9EA 5BUUA 3CG3A 3N94A 3B50A 4NX1A 4FEBA 1H3DA 2HCAA 3G3IA 3MP6A 5I3SA 5H8HA 1MQJA 4F29A 4P11A 2Q74A 3FVOA 5J16A 4NF4A 5DT6A 1ELJA 4YMAA 4OQOA 3O6IA 3TMGA 1XVYA 4GQOA 1ZBMA 1XI6A 4HCWA 4ZECA 4P0GA 4KCDA 4DLDA 3EQ1A 2PBWA 1OVBA 4ELRA 2PVUA 1A54A 4GX4A 4PE3A 4GF8A 2P3NA 1N7WA 2ONRA 3FJGA 4F3GA 3IO6A 5I2NA 4ND9A 1GTKA 4Q5TA 5B70A 1YPNA 3C4MA 1M5FA 1MY3A 1URDA 2DVZA 2XWIA 2F34A 4HS7A 1FPKA 3BKIB 4NF8A 4PDHA 1KZ8A 1D3KA 2DDKA 5AA4A 4ESWA 2F36A 1DOTA 4LQ5A 3UIFA 3VLUA 4KPTA 1SYHA 2Y7PA 4BLAA 2Q2CA 5ITPA 4EQ7A 5J1DA 3QUJA 1FPIA 1Y20A 4MBPA 3U92A 1LBWA 3FV2A 5KDTA 2ZXTA 2BJJX 2REGA 2QS4A 4LQ2A 3JZJA 1FBPA 2Z22A 3M8UA 4NHBA 2FHYA 4GWSA 2UVJA 4XKRA 3RGYA 4NMYA 4MLQA 4GWZA 1IXGA 5L9SA 2DWHA 1NV0A 2XXPA 4C1UA 4WEPA 1MY0A 3SEVA 1MQGA 2ONKE 2F7CA 3IO4A 3UGWA 1B2HA 1LSTA 1B0HA 1N3XA 2CZIA 5I2KA 3IB1A 1M5BA 1B3LA 5BWJA 3E9XA 1D9QA 1N84A 4YKKA 4KD5A 4R72A 1JEUA 3RN8A 1IMFA 3OEMA 5TP9B 2HXWA 1P1OA 2VD3A 1FQBA 4IY5A 4ISUA 4F1YA 3LSFB 2UVGA 4OVRA 5KZTA 5DVIA 3PGFA 2Z23A 2DOJA 3T9HB 1B32A 1NV2A 2Y7KA 4H6DA 4BDLA 1JVYA 3Q28A 1O7TA 1S9TA 2XXIA 3DELB 5EQAA 3K2DA 4F19A 2H4IA 3IOUA 1SW2A 3GYYA 2Q8MA 3HSTA 3K1MA 3QSLA 1B3FA 2XWOA 3RUMA 2UYFA 4G68A 4GL0A 3TCFA 4R73A 2ZNUA 1FBHA 2Z8FA 4GVOA 3MP8A 1IMCA 1IMDA 2QFLA 1QGXA 2V25A 3K00A 2X26A 1IEJA 1OQGA 1HSEA 3U8QA 5JTYA 5ITOA 3S4UA 1PB7A 3GBAA 4FATA 3O2AA 1KA0A 2QMWA 4ELOA 3HHFA 5AE4A 3PMXA 1BK4A 1CB6A 4F3SA 3V89B 4KHZE 1IMAA 3KBRA 1JVXA 5I58A 3PU5A 2AIXA 3K6UA 5H8NA 5FTHA 1FTMA 1AMFA 4RJZA 3PPRA 1G0IA 1LFHA 3CVGA 3LSWA 2KR0A 4FIMA 3SERA 3ILUB 3ODBA 1XC1A 3KZGA 5JEIA 1UTHA 4F2QA 1YTVA 4QRZA 5HPQA 2GHBA 4DI4B 2X7QA 4G77A 3M3KA 1B7HA 3O6GA 1URGA 2G29A 4QF9A 4YZZA 1IMEA 1FBFA 4GL8A 5LTCA 1PBQA 4U22A 1ZTYA 1B3EA 2AYSA 1B4ZA 4F1UA 1LBZA 4GWOA 4ZEFA 1PB8A 2ZMBA 3DP6A 4YKIA 4N15A 2RKMA 1LAFE 1ANFA 4MEVA 2F6PA 2RCAA 5AA1A 5EYGA 3RPWA 3SETA 5H8SA 1B9JA 4QFLA 1NNFA 3TTNA 3KC0A 4OVJA 2A5SA 3VDFA 4HCYA 3MYUA 2GQ1A 3FXQA 3M3LA 3RT8A 3EHUA 1OMPA 3H06B 3TTMA 4XF5A 1N76A 1TFDA 2WX9A 4TLLB 2I0BA 3PV0E 1MG1A 4P0IA 2ZYOA 1N04A 5IGAA 3PUZE 4YKJA 5DVJA 4EXKA 3E79A 1URSA 4F31B 1UQWA 1O63A 5EQ7A 2HZLA 4H45A 2Q88A 3SEYA 3KJTA 1XVXA 3IX1A 4OETA 3QK6A 2DE2A 1H43A 3D4GA 4OHNA 1I6AA 2ZZXA 3T9UA 3KOTA 4KXPA 1VR5A 2R6GE 4ZEDA 4KQPA 3ZKKA 3H6UA 4GBWA 1NV6A 5FTIA 4GX3A 2M8CA 1B0LA 2VPOA 1MQHA 3I6VA 4I1DA 2H9BA 2QMXA 1NFTA 3RNNA 3E13X 2FBPA 3K01A 3KGCA 3EKIA 1MH3A 4H0WA 4H67A 5EYHA 2PYYA 4JVCA 2Y84A 3MVWA 3O97A 1BTJA 3TUSA 3BFUA 4IO5A 3FIRA 4LZ8A 2F3BA 4IGRA 2I4BA 3TTRA 4U23A 3GBBA 2R9JA 2B3BA 1TFAA 3HHGA 4PDDA 1M5EA 2OPDA 3MZ1A 4H5GA 5CM6A 3K1PA 4QFKA 3MPKA 3TEPA 5ICQA 3KJ7A 4OXVA 4PCDA 1SYIA 5I56B 4KCCA 2I49A 5T3JA 4GWXA 3VLWA 1DK4A 2Y5KA 4N07A 3IFCA 3IB2A 2XXTA 4IO7A 1INPA 2QS3A 1LBCA 5DYHA 3ONMA 4HTGA 1FCKA 1OIBA 1Y3NA 3JYRA 2Q2AA 2H98A 1ZJLA 1HSLA 3N26A 3HN0A 4EUOA 1QUKA 4R9FA 1MDQA 4QSDA 4F2OA 3PPPA 1FPLA 4I3EA 4ZS9A 1EZPA 4RYAA 2JJKA 1FJ6A 1ATGA 1GVCA 5EQ9A 1JETA 4DXCA 2F78A 2ZNTA 4IY6A 4YU0A 2V4CA 3KN8A 1PC3A 5CMMA 5K2YA 3SEUA 1AH5A 3TDJA 3UP9A 2NWJA 4JSDA 4Z0IA 1BKAA 3FV1A 3K1NA 4TLMB 3MUQA 4H1XA 4ZEBA 2XWVA 2O84X 1PDAA 4PC9A 4XKPA 2I3VA 4NF5A 1NV4A 3SKPA 2KQZA 3PMWA 5H8QB 3EPEA 2CEXA 4NF0A 3FVKA 3MQ9A 3OSQA 4PGNA 4R6HA 3MP1A 4N6PA 3H7MA 1QULA 1WODA 3N5LA 3WAFA 4G4PA 1TWYA 4JVDA 4PFRA 4JVIA 4O94A 1CNQA 1Y3QA 3C9HA 4H5FA 3OO9A 1B3GA 1QW0A 3OENA 4PAFA 4BDOA 3VXCA 2HXRA 3UN6A 1MQIA 1H44A 1II5A 3MWBA 4LUBA 3HO7A 2RC7A 3OELA 1LLSA 4JSOA 4C1TA 4DI3D 1EH3A 1SD3A 4PFUA 4X9TA 5DW8A 4YMBA 4RNSA 4KYDA 3E78A 5H8FA 4PETA 3FJMA 4KR5A 1MQDA 1DBZA 3G3JA 2XD3A 3FGSA 3VE1B 4PFWA 