1IMFA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
262
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 262
sequence length 272
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imfA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imfA02
5EQ7A 5F24A 3ROJA 1IMFA 1RDZA 2BJIA 1NV4A 1NUYA 4HXVA 3IFCA 3KBZA 2PCRA 1KZ8A 5FBPA 1NUZA 1NV6A 1LBYA 1JP4A 5IZ3A 1YZ0A 1KA0A 2FIXA 1SPIA 3LUZA 2CZKA 2QFLA 1NI9A 2JJKA 1FPJA 1NV7A 4HE1A 4GWXA 4PTKA 1CNQA 1FPFA 3LV0A 2OX3A 3QMFA 5IZ1A 1FPGA 2OWZA 1FBPA 1INPA 1FJ6A 2DDKA 2WBBA 2GQ1A 4GX4A 5EYGA 1IMEA 1EYIA 2QVRA 1DK4A 4GX3A 1RDYA 4FBPA 3T0JA 4IR8A 1RDXA 4H46A 1K9ZA 1XI6A 1IMCA 1IMDA 4MJOA 2R8TA 4AS5A 4GX6A 1KA1A 1NV2A 4GWZA 2FIEA 4GWSA 3BIHA 1IMBA 4I3EA 3KC0A 1FRPA 2WEFA 2Q74A 2P3NA 1FPDA 3B8BA 4AS4A 3D1RA 2QVUA 4GWUA 1FBCA 3A29A 1FTAA 1FPKA 5ESYA 1FBHA 2QVVA 2F3BA 1DBZA 2Y5LA 1AWBA 1LBZA 2Y5KA 4I40A 1NV3A 5ET5A 4HE2A 5T3JA 1D9QA 1NUXA 2HHMA 3KC1A 1QGXA 1BK4A 4GBWA 3FBPA 5J16A 1FSAA 5I3SA 1FJ9A 1FPIA 4H45A 4QXDA 5ET6A 2CZIA 1FBDA 5EQ8A 1G0IA 1LEVA 5IZ3B 1FBFA 4N81A 1FBEA 4I3YA 1NV5A 3RPLB 1YXIA 4KXPA 5EYHA 2VT5A 3RYDA 1LBWA 3IFAA 2CZHA 4GWWA 4GBVA 1K9YA 2Q8MA 1EYKA 1FBGA 1YYZA 1FPBA 4G61A 5A5LA 1NUWA 1EYJA 1Q9DA 5DW8A 3RPLA 2FHYA 5ET7A 1LBXA 1FPLA 2P3VA 1NV0A 1VDWA 5EQ9A 1DCUA 4O7IA 1NV1A 2FBPA 2FVZA 1LBVA 1FPEA 2F3DA 3BIGA 2WBDA 5ET8A 4GWYA 5EQAA 4HE0A 1IMAA 1G0HA 5LDZA
chains in the Genus database with same CATH superfamily
4H6DA 1Y20A 3O6HA 3UIFA 2B65A 5FBPA 3G7WA 1Z7NE 3MP6A 4F2OA 1JP4A 2XWVA 2FIXA 4KPTA 2PFZA 3PMVA 4FEDA 2UYFA 1NV7A 2CZLA 1FTLA 2UXAA 1CNQA 1LFHA 4YZZA 1MY3A 1P1QA 2H4IA 1IMEA 4PQJA 1QULA 3B6QA 1XC1A 1IQ7A 1RDYA 2RKMA 3OELA 3JYRA 4IO6A 1ANFA 1B6HA 1B0LA 5L9SA 1SI0A 5TP9A 1FRPA 3E9XA 1UIVA 4AS4A 5CMBA 4GWUA 1B4HA 5H8NB 4RXLA 1FBHA 1B5HA 3SERA 3H6VA 2QSXA 5DT6A 5I59B 1FSAA 3OENA 4P0GA 3ZSFA 5CMCA 3TZAA 1TT1A 2F8DA 2XXPA 5EYFA 4NF4A 3MP8A 1LGBC 4ECFA 1B58A 1LAHE 2F97A 3HN0A 3S9EA 3ZKLA 1US5A 1IXHA 5ELVA 4OHNA 3SZPA 5TU0A 4IB2A 2F78A 3IB2A 3CFZA 3U93A 3CG3A 2WBDA 2G29A 1MXVA 3K1NA 1B0HA 2V4CA 4QSEA 3B7DA 2Q2CA 5K2XA 2QFLA 1ZU0A 4EXKA 3W15C 3LV0A 4R72A 3VV5A 2OX3A 4DXUA 3DM0A 2AL5A 5AA2A 5HBCA 4GX4A 3O2AA 1NKXA 4GOTA 4XIGQ 3IOVA 2CMOA 4GX6A 3QYTA 3M3KA 4MLQA 1GVCA 4ESXA 1WODA 3M3FA 4KYEA 3E13X 3MAMA 3VLVA 1MQDA 3O6IA 4KI0E 4ZS9A 4LQ2A 3UP9A 5JEIA 4JSOA 1IUDA 3U92A 5HM4B 4QHQA 4I8CA 1NV5A 3TQWA 2HXRA 2Z8DA 3C31A 4R73A 2HEUA 1SVXB 3MVZA 3LBSA 3PPNA 1B1XA 2DVCA 3N6TA 4POXA 4O7MA 4EUOA 5IKBA 4OA4A 4BLAA 4PC9A 4OENA 4JSDA 3RY3A 4HE0A 2VD2A 4PP0A 3H6TA 2M8CA 4I1DA 4NF5B 3M8UA 1IMFA 3T9VA 3T9HB 1PB9A 3UORA 2DQVA 1QKAA 2X7QA 3MVWA 2GFEA 3ZKKA 1N3XA 4OVQA 2PT2A 5H8FB 4MFIA 5LTCA 4MNCA 4TQUQ 5DEXB 5CI5A 2NVUB 4F18A 1XI6A 4MJOA 2XX7A 3RTFB 5I7IA 2DE3A 3MWBA 3SKPA 4PAKA 2P3NA 3V5AA 1P1WA 5CRYA 3D1RA 3HCQA 5L9OA 2XXVA 2F3BA 2A5TB 3S4UA 3PMWA 3T9UA 1BTJA 3CSGA 2VD3A 3HO7A 3KOSA 4MCOA 2RC9A 3GZGA 4ELOA 4I3YA 3K0VA 2H9BA 3C32A 1OLCA 1SW5A 2XXRA 4PFWA 1FQEA 3IO4A 4PGPA 1GR2A 4LP2B 1H45A 1MS7A 5I5PA 1IZ1A 2AYSA 2OLBA 1JNFA 2F3DA 2I3WA 2F5XA 1R6ZA 4R9GA 2R71A 1N7WA 2V25A 1RDZA 4NWCA 2BJIA 4C0RA 3MZ1A 1Y3NA 3TCFA 3LUZA 4NG7A 4MHFA 3T9XB 5JTYA 4DZ1A 2BJJX 3M3LA 2I48A 4LVQA 3F11A 1USYH 4QRZA 1N7XA 3RGYA 3RUMA 4YAHX 5CC2A 4PTKA 3MVXA 4F22A 1DTGA 4IGRA 1FPGA 2PT1A 2OWTA 4PE5B 1MXZA 3FUZA 1EYIA 1OQGA 2B4LA 5B70A 5L9MA 3KN8A 4PGNA 1IMDA 4NF4B 4IO7A 4GWZA 3G3HA 3FATA 3LC8A 1IMBA 2I49A 2GHBA 2DSFA 2WEFA 4ONYA 3LSXA 4Q30B 2QRYA 3HFUA 1H43A 2HCAA 1DBZA 4FATA 4FJPA 5ET5A 2ZYNA 1FTJA 4PAIA 2ZMBA 2UYEA 4HS7A 2I6EA 3G3JA 1HSEA 2XXWA 4U22A 4H45A 3O28A 4R6KA 1MPBA 5ET6A 2CZIA 3K2DA 2XX8A 3SEXA 2I58A 1FBDA 2MKZA 4QF9A 3LSFB 2NUVA 1PEBA 1M5EA 3IAZA 4N6KA 3TTMA 4EF1A 4P1EA 3OO9A 1Q1KA 4ZDMA 4QFPA 4P9KA 5AA2B 4XKQA 3EPEA 3CSBA 1MQHA 3JV9A 4GVOA 1UQWA 1XHYA 3Q26A 1FPLA 2ONKE 1AOVA 3KN7A 4F3SA 3C4MA 2O1MA 4XXUA 3SESA 1O7TA 3U1OA 1B32A 2DE4A 1PB7A 1M5FA 2AIXA 4LN5A 1NNFA 3CG1A 1KA0A 1QUKA 1BIYA 3IR1A 5A5XA 2QS4A 3U72A 3L6HA 3FV1A 3B6WA 1FJ6A 2DDKA 4OZ9A 4P3LA 4GX3A 3MP1A 1LFIA 3IOTA 4OFLA 2XXQA 4X1BA 4F3BA 3GBAA 1KA1A 3RTWB 2XXKA 4YMBA 2OPEA 5AA2D 3KC0A 4JVIA 2LAOA 2O1LA 2WKYA 4OEUA 3W9WA 3IOUA 2XXYA 3QIMA 