1IMFA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
262
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 262
sequence length 272
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imfA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imfA02
1FPGA 1FBDA 3LUZA 1FTAA 2QVUA 5EQ7A 4GWSA 4GBVA 5ET5A 4GX6A 2P3NA 3B8BA 5ET7A 1FJ6A 5IZ1A 1KZ8A 1NUYA 1AWBA 1XI6A 1CNQA 1RDYA 2DDKA 4GWUA 2FIXA 4HXVA 5A5LA 4I3EA 4KXPA 2PCRA 1FPEA 2F3DA 5ET6A 1FBHA 2Y5LA 1D9QA 1NV3A 4IR8A 3IFAA 1K9YA 2HHMA 2QVRA 1YZ0A 2FVZA 4GX3A 1INPA 2QFLA 1G0IA 1YXIA 2FBPA 1JP4A 2Y5KA 1FBCA 1NUWA 2Q74A 4GWWA 4HE0A 3KC1A 1LBZA 5DW8A 2P3VA 5EYGA 4GWYA 2JJKA 3LV0A 2FIEA 3QMFA 3ROJA 5I3SA 2CZHA 1VDWA 1NV4A 1NV0A 2OX3A 4GX4A 4HE1A 4MJOA 1LEVA 1FPKA 1IMAA 2FHYA 1FPLA 1KA1A 1G0HA 2OWZA 3IFCA 1DCUA 5EQ9A 1FSAA 1IMDA 4AS4A 1FBFA 1NI9A 1LBYA 3RYDA 1FPDA 1RDZA 1SPIA 1FRPA 2VT5A 2WBBA 1RDXA 2CZIA 1FBGA 4I3YA 1EYIA 5EQ8A 1LBWA 4H46A 1NV2A 2WBDA 2WEFA 4QXDA 1DBZA 1NV5A 1IMBA 4G61A 1NV6A 5ET8A 1FPBA 1LBVA 1NUZA 1EYKA 4GWZA 3KC0A 1NV1A 1DK4A 2R8TA 5J16A 5EQAA 1IMEA 4FBPA 3BIHA 4H45A 1FPIA 4I40A 4GBWA 5IZ3A 1YYZA 5T3JA 4HE2A 3BIGA 2Q8MA 5FBPA 1NV7A 5IZ3B 3D1RA 1IMFA 1FJ9A 3RPLA 3T0JA 3FBPA 4N81A 1K9ZA 1IMCA 3A29A 1NUXA 1FBEA 1FPJA 1LBXA 1QGXA 1BK4A 2QVVA 5EYHA 3RPLB 4AS5A 4PTKA 4GWXA 2BJIA 2GQ1A 1FBPA 5LDZA 3KBZA 1FPFA 1Q9DA 4O7IA 5F24A 5ESYA 1KA0A 2F3BA 2CZKA 1EYJA
chains in the Genus database with same CATH superfamily
1FQBA 2NWJA 1A40A 3H6VA 2DDKA 2UVIA 3OO7A 3NOHA 4QBAA 1FPEA 1MDQA 4G68B 3G3HA 4QSEA 1B6HA 4H65A 2GH9A 4R73A 3K6VA 4GX3A 4MMPA 1GTKA 4ZEBA 3RT8A 3PD9A 4ZE8A 1PEBA 3K6UA 2AL4A 3MYUA 2Q2AA 1Y1MA 3UP9A 3UGWA 1RYOA 5ITPA 1NV0A 3A3CA 2R9JA 4LVQA 4MJOA 3R7XA 3TUSA 2XXUA 5I57B 3MVZA 2FHYA 1G0HA 1DPPA 1MQGA 2HZLA 4I9DA 2THIA 3RYDA 4JVDA 2O69A 4OVQA 4KHZE 4ELPA 1Y3QA 4XKRA 3HO7A 3EHTA 3TQLA 4ZEDA 2Y7WA 2HQ0A 4MF3A 5KCJB 1POTA 3K1PA 2I0BA 2R8TA 1N0TA 