3O29A 1NUZA 1EZ9A 1SI1A 2XXRA 5L8DA 1YAEA 4FAJA 4MNCA 3FASA 4GWUA 2CZHA 4QSCA 4ZDMA 3Q29A 3LUYA 4GOTA 4JB7A 3D1RA 3OD7A 4R6KA 5H8HB 2Y7RA 4G8MA 3IJXB 4DE8A 4F1VA 3IR1A 3PD8A 3VVEA 2H99A 1MRPA 1IXCA 3RT6B 4ZEIA 3S9NC 4DCXA 4YB6A 5I57A 3K4UA 2PT1A 1YCJA 2A5TA 3DM0A 1Y3PA 3P7IA 1FQFA 2ANJA 1UIUA 1MXVA 1LAGE 2Z8EA 4OMBA 3USDA 3PUYE 3A3UA 3N6TA 3C35A 4QSEA 4F3PA 4HW8A 4JBZA 1LBXA 4XXUA 3PPQA 4WKMA 2OWTA 1DPPA 1UTBA 4RXLA 1LGBC 3B6WA 1FTJA 3O66A 2QVRA 2O7IA 3TPAA 3OOAA 2XXWA 3G7WA 4FORA 3KFMA 4QXDA 3RPLA 4MCOA 5ET7A 4NF8B 4F22A 1O64A 1MPDA 1NV1A 5AA4B 4RY1A 2DWAA 3FZVA 1FQDA 1IMBA 1FW0A 4PF8A 1MS7A 4X1DA 2V3QA 3U72A 2RF1A 3KSXA 4N4UA 3B8BA 5A5XB 4N6DA 1AOVA 3RLFE 2WYPA 3PUWE 1P1NA 4I40A 2XWKA 4YICA 3D4CA 3RY3A 1DTGA 1KWHA 4MJOA 1NUXA 1POTA 4UABA 4JWOA 4PP0A 1Y4CA 4X8RA 3HPIA 2XXUA 1XHYA 3KN3A 1FPBA 3FATA 1L5TA 3R7XA 4G8NA 1IUDA 3QAXA 2XHDA 4MMPA 2CZKA 3IB0A 3MVZA 1JW5A 1WDNA 5DVFA 3UK4A 1FTOA 1BLFA 3B6TA 5I59A 4XIGQ 2YJPA 3M3FA 1JW4A 3T22A 5A5LA 3Q27A 3KN7A 3NOHA 3UA8A 3G3GA 3A29A 1A8EA 4KYEA 3MZBA 4Q8RA 3VLVA 4RPNA 4I62A 5I2KB 1IXHA 3C31A 3MW0A 3IAZA 3BIGA 3CFXA 1FPEA 2QJEA 3GZGA 4GLIA 4YB5A 3T96B 4OENA 4NE4A 4I8CA 5K2XA 5TPAB 1MM6A 4LVQA 3MAMA 1IQ7A 2HZKA 1SDXA 4THIA 3TCHA 5CI5A 3QIMA 4KFQA 1YYZA 2O1LA 3MPLA 1RKMA 4ELQA 4XKNA 2B3FA 3IL1B 2XX8A 1HSJA 3W9WA 3TTLA 2OWSA 1B4HA 2DSFA 3KG2A 4Z7EA 1B58A 3C32A 3CR9A 2GH9A 4EQ9A 3SEXA 3W15C 4NTLA 4C0RA 4P1EA 4IR8A 3T0JA 1FPFA 4NF6A 3FXUA 1GV8A 2YPNA 1GR2A 2PCRA 3LSXA 4L17A 4OFJA 2YLNA 2HFBA 2UXAA 1FBGA 2FIEA 1MY1A 3DP8A 1NV3A 4AB5A 2DVCA 1VFDA 4AS4A 2PFZA 3GLBA 4LATA 4OESA 2F8DA 1YXIA 4PF6A 5I7IA 4N81A 5IZZA 3C36A 2Y7IA 5JTYB 3S9MC 2FA7A 4EDPA 4FBPA 1IIWA 4LN5A 4NGUA 4RK9A 1A40A 3CHGA 5FHOA 4G8HA 1TT1A 2DS9A 5DEXB 3LR1A 5IZ3A 2Q8JA 4IO4A 5I58B 2QS2A 1FTKA 3T9XB 5H8NB 3FXRA 3W9VA 4PQJA 3UORA 4POXA 1B7UA 2HHMA 3O28A 2FVZA 4OVPA 1I6BA 5ET6A 2B4LA 2I58A 2XXKA 4PFIA 1UTHB 1JP4A 3HCQA 1QKBA 1M5CA 2HQ0A 5DTBA 4G68C 1A7LA 2V3TA 4QFPA 5CBRA 3ZSFA 2OX3A 4UACA 1SQYA 3B6QA 3CFZA 3TQLA 4U2RA 3LC8A 1B52A 4H46A 1VSOA 3CSGA 5I84A 4NAPA 1QJMA 1MY2A 2O68A 4OYVA 1R9LA 3OSRA 3A09A 3L6GA 2F7BA 3PUXE 5TU0A 1Y1ZA 3VV5A 1Y9UA 4GWWA 4G61A 4Q30B 3MBPA 4ZZAA 1QKAA 1NNTA 3K6VA 5ELVA 1MXYA 3T93B 1R9QA 4U21A 5CBSA 4IO6A 4TQUQ 4OERA 4NEDA 4XTCQ 1VFEA 4QFNA 4NWCA 1LFIA 1SW5A 3LSLA 4GXSB 1MPBA 3GXAA 5FBPA 5M2VA 4BDRA 4H8IA 3T1BA 3LBSA 2QS1A 4PFBA 5CC2A 2I0CA 4P56A 2O7UA 3A3CA 1J1NA 1SW4A 1IITA 2R71A 5FHNA 3TTKA 5CMCA 3VXBA 2Z8DA 2P0SA 3G3FA 2OBGA 1DCUA 4HE2A 4PBQA 4N91A 4HXVA 4YAHX 2G93A 4QBAA 4OVTA 1OVTA 3FVGA 4NQ8A 3MJNA 3V5AA 4JWXA 4LZ5A 1N3WA 2AL5A 3PTYA 4ESXA 1FBCA 1NV7A 1Y1MA 4DIGA 4U1ZA 2KLFA 1K9YA 3DP4A 5KCJB 4MHFA 3THIA 3E4RA 2DQVA 3TCGA 3ISPA 1SPIA 2ABHA 3OO8A 5F7VA 1B46A 3TYHA 4OTEA 1MH4A 2FYIA 4TOZA 1LBYA 2VOZA 3IORA 2ZZWA 4IO2A 3SEWA 3TELA 4DXBA 2RC8A 2FIXA 3TKDA 4WXJA 1B5IA 1FTLA 4OFLA 4OVQA 1IXIA 1NUWA 3U94A 4P9KA 1LCFA 2F3DA 2D21A 4FECA
chains in the Genus database with same CATH topology
4GX6A 4MNPA 5I5PA 4P1LA 1LBVA 2OWZA 2Y5LA 5ET8A 1G0IA 2KR0A 1LBXA 4N8GA 2PFYA 1FJ9A 3MSTA 4OVSA 2QVRA 4DI4B 2CEYA 4QXDA 3RPLA 4MCOA 5ET7A 2Q9TA 4P47A 4YZZA 1IMEA 1FBFA 1EYKA 5LTCA 1NV1A 5IZ3B 4MAGA 4F1UA 1LBZA 3LUZA 2VT5A 3HFUA 4N15A 1G0HA 1IMBA 4MEVA 4PF8A 5EYGA 2V3QA 4N4UA 3B8BA 4N6DA 1FPGA 2WYPA 4OA4A 4PTKA 4I40A 3KC0A 2XWKA 4YICA 4N8YA 2WBDA 4HCYA 4O7MA 3MYUA 3FBPA 2GQ1A 4MJOA 4XF5A 1NUXA 4UABA 3ROJA 4X8RA 4M1VA 4MIJA 1FPBA 2WX9A 1FPDA 4MMPA 2CZKA 1YZ0A 2XA5A 5IGAA 3QMFA 2B4MA 3E79A 3FXBA 2WBBA 5A5LA 5EQ7A 3NOHA 2HZLA 4H45A 1K9ZA 4MNIA 3A29A 