4GLIA 2XXTA 5BUUA 5HPQA 1MPDA 1ZLQA 3KBRA 3ECRA 2UVIA 1EZOA 1UTBB 3GLBA 1ZTYA 3D4GA 4F1YA 5FHOA 2P2AA 2Q9TA 4JDFA 5KZTA 2VT5A 3PUXE 2F7BA 2Q88A 4G8MA 4H8JA 3MJNA 3EHTA 2Z8EA 2O7UA 4OQOA 4P11A 1MQJA 3C33A 1T0KA 1FCKA 2D3IA 4JVCA 3BIGA 1DMBA 4PFIA 5EQ7A 3ROJA 3KJ7A 4QSCA 4NEDA 3K02A 2Q2AA 1NNTA 1VR5A 2ANJA 1B3EA 2DOJA 2JJKA 4GIZA 5ISUA 4KCCA 1Y3PA 4XKNA 1N3WA 3B50A 2H99A 4YB5A 3UGWA 1FBPA 3S9LC 4FEBA 1HSJA 2ONSA 1A55A 4X8RA 4R74A 3PPRA 2V84A 3T93B 3K4UA 3R6UA 4F3PA 4P8BA 1QJMA 1SW2A 2Q74A 1P1UA 3CR9A 3C36A 3A29A 4NQ8A 3V89B 2F7AA 2VOZA 2RCBA 1BK4A 3SEYA 1RYOA 1DOTA 2B3BA 2DYXA 1UIUA 3CFLA 1FBFA 3T1BA 1IEJA 1UTHA 4XKPA 4PDDA 4WEPA 3DP6A 5JTYB 1MXWA 2CZHA 4F39A 2XX9A 3SEUA 2VGQA 4ELRA 2H25A 1B7HA 3S9NC 4MLVA 1MM6A 3PUVE 1H76A 3JZJA 1ZBMA 3TTLA 5I58B 2DE2A 2B3FA 4HCWA 4WEDA 1LBVA 3NOHA 3L6GA 1TWYA 3TODA 4HCYA 5EQ8A 1II5A 4O3BA 4DCYA 2NOOA 2QMWA 1MY1A 3FXQA 4N15A 4YKKA 1B52A 4WKMA 4KFQA 1B2HA 3MC2A 2OWSA 4OVSA 1OMPA 1Z7ME 3N94A 1MQGA 1P99A 2QL3A 4NF6B 5AA4A 2DWIA 2Y7RA 2FNCA 4JWYA 1FQDA 3OEKA 3MUQA 3TFLA 4JBZA 5EYGA 4MBPA 4XKRA 4UABA 3U65A 3UN6A 1BKAA 3WAEA 4YB7A 5CMKA 4NF0A 4U1OA 3EHUA 3B6TA 4F29A 3UK4A 4N4UA 5H8QA 4BDMA 1M5BA 1NV2A 4NF8A 1MRPA 3BIHA 1YPNA 4KHZE 4I3EA 4P0IA 4I9DA 3RNNA 2HAUA 3BFTA 3USDA 4FORA 3FASA 1WVJA 1LBZA 3CFXA 4OETA 5AE4A 2GHAA 2UVJA 5T3JA 1NUXA 3KFMA 1P1NA 3TAJA 3FBPA 2PYYA 2QJEA 1B40A 4GQOA 4ZEDA 2ALUA 1DSNA 4N81A 4H67A 4JXIA 1A8FA 3RPLB 3RYDA 3G3KA 4GWWA 4GBVA 3PUZE 2KR0A 3A3CA 2F35A 4G61A 2Y7PA 3N26A 1QUJA 3KJTA 1EYJA 3K6UA 3N5LA 4DLDA 4R6YA 4G8NA 1A40A 1XVXA 2OPDA 2REGA 5EQ9A 4H5FA 3KZGA 3O9PA 5DVFA 3A3UA 1EH3A 1JQFA 4NWDA 2ZYMA 5H8HB 1OIBA 1NV4A 1MH4A 2F7CA 2VPOA 2F6GA 4O8MA 4XTCQ 3IB1A 1XT8A 4HE1A 4O94A 3PPOA 5KDTA 4GXAA 4ZE8A 4X9TA 2O51A 4LZ8A 1KWHA 1B7ZA 2QS2A 2GRVA 4FBPA 4OMBA 5I2NA 5I56B 1SYIA 3Q25A 4OVJA 1PBPA 4P47A 3OO7A 1LFGA 1A54A 3C34A 1O63A 3LUYA 4TLLB 1MXYA 2DS9A 3GXAA 1XS5A 4QBAA 2H5YA 1QKBA 2Y5KA 4HE2A 4H0WA 2HAVA 4C1TA 3VDFA 4IO5A 5J16A 4FE8A 2XD3A 3HV1A 3TKDA 2Z22A 2Z23A 2A5SA 4PDHA 4PFBA 3AXFA 1B3LA 4AQ4A 1B5IA 1B4ZA 2Q8MA 1URDA 2V3UA 1FPBA 2NWJA 4THIA 4Z0IA 2F34A 5A5LA 1URSA 2DWJA 3H3GA 3V8XB 2OBGA 1FPEA 3CIJA 1IMAA 1YAEA 4U2RA 5I2KA 1D9VA 5JK4A 2XA5A 3Q27A 2XD2A 4BDRA 5DVJA 3BKIB 3VVDA 3GYYA 1B05A 3ZS6A 2DP8A 4NAPA 3C9HA 3I3VA 3DP8A 3Q29A 4LUBA 1A7LA 1MY0A 3PV0E 3QMFA 4R2FA 1INPA 1AMFA 2G93A 4ZEBA 5TPAA 4TLMB 5TP9B 1I6BA 1UTHB 1ZJLA 3VXBA 4DI3D 2F6PA 4RJZA 1MPCA 3FJMA 2FIEA 4NGUA 4F2QA 1R9QA 3IK6B 4OXVA 4M4GA 3FIRA 3OD7A 3O97A 5ESYA 2Y5LA 1Y4CA 4LA9A 4KCDA 3KGCA 5KCJA 4N8YA 1FQAA 2XWKA 2V3TA 3LSLA 2XXXA 4G68C 4POWA 3IJXB 3K01A 1PDAA 4LATA 3P7IA 1H3DA 3E4RA 2WYKA 5AA4B 1LBWA 5I59A 3MPLA 5LOMA 1K9YA 4Z7EA 1FBGA 4MNIA 1M5DA 1B3HA 3ILTB 3EKIA 2ZYOA 2I0BA 4OVRA 4DDDA 1MG1A 2Z8FA 3FVKA 3H6WA 1LBCA 5H8QB 2ZXTA 4PE3A 1B5JA 1MH3A 5F24A 2HZLA 2ZYKA 4F31B 4OWDA 5CMMA 1Q35A 4RK2A 1TFAA 4U21A 1LBYA 4BDNA 1YZ0A 1FTMA 3IX1A 3OEMA 4O3AA 4OEVA 1YCJA 3KEIA 5I57A 4K3FA 4X48A 4EQ9A 2OWZA 2WBBA 4Q8RA 3WAFA 3O29A 3OSRA 4ELPA 3HSTA 1VE4A 5DTBA 1QW0A 2ABHA 4BDLA 4RPOA 4OTEA 3Q28A 4NE4A 3VFJA 3K6WA 1IMCA 1BP5A 4DI4B 3MQ9A 4YICA 3DLNA 1Y9UA 2XXHA 2QVUA 1FBCA 1FQBA 1I6AA 2QVVA 2QS3A 4DCXA 2I4BA 2ZNUA 1OVTA 3MZBA 3RN8A 2OK2A 1USYE 2D5WA 4OFOA 4TOZA 5EYHA 1CB6A 4G68A 3IFAA 2DVZA 1B1HA 3IOWA 5BWJA 1AIVA 2OZZA 1Y1ZA 4GRKA 2E0SA 1B46A 5ITPA 3SEWA 1B3GA 5I2NB 3QAXA 5I84A 4PCDA 4FIMA 5L8DA 2XXIA 2FBPA 3KSXA 1SI1A 2X26A 4F1UA 1JVYA 4GWOA 1FW0A 3U8QA 3VLWA 2WYPA 4HXVA 4NX1A 1OVBA 1IXCA 4IO2A 5FTHA 1MDQA 1D3KA 2ZNSA 3OO8A 2RINA 2HFBA 2RC7A 2ESNA 2DWHA 4WXJA 3ILUB 2D21A 2UVGA 3LSWA 3TPAA 1N84A 1SQYA 2WX9A 3MPKA 2HXWA 2GQ1A 1SD3A 2QVRA 3TELA 4HW8A 2OCUA 1VSOA 2V93A 2YJPA 1NH7A 2R8TA 2ZZWA 4N6PA 3KN3A 3VVFA 1RYXA 3FVNA 4QFKA 3HPIA 1Y3QA 4RNSA 1LAXA 3CVGA 1FPKA 5AA3A 4G8HA 3PD9A 1TXFA 3TDJA 3KC1A 4KYSA 1SW1A 5I2KB 1Y4TA 2ONRA 4QXDA 4MAGA 2DXRA 4KXPA 1LAGE 5CBSA 3GBBA 1LB9A 3MSTA 4XEQA 2VPNA 3T66A 4RY1A 3EN3A 2RF1A 4N17A 4ZZAA 4PBQA 1PBQA 5TPAB 2XWOA 1Q9DA 5DW8A 2FHYA 4RYAA 1LBXA 3MW0A 4KR5A 3PMXA 4OVPA 1O64A 1BLFA 2QS1A 4U4XA 1MXXA 1LSTA 1KZ8A 3VVEA 4BDOA 3MYUA 1NI9A 1B9JA 2O69A 1EU8A 3MZ9A 5KCJB 1US4A 3QUFA 5ITOA 4F3GA 5AA1A 