1VFEA 3E79A 3W15C 2O1MA 3TTKA 4G77A 1QW0A 4ND9A 4X8RA 1FPIA 2L5VA 1JEVA 1MQHA 1UIVA 4MH5A 2D3IA 4KQPA 3A29A 4IO4A 3K6WA 4PE3A 1NUXA 4BDNA 4PTKA 5EYFA 3H6WA 4JVIA 1QUJA 2F3BA 3D4GA 2QS4A 2I0CA 3SESA 5A5XB 3PUVE 1SW5A 3PGFA 5ET7A 3OO9A 4YZZA 4EDPA 3LR1A 2F6GA 4O7MA 2OCUA 1P1NA 2A5TB 1RDYA 2FIXA 5I2KA 4WKMA 4G68A 3TODA 1JW5A 1YAEA 2Y5LA 3CFZA 4MCOA 5ICQA 1YZ0A 2FVZA 1MXYA 4OEUA 3V89B 4U21A 1L5TA 4F31B 2GHBA 3VV5A 4BDRA 4GWWA 3IOUA 4XKQA 4GQOA 4ZEFA 2OZZA 3ROJA 2XWVA 3BFUA 3CIJA 4EUOA 1O63A 3T96B 3MC2A 5I57A 1NNKA 3S2VA 3DP4A 1VE4A 3TDJA 1DCUA 1Y3PA 4DXCA 1NI9A 4PDDA 1HSJA 3PPPA 1JNFA 1MG1A 3M8UA 3PMXA 1M5CA 3SEUA 2XXXA 2ZYOA 3C36A 3H4ZA 5KCJA 3CSBA 1B46A 1IMBA 1NUZA 2VD2A 1LB8A 3FASA 4P56A 3VLUA 2Y7PA 4EQ7A 1M5BA 4YU0A 1Y9UA 2WX9A 4H8IA 2RINA 2QPQA 2Z8DA 2F7CA 4QFPA 4JBZA 1MM7A 3PV0E 1GVCA 4IGTA 5CBSA 5AA1A 4NEDA 1FTOA 5A5XA 4GX6A 3FV2A 4P11A 5FTHA 1LSTA 2A5TA 1KZ8A 2HPGA 5KDTB 2YPNA 1CE2A 1XT8A 1DTGA 3KG2A 1LCFA 2ZYNA 1D9QA 4HCYA 4OENA 3C33A 2Q88A 4F1YA 1MXUA 2Y5KA 1JP4A 2F36A 2VD3A 1B5IA 2HAVA 3TTLA 4MFIA 3IO4A 4G68C 4FECA 1EH3A 2X7QA 3IORA 4TOZA 3TAJA 3HHFA 3DP6A 2F97A 5LTCA 4H5FA 1KA1A 3ISPA 3H06B 5ELVA 4Q30B 4H67A 1LBYA 4N15A 4R6YA 1XC1A 2HEUA 4IO5A 2DE3A 4IO2A 1A8FA 3IR1A 3VFJA 4BDMA 4O8MA 3O28A 5KZTA 2YLNA 3FXRA 1WODA 2Q2CA 3MZ9A 2PBWA 4E0XA 1SQYA 5CI5A 4G61A 4XKNA 4PGPA 3DELB 2HXRA 1N76A 3HFUA 2F7BA 1IMEA 4YKIA 3T9UA 2DWJA 4KD5A 5IZ3B 5CBRA 3FBPA 1K9ZA 1FPJA 5EYHA 4AS5A 2QS1A 2ANJA 4MNIA 5EHMA 1B51A 3QUFA 1URSA 4GBVA 4PAKA 3E13X 3S9LC 1H76A 5KDTA 5DVIA 2F7AA 4R2FA 3D4CA 4I8CA 4OZ9A 1B2HA 3PMWA 4TLMB 1NL5A 3TQWA 4NTLA 3IOVA 2FBPA 4ESWA 1FBCA 2UVJA 1LBZA 5B70A 4QFOA 2FIEA 3MP1A 3LSLA 2R6GE 4KR5A 2OX3A 4X04A 1NNFA 2RC7A 3FVGA 1USYE 4R2BA 2OWSA 5DTBA 2DOJA 3SEWA 3O6GA 1IMDA 1FRPA 4DI3D 2PT2A 1FBGA 1LCTA 4OTEA 3N94A 3JV9A 2H5YA 4O3CA 2A5SA 1OLAA 3UK4A 2XXKA 4LZ8A 4ZDMA 4OFOA 4JDFA 4FEDA 4OXVA 2XX7A 3TPAA 2G93A 2WYPA 