5LDZA 4X04A 5ESYA 1FRPA 2DE2A 2ZZXA 4KXPA 1NI9A 4GBWA 2DE4A 1NV6A 4NG7A 3BIGA 4GX3A 1FPEA 1RDZA 4OANA 1FPJA 2VPOA 3LV0A 3KC1A 4GBVA 5JK4A 5ET5A 2HZKA 2FBPA 3B50A 4NX1A 1FSAA 1YYZA 3EKIA 5I3SA 5EYHA 4HE1A 4JVCA 4HE0A 3W9WA 2Q74A 5J16A 1XI6A 2F3BA 4HCWA 2DE3A 4P1EA 4PDDA 4IR8A 3T0JA 1FPFA 2L5VA 2PCRA 5IZ1A 4GX4A 5CM6A 4PE3A 1FBGA 2FIEA 1NV3A 2P3NA 4PCDA 2F5XA 4AS4A 2PFZA 1LEVA 5T3JA 4GWXA 1YXIA 4PF6A 5I7IA 4N81A 5IZZA 4I3YA 1KA1A 1DK4A 2DVZA 2Y5KA 2XWIA 3IFCA 1FPKA 4FBPA 4LN5A 4NGUA 4GWYA 1INPA 3CHGA 4O8MA 1Q9DA 3KBZA 4PDHA 4N17A 1KZ8A 4N6KA 2DDKA 5IZ3A 4MX6A 3W9VA 5J1DA 1FPIA 4XEQA 1FPLA 4I3EA 2HHMA 5F24A 2FVZA 4OVPA 2JJKA 5ET6A 1FJ6A 1FTAA 1LBWA 4PAKA 2B4LA 4P8BA 2WYKA 5EQ9A 2XXKA 5IM2A 4PFIA 1JP4A 3U65A 1FBPA 4NHBA 2V4CA 2FHYA 2OX3A 4GWSA 3BIHA 3RPLB 2HPGA 4GWZA 1NV0A 2QPQA 2XWVA 4H46A 4NAPA 4PC9A 1AWBA 1NV4A 2KQZA 2CZIA 4AS5A 4PAIA 4GWWA 4G61A 2CEXA 4NF0A 4PGNA 1D9QA 4O7IA 4JVDA 2R8TA 2WEFA 4PFRA 4JVIA 2MKZA 4O94A 1CNQA 1IMFA 2QVUA 1RDXA 4PAFA 4PGPA 5FBPA 1NUYA 4OVRA 4XFEA 2HXRA 3T1BA 4NN3A 4PFBA 1RDYA 1NV2A 1FBEA 4P56A 3RYDA 4DI3D 1EYJA 1DCUA 4HE2A 4PBQA 4N91A 4X9TA 5DW8A 4HXVA 5EQAA 2QVVA 4QBAA 3E78A 4OVTA 4F19A 4PETA 3GYYA 2VPNA 1DBZA 4NQ8A 3SZPA 2Q8MA 2ZZVA 1VDWA 1NUZA 3PTYA 2XWOA 2BJIA 1FBCA 1NV7A 4MNCA 1K9YA 1FBHA 4GWUA 2CZHA 1IMCA 4MHFA 2P3VA 1IMDA 1NV5A 1QGXA 2QFLA 3D1RA 4PBHA 3ISPA 1SPIA 4F18A 4F1VA 1LBYA 2ZZWA 1KA0A 1EYIA 2FIXA 4OVQA 1BK4A 1NUWA 4P9KA 3IFAA 1FBDA 4P3LA 2F3DA 1IMAA 5EQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N81 A;  5A5L A;  4I3Y A;  5EQ7 A;  1CNQ A;  1IMF A;  1KA1 A;  4H45 A;  1K9Z A;  2QVU A;  1DK4 A;  3A29 A;  5LDZ A;  2Y5K A;  1RDX A;  4GX6 A;  3IFC A;  5ESY A;  1FRP A;  1FPK A;  4FBP A;  1LBV A;  2OWZ A;  2Y5L A;  5FBP A;  1NUY A;  4GWY A;  5ET8 A;  1INP A;  1G0I A;  4KXP A;  1Q9D A;  3KBZ A;  1KZ8 A;  2DDK A;  1NI9 A;  1LBX A;  4GBW A;  5IZ3 A;  1NV6 A;  1RDY A;  3BIG A;  4GX3 A;  1FJ9 A;  1FPE A;  1FBE A;  1NV2 A;  1RDZ A;  1FPJ A;  3LV0 A;  3KC1 A;  2QVR A;  3RYD A;  4GBV A;  1EYJ A;  1DCU A;  4HE2 A;  5ET5 A;  4QXD A;  1FPI A;  5DW8 A;  3RPL A;  4HXV A;  1FPL A;  5EQA A;  4I3E A;  2FBP A;  5ET7 A;  2QVV A;  1IME A;  2HHM A;  5F24 A;  1FBF A;  2FVZ A;  1EYK A;  1FSA A;  2JJK A;  1NV1 A;  5ET6 A;  1FJ6 A;  1YYZ A;  1FTA A;  1LBW A;  5IZ3 B;  1DBZ A;  1LBZ A;  3LUZ A;  5I3S A;  2Q8M A;  5EQ9 A;  2VT5 A;  5EYH A;  1VDW A;  1NUZ A;  4HE1 A;  1G0H A;  1IMB A;  1JP4 A;  4HE0 A;  1FBP A;  5EYG A;  2BJI A;  2Q74 A;  5J16 A;  2FHY A;  1FBC A;  1NV7 A;  3B8B A;  2OX3 A;  4GWS A;  1K9Y A;  3BIH A;  1FBH A;  3RPL B;  4GWU A;  2CZH A;  1FPG A;  4GWZ A;  1IMC A;  4PTK A;  1NV0 A;  1XI6 A;  2P3V A;  2F3B A;  4I40 A;  3KC0 A;  1IMD A;  1NV5 A;  1QGX A;  2QFL A;  2WBD A;  3D1R A;  3FBP A;  2GQ1 A;  4MJO A;  4IR8 A;  3T0J A;  1SPI A;  4H46 A;  1FPF A;  1NUX A;  3ROJ A;  2PCR A;  5IZ1 A;  1LBY A;  1AWB A;  1NV4 A;  4GX4 A;  1FPB A;  2CZI A;  4AS5 A;  1KA0 A;  1FBG A;  1FPD A;  1EYI A;  2FIE A;  4GWW A;  1NV3 A;  2P3N A;  4G61 A;  2FIX A;  2CZK A;  1YZ0 A;  1BK4 A;  4AS4 A;  3QMF A;  1LEV A;  1D9Q A;  4O7I A;  5T3J A;  1NUW A;  3IFA A;  2R8T A;  4GWX A;  1FBD A;  1YXI A;  2F3D A;  2WEF A;  1IMA A;  2WBB A;  5EQ8 A; 
#chains in the Genus database with same CATH topology