3EHSA 4N07A 2XXUA 5IZ1A 3CHGA 3QK6A 3T96B 4PF8A 4IR8A 4N13A 1RDXA 1SYHA 3ONMA 3OMBA 1K9ZA 2UVHA 4LZ5A 4IY6A 4U23A 4JWXA 2Q89A 3RPWA 4ZEIA 4OVTA 4AB6A 3FXBA 5M2VA 1JW1A 3OO6A 3G3GA 4ZZEA 4LONB 1D9QA 5K2YA 4BDQA 2HHMA 4ZECA 1ZIUA 1R1NA 1VFEA 1XVYA 1POTA 1ZMGA 3O66A 3S9MC 2QMXA 4ZE9A 3TMGA 1DPPA 4GD5A 2E1SA 4EF2A 4YMAA 1YXIA 1MXUA 1DPEA 5I57B 3S2VA 1EYKA 3FD3A 1M5CA 4GFRA 4LQ5A 4ZEKA 4NHBA 4PBHA 1VFDA 5ET7A 3K1PA 1WDNA 2HQ0A 3E79A 3EF7A 1FQFA 3EQ1A 1DCUA 1N76A 2IA4A 1SBPA 1TFDA 5ET8A 4OFJA 1N04A 5EHSA 5A5XB 1IITA 4GL0A 3I6VA 3VLUA 1NUYA 2PCRA 4M1VA 3TCHA 1NUZA 5B7DA 5IZ3A 3ODBA 2I0CA 2HZKA 3KG2A 3FJGA 2CZKA 3TUSA 1MY4A 4GWXA 2Q8JA 1ZKBA 1NMUA 2CEYA 3K1MA 4ZEFA 3I5OA 1NFTA 4H1XA 3PTYA 1JETA 1R9LA 3K6VA 4G68B 4H46A 4F19A 4AS5A 4R2BA 1LBBA 1P1OA 2O7IA 4KYDA 4FAJA 3SETA 3OXNA 1LCFA 3FXRA 2YPNA 3N6UA 3E3KA 4P1LA 3MBPA 1NNPA 4FECA 2XHDA 4G2ZA 3O6GA 3LR1A 1J1NA 3W9VA 5FTIA 1MM7A 2X7PA 1B51A 4MIJA 3R7XA 1OQHA 1G0IA 1LEVA 2CEXA 4QFLA 3TCGA 1OLAA 4YKPA 4EQ7A 5F1QA 3FGSA 3IL1B 3FZVA 3UA8A 1NL5A 2ZNTA 1GV8A 3KSJA 5EHMA 4QFOA 3RQTA 5IM2A 1UTBA 4GXSB 2P1SA 1NUWA 3H7MA 2VHAA 1H44A 4MF3A 3HHGA 1AH5A 2OJTA 4O7IA 2NXOA 4Q5TA 4PAFA 4N8GA 2QPQA 4DE8A 5IAIA 3T22A 3PUWE 2KLFA 3KBZA 3QXMA 2O6AA 3FV2A 3C35A 4RK9A 2F36A 1SPIA 3VE1B 4MEVA 3H03A 5DVIA 2Y7IA 3FJ7A 3U94A 4O3CA 1JVXA 1EZ9A 1QVSA 1XOCA 4OANA 1L5TA 1S7YA 4YKJA 3BBRA 3TEPA 1LB8A 3D4CA 3A09A 4HTGA 4IGTA 4ESWA 3TTNA 4OYVA 1JEVA 2THIA 1QUIA 4IO4A 3TYHA 4GWSA 4G4PA 3TTKA 4KD5A 4N91A 4XFEA 4DIGA 2I4CA 4LZ7A 2HPGA 2O84X 3THIA 5DYHA 4EDPA 3IB0A 2FYIA 1FTAA 5FHNA 4I62A 4I40A 1NV3A 4OERA 1FTKA 1I6QA 3MVYA 4F1VA 3RT6B 4YB6A 4DXBA 2ZZVA 3IJOB 1FJ9A 1FPIA 2RCAA 1HSLA 1POY1 4X1DA 5CM6A 1IIWA 4JWOA 4E0WA 4C1UA 4GL8A 4PFYA 4NN3A 2XWIA 3TTRA 1B7UA 1YYZA 1D4NA 2L5VA 4MH5A 5IGAA 2P0SA 1CE2A 2GH9A 3KOTA 4DXCA 5H8NA 3PU5A 3IO6A 3FVOA 3K6XA 1G0HA 3OOAA 3FXUA 3IFCA 5I58A 3RLFE 4U4SA 1DTZA 1EZPA 1MY2A 4UA8A 4H5GA 4G77A 4P56A 1GTKA 1FPJA 4E0XA 5CBRA 1NNKA 2O68A 1FPFA 3SEVA 4MNPA 4EQBA 2V3QA 4NF8B 2IEEA 1B3FA 2VP1A 1SDXA 4NF6A 4R9FA 3IORA 3T0JA 1RKMA 3SDFA 4JVDA 1MDP1 1JW4A 2Y84A 2DWAA 3PPPA 3OSQA 2ZZXA 2YLNA 1A99A 3G3FA 4H65A 1ATGA 4IO3A 4R6HA 1LCTA 3B8BA 4YKIA 2FA7A 2B4MA 2PFYA 1QGXA 4GBWA 3G3IA 4AB5A 1YTVA 3ISPA 5IZZA 5IZ3B 4ELQA 1FBEA 3V83A 1FQCA 5J1DA 3CRBA 4PF6A 4YU0A 2Y7WA 1N0TA 4L17A 1GGGA 2KQZA 3QSLA 1MQIA 1S50A 1D9YA 4JB7A 4IY5A 4OESA 3RPLA 4RA1A 3QUJA 1NV0A 4NTLA 4EXLA 3VXCA 2REJA 2PX1A 1NV1A 4XF5A 2FVZA 5EQAA 3PGFA 3H6UA 2RC8A 4PFRA 4RPNA 5KDTB 1LAFE 1IXGA 1NV6A 4NMYA 1ELJA 5FHMA 1URGA 2Y7KA 5H8HA 3PUYE 2PBWA 4QSDA 1DK4A 1F9BA 2PVUA 4MMPA 3RT8A 1PB8A 2W7YA 4U1ZA 4QFNA 1IXIA 3R26A 3H4ZA 1FTOA 4MX6A 4NF5A 1JW5A 2I3VA 1FPDA 1S9TA 2AL4A 5ICTA 4H8IA 5F7VA 2R6GE 4X04A 5I56A 3K00A 1AL3A 4PFTA 3CI8A 1JEUA 4PFUA 3PD8A 1AWBA 1A8EA 1LLSA 2DXYA 2H98A 5I3SA 1Y1MA 5ICQA 4UACA 5H8FA 2PMSA 1SW4A 4Q0CA 2R9JA 4PETA 5DEXA 3FVGA 3DP4A 1PC3A 1NH8A 3BFUA 3PPQA 1I69A 4ND9A 2P3VA 1VDWA 4KQPA 5H8SA 4GF8A 4ISUA 4N6DA 2A5TA 3HHFA 3E78A 3H06B 4R75A 3TQLA 4GWYA 3DELB 5LDZA
chains in the Genus database with same CATH topology
2DE4A 5JK4A 2XA5A 1NUYA 4LN5A 2PCRA 5FBPA 4M1VA 1NUZA 1JP4A 5IZ3A 2XWVA 2FIXA 1KA0A 2HZKA 3GYYA 2PFZA 2CZKA 4NAPA 1NV7A 4GWXA 1CNQA 3QMFA 4YZZA 1INPA 1FJ6A 2DDKA 2CEYA 1IMEA 4P3LA 4GX3A 1RDYA 3PTYA 4H46A 4DI3D 4F19A 4AS5A 1KA1A 2FIEA 4NGUA 2XXKA 3KC0A 1FRPA 4JVIA 4AS4A 3W9WA 4GWUA 5ESYA 4P1LA 1FBHA 2Y5LA 4N8YA 2XWKA 1FSAA 3W9VA 4MIJA 1G0IA 1LEVA 2CEXA 2Q9TA 2VT5A 2WYKA 1LBWA 1K9YA 1FBGA 5IM2A 4MNIA 1NUWA 3EKIA 3SZPA 4OVRA 4O7IA 4PAFA 4JVCA 4N8GA 4PE3A 3BIGA 2WBDA 2QPQA 4PFIA 5EQ7A 5F24A 3ROJA 2HZLA 3KBZA 2V4CA 1LBYA 1YZ0A 1SPIA 4MEVA 2QFLA 2JJKA 3LV0A 4OANA 2OX3A 3B50A 2OWZA 1FBPA 2WBBA 4GX4A 4X8RA 1IMCA 4GX6A 4GWSA 4DI4B 4YICA 4P8BA 4N91A 4XFEA 2Q74A 2HPGA 2QVUA 1FBCA 3A29A 1FTAA 4NQ8A 2QVVA 4I40A 1NV3A 4F1VA 1BK4A 2ZZVA 1FJ9A 1FPIA 1FBFA 5CM6A 3T1BA 4PDDA 1NV5A 5EYHA 3IFAA 2CZHA 2DVZA 4NN3A 2XWIA 1YYZA 2HXRA 2L5VA 5IGAA 4O7MA 4OA4A 4PC9A 2DE2A 4PCDA 4HCWA 2FBPA 3NOHA 1LBVA 4HE0A 4HCYA 5EQ8A 1G0HA 4F1UA 1IMFA 2WYPA 4HXVA 4N15A 3IFCA 4NX1A 4OVSA 4P56A 1FPJA 1FPFA 4MNPA 2WX9A 2GQ1A 4OVQA 2V3QA 5EYGA 2QVRA 5LTCA 4UABA 4MNCA 