2XWIA 4H6DA 1BKAA 2ZZVA 4PQJA 1LAFE 5IZ3A 1YYZA 5FBPA 4PBQA 3O66A 2NOOA 5L8DA 4FEBA 1S50A 4MNCA 3PUZE 5CC2A 2B3BA 2QMXA 1Y1ZA 1SYIA 3LUZA 1B05A 2P3NA 2B4MA 3GZGA 2RC8A 4R75A 3G3JA 4GWUA 4HXVA 4PAIA 3T9XB 3RPWA 4N6KA 1MRPA 4IO6A 2XXRA 2YJPA 4LATA 3VLVA 1NV3A 3ILTB 3IFAA 4YICA 1LAGE 4OVPA 4OESA 4NF6B 3IL1B 1N3WA 2E1SA 4GL8A 4XIGQ 4NF5B 4G8MA 3LUYA 4PP0A 1SYHA 4IGRA 4M1VA 4ELRA 5EQ9A 4OETA 2H4IA 1I6AA 4PF8A 3PPNA 1B5JA 3ONMA 3EQ1A 2V84A 2WYKA 3HHGA 4I3YA 3VXBA 4QFLA 3E3KA 4YMBA 2WEFA 2PT1A 1NNTA 4YB5A 3C4MA 1A7LA 4GWZA 3LSXA 3KC0A 4RYAA 3ODBA 3AXFA 4H1XA 3TTMA 4OA4A 4LZ5A 3G3GA 3JYRA 4H0WA 4IY5A 3U8QA 2PFZA 1TFAA 4KYDA 2H25A 2GRVA 1UTBB 2VHAA 1GGGA 3UA8A 4F2QA 2QS3A 3HPIA 1IZ1A 1HSEA 1JVXA 4FIMA 2OBGA 4RXLA 2XXHA 2O1LA 1O7TA 5JK4A 1FPGA 3SDFA 3MP8A 2Z22A 2XD3A 1SVXB 4JWYA 2ZYKA 3L6GA 3G3KA 2ZNTA 4F3PA 5A5LA 3QAXA 4PFIA 4Z0IA 3QIMA 3IX1A 2E0SA 4P8BA 5EHSA 4JVCA 2O7UA 2OLBA 4F39A 4WEDA 4LN5A 2VP1A 3PTYA 4P47A 4NF6A 2G29A 4G2ZA 2CMOA 3O2AA 3CG1A 1AIVA 4NF5A 4JXIA 2DWIA 3PMVA 2F5XA 3TEPA 4YB7A 5BUUA 3MSTA 4OANA 1Z7ME 5DVFA 4L17A 3FJ7A 1QUKA 4F1VA 3PD8A 2ALUA 1ZJLA 1POY1 3T9HB 1RDXA 3MJNA 2B3FA 4GD5A 4F29A 4Q0CA 4PFWA 1USYH 1NV2A 5CM6A 2XD2A 3T9VA 1SDXA 1ZIUA 4NAPA 3Q25A 1NV6A 1LBBA 3S9EA 2IA4A 2H9BA 1NNPA 4QFNA 1GV8A 4NF8B 2RKMA 2OJTA 1Y3NA 3VVDA 1DPEA 1UTBA 2UVHA 2DSFA 3D1RA 1IMFA 2F34A 1SW1A 4YKKA 2D21A 1I6BA 4LONB 3KBZA 1PC3A 5I2NB 4OFJA 1MPBA 3K6XA 2V25A 4KPTA 3CR9A 1QKBA 4GWSA 4TLLB 4ZECA 2ABHA 3LC8A 4N13A 1N04A 3MPKA 1DSNA 5LOMA 3N6TA 1M5FA 3C31A 4RY1A 1QKAA 1LFIA 1I69A 3THIA 1MM6A 3IB2A 4YKJA 5BWJA 2DVCA 2X7PA 1IIWA 2ZNUA 4KCCA 4KFQA 4NWCA 1R9LA 1JW4A 2Q9TA 1B7UA 3BBRA 4OQOA 3PPOA 1FTLA 4HE1A 3OEMA 1FQFA 1JEUA 1B0HA 2ZMBA 3B7DA 4UA8A 1A54A 3EN3A 2ESNA 3OOAA 4POWA 2WBBA 3TKDA 4O3AA 4X1BA 4OVRA 3MWBA 1LBWA 2ZZWA 4HTGA 3TTRA 1FTMA 4Q8RA 1CB6A 1I6QA 1SW2A 4NMYA 3HN0A 5JTYB 3FIRA 3H3GA 1SW4A 4JB7A 4E0WA 2LAOA 2RF1A 