 4LA9 A;  2F6G A;  2V93 A;  4GX6 A;  4MNP A;  5I5P A;  1NMU A;  1LBV A;  1I6Q A;  2Y5L A;  5ET8 A;  3OMB A;  1RYX A;  4EXL A;  3VVF A;  1D9Y A;  5B7D A;  5L9M A;  2OZZ A;  3MST A;  4OVS A;  2W7Y A;  4OEV A;  5IKB A;  2UYE A;  3OO7 A;  4OWD A;  3T66 A;  4GXA A;  1FQA A;  4R2B A;  4IB2 A;  1EZO A;  2UVH A;  3I5O A;  2ONS A;  3ZKL A;  2Q9T A;  4P47 A;  1EYK A;  4LON B;  1SI0 A;  3E3K A;  4MAG A;  1A8F A;  3C34 A;  3JV9 A;  4KI0 E;  4R9G A;  3S2V A;  1R6Z A;  1DTZ A;  3IOT A;  3ECR A;  3H6V A;  4O3B A;  4UA8 A;  2O69 A;  5AA2 B;  1LCT A;  3FJ7 A;  2I3W A;  2IA4 A;  4EF2 A;  3FVN A;  1H76 A;  2THI A;  2ALU A;  3OEK A;  4N8Y A;  2WBD A;  4O7M A;  2GFE A;  3K6X A;  4MF3 A;  3FBP A;  1P1Q A;  3TAJ A;  3TZA A;  4EF1 A;  4O3C A;  2QSX A;  3VFJ A;  5TP9 A;  4M1V A;  4MIJ A;  1B1H A;  2O6A A;  2I6E A;  2LAO A;  1B5J A;  3QMF A;  1FQC A;  3MZ9 A;  3FXB A;  4Q0C A;  1DSN A;  4WED A;  1P1U A;  2WBB A;  1OQH A;  4NF5 B;  4ZZE A;  5A5X A;  3S9L C;  4NF4 B;  4AQ4 A;  3KEI A;  1B51 A;  1GGG A;  2ESN A;  2CMO A;  4OEU A;  2HAU A;  1NL5 A;  2DE4 A;  3H6T A;  3QYT A;  4OAN A;  1FPJ A;  2O1M A;  4H65 A;  3LV0 A;  3TOD A;  4GBV A;  5JK4 A;  2H25 A;  5ET5 A;  1QUI A;  3ILT B;  1MXW A;  1LB8 A;  1B05 A;  2V3U A;  4DXU A;  1PEB A;  1FSA A;  1N0T A;  4PFT A;  5I2N B;  4X48 A;  1M5D A;  2XX9 A;  2RIN A;  4HE1 A;  4HE0 A;  2GRV A;  3CG1 A;  4FJP A;  4I9D A;  4R2F A;  3PMV A;  2PX1 A;  2VD2 A;  4ELP A;  1MY4 A;  4DZ1 A;  4ZE8 A;  1SVX B;  3MVX A;  5H8F B;  5HBC A;  2DE3 A;  1ZMG A;  3OO6 A;  4PFY A;  4ECF A;  3EHS A;  1JEV A;  1MM7 A;  3AXF A;  2L5V A;  3IK6 B;  3ZS6 A;  5IZ1 A;  3EHT A;  3O9P A;  3IOV A;  5TPA A;  4U4S A;  1Z7N E;  3K6W A;  3CSB A;  1S50 A;  2F5X A;  3H6W A;  3C33 A;  4GRK A;  1LEV A;  2VHA A;  5ISU A;  3MVY A;  1ZLQ A;  5KDT B;  3IOW A;  4X1B A;  2OLB A;  2HEU A;  3CRB A;  4POW A;  4I3Y A;  1KA1 A;  4JWY A;  1F9B A;  1B3H A;  4FED A;  1USY H;  2B65 A;  2XXX A;  1PBP A;  5IAI A;  1SBP A;  4O3A A;  4GWY A;  4O8M A;  1Q9D A;  3KBZ A;  4N17 A;  2I48 A;  4N6K A;  5I57 B;  3KSJ A;  1A55 A;  2A5T B;  3HV1 A;  2XXQ A;  3FUZ A;  4BDM A;  4MX6 A;  3QXM A;  1B40 A;  2DXY A;  4FE8 A;  4R74 A;  1N7X A;  3OXN A;  4DCY A;  4XEQ A;  2D5W A;  4BDQ A;  5F24 A;  1H45 A;  2WKY A;  1WVJ A;  2HAV A;  1FTA A;  4PAK A;  2UVI A;  1AIV A;  4P8B A;  2WYK A;  1QUJ A;  4AB6 A;  5IM2 A;  1UTB B;  5EHS A;  1QVS A;  1US4 A;  3U65 A;  2E1S A;  1S7Y A;  2PT2 A;  3BIH A;  3RPL B;  1XS5 A;  4KYS A;  2HPG A;  3N6U A;  3RQT A;  4RA1 A;  5DEX A;  4JXI A;  2GHA A;  2QPQ A;  4R75 A;  1LAX A;  3H03 A;  4YKP A;  2QRY A;  4GD5 A;  1AWB A;  3K02 A;  2P1S A;  3L6H A;  4RK2 A;  4AS5 A;  4PAI A;  1USY E;  4XKQ A;  1Q1K A;  1MXU A;  4O7I A;  2OJT A;  1NH8 A;  2R8T A;  2WEF A;  1MXZ A;  2MKZ A;  2QVU A;  2DXR A;  1RDX A;  2F97 A;  3R26 A;  1Y4T A;  2F35 A;  1XT8 A;  2X7P A;  4G68 B;  4PGP A;  1B6H A;  1ZU0 A;  1D9V A;  1NUY A;  4XFE A;  3PPN A;  4NN3 A;  5EYF A;  3B7D A;  1B7Z A;  3PD9 A;  1JW1 A;  3G3H A;  4E0W A;  5I59 B;  1RDY A;  4R6Y A;  1FBE A;  3Q26 A;  1MPC A;  2E0S A;  4NWD A;  2REJ A;  3BFT A;  1Q35 A;  2Q89 A;  2ZYN A;  1DMB A;  3RTW B;  3V8X B;  1EU8 A;  1XOC A;  3RYD A;  1EYJ A;  1TXF A;  1T0K A;  4JDF A;  1BIY A;  1POY 1;  2QVV A;  2ZYK A;  2H5Y A;  2QL3 A;  1SW1 A;  1VE4 A;  5AA3 A;  1MDP 1;  2VPN A;  3SZP A;  2ZZV A;  2XXV A;  3CIJ A;  4N13 A;  1VDW A;  5L9O A;  4IGT A;  3RTF B;  3VVD A;  3O6H A;  3DLN A;  2BJI A;  2RCB A;  2NXO A;  2DP8 A;  3V83 A;  2O51 A;  2DWJ A;  1NKX A;  5I56 A;  2FNC A;  2VP1 A;  1B5H A;  5CMB A;  4GIZ A;  2P3V A;  2F7A A;  4M4G A;  1NV5 A;  4YB7 A;  1LFG A;  4PBH A;  4F18 A;  4DDD A;  3F11 A;  3U1O A;  3U93 A;  5EHM A;  1JNF A;  4EQB A;  4U1O A;  2NUV A;  2XD2 A;  1EYI A;  1PB9 A;  4GFR A;  3KOS A;  2CZL A;  3IJO B;  3SDF A;  3IFA A;  