3U65A 4NF0A 3T0JA 4F18A 1XI6A 4N4UA 4MJOA 2R8TA 5I7IA 2DE3A 2ZZWA 1NV2A 4JVDA 3BIHA 4I3EA 4PAKA 2ZZXA 2P3NA 3B8BA 3D1RA 1FPKA 2F3BA 1LBZA 5T3JA 1NUXA 2B4MA 3KC1A 2PFYA 1QGXA 4GBWA 3FBPA 4MCOA 4QXDA 3ISPA 5IZZA 5IZ3B 4N81A 1FBEA 4I3YA 5J1DA 4MAGA 3RPLB 4KXPA 3RYDA 3MSTA 4PF6A 4XEQA 2VPNA 4GWWA 4GBVA 2KR0A 2KQZA 4N17A 4PBQA 4G61A 2XWOA 1EYJA 1Q9DA 5DW8A 3RPLA 4PGPA 2FHYA 1LBXA 1NV0A 5EQ9A 5I5PA 4OVPA 1NV1A 4XF5A 2FVZA 2F3DA 5EQAA 2F5XA 4PFRA 1RDZA 2BJIA 1NV4A 1KZ8A 1NV6A 2VPOA 3MYUA 3LUZA 4NG7A 4O8MA 4MHFA 1NI9A 4HE1A 4O94A 4PTKA 5IZ1A 1FPGA 3CHGA 4X9TA 1EYIA 1DK4A 2B4LA 4PF8A 4FBPA 4MMPA 4IR8A 1RDXA 1K9ZA 4PGNA 1IMDA 4P47A 4GWZA 1IMBA 4OVTA 4MX6A 2WEFA 1FPDA 3FXBA 4X04A 3HFUA 4QBAA 1DBZA 1AWBA 2Y5KA 5ET5A 4HE2A 1D9QA 2HHMA 4PAIA 5J16A 5I3SA 4H45A 5ET6A 2CZIA 1FBDA 2MKZA 4PDHA 4PFBA 4PETA 1YXIA 4N6KA 4P1EA 2Q8MA 1EYKA 1FPBA 4P9KA 5A5LA 4NHBA 4PBHA 5ET7A 1FPLA 3E79A 2P3VA 1VDWA 1DCUA 4N6DA 3E78A 5ET8A 1FPEA 4GWYA 1IMAA 5LDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQ7 A;  5F24 A;  3ROJ A;  1IMF A;  1RDZ A;  2BJI A;  1NV4 A;  1NUY A;  4HXV A;  3IFC A;  3KBZ A;  2PCR A;  1KZ8 A;  5FBP A;  1NUZ A;  1NV6 A;  1LBY A;  1JP4 A;  5IZ3 A;  1YZ0 A;  1KA0 A;  2FIX A;  1SPI A;  3LUZ A;  2CZK A;  2QFL A;  1NI9 A;  2JJK A;  1FPJ A;  1NV7 A;  4HE1 A;  4GWX A;  4PTK A;  1CNQ A;  1FPF A;  3LV0 A;  2OX3 A;  3QMF A;  5IZ1 A;  1FPG A;  2OWZ A;  1FBP A;  1INP A;  1FJ6 A;  2DDK A;  2WBB A;  2GQ1 A;  4GX4 A;  5EYG A;  1IME A;  1EYI A;  2QVR A;  1DK4 A;  4GX3 A;  1RDY A;  4FBP A;  3T0J A;  4IR8 A;  1RDX A;  4H46 A;  1K9Z A;  1XI6 A;  1IMC A;  1IMD A;  4MJO A;  2R8T A;  4AS5 A;  4GX6 A;  1KA1 A;  1NV2 A;  4GWZ A;  2FIE A;  4GWS A;  3BIH A;  1IMB A;  4I3E A;  3KC0 A;  1FRP A;  2WEF A;  2Q74 A;  2P3N A;  1FPD A;  3B8B A;  4AS4 A;  3D1R A;  2QVU A;  4GWU A;  1FBC A;  3A29 A;  1FTA A;  1FPK A;  5ESY A;  1FBH A;  2QVV A;  2F3B A;  1DBZ A;  2Y5L A;  1AWB A;  1LBZ A;  2Y5K A;  4I40 A;  1NV3 A;  5ET5 A;  4HE2 A;  5T3J A;  1D9Q A;  1NUX A;  2HHM A;  3KC1 A;  1QGX A;  1BK4 A;  4GBW A;  3FBP A;  5J16 A;  1FSA A;  5I3S A;  1FJ9 A;  1FPI A;  4H45 A;  4QXD A;  5ET6 A;  2CZI A;  1FBD A;  5EQ8 A;  1G0I A;  1LEV A;  5IZ3 B;  1FBF A;  4N81 A;  1FBE A;  4I3Y A;  1NV5 A;  3RPL B;  1YXI A;  4KXP A;  5EYH A;  2VT5 A;  3RYD A;  1LBW A;  3IFA A;  2CZH A;  4GWW A;  4GBV A;  1K9Y A;  2Q8M A;  1EYK A;  1FBG A;  1YYZ A;  1FPB A;  4G61 A;  5A5L A;  1NUW A;  1EYJ A;  1Q9D A;  5DW8 A;  3RPL A;  2FHY A;  5ET7 A;  1LBX A;  1FPL A;  2P3V A;  1NV0 A;  1VDW A;  5EQ9 A;  1DCU A;  4O7I A;  1NV1 A;  2FBP A;  2FVZ A;  1LBV A;  1FPE A;  2F3D A;  3BIG A;  2WBD A;  5ET8 A;  4GWY A;  5EQA A;  4HE0 A;  1IMA A;  1G0H A;  5LDZ A; 
#chains in the Genus database with same CATH topology
 4H6D A;  1Y20 A;  3O6H A;  3UIF A;  2B65 A;  5FBP A;  3G7W A;  1Z7N E;  3MP6 A;  4F2O A;  1JP4 A;  2XWV A;  2FIX A;  4KPT A;  2PFZ A;  3PMV A;  4FED A;  2UYF A;  1NV7 A;  2CZL A;  1FTL A;  2UXA A;  1CNQ A;  1LFH A;  4YZZ A;  1MY3 A;  1P1Q A;  2H4I A;  1IME A;  4PQJ A;  1QUL A;  3B6Q A;  1XC1 A;  1IQ7 A;  1RDY A;  2RKM A;  3OEL A;  3JYR A;  4IO6 A;  1ANF A;  1B6H A;  1B0L A;  5L9S A;  1SI0 A;  5TP9 A;  1FRP A;  3E9X A;  1UIV A;  4AS4 A;  5CMB A;  4GWU A;  1B4H A;  5H8N B;  4RXL A;  1FBH A;  1B5H A;  3SER A;  3H6V A;  2QSX A;  5DT6 A;  5I59 B;  1FSA A;  3OEN A;  4P0G A;  3ZSF A;  5CMC A;  3TZA A;  1TT1 A;  2F8D A;  2XXP A;  5EYF A;  4NF4 A;  3MP8 A;  1LGB C;  4ECF A;  1B58 A;  1LAH E;  2F97 A;  3HN0 A;  3S9E A;  3ZKL A;  1US5 A;  1IXH A;  5ELV A;  4OHN A;  3SZP A;  5TU0 A;  4IB2 A;  2F78 A;  3IB2 A;  3CFZ A;  3U93 A;  3CG3 A;  2WBD A;  2G29 A;  1MXV A;  3K1N A;  1B0H A;  2V4C A;  4QSE A;  3B7D A;  2Q2C A;  5K2X A;  2QFL A;  1ZU0 A;  4EXK A;  3W15 C;  3LV0 A;  4R72 A;  3VV5 A;  2OX3 A;  4DXU A;  3DM0 A;  2AL5 A;  5AA2 A;  5HBC A;  4GX4 A;  3O2A A;  1NKX A;  4GOT A;  4XIG Q;  3IOV A;  2CMO A;  4GX6 A;  3QYT A;  3M3K A;  4MLQ A;  1GVC A;  4ESX A;  1WOD A;  3M3F A;  4KYE A;  3E13 X;  3MAM A;  3VLV A;  1MQD A;  3O6I A;  4KI0 E;  4ZS9 A;  4LQ2 A;  3UP9 A;  5JEI A;  4JSO A;  1IUD A;  3U92 A;  5HM4 B;  4QHQ A;  4I8C A;  