2UVGA 3KSJA 4P1LA 4NF8A 1PB7A 5HBCA 3TELA 3FVOA 3L6HA 2H98A 3GBAA 1P1UA 2XX8A 2Y7KA 5ICTA 5DVJA 3V83A 1FBEA 5H8HB 1PB8A 3H6UA 5I2NA 1FBPA 4RK2A 1Q9DA 2Q8JA 3QYTA 3T22A 2IEEA 1LAHE 2NUVA 5IZ1A 1B1HA 3EF7A 1XI6A 1CNQA 1ELJA 1S7YA 3B50A 3F11A 1AOVA 3K1NA 2DYXA 3Q27A 1NH7A 3C34A 3DP8A 1H3DA 1MH4A 2GFEA 3Q29A 2RCAA 4M4GA 4HE0A 4OVJA 2QMWA 3KC1A 3N5LA 1OQGA 2W7YA 2P2AA 3EPEA 5L9OA 3E78A 1IMAA 3IB0A 3JZJA 1FSAA 5I59B 4DCXA 4LQ2A 3KEIA 1JVYA 1B4ZA 1MH3A 2XX9A 1A8EA 1VFDA 3IB1A 3TCHA 2NXOA 5AA3A 4H46A 1QULA 3FV1A 5JTYA 3H6TA 4ZE9A 1DBZA 1YCJA 2V3UA 2HFBA 4N8YA 4PFBA 2BJJX 4N07A 3OELA 2PMSA 1OVBA 3PU5A 2DXYA 4KCDA 4YMAA 1YTVA 2DWAA 4EF1A 4FAJA 4NE4A 1OVTA 3FXBA 3P7IA 4HE2A 5M2VA 4BDOA 4PFTA 4RPNA 5I58B 2I6EA 4ELOA 5H8HA 3SEVA 4DIGA 4OVSA 4NX1A 1OLCA 3FUZA 4GWXA 3KJ7A 2UYFA 3B6QA 4R9FA 3U94A 4X1DA 4XFEA 1DOTA 4UABA 5H8NB 4PGNA 3PUYE 4BDLA 1Q1KA 1FQCA 2Z8EA 2PCRA 1MXZA 1XS5A 4F19A 1LFHA 4OYVA 1ANFA 4JSOA 4NHBA 2QFLA 5IAIA 4WXJA 3K00A 4QSDA 4P3LA 2X26A 1ZBMA 1B4HA 3QMFA 3MW0A 3EKIA 1B9JA 4THIA 3TZAA 4LQ5A 5I7IA 5K2XA 2ONKE 4EQBA 2QS2A 4OVTA 1FPLA 1IUDA 5I59A 1YPNA 4EXKA 1PBQA 4I62A 4QFKA 4AS4A 4R72A 1Y20A 3MPLA 3CSGA 1N7WA 1SPIA 2KQZA 2VT5A 1ZU0A 2DWHA 2DS9A 4N17A 3QSLA 3FZVA 1URGA 3M3FA 2WBDA 4X48A 2UYEA 2Y7IA 4QXDA 3OSQA 1MQDA 1LFGA 1LBVA 2ONRA 3KZGA 4C1TA 1VSOA 2O84X 4FBPA 3O9PA 2DE2A 3RTWB 2V93A 4F2OA 5I58A 3ILUB 2CZLA 1LGBC 3TCFA 4EF2A 3KOTA 4EQ9A 3T0JA 3LBSA 1FCKA 1DTZA 2VPOA 1P1OA 2QRYA 1KA0A 3MBPA 3DM0A 3RNNA 2QSXA 3V5AA 1FBDA 3WAEA 1FTAA 1OMPA 4ONYA 5ET5A 1MQJA 4QSCA 3RLFE 2F35A 1B1XA 4JWXA 4KXPA 1IEJA 1R9QA 4OWDA 1TT1A 4FE8A 4C0RA 3IJXB 3KN3A 2B4LA 3KN7A 2XXQA 1FQDA 2I4CA 3B6WA 4ZEIA 4N91A 1YXIA 1NH8A 2Q74A 1N7XA 3O29A 5ITOA 2P3VA 4GIZA 3FD3A 2OK2A 2PX1A 4NWDA 2XWOA 2V3QA 1GR2A 1M5EA 1FPKA 2OWZA 3K1MA 1MXXA 3CI8A 3FXQA 4XF5A 1FQAA 2I58A 4X9TA 4DCYA 1ZKBA 1EYIA 4R74A 4ISUA 2DVZA 2Q89A 5IKBA 5ET8A 1EYKA 5DT6A 3PPQA 