1FBD A;  4P3L A;  2RC9 A;  2PMS A;  4F3B A;  3MC2 A;  2D3I A;  5EQ8 A;  1FQE A;  4NF6 B;  3Q25 A;  4U4X A;  3SES A;  3WAE A;  1IZ1 A;  2NOO A;  3I3V A;  2NVU B;  2I4C A;  4P1L A;  3PUV E;  1OLA A;  2OWZ A;  5KCJ A;  4QHQ A;  2IEE A;  4PE5 B;  1NNP A;  1NNK A;  2VGQ A;  4ZEK A;  1RYO A;  4N8G A;  1I69 A;  2ZNS A;  5CMK A;  1Z7M E;  2PFY A;  1FJ9 A;  4F39 A;  3EF7 A;  4MLV A;  2DWI A;  2XX7 A;  4G2Z A;  1P1W A;  1NH7 A;  2CEY A;  5AA2 D;  3T9V A;  5CRY A;  1P99 A;  5FHM A;  3H3G A;  4LZ7 A;  2ZYM A;  4MH5 A;  3K0V A;  1LB9 A;  1DPE A;  4OFO A;  4ZE9 A;  4IO3 A;  5IZ3 B;  5F1Q A;  5HM4 B;  2OPE A;  3LUZ A;  2VT5 A;  2XXY A;  3HFU A;  2XXH A;  1G0H A;  4H8J A;  1D4N A;  5H8Q A;  4MFI A;  1R1N A;  5ICT A;  1FPG A;  4OA4 A;  4PTK A;  1MXX A;  3QUF A;  1ZIU A;  3BBR A;  3H4Z A;  4BDN A;  4OZ9 A;  3FD3 A;  2DYX A;  3ROJ A;  5LOM A;  1LAH E;  1FPD A;  1AL3 A;  4K3F A;  1JQF A;  1YZ0 A;  1B1X A;  2XA5 A;  1A99 A;  3PPO A;  4ONY A;  2B4M A;  1OLC A;  3CI8 A;  1UIV A;  1K9Z A;  4MNI A;  5LDZ A;  1US5 A;  3TQW A;  5AA2 A;  3R6U A;  4X04 A;  5ESY A;  1FRP A;  2AL4 A;  4RPO A;  3G3K A;  4LP2 B;  1CE2 A;  2Y7W A;  1NI9 A;  2V84 A;  1ZKB A;  2P2A A;  4NG7 A;  3EN3 A;  1RDZ A;  3TFL A;  1LBB A;  3CFL A;  4E0X A;  2OCU A;  4QFO A;  3KC1 A;  1BP5 A;  2OK2 A;  3S9E A;  5BUU A;  3CG3 A;  3N94 A;  3B50 A;  4NX1 A;  4FEB A;  1H3D A;  2HCA A;  3G3I A;  3MP6 A;  5I3S A;  5H8H A;  1MQJ A;  4F29 A;  4P11 A;  2Q74 A;  3FVO A;  5J16 A;  4NF4 A;  5DT6 A;  1ELJ A;  4YMA A;  4OQO A;  3O6I A;  3TMG A;  1XVY A;  4GQO A;  1ZBM A;  1XI6 A;  4HCW A;  4ZEC A;  4P0G A;  4KCD A;  4DLD A;  3EQ1 A;  2PBW A;  1OVB A;  4ELR A;  2PVU A;  1A54 A;  4GX4 A;  4PE3 A;  4GF8 A;  2P3N A;  1N7W A;  2ONR A;  3FJG A;  4F3G A;  3IO6 A;  5I2N A;  4ND9 A;  1GTK A;  4Q5T A;  5B70 A;  1YPN A;  3C4M A;  1M5F A;  1MY3 A;  1URD A;  2DVZ A;  2XWI A;  2F34 A;  4HS7 A;  1FPK A;  3BKI B;  4NF8 A;  4PDH A;  1KZ8 A;  1D3K A;  2DDK A;  5AA4 A;  4ESW A;  2F36 A;  1DOT A;  4LQ5 A;  3UIF A;  3VLU A;  4KPT A;  1SYH A;  2Y7P A;  4BLA A;  2Q2C A;  5ITP A;  4EQ7 A;  5J1D A;  3QUJ A;  1FPI A;  1Y20 A;  4MBP A;  3U92 A;  1LBW A;  3FV2 A;  5KDT A;  2ZXT A;  2BJJ X;  2REG A;  2QS4 A;  4LQ2 A;  3JZJ A;  1FBP A;  2Z22 A;  3M8U A;  4NHB A;  2FHY A;  4GWS A;  2UVJ A;  4XKR A;  3RGY A;  4NMY A;  4MLQ A;  4GWZ A;  1IXG A;  5L9S A;  2DWH A;  1NV0 A;  2XXP A;  4C1U A;  4WEP A;  1MY0 A;  3SEV A;  1MQG A;  2ONK E;  2F7C A;  3IO4 A;  3UGW A;  1B2H A;  1LST A;  1B0H A;  1N3X A;  2CZI A;  5I2K A;  3IB1 A;  1M5B A;  1B3L A;  5BWJ A;  3E9X A;  1D9Q A;  1N84 A;  4YKK A;  4KD5 A;  4R72 A;  1JEU A;  3RN8 A;  1IMF A;  3OEM A;  5TP9 B;  2HXW A;  1P1O A;  2VD3 A;  1FQB A;  4IY5 A;  4ISU A;  4F1Y A;  3LSF B;  2UVG A;  4OVR A;  5KZT A;  5DVI A;  3PGF A;  2Z23 A;  2DOJ A;  3T9H B;  1B32 A;  1NV2 A;  2Y7K A;  4H6D A;  4BDL A;  1JVY A;  3Q28 A;  1O7T A;  1S9T A;  2XXI A;  3DEL B;  5EQA A;  3K2D A;  4F19 A;  2H4I A;  3IOU A;  1SW2 A;  3GYY A;  2Q8M A;  3HST A;  3K1M A;  3QSL A;  1B3F A;  2XWO A;  3RUM A;  2UYF A;  4G68 A;  4GL0 A;  3TCF A;  4R73 A;  2ZNU A;  1FBH A;  2Z8F A;  4GVO A;  3MP8 A;  1IMC A;  1IMD A;  2QFL A;  1QGX A;  2V25 A;  3K00 A;  2X26 A;  1IEJ A;  1OQG A;  1HSE A;  3U8Q A;  5JTY A;  5ITO A;  3S4U A;  1PB7 A;  3GBA A;  4FAT A;  3O2A A;  1KA0 A;  2QMW A;  4ELO A;  3HHF A;  5AE4 A;  3PMX A;  1BK4 A;  1CB6 A;  4F3S A;  3V89 B;  4KHZ E;  1IMA A;  3KBR A;  1JVX A;  5I58 A;  3PU5 A;  2AIX A;  3K6U A;  5H8N A;  5FTH A;  1FTM A;  1AMF A;  4RJZ A;  3PPR