1NV5 A;  3TQW A;  2HXR A;  2Z8D A;  3C31 A;  4R73 A;  2HEU A;  1SVX B;  3MVZ A;  3LBS A;  3PPN A;  1B1X A;  2DVC A;  3N6T A;  4POX A;  4O7M A;  4EUO A;  5IKB A;  4OA4 A;  4BLA A;  4PC9 A;  4OEN A;  4JSD A;  3RY3 A;  4HE0 A;  2VD2 A;  4PP0 A;  3H6T A;  2M8C A;  4I1D A;  4NF5 B;  3M8U A;  1IMF A;  3T9V A;  3T9H B;  1PB9 A;  3UOR A;  2DQV A;  1QKA A;  2X7Q A;  3MVW A;  2GFE A;  3ZKK A;  1N3X A;  4OVQ A;  2PT2 A;  5H8F B;  4MFI A;  5LTC A;  4MNC A;  4TQU Q;  5DEX B;  5CI5 A;  2NVU B;  4F18 A;  1XI6 A;  4MJO A;  2XX7 A;  3RTF B;  5I7I A;  2DE3 A;  3MWB A;  3SKP A;  4PAK A;  2P3N A;  3V5A A;  1P1W A;  5CRY A;  3D1R A;  3HCQ A;  5L9O A;  2XXV A;  2F3B A;  2A5T B;  3S4U A;  3PMW A;  3T9U A;  1BTJ A;  3CSG A;  2VD3 A;  3HO7 A;  3KOS A;  4MCO A;  2RC9 A;  3GZG A;  4ELO A;  4I3Y A;  3K0V A;  2H9B A;  3C32 A;  1OLC A;  1SW5 A;  2XXR A;  4PFW A;  1FQE A;  3IO4 A;  4PGP A;  1GR2 A;  4LP2 B;  1H45 A;  1MS7 A;  5I5P A;  1IZ1 A;  2AYS A;  2OLB A;  1JNF A;  2F3D A;  2I3W A;  2F5X A;  1R6Z A;  4R9G A;  2R71 A;  1N7W A;  2V25 A;  1RDZ A;  4NWC A;  2BJI A;  4C0R A;  3MZ1 A;  1Y3N A;  3TCF A;  3LUZ A;  4NG7 A;  4MHF A;  3T9X B;  5JTY A;  4DZ1 A;  2BJJ X;  3M3L A;  2I48 A;  4LVQ A;  3F11 A;  1USY H;  4QRZ A;  1N7X A;  3RGY A;  3RUM A;  4YAH X;  5CC2 A;  4PTK A;  3MVX A;  4F22 A;  1DTG A;  4IGR A;  1FPG A;  2PT1 A;  2OWT A;  4PE5 B;  1MXZ A;  3FUZ A;  1EYI A;  1OQG A;  2B4L A;  5B70 A;  5L9M A;  3KN8 A;  4PGN A;  1IMD A;  4NF4 B;  4IO7 A;  4GWZ A;  3G3H A;  3FAT A;  3LC8 A;  1IMB A;  2I49 A;  2GHB A;  2DSF A;  2WEF A;  4ONY A;  3LSX A;  4Q30 B;  2QRY A;  3HFU A;  1H43 A;  2HCA A;  1DBZ A;  4FAT A;  4FJP A;  5ET5 A;  2ZYN A;  1FTJ A;  4PAI A;  2ZMB A;  2UYE A;  4HS7 A;  2I6E A;  3G3J A;  1HSE A;  2XXW A;  4U22 A;  4H45 A;  3O28 A;  4R6K A;  1MPB A;  5ET6 A;  2CZI A;  3K2D A;  2XX8 A;  3SEX A;  2I58 A;  1FBD A;  2MKZ A;  4QF9 A;  3LSF B;  2NUV A;  1PEB A;  1M5E A;  3IAZ A;  4N6K A;  3TTM A;  4EF1 A;  4P1E A;  3OO9 A;  1Q1K A;  4ZDM A;  4QFP A;  4P9K A;  5AA2 B;  4XKQ A;  3EPE A;  3CSB A;  1MQH A;  3JV9 A;  4GVO A;  1UQW A;  1XHY A;  3Q26 A;  1FPL A;  2ONK E;  1AOV A;  3KN7 A;  4F3S A;  3C4M A;  2O1M A;  4XXU A;  3SES A;  1O7T A;  3U1O A;  1B32 A;  2DE4 A;  1PB7 A;  1M5F A;  2AIX A;  4LN5 A;  1NNF A;  3CG1 A;  1KA0 A;  1QUK A;  1BIY A;  3IR1 A;  5A5X A;  2QS4 A;  3U72 A;  3L6H A;  3FV1 A;  3B6W A;  1FJ6 A;  2DDK A;  4OZ9 A;  4P3L A;  4GX3 A;  3MP1 A;  1LFI A;  3IOT A;  4OFL A;  2XXQ A;  4X1B A;  4F3B A;  3GBA A;  1KA1 A;  3RTW B;  2XXK A;  4YMB A;  2OPE A;  5AA2 D;  3KC0 A;  4JVI A;  2LAO A;  2O1L A;  2WKY A;  4OEU A;  3W9W A;  3IOU A;  2XXY A;  3QIM A;  4GLI A;  2XXT A;  5BUU A;  5HPQ A;  1MPD A;  1ZLQ A;  3KBR A;  3ECR A;  2UVI A;  1EZO A;  1UTB B;  3GLB A;  1ZTY A;  3D4G A;  4F1Y A;  5FHO A;  2P2A A;  2Q9T A;  4JDF A;  5KZT A;  2VT5 A;  3PUX E;  2F7B A;  2Q88 A;  4G8M A;  4H8J A;  3MJN A;  3EHT A;  2Z8E A;  2O7U A;  4OQO A;  4P11 A;  1MQJ A;  3C33 A;  1T0K A;  1FCK A;  2D3I A;  4JVC A;  3BIG A;  1DMB A;  4PFI A;  5EQ7 A;  3ROJ A;  3KJ7 A;  4QSC A;  4NED A;  3K02 A;  2Q2A A;  1NNT A;  1VR5 A;  2ANJ A;  1B3E A;  2DOJ A;  2JJK A;  4GIZ A;  5ISU A;  4KCC A;  1Y3P A;  4XKN A;  1N3W A;  3B50 A;  2H99 A;  4YB5 A;  3UGW A;  1FBP A;  3S9L C;  4FEB A;  1HSJ A;  2ONS A;  1A55 A;  4X8R A;  4R74 A;  3PPR A;  2V84 A;  3T93 B;  3K4U A;  3R6U A;  4F3P A;  4P8B A;  1QJM A;  1SW2 A;  2Q74 A;  1P1U A;  3CR9 A;  3C36 A;  3A29 A;  4NQ8 A;  3V89 B;  2F7A A;  2VOZ A;  2RCB A;  1BK4 A;  3SEY A;  1RYO A;  1DOT A;  2B3B A;  2DYX A;  1UIU A;  3CFL A;  1FBF A;  3T1B A;  1IEJ A;  1UTH A;  4XKP A;  4PDD A;  4WEP A;  3DP6 A;  5JTY B;  1MXW A;  2CZH A;  4F39 A;  2XX9 A;  3SEU A;  2VGQ A;  4ELR A;  2H25 A;  1B7H A;  3S9N C;  4MLV A;  1MM6 A;  3PUV E;  1H76 A;  3JZJ A;  1ZBM A;  3TTL A;  5I58 B;  2DE2 A;  2B3F A;  4HCW A;  4WED A;  1LBV A;  3NOH A;  3L6G A;  1TWY A;  3TOD A;  4HCY A;  5EQ8 A;  1II5 A;  4O3B A;  4DCY A;  2NOO A;  2QMW A;  1MY1 A;  3FXQ A;  4N15 A;  4YKK A;  1B52 A;  4WKM A;  4KFQ A;  1B2H A;  3MC2 A;  2OWS A;  4OVS A;  1OMP A;  1Z7M E;  3N94 A;  1MQG A;  1P99 A;  2QL3 A;  