5FHMA 3R6UA 4GXAA 4JWOA 4XXUA 2REGA 3BIHA 4H45A 2F8DA 4XTCQ 2CEXA 5T3JA 1MY1A 1NV7A 1B3LA 1FJ9A 1QGXA 4F1UA 4HS7A 3R26A 4ECFA 1H43A 1UQWA 3G7WA 2ZNSA 3IK6B 4O7IA 4ZZEA 1DMBA 2I4BA 4PCDA 1FJ6A 1MQIA 3USDA 3Q26A 1Q35A 4ZZAA 2XWKA 1EZ9A 5DYHA 1QJMA 2XXVA 2F3DA 1MPCA 2XXIA 4PC9A 1MS7A 3MQ9A 1K9YA 2HHMA 2QVRA 5HPQA 1VR5A 1G0IA 3ZKLA 1J1NA 2VPNA 3FJGA 5DW8A 5EYGA 3VVEA 3S4UA 3GXAA 4NN3A 1IXGA 3TYHA 1LEVA 4YAHX 4MLVA 2I3VA 3KN8A 5ISUA 3N6UA 1IITA 1JETA 4AB5A 1FBFA 2XXTA 1HSLA 2O7IA 1FPDA 1RDZA 1II5A 3IJOB 1B3GA 3IO6A 2FYIA 2I48A 1P1WA 3QK6A 4PFUA 4GFRA 3U92A 4MLQA 3SZPA 5J16A 2PFYA 2F6PA 3G3IA 3RTFB 2AIXA 3CFXA 1JW1A 4U2RA 3ZS6A 4I40A 1UTHB 1SI1A 2Q8MA 2M8CA 3U72A 5I2KB 2GHAA 4N81A 1LBXA 3IAZA 4RPOA 2GQ1A 5LDZA 2R71A 3RY3A 1IXHA 1PB9A 1NUYA 1H44A 5I56B 5L9MA 3GYYA 3UIFA 4OFLA 3RQTA 4BLAA 3I5OA 3O97A 3W9VA 3Q28A 1MY3A 3T1BA 3M3LA 2MKZA 3MVXA 3K01A 1US4A 4XKPA 1MDP1 5I3SA 1NV4A 4F3GA 1P1QA 1XVXA 5IGAA 4MX6A 5H8FB 4N6DA 3OMBA 1A99A 2HZKA 3RUMA 3SEXA 2Y7RA 3A3UA 4PETA 1B32A 1LB9A 3V8XB 4MBPA 3M3KA 2OPEA 1O64A 3I6VA 4MEVA 3QXMA 3UN6A 1FPBA 1N3XA 1D4NA 1URDA 4PBHA 1AL3A 1DK4A 3KBRA 3MAMA 4JSDA 4P1EA 4UACA 1UTHA 1MPDA 1B3FA 1US5A 3IOWA 4PE5B 4ZS9A 4R6KA 3TFLA 4LP2B 5AA2B 5JEIA 3CFLA 4DXUA 4H8JA 5IZZA 1D9YA 2FNCA 4DLDA 2ZXTA 1RYXA 1LLSA 1MXWA 5ESYA 1PBPA 2DXRA 2P1SA 5J1DA 3FATA 3OD7A 4N6PA 4GWOA 1B3EA 4PFRA 5I56A 2P0SA 3OENA 1KWHA 3U93A 3EHUA 5CMCA 3K0VA 1AWBA 4Q5TA 4I3EA 3VLWA 1BTJA 2AL5A 4LZ7A 5ET6A 3ZKKA 5FHNA 4PF6A 2NVUB 1QVSA 2CEYA 1WDNA 2O51A 4RK9A 1SI0A 1OIBA 4MHFA 1TXFA 3VVFA 1D3KA 5B7DA 3MVWA 2CZHA 1OQHA 4OMBA 4OERA 1VDWA 1AH5A 4U4XA 5AE4A 2I3WA 4O3BA 1RKMA 4DZ1A 4BDQA 3MP6A 5TP9B 5H8FA 3C9HA 3BKIB 1IXCA 4F22A 3CRBA 5F7VA 4H5GA 4GL0A 1P99A 1FTKA 1S9TA 1UIUA 1MY2A 4IY6A 5I5PA 4PDHA 4ZEKA 5AA4B 1NV5A 4FORA 4LUBA 1TFDA 4GF8A 1SD3A 4YB6A 3CHGA 4G8NA 2F78A 2HXWA 5AA2D 1TWYA 5HM4B 1MXVA 4GBWA 2XHDA 2OPDA 1XOCA 4QHQA 1Y4TA 5FTIA 