A;  1G0I A;  1LFH A;  3CVG A;  3LSW A;  2KR0 A;  4FIM A;  3SER A;  3ILU B;  3ODB A;  1XC1 A;  3KZG A;  5JEI A;  1UTH A;  4F2Q A;  1YTV A;  4QRZ A;  5HPQ A;  2GHB A;  4DI4 B;  2X7Q A;  4G77 A;  3M3K A;  1B7H A;  3O6G A;  1URG A;  2G29 A;  4QF9 A;  4YZZ A;  1IME A;  1FBF A;  4GL8 A;  5LTC A;  1PBQ A;  4U22 A;  1ZTY A;  1B3E A;  2AYS A;  1B4Z A;  4F1U A;  1LBZ A;  4GWO A;  4ZEF A;  1PB8 A;  2ZMB A;  3DP6 A;  4YKI A;  4N15 A;  2RKM A;  1LAF E;  1ANF A;  4MEV A;  2F6P A;  2RCA A;  5AA1 A;  5EYG A;  3RPW A;  3SET A;  5H8S A;  1B9J A;  4QFL A;  1NNF A;  3TTN A;  3KC0 A;  4OVJ A;  2A5S A;  3VDF A;  4HCY A;  3MYU A;  2GQ1 A;  3FXQ A;  3M3L A;  3RT8 A;  3EHU A;  1OMP A;  3H06 B;  3TTM A;  4XF5 A;  1N76 A;  1TFD A;  2WX9 A;  4TLL B;  2I0B A;  3PV0 E;  1MG1 A;  4P0I A;  2ZYO A;  1N04 A;  5IGA A;  3PUZ E;  4YKJ A;  5DVJ A;  4EXK A;  3E79 A;  1URS A;  4F31 B;  1UQW A;  1O63 A;  5EQ7 A;  2HZL A;  4H45 A;  2Q88 A;  3SEY A;  3KJT A;  1XVX A;  3IX1 A;  4OET A;  3QK6 A;  2DE2 A;  1H43 A;  3D4G A;  4OHN A;  1I6A A;  2ZZX A;  3T9U A;  3KOT A;  4KXP A;  1VR5 A;  2R6G E;  4ZED A;  4KQP A;  3ZKK A;  3H6U A;  4GBW A;  1NV6 A;  5FTI A;  4GX3 A;  2M8C A;  1B0L A;  2VPO A;  1MQH A;  3I6V A;  4I1D A;  2H9B A;  2QMX A;  1NFT A;  3RNN A;  3E13 X;  2FBP A;  3K01 A;  3KGC A;  3EKI A;  1MH3 A;  4H0W A;  4H67 A;  5EYH A;  2PYY A;  4JVC A;  2Y84 A;  3MVW A;  3O97 A;  1BTJ A;  3TUS A;  3BFU A;  4IO5 A;  3FIR A;  4LZ8 A;  2F3B A;  4IGR A;  2I4B A;  3TTR A;  4U23 A;  3GBB A;  2R9J A;  2B3B A;  1TFA A;  3HHG A;  4PDD A;  1M5E A;  2OPD A;  3MZ1 A;  4H5G A;  5CM6 A;  3K1P A;  4QFK A;  3MPK A;  3TEP A;  5ICQ A;  3KJ7 A;  4OXV A;  4PCD A;  1SYI A;  5I56 B;  4KCC A;  2I49 A;  5T3J A;  4GWX A;  3VLW A;  1DK4 A;  2Y5K A;  4N07 A;  3IFC A;  3IB2 A;  2XXT A;  4IO7 A;  1INP A;  2QS3 A;  1LBC A;  5DYH A;  3ONM A;  4HTG A;  1FCK A;  1OIB A;  1Y3N A;  3JYR A;  2Q2A A;  2H98 A;  1ZJL A;  1HSL A;  3N26 A;  3HN0 A;  4EUO A;  1QUK A;  4R9F A;  1MDQ A;  4QSD A;  4F2O A;  3PPP A;  1FPL A;  4I3E A;  4ZS9 A;  1EZP A;  4RYA A;  2JJK A;  1FJ6 A;  1ATG A;  1GVC A;  5EQ9 A;  1JET A;  4DXC A;  2F78 A;  2ZNT A;  4IY6 A;  4YU0 A;  2V4C A;  3KN8 A;  1PC3 A;  5CMM A;  5K2Y A;  3SEU A;  1AH5 A;  3TDJ A;  3UP9 A;  2NWJ A;  4JSD A;  4Z0I A;  1BKA A;  3FV1 A;  3K1N A;  4TLM B;  3MUQ A;  4H1X A;  4ZEB A;  2XWV A;  2O84 X;  1PDA A;  4PC9 A;  4XKP A;  2I3V A;  4NF5 A;  1NV4 A;  3SKP A;  2KQZ A;  3PMW A;  5H8Q B;  3EPE A;  2CEX A;  4NF0 A;  3FVK A;  3MQ9 A;  3OSQ A;  4PGN A;  4R6H A;  3MP1 A;  4N6P A;  3H7M A;  1QUL A;  1WOD A;  3N5L A;  3WAF A;  4G4P A;  1TWY A;  4JVD A;  4PFR A;  4JVI A;  4O94 A;  1CNQ A;  1Y3Q A;  3C9H A;  4H5F A;  3OO9 A;  1B3G A;  1QW0 A;  3OEN A;  4PAF A;  4BDO A;  3VXC A;  2HXR A;  3UN6 A;  1MQI A;  1H44 A;  1II5 A;  3MWB A;  4LUB A;  3HO7 A;  2RC7 A;  3OEL A;  1LLS A;  4JSO A;  4C1T A;  4DI3 D;  1EH3 A;  1SD3 A;  4PFU A;  4X9T A;  5DW8 A;  4YMB A;  4RNS A;  4KYD A;  3E78 A;  5H8F A;  4PET A;  3FJM A;  4KR5 A;  1MQD A;  1DBZ A;  3G3J A;  2XD3 A;  3FGS A;  3VE1 B;  4PFW A;  3O29 A;  1NUZ A;  1EZ9 A;  1SI1 A;  2XXR A;  5L8D A;  1YAE A;  4FAJ A;  4MNC A;  3FAS A;  4GWU A;  2CZH A;  4QSC A;  4ZDM A;  3Q29 A;  3LUY A;  4GOT A;  4JB7 A;  3D1R A;  3OD7 A;  4R6K A;  5H8H B;  2Y7R A;  4G8M A;  3IJX B;  4DE8 A;  4F1V A;  3IR1 A;  3PD8 A;  3VVE A;  2H99 A;  1MRP A;  1IXC A;  3RT6 B;  4ZEI A;  3S9N C;  4DCX A;  4YB6 A;  5I57 A;  3K4U A;  2PT1 A;  1YCJ A;  2A5T A;  3DM0 A;  1Y3P A;  3P7I A;  1FQF A;  2ANJ A;  1UIU A;  1MXV