4NF6 B;  5AA4 A;  2DWI A;  2Y7R A;  2FNC A;  4JWY A;  1FQD A;  3OEK A;  3MUQ A;  3TFL A;  4JBZ A;  5EYG A;  4MBP A;  4XKR A;  4UAB A;  3U65 A;  3UN6 A;  1BKA A;  3WAE A;  4YB7 A;  5CMK A;  4NF0 A;  4U1O A;  3EHU A;  3B6T A;  4F29 A;  3UK4 A;  4N4U A;  5H8Q A;  4BDM A;  1M5B A;  1NV2 A;  4NF8 A;  1MRP A;  3BIH A;  1YPN A;  4KHZ E;  4I3E A;  4P0I A;  4I9D A;  3RNN A;  2HAU A;  3BFT A;  3USD A;  4FOR A;  3FAS A;  1WVJ A;  1LBZ A;  3CFX A;  4OET A;  5AE4 A;  2GHA A;  2UVJ A;  5T3J A;  1NUX A;  3KFM A;  1P1N A;  3TAJ A;  3FBP A;  2PYY A;  2QJE A;  1B40 A;  4GQO A;  4ZED A;  2ALU A;  1DSN A;  4N81 A;  4H67 A;  4JXI A;  1A8F A;  3RPL B;  3RYD A;  3G3K A;  4GWW A;  4GBV A;  3PUZ E;  2KR0 A;  3A3C A;  2F35 A;  4G61 A;  2Y7P A;  3N26 A;  1QUJ A;  3KJT A;  1EYJ A;  3K6U A;  3N5L A;  4DLD A;  4R6Y A;  4G8N A;  1A40 A;  1XVX A;  2OPD A;  2REG A;  5EQ9 A;  4H5F A;  3KZG A;  3O9P A;  5DVF A;  3A3U A;  1EH3 A;  1JQF A;  4NWD A;  2ZYM A;  5H8H B;  1OIB A;  1NV4 A;  1MH4 A;  2F7C A;  2VPO A;  2F6G A;  4O8M A;  4XTC Q;  3IB1 A;  1XT8 A;  4HE1 A;  4O94 A;  3PPO A;  5KDT A;  4GXA A;  4ZE8 A;  4X9T A;  2O51 A;  4LZ8 A;  1KWH A;  1B7Z A;  2QS2 A;  2GRV A;  4FBP A;  4OMB A;  5I2N A;  5I56 B;  1SYI A;  3Q25 A;  4OVJ A;  1PBP A;  4P47 A;  3OO7 A;  1LFG A;  1A54 A;  3C34 A;  1O63 A;  3LUY A;  4TLL B;  1MXY A;  2DS9 A;  3GXA A;  1XS5 A;  4QBA A;  2H5Y A;  1QKB A;  2Y5K A;  4HE2 A;  4H0W A;  2HAV A;  4C1T A;  3VDF A;  4IO5 A;  5J16 A;  4FE8 A;  2XD3 A;  3HV1 A;  3TKD A;  2Z22 A;  2Z23 A;  2A5S A;  4PDH A;  4PFB A;  3AXF A;  1B3L A;  4AQ4 A;  1B5I A;  1B4Z A;  2Q8M A;  1URD A;  2V3U A;  1FPB A;  2NWJ A;  4THI A;  4Z0I A;  2F34 A;  5A5L A;  1URS A;  2DWJ A;  3H3G A;  3V8X B;  2OBG A;  1FPE A;  3CIJ A;  1IMA A;  1YAE A;  4U2R A;  5I2K A;  1D9V A;  5JK4 A;  2XA5 A;  3Q27 A;  2XD2 A;  4BDR A;  5DVJ A;  3BKI B;  3VVD A;  3GYY A;  1B05 A;  3ZS6 A;  2DP8 A;  4NAP A;  3C9H A;  3I3V A;  3DP8 A;  3Q29 A;  4LUB A;  1A7L A;  1MY0 A;  3PV0 E;  3QMF A;  4R2F A;  1INP A;  1AMF A;  2G93 A;  4ZEB A;  5TPA A;  4TLM B;  5TP9 B;  1I6B A;  1UTH B;  1ZJL A;  3VXB A;  4DI3 D;  2F6P A;  4RJZ A;  1MPC A;  3FJM A;  2FIE A;  4NGU A;  4F2Q A;  1R9Q A;  3IK6 B;  4OXV A;  4M4G A;  3FIR A;  3OD7 A;  3O97 A;  5ESY A;  2Y5L A;  1Y4C A;  4LA9 A;  4KCD A;  3KGC A;  5KCJ A;  4N8Y A;  1FQA A;  2XWK A;  2V3T A;  3LSL A;  2XXX A;  4G68 C;  4POW A;  3IJX B;  3K01 A;  1PDA A;  4LAT A;  3P7I A;  1H3D A;  3E4R A;  2WYK A;  5AA4 B;  1LBW A;  5I59 A;  3MPL A;  5LOM A;  1K9Y A;  4Z7E A;  1FBG A;  4MNI A;  1M5D A;  1B3H A;  3ILT B;  3EKI A;  2ZYO A;  2I0B A;  4OVR A;  4DDD A;  1MG1 A;  2Z8F A;  3FVK A;  3H6W A;  1LBC A;  5H8Q B;  2ZXT A;  4PE3 A;  1B5J A;  1MH3 A;  5F24 A;  2HZL A;  2ZYK A;  4F31 B;  4OWD A;  5CMM A;  1Q35 A;  4RK2 A;  1TFA A;  4U21 A;  1LBY A;  4BDN A;  1YZ0 A;  1FTM A;  3IX1 A;  3OEM A;  4O3A A;  4OEV A;  1YCJ A;  3KEI A;  5I57 A;  4K3F A;  4X48 A;  4EQ9 A;  2OWZ A;  2WBB A;  4Q8R A;  3WAF A;  3O29 A;  3OSR A;  4ELP A;  3HST A;  1VE4 A;  5DTB A;  1QW0 A;  2ABH A;  4BDL A;  4RPO A;  4OTE A;  3Q28 A;  4NE4 A;  3VFJ A;  3K6W A;  1IMC A;  1BP5 A;  4DI4 B;  3MQ9 A;  4YIC A;  3DLN A;  1Y9U A;  2XXH A;  2QVU A;  1FBC A;  1FQB A;  1I6A A;  2QVV A;  2QS3 A;  4DCX A;  2I4B A;  2ZNU A;  1OVT A;  3MZB A;  3RN8 A;  2OK2 A;  1USY E;  2D5W A;  4OFO A;  4TOZ A;  5EYH A;  1CB6 A;  4G68 A;  3IFA A;  2DVZ A;  1B1H A;  3IOW A;  5BWJ A;  1AIV A;  2OZZ A;  1Y1Z A;  4GRK A;  2E0S A;  1B46 A;  5ITP A;  3SEW A;  1B3G A;  5I2N B;  3QAX A;  5I84 A;  4PCD A;  4FIM A;  5L8D A;  2XXI A;  2FBP A;  3KSX A;  1SI1 A;  2X26 A;  4F1U A;  1JVY A;  4GWO A;  1FW0 A;  3U8Q A;  3VLW A;  2WYP A;  4HXV A;  4NX1 A;  1OVB A;  1IXC A;  4IO2 A;  5FTH A;  1MDQ A;  1D3K A;  2ZNS A;  3OO8 A;  2RIN A;  2HFB A;  2RC7 A;  2ESN A;  2DWH A;  4WXJ A;  3ILU B;  2D21 A;  2UVG A;  3LSW A;  3TPA A;  1N84 A;  1SQY A;  2WX9 A;  3MPK A;  2HXW A;  2GQ1 A;  1SD3 A;  2QVR A;  3TEL A;  4HW8 A;  2OCU A;  1VSO A;  2V93 A;  2YJP A;  1NH7 A;  2R8T A;  2ZZW A;  4N6P A;  3KN3 A;  3VVF A;  1RYX A;  3FVN A;  4QFK A;  3HPI A;  1Y3Q A;  4RNS A;  1LAX A;  3CVG A;  