5AA2A 3RPLB 1BK4A 4F3SA 4P9KA 1T0KA 4YKPA 3OSRA 5EQ7A 2REJA 4GLIA 3B8BA 4KYSA 5CMBA 3ECRA 3VXCA 1D9VA 4G4PA 1LBCA 3IOTA 3RT6B 3TCGA 1MY0A 4QF9A 5H8SA 4HCWA 1IXIA 1QUIA 4IR8A 5TPAB 2FA7A 2VGQA 4RA1A 1R6ZA 1ATGA 4NF4B 3O6IA 1PDAA 1IQ7A 1EZOA 3KOSA 2KLFA 2H99A 2UXAA 3K4UA 5TP9A 4P0IA 2ONSA 3SETA 2XXYA 3VDFA 3KGCA 4XEQA 3MZBA 3TTNA 3IFCA 3SKPA 1EU8A 1WVJA 1B5HA 4LA9A 2QL3A 3FVNA 1JQFA 4C1UA 1B0LA 3MZ1A 4I1DA 4RJZA 2CZIA 2ZYMA 3BFTA 5EQ8A 5AA4A 1NMUA 2PVUA 2O68A 3SERA 1Z7NE 3UORA 2RCBA 4DXBA 3MUQA 4N4UA 3KSXA 4F3BA 3I3VA 2O6AA 1MY4A 1EZPA 4PFYA 2DP8A 4POXA 1B3HA 5IM2A 1R1NA 3RPLA 2BJIA 2HCAA 3T66A 1FPFA 5F24A 2KR0A 1B52A 1EYJA 2QVUA 4NGUA 2PYYA 4G8HA 4ELQA 3H7MA 1BP5A 1B58A 4Z7EA 1B40A 4F18A 2HAUA 3FXUA 3C32A 5TPAA 3U1OA 5I84A 1FBHA 2OWTA 4GXSB 1A55A 1FTJA 4U22A 3PUWE 4U1OA 3OO8A 1INPA 3DLNA 4NF4A 1NUWA 5H8NA 4OHNA 5CMMA 2QJEA 4FJPA 2JJKA 3LV0A 3OEKA 4MIJA 1SBPA 3FGSA 1FW0A 1FQEA 3K2DA 2D5WA 2I49A 1M5DA 5DEXB 3K02A 2XXPA 4U23A 2Z23A 4EXLA 4KYEA 4NG7A 3GLBA 4R9GA 4HW8A 1AMFA 3OXNA 4PAFA 2XA5A 2RC9A 1ZMGA 3S9NC 5CRYA 1NKXA 3OO6A 1ZLQA 2ZZXA 3RN8A 1XVYA 4KI0E 1BIYA 1ZTYA 3BIGA 4K3FA 3G3FA 3FVKA 2DE4A 1IMCA 3O6HA 2V3TA 4GRKA 3E9XA 1NFTA 5H8QB 3CVGA 2CZKA 3PPRA 4U1ZA 3H03A 3E4RA 4AQ4A 2WKYA 5L9SA 3MVYA 3A09A 3LSWA 4ESXA 3RGYA 3S9MC 3KJTA 3VE1B 3U65A 4IO3A 1B7ZA 3QUJA 5F1QA 4QRZA 4GWYA 4N8GA 2VOZA 5CMKA 3PUXE 1F9BA 4O94A 2B65A 4GX4A 4MAGA 5DEXA 3W9WA 3KFMA 3C35A 4P0GA 4FATA 1Y4CA 2V4CA 2DQVA 4NQ8A 2AYSA 4GOTA 4WEPA 3CG3A 1H45A 5FHOA 4R6HA 3HSTA 3ZSFA 4MNPA 3HV1A 1BLFA 2Y84A 1N84A 3SEYA 4DI4B 4IO7A 1NV1A 4NF0A 3GBBA 1B7HA 3LSFB 4OEVA 2Z8FA 2XXWA 5EQAA 4GVOA 4AB6A 3B6TA 5K2YA 4U4SA 4DDDA 5TU0A 3TMGA 3WAFA 1XHYA 5H8QA 4TQUQ 2QVVA 4IB2A 3HCQA 1LAXA 3EHSA 4RNSA 3N26A 4DE8A 3T93B 3FJMA
chains in the Genus database with same CATH topology