A;  1LAG E;  2Z8E A;  4OMB A;  3USD A;  3PUY E;  3A3U A;  3N6T A;  3C35 A;  4QSE A;  4F3P A;  4HW8 A;  4JBZ A;  1LBX A;  4XXU A;  3PPQ A;  4WKM A;  2OWT A;  1DPP A;  1UTB A;  4RXL A;  1LGB C;  3B6W A;  1FTJ A;  3O66 A;  2QVR A;  2O7I A;  3TPA A;  3OOA A;  2XXW A;  3G7W A;  4FOR A;  3KFM A;  4QXD A;  3RPL A;  4MCO A;  5ET7 A;  4NF8 B;  4F22 A;  1O64 A;  1MPD A;  1NV1 A;  5AA4 B;  4RY1 A;  2DWA A;  3FZV A;  1FQD A;  1IMB A;  1FW0 A;  4PF8 A;  1MS7 A;  4X1D A;  2V3Q A;  3U72 A;  2RF1 A;  3KSX A;  4N4U A;  3B8B A;  5A5X B;  4N6D A;  1AOV A;  3RLF E;  2WYP A;  3PUW E;  1P1N A;  4I40 A;  2XWK A;  4YIC A;  3D4C A;  3RY3 A;  1DTG A;  1KWH A;  4MJO A;  1NUX A;  1POT A;  4UAB A;  4JWO A;  4PP0 A;  1Y4C A;  4X8R A;  3HPI A;  2XXU A;  1XHY A;  3KN3 A;  1FPB A;  3FAT A;  1L5T A;  3R7X A;  4G8N A;  1IUD A;  3QAX A;  2XHD A;  4MMP A;  2CZK A;  3IB0 A;  3MVZ A;  1JW5 A;  1WDN A;  5DVF A;  3UK4 A;  1FTO A;  1BLF A;  3B6T A;  5I59 A;  4XIG Q;  2YJP A;  3M3F A;  1JW4 A;  3T22 A;  5A5L A;  3Q27 A;  3KN7 A;  3NOH A;  3UA8 A;  3G3G A;  3A29 A;  1A8E A;  4KYE A;  3MZB A;  4Q8R A;  3VLV A;  4RPN A;  4I62 A;  5I2K B;  1IXH A;  3C31 A;  3MW0 A;  3IAZ A;  3BIG A;  3CFX A;  1FPE A;  2QJE A;  3GZG A;  4GLI A;  4YB5 A;  3T96 B;  4OEN A;  4NE4 A;  4I8C A;  5K2X A;  5TPA B;  1MM6 A;  4LVQ A;  3MAM A;  1IQ7 A;  2HZK A;  1SDX A;  4THI A;  3TCH A;  5CI5 A;  3QIM A;  4KFQ A;  1YYZ A;  2O1L A;  3MPL A;  1RKM A;  4ELQ A;  4XKN A;  2B3F A;  3IL1 B;  2XX8 A;  1HSJ A;  3W9W A;  3TTL A;  2OWS A;  1B4H A;  2DSF A;  3KG2 A;  4Z7E A;  1B58 A;  3C32 A;  3CR9 A;  2GH9 A;  4EQ9 A;  3SEX A;  3W15 C;  4NTL A;  4C0R A;  4P1E A;  4IR8 A;  3T0J A;  1FPF A;  4NF6 A;  3FXU A;  1GV8 A;  2YPN A;  1GR2 A;  2PCR A;  3LSX A;  4L17 A;  4OFJ A;  2YLN A;  2HFB A;  2UXA A;  1FBG A;  2FIE A;  1MY1 A;  3DP8 A;  1NV3 A;  4AB5 A;  2DVC A;  1VFD A;  4AS4 A;  2PFZ A;  3GLB A;  4LAT A;  4OES A;  2F8D A;  1YXI A;  4PF6 A;  5I7I A;  4N81 A;  5IZZ A;  3C36 A;  2Y7I A;  5JTY B;  3S9M C;  2FA7 A;  4EDP A;  4FBP A;  1IIW A;  4LN5 A;  4NGU A;  4RK9 A;  1A40 A;  3CHG A;  5FHO A;  4G8H A;  1TT1 A;  2DS9 A;  5DEX B;  3LR1 A;  5IZ3 A;  2Q8J A;  4IO4 A;  5I58 B;  2QS2 A;  1FTK A;  3T9X B;  5H8N B;  3FXR A;  3W9V A;  4PQJ A;  3UOR A;  4POX A;  1B7U A;  2HHM A;  3O28 A;  2FVZ A;  4OVP A;  1I6B A;  5ET6 A;  2B4L A;  2I58 A;  2XXK A;  4PFI A;  1UTH B;  1JP4 A;  3HCQ A;  1QKB A;  1M5C A;  2HQ0 A;  5DTB A;  4G68 C;  1A7L A;  2V3T A;  4QFP A;  5CBR A;  3ZSF A;  2OX3 A;  4UAC A;  1SQY A;  3B6Q A;  3CFZ A;  3TQL A;  4U2R A;  3LC8 A;  1B52 A;  4H46 A;  1VSO A;  3CSG A;  5I84 A;  4NAP A;  1QJM A;  1MY2 A;  2O68 A;  4OYV A;  1R9L A;  3OSR A;  3A09 A;  3L6G A;  2F7B A;  3PUX E;  5TU0 A;  1Y1Z A;  3VV5 A;  1Y9U A;  4GWW A;  4G61 A;  4Q30 B;  3MBP A;  4ZZA A;  1QKA A;  1NNT A;  3K6V A;  5ELV A;  1MXY A;  3T93 B;  1R9Q A;  4U21 A;  5CBS A;  4IO6 A;  4TQU Q;  4OER A;  4NED A;  4XTC Q;  1VFE A;  4QFN A;  4NWC A;  1LFI A;  1SW5 A;  3LSL A;  4GXS B;  1MPB A;  3GXA A;  5FBP A;  5M2V A;  4BDR A;  4H8I A;  3T1B A;  3LBS A;  2QS1 A;  4PFB A;  5CC2 A;  2I0C A;  4P56 A;  2O7U A;  3A3C A;  1J1N A;  1SW4 A;  1IIT A;  2R71 A;  5FHN A;  3TTK A;  5CMC A;  3VXB A;  2Z8D A;  2P0S A;  3G3F A;  2OBG A;  1DCU A;  4HE2 A;  4PBQ A;  4N91 A;  4HXV A;  4YAH X;  2G93 A;  4QBA A;  4OVT A;  1OVT A;  3FVG A;  4NQ8 A;  3MJN A;  3V5A A;  4JWX A;  4LZ5 A;  1N3W A;  2AL5 A;  3PTY A;  4ESX A;  1FBC A;  1NV7 A;  1Y1M A;  4DIG A;  4U1Z A;  2KLF A;  1K9Y A;  3DP4 A;  5KCJ B;  4MHF A;  3THI A;  3E4R A;  2DQV A;  3TCG A;  3ISP A;  1SPI A;  2ABH A;  3OO8 A;  5F7V A;  1B46 A;  3TYH A;  4OTE A;  1MH4 A;  2FYI A;  4TOZ A;  1LBY A;  2VOZ A;  3IOR A;  2ZZW A;  4IO2 A;  3SEW A;  3TEL A;  4DXB A;  2RC8 A;  2FIX A;  3TKD A;  4WXJ A;  1B5I A;  1FTL A;  4OFL A;  4OVQ A;  1IXI A;  1NUW A;  3U94 A;  4P9K A;  1LCF A;  2F3D A;  2D21 A;  4FEC A; 