1FPK A;  5AA3 A;  4G8H A;  3PD9 A;  1TXF A;  3TDJ A;  3KC1 A;  4KYS A;  1SW1 A;  5I2K B;  1Y4T A;  2ONR A;  4QXD A;  4MAG A;  2DXR A;  4KXP A;  1LAG E;  5CBS A;  3GBB A;  1LB9 A;  3MST A;  4XEQ A;  2VPN A;  3T66 A;  4RY1 A;  3EN3 A;  2RF1 A;  4N17 A;  4ZZA A;  4PBQ A;  1PBQ A;  5TPA B;  2XWO A;  1Q9D A;  5DW8 A;  2FHY A;  4RYA A;  1LBX A;  3MW0 A;  4KR5 A;  3PMX A;  4OVP A;  1O64 A;  1BLF A;  2QS1 A;  4U4X A;  1MXX A;  1LST A;  1KZ8 A;  3VVE A;  4BDO A;  3MYU A;  1NI9 A;  1B9J A;  2O69 A;  1EU8 A;  3MZ9 A;  5KCJ B;  1US4 A;  3QUF A;  5ITO A;  4F3G A;  5AA1 A;  3EHS A;  4N07 A;  2XXU A;  5IZ1 A;  3CHG A;  3QK6 A;  3T96 B;  4PF8 A;  4IR8 A;  4N13 A;  1RDX A;  1SYH A;  3ONM A;  3OMB A;  1K9Z A;  2UVH A;  4LZ5 A;  4IY6 A;  4U23 A;  4JWX A;  2Q89 A;  3RPW A;  4ZEI A;  4OVT A;  4AB6 A;  3FXB A;  5M2V A;  1JW1 A;  3OO6 A;  3G3G A;  4ZZE A;  4LON B;  1D9Q A;  5K2Y A;  4BDQ A;  2HHM A;  4ZEC A;  1ZIU A;  1R1N A;  1VFE A;  1XVY A;  1POT A;  1ZMG A;  3O66 A;  3S9M C;  2QMX A;  4ZE9 A;  3TMG A;  1DPP A;  4GD5 A;  2E1S A;  4EF2 A;  4YMA A;  1YXI A;  1MXU A;  1DPE A;  5I57 B;  3S2V A;  1EYK A;  3FD3 A;  1M5C A;  4GFR A;  4LQ5 A;  4ZEK A;  4NHB A;  4PBH A;  1VFD A;  5ET7 A;  3K1P A;  1WDN A;  2HQ0 A;  3E79 A;  3EF7 A;  1FQF A;  3EQ1 A;  1DCU A;  1N76 A;  2IA4 A;  1SBP A;  1TFD A;  5ET8 A;  4OFJ A;  1N04 A;  5EHS A;  5A5X B;  1IIT A;  4GL0 A;  3I6V A;  3VLU A;  1NUY A;  2PCR A;  4M1V A;  3TCH A;  1NUZ A;  5B7D A;  5IZ3 A;  3ODB A;  2I0C A;  2HZK A;  3KG2 A;  3FJG A;  2CZK A;  3TUS A;  1MY4 A;  4GWX A;  2Q8J A;  1ZKB A;  1NMU A;  2CEY A;  3K1M A;  4ZEF A;  3I5O A;  1NFT A;  4H1X A;  3PTY A;  1JET A;  1R9L A;  3K6V A;  4G68 B;  4H46 A;  4F19 A;  4AS5 A;  4R2B A;  1LBB A;  1P1O A;  2O7I A;  4KYD A;  4FAJ A;  3SET A;  3OXN A;  1LCF A;  3FXR A;  2YPN A;  3N6U A;  3E3K A;  4P1L A;  3MBP A;  1NNP A;  4FEC A;  2XHD A;  4G2Z A;  3O6G A;  3LR1 A;  1J1N A;  3W9V A;  5FTI A;  1MM7 A;  2X7P A;  1B51 A;  4MIJ A;  3R7X A;  1OQH A;  1G0I A;  1LEV A;  2CEX A;  4QFL A;  3TCG A;  1OLA A;  4YKP A;  4EQ7 A;  5F1Q A;  3FGS A;  3IL1 B;  3FZV A;  3UA8 A;  1NL5 A;  2ZNT A;  1GV8 A;  3KSJ A;  5EHM A;  4QFO A;  3RQT A;  5IM2 A;  1UTB A;  4GXS B;  2P1S A;  1NUW A;  3H7M A;  2VHA A;  1H44 A;  4MF3 A;  3HHG A;  1AH5 A;  2OJT A;  4O7I A;  2NXO A;  4Q5T A;  4PAF A;  4N8G A;  2QPQ A;  4DE8 A;  5IAI A;  3T22 A;  3PUW E;  2KLF A;  3KBZ A;  3QXM A;  2O6A A;  3FV2 A;  3C35 A;  4RK9 A;  2F36 A;  1SPI A;  3VE1 B;  4MEV A;  3H03 A;  5DVI A;  2Y7I A;  3FJ7 A;  3U94 A;  4O3C A;  1JVX A;  1EZ9 A;  1QVS A;  1XOC A;  4OAN A;  1L5T A;  1S7Y A;  4YKJ A;  3BBR A;  3TEP A;  1LB8 A;  3D4C A;  3A09 A;  4HTG A;  4IGT A;  4ESW A;  3TTN A;  4OYV A;  1JEV A;  2THI A;  1QUI A;  4IO4 A;  3TYH A;  4GWS A;  4G4P A;  3TTK A;  4KD5 A;  4N91 A;  4XFE A;  4DIG A;  2I4C A;  4LZ7 A;  2HPG A;  2O84 X;  3THI A;  5DYH A;  4EDP A;  3IB0 A;  2FYI A;  1FTA A;  5FHN A;  4I62 A;  4I40 A;  1NV3 A;  4OER A;  1FTK A;  1I6Q A;  3MVY A;  4F1V A;  3RT6 B;  4YB6 A;  4DXB A;  2ZZV A;  3IJO B;  1FJ9 A;  1FPI A;  2RCA A;  1HSL A;  1POY 1;  4X1D A;  5CM6 A;  1IIW A;  4JWO A;  4E0W A;  4C1U A;  4GL8 A;  4PFY A;  4NN3 A;  2XWI A;  3TTR A;  1B7U A;  1YYZ A;  1D4N A;  2L5V A;  4MH5 A;  5IGA A;  2P0S A;  1CE2 A;  2GH9 A;  3KOT A;  4DXC A;  5H8N A;  3PU5 A;  3IO6 A;  3FVO A;  3K6X A;  1G0H A;  3OOA A;  3FXU A;  3IFC A;  5I58 A;  3RLF E;  4U4S A;  1DTZ A;  1EZP A;  1MY2 A;  4UA8 A;  4H5G A;  4G77 A;  4P56 A;  1GTK A;  1FPJ A;  4E0X A;  5CBR A;  1NNK A;  2O68 A;  1FPF A;  3SEV A;  4MNP A;  4EQB A;  2V3Q A;  4NF8 B;  2IEE A;  1B3F A;  2VP1 A;  1SDX A;  4NF6 A;  4R9F A;  3IOR A;  3T0J A;  1RKM A;  3SDF A;  4JVD A;  1MDP 1;  1JW4 A;  2Y84 A;  2DWA A;  3PPP A;  3OSQ A;  2ZZX A;  2YLN A;  1A99 A;  3G3F A;  4H65 A;  1ATG A;  4IO3 A;  4R6H A;  1LCT A;  3B8B A;  4YKI A;  2FA7 A;  2B4M A;  2PFY A;  1QGX A;  4GBW A;  3G3I A;  4AB5 A;  1YTV A;  3ISP A;  5IZZ A;  5IZ3 B;  4ELQ A;  1FBE A;  3V83 A;  1FQC A;  5J1D A;  3CRB A;  4PF6 A;  4YU0 A;  2Y7W A;  1N0T A;  4L17 A;  1GGG A;  2KQZ A;  3QSL A;  1MQI A;  1S50 A;  1D9Y A;  4JB7 A;  4IY5 A;  4OES A;  