3LUZA 4XFEA 4PFRA 4UABA 2P3NA 4PGNA 2B4MA 1AWBA 2DDKA 4GWUA 4HXVA 4PAIA 4I3EA 4N6KA 3NOHA 4QBAA 2PCRA 1FPEA 5ET6A 4F19A 1NV3A 4PF6A 3IFAA 2CEYA 4YICA 4GX3A 4NHBA 2QFLA 4MMPA 4OVPA 4MHFA 4P3LA 3QMFA 2CZHA 3MYUA 1VDWA 1NV0A 3EKIA 5I7IA 4MJOA 4M1VA 4OVTA 2FHYA 1FPLA 1G0HA 5EQ9A 4AS4A 2HZLA 4PF8A 3RYDA 4JVDA 1SPIA 2KQZA 4OVQA 2VT5A 2WYKA 4I3YA 4N17A 5I5PA 4PDHA 2WBDA 2WEFA 4QXDA 1NV5A 1LBVA 4GWZA 3KC0A 3CHGA 2R8TA 3E79A 4FBPA 4OA4A 2DE2A 4X8RA 1FPIA 4GBWA 2L5VA 2PFZA 3T0JA 3A29A 4PE3A 2VPOA 1NUXA 3RPLB 1BK4A 4PTKA 4P9KA 4JVIA 1KA0A 2F3BA 5JK4A 1FPGA 1FBDA 5EQ7A 1FTAA 5ET5A 5ET7A 3B8BA 4YZZA 4O7MA 1RDYA 2FIXA 5A5LA 4PFIA 4KXPA 2Y5LA 4HCWA 2B4LA 4IR8A 4MCOA 4P8BA 4JVCA 1YZ0A 2FVZA 4N91A 4LN5A 1YXIA 3PTYA 4P47A 2Q74A 4GWWA 2P3VA 3ROJA 2XWVA 2F5XA 2XWOA 2V3QA 1FPKA 4XEQA 2OWZA 3MSTA 4OANA 3IFCA 1DCUA 4F1VA 1NI9A 4PDDA 4XF5A 1RDXA 2CZIA 4X9TA 1EYIA 5EQ8A 1NV2A 2DVZA 5CM6A 1IMBA 4NAPA 1NV6A 5ET8A 1NUZA 1EYKA 4N4UA 4P56A 3BIHA 4H45A 2CEXA 5T3JA 2WX9A 1NV7A 3D1RA 1IMFA 5IM2A 1FJ9A 3RPLA 2QPQA 1QGXA 4F1UA 2BJIA 3KBZA 1FPFA 4O7IA 5F24A 2KR0A 4GX6A 1EYJA 2QVUA 4PCDA 4GWSA 4NGUA 1FJ6A 1KZ8A 2HPGA 2XWKA 4F18A 2F3DA 1FBHA 4PC9A 1D9QA 4HCYA 1K9YA 2HHMA 2QVRA 1INPA 1G0IA 2Y5KA 1JP4A 1NUWA 2VPNA 5DW8A 5EYGA 2JJKA 3LV0A 2Q9TA 4MIJA 4NN3A 4HE1A 5LTCA 1LEVA 1KA1A 3ISPA 4NG7A 1FBFA 1LBYA 4N15A 1FPDA 1RDZA 2WBBA 2DE3A 4OVRA 4PAFA 4O8MA 1LBWA 2XA5A 2ZZWA 4G61A 4PGPA 2HXRA 3HFUA 2ZZXA 4P1LA 3SZPA 5J16A 2PFYA 1IMEA 4I40A 3BIGA 2Q8MA 5IZ3B 2DE4A 3FBPA 4N81A 1K9ZA 1IMCA 1FBEA 1FPJA 1LBXA 5EYHA 4AS5A 2GQ1A 1FBPA 5LDZA 4MNIA 1Q9DA 2CZKA 4GBVA 4PAKA 5IZ1A 1NUYA 1XI6A 3GYYA 1CNQA 3B50A 3W9VA 3T1BA 2MKZA 3U65A 2FBPA 1FBCA 4HE0A 3KC1A 1LBZA 4GWYA 2FIEA 4N8GA 5I3SA 1NV4A 2OX3A 4X04A 4O94A 4GX4A 4MAGA 3E78A 3W9WA 5IGAA 4MX6A 1IMAA 4N6DA 1FSAA 1IMDA 2HZKA 2V4CA 4NQ8A 1FRPA 4DI3D 1FBGA 4PETA 4H46A 4MNPA 2XXKA 1DBZA 4MEVA 4N8YA 1FPBA 4PFBA 4DI4B 1NV1A 4NF0A 4PBHA 1DK4A 2WYPA 5EQAA 2XWIA 2ZZVA 4P1EA 5IZ3A 3FXBA 1YYZA 4HE2A 5FBPA 4PBQA 4OVSA 4NX1A 