#chains in the Genus database with same CATH homology
 4GX6 A;  4MNP A;  5I5P A;  4P1L A;  1LBV A;  2OWZ A;  2Y5L A;  5ET8 A;  1G0I A;  2KR0 A;  1LBX A;  4N8G A;  2PFY A;  1FJ9 A;  3MST A;  4OVS A;  2QVR A;  4DI4 B;  2CEY A;  4QXD A;  3RPL A;  4MCO A;  5ET7 A;  2Q9T A;  4P47 A;  4YZZ A;  1IME A;  1FBF A;  1EYK A;  5LTC A;  1NV1 A;  5IZ3 B;  4MAG A;  4F1U A;  1LBZ A;  3LUZ A;  2VT5 A;  3HFU A;  4N15 A;  1G0H A;  1IMB A;  4MEV A;  4PF8 A;  5EYG A;  2V3Q A;  4N4U A;  3B8B A;  4N6D A;  1FPG A;  2WYP A;  4OA4 A;  4PTK A;  4I40 A;  3KC0 A;  2XWK A;  4YIC A;  4N8Y A;  2WBD A;  4HCY A;  4O7M A;  3MYU A;  3FBP A;  2GQ1 A;  4MJO A;  4XF5 A;  1NUX A;  4UAB A;  3ROJ A;  4X8R A;  4M1V A;  4MIJ A;  1FPB A;  2WX9 A;  1FPD A;  4MMP A;  2CZK A;  1YZ0 A;  2XA5 A;  5IGA A;  3QMF A;  2B4M A;  3E79 A;  3FXB A;  2WBB A;  5A5L A;  5EQ7 A;  3NOH A;  2HZL A;  4H45 A;  1K9Z A;  4MNI A;  3A29 A;  5LDZ A;  4X04 A;  5ESY A;  1FRP A;  2DE2 A;  2ZZX A;  4KXP A;  1NI9 A;  4GBW A;  2DE4 A;  1NV6 A;  4NG7 A;  3BIG A;  4GX3 A;  1FPE A;  1RDZ A;  4OAN A;  1FPJ A;  2VPO A;  3LV0 A;  3KC1 A;  4GBV A;  5JK4 A;  5ET5 A;  2HZK A;  2FBP A;  3B50 A;  4NX1 A;  1FSA A;  1YYZ A;  3EKI A;  5I3S A;  5EYH A;  4HE1 A;  4JVC A;  4HE0 A;  3W9W A;  2Q74 A;  5J16 A;  1XI6 A;  2F3B A;  4HCW A;  2DE3 A;  4P1E A;  4PDD A;  4IR8 A;  3T0J A;  1FPF A;  2L5V A;  2PCR A;  5IZ1 A;  4GX4 A;  5CM6 A;  4PE3 A;  1FBG A;  2FIE A;  1NV3 A;  2P3N A;  4PCD A;  2F5X A;  4AS4 A;  2PFZ A;  1LEV A;  5T3J A;  4GWX A;  1YXI A;  4PF6 A;  5I7I A;  4N81 A;  5IZZ A;  4I3Y A;  1KA1 A;  1DK4 A;  2DVZ A;  2Y5K A;  2XWI A;  3IFC A;  1FPK A;  4FBP A;  4LN5 A;  4NGU A;  4GWY A;  1INP A;  3CHG A;  4O8M A;  1Q9D A;  3KBZ A;  4PDH A;  4N17 A;  1KZ8 A;  4N6K A;  2DDK A;  5IZ3 A;  4MX6 A;  3W9V A;  5J1D A;  1FPI A;  4XEQ A;  1FPL A;  4I3E A;  2HHM A;  5F24 A;  2FVZ A;  4OVP A;  2JJK A;  5ET6 A;  1FJ6 A;  1FTA A;  1LBW A;  4PAK A;  2B4L A;  4P8B A;  2WYK A;  5EQ9 A;  2XXK A;  5IM2 A;  4PFI A;  1JP4 A;  3U65 A;  1FBP A;  4NHB A;  2V4C A;  2FHY A;  2OX3 A;  4GWS A;  3BIH A;  3RPL B;  2HPG A;  4GWZ A;  1NV0 A;  2QPQ A;  2XWV A;  4H46 A;  4NAP A;  4PC9 A;  1AWB A;  1NV4 A;  2KQZ A;  2CZI A;  4AS5 A;  4PAI A;  4GWW A;  4G61 A;  2CEX A;  4NF0 A;  4PGN A;  1D9Q A;  4O7I A;  4JVD A;  2R8T A;  2WEF A;  4PFR A;  4JVI A;  2MKZ A;  4O94 A;  1CNQ A;  1IMF A;  2QVU A;  1RDX A;  4PAF A;  4PGP A;  5FBP A;  1NUY A;  4OVR A;  4XFE A;  2HXR A;  3T1B A;  4NN3 A;  4PFB A;  1RDY A;  1NV2 A;  1FBE A;  4P56 A;  3RYD A;  4DI3 D;  1EYJ A;  1DCU A;  4HE2 A;  4PBQ A;  4N91 A;  4X9T A;  5DW8 A;  4HXV A;  5EQA A;  2QVV A;  4QBA A;  3E78 A;  4OVT A;  4F19 A;  4PET A;  3GYY A;  2VPN A;  1DBZ A;  4NQ8 A;  3SZP A;  2Q8M A;  2ZZV A;  1VDW A;  1NUZ A;  3PTY A;  2XWO A;  2BJI A;  1FBC A;  1NV7 A;  4MNC A;  1K9Y A;  1FBH A;  4GWU A;  2CZH A;  1IMC A;  4MHF A;  2P3V A;  1IMD A;  1NV5 A;  1QGX A;  2QFL A;  3D1R A;  4PBH A;  3ISP A;  1SPI A;  4F18 A;  4F1V A;  1LBY A;  2ZZW A;  1KA0 A;  1EYI A;  2FIX A;  4OVQ A;  1BK4 A;  1NUW A;  4P9K A;  3IFA A;  1FBD A;  4P3L A;  2F3D A;  1IMA A;  5EQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...