3RPL A;  4RA1 A;  3QUJ A;  1NV0 A;  4NTL A;  4EXL A;  3VXC A;  2REJ A;  2PX1 A;  1NV1 A;  4XF5 A;  2FVZ A;  5EQA A;  3PGF A;  3H6U A;  2RC8 A;  4PFR A;  4RPN A;  5KDT B;  1LAF E;  1IXG A;  1NV6 A;  4NMY A;  1ELJ A;  5FHM A;  1URG A;  2Y7K A;  5H8H A;  3PUY E;  2PBW A;  4QSD A;  1DK4 A;  1F9B A;  2PVU A;  4MMP A;  3RT8 A;  1PB8 A;  2W7Y A;  4U1Z A;  4QFN A;  1IXI A;  3R26 A;  3H4Z A;  1FTO A;  4MX6 A;  4NF5 A;  1JW5 A;  2I3V A;  1FPD A;  1S9T A;  2AL4 A;  5ICT A;  4H8I A;  5F7V A;  2R6G E;  4X04 A;  5I56 A;  3K00 A;  1AL3 A;  4PFT A;  3CI8 A;  1JEU A;  4PFU A;  3PD8 A;  1AWB A;  1A8E A;  1LLS A;  2DXY A;  2H98 A;  5I3S A;  1Y1M A;  5ICQ A;  4UAC A;  5H8F A;  2PMS A;  1SW4 A;  4Q0C A;  2R9J A;  4PET A;  5DEX A;  3FVG A;  3DP4 A;  1PC3 A;  1NH8 A;  3BFU A;  3PPQ A;  1I69 A;  4ND9 A;  2P3V A;  1VDW A;  4KQP A;  5H8S A;  4GF8 A;  4ISU A;  4N6D A;  2A5T A;  3HHF A;  3E78 A;  3H06 B;  4R75 A;  3TQL A;  4GWY A;  3DEL B;  5LDZ A; 
#chains in the Genus database with same CATH homology
 2DE4 A;  5JK4 A;  2XA5 A;  1NUY A;  4LN5 A;  2PCR A;  5FBP A;  4M1V A;  1NUZ A;  1JP4 A;  5IZ3 A;  2XWV A;  2FIX A;  1KA0 A;  2HZK A;  3GYY A;  2PFZ A;  2CZK A;  4NAP A;  1NV7 A;  4GWX A;  1CNQ A;  3QMF A;  4YZZ A;  1INP A;  1FJ6 A;  2DDK A;  2CEY A;  1IME A;  4P3L A;  4GX3 A;  1RDY A;  3PTY A;  4H46 A;  4DI3 D;  4F19 A;  4AS5 A;  1KA1 A;  2FIE A;  4NGU A;  2XXK A;  3KC0 A;  1FRP A;  4JVI A;  4AS4 A;  3W9W A;  4GWU A;  5ESY A;  4P1L A;  1FBH A;  2Y5L A;  4N8Y A;  2XWK A;  1FSA A;  3W9V A;  4MIJ A;  1G0I A;  1LEV A;  2CEX A;  2Q9T A;  2VT5 A;  2WYK A;  1LBW A;  1K9Y A;  1FBG A;  5IM2 A;  4MNI A;  1NUW A;  3EKI A;  3SZP A;  4OVR A;  4O7I A;  4PAF A;  4JVC A;  4N8G A;  4PE3 A;  3BIG A;  2WBD A;  2QPQ A;  4PFI A;  5EQ7 A;  5F24 A;  3ROJ A;  2HZL A;  3KBZ A;  2V4C A;  1LBY A;  1YZ0 A;  1SPI A;  4MEV A;  2QFL A;  2JJK A;  3LV0 A;  4OAN A;  2OX3 A;  3B50 A;  2OWZ A;  1FBP A;  2WBB A;  4GX4 A;  4X8R A;  1IMC A;  4GX6 A;  4GWS A;  4DI4 B;  4YIC A;  4P8B A;  4N91 A;  4XFE A;  2Q74 A;  2HPG A;  2QVU A;  1FBC A;  3A29 A;  1FTA A;  4NQ8 A;  2QVV A;  4I40 A;  1NV3 A;  4F1V A;  1BK4 A;  2ZZV A;  1FJ9 A;  1FPI A;  1FBF A;  5CM6 A;  3T1B A;  4PDD A;  1NV5 A;  5EYH A;  3IFA A;  2CZH A;  2DVZ A;  4NN3 A;  2XWI A;  1YYZ A;  2HXR A;  2L5V A;  5IGA A;  4O7M A;  4OA4 A;  4PC9 A;  2DE2 A;  4PCD A;  4HCW A;  2FBP A;  3NOH A;  1LBV A;  4HE0 A;  4HCY A;  5EQ8 A;  1G0H A;  4F1U A;  1IMF A;  2WYP A;  4HXV A;  4N15 A;  3IFC A;  4NX1 A;  4OVS A;  4P56 A;  1FPJ A;  1FPF A;  4MNP A;  2WX9 A;  2GQ1 A;  4OVQ A;  2V3Q A;  5EYG A;  2QVR A;  5LTC A;  4UAB A;  4MNC A;  3U65 A;  4NF0 A;  3T0J A;  4F18 A;  1XI6 A;  4N4U A;  4MJO A;  2R8T A;  5I7I A;  2DE3 A;  2ZZW A;  1NV2 A;  4JVD A;  3BIH A;  4I3E A;  4PAK A;  2ZZX A;  2P3N A;  3B8B A;  3D1R A;  1FPK A;  2F3B A;  1LBZ A;  5T3J A;  1NUX A;  2B4M A;  3KC1 A;  2PFY A;  1QGX A;  4GBW A;  3FBP A;  4MCO A;  4QXD A;  3ISP A;  5IZZ A;  5IZ3 B;  4N81 A;  1FBE A;  4I3Y A;  5J1D A;  4MAG A;  3RPL B;  4KXP A;  3RYD A;  3MST A;  4PF6 A;  4XEQ A;  2VPN A;  4GWW A;  4GBV A;  2KR0 A;  2KQZ A;  4N17 A;  4PBQ A;  4G61 A;  2XWO A;  1EYJ A;  1Q9D A;  5DW8 A;  3RPL A;  4PGP A;  2FHY A;  1LBX A;  1NV0 A;  5EQ9 A;  5I5P A;  4OVP A;  1NV1 A;  4XF5 A;  2FVZ A;  2F3D A;  5EQA A;  2F5X A;  4PFR A;  1RDZ A;  2BJI A;  1NV4 A;  1KZ8 A;  1NV6 A;  2VPO A;  3MYU A;  3LUZ A;  4NG7 A;  4O8M A;  4MHF A;  1NI9 A;  4HE1 A;  4O94 A;  4PTK A;  5IZ1 A;  1FPG A;  3CHG A;  4X9T A;  1EYI A;  1DK4 A;  2B4L A;  4PF8 A;  4FBP A;  4MMP A;  4IR8 A;  1RDX A;  1K9Z A;  4PGN A;  1IMD A;  4P47 A;  4GWZ A;  1IMB A;  4OVT A;  4MX6 A;  2WEF A;  1FPD A;  3FXB A;  4X04 A;  3HFU A;  4QBA A;  1DBZ A;  1AWB A;  2Y5K A;  5ET5 A;  4HE2 A;  1D9Q A;  2HHM A;  4PAI A;  5J16 A;  5I3S A;  4H45 A;  5ET6 A;  2CZI A;  1FBD A;  2MKZ A;  4PDH A;  4PFB A;  4PET A;  1YXI A;  4N6K A;  4P1E A;  2Q8M A;  1EYK A;  1FPB A;  4P9K A;  5A5L A;  4NHB A;  4PBH A;  5ET7 A;  1FPL A;  3E79 A;  2P3V A;  1VDW A;  1DCU A;  4N6D A;  3E78 A;  5ET8 A;  1FPE A;  4GWY A;  1IMA A;  5LDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...