2QVVA 5IZZA 4GWXA 5ESYA 4MNCA 5J1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPG A;  1FBD A;  3LUZ A;  1FTA A;  2QVU A;  5EQ7 A;  4GWS A;  4GBV A;  5ET5 A;  4GX6 A;  2P3N A;  3B8B A;  5ET7 A;  1FJ6 A;  5IZ1 A;  1KZ8 A;  1NUY A;  1AWB A;  1XI6 A;  1CNQ A;  1RDY A;  2DDK A;  4GWU A;  2FIX A;  4HXV A;  5A5L A;  4I3E A;  4KXP A;  2PCR A;  1FPE A;  2F3D A;  5ET6 A;  1FBH A;  2Y5L A;  1D9Q A;  1NV3 A;  4IR8 A;  3IFA A;  1K9Y A;  2HHM A;  2QVR A;  1YZ0 A;  2FVZ A;  4GX3 A;  1INP A;  2QFL A;  1G0I A;  1YXI A;  2FBP A;  1JP4 A;  2Y5K A;  1FBC A;  1NUW A;  2Q74 A;  4GWW A;  4HE0 A;  3KC1 A;  1LBZ A;  5DW8 A;  2P3V A;  5EYG A;  4GWY A;  2JJK A;  3LV0 A;  2FIE A;  3QMF A;  3ROJ A;  5I3S A;  2CZH A;  1VDW A;  1NV4 A;  1NV0 A;  2OX3 A;  4GX4 A;  4HE1 A;  4MJO A;  1LEV A;  1FPK A;  1IMA A;  2FHY A;  1FPL A;  1KA1 A;  1G0H A;  2OWZ A;  3IFC A;  1DCU A;  5EQ9 A;  1FSA A;  1IMD A;  4AS4 A;  1FBF A;  1NI9 A;  1LBY A;  3RYD A;  1FPD A;  1RDZ A;  1SPI A;  1FRP A;  2VT5 A;  2WBB A;  1RDX A;  2CZI A;  1FBG A;  4I3Y A;  1EYI A;  5EQ8 A;  1LBW A;  4H46 A;  1NV2 A;  2WBD A;  2WEF A;  4QXD A;  1DBZ A;  1NV5 A;  1IMB A;  4G61 A;  1NV6 A;  5ET8 A;  1FPB A;  1LBV A;  1NUZ A;  1EYK A;  4GWZ A;  3KC0 A;  1NV1 A;  1DK4 A;  2R8T A;  5J16 A;  5EQA A;  1IME A;  4FBP A;  3BIH A;  4H45 A;  1FPI A;  4I40 A;  4GBW A;  5IZ3 A;  1YYZ A;  5T3J A;  4HE2 A;  3BIG A;  2Q8M A;  5FBP A;  1NV7 A;  5IZ3 B;  3D1R A;  1IMF A;  1FJ9 A;  3RPL A;  3T0J A;  3FBP A;  4N81 A;  1K9Z A;  1IMC A;  3A29 A;  1NUX A;  1FBE A;  1FPJ A;  1LBX A;  1QGX A;  1BK4 A;  2QVV A;  5EYH A;  3RPL B;  4AS5 A;  4PTK A;  4GWX A;  2BJI A;  2GQ1 A;  1FBP A;  5LDZ A;  3KBZ A;  1FPF A;  1Q9D A;  4O7I A;  5F24 A;  5ESY A;  1KA0 A;  2F3B A;  2CZK A;  1EYJ A; 
#chains in the Genus database with same CATH topology
 1FQB A;  2NWJ A;  1A40 A;  3H6V A;  2DDK A;  2UVI A;  3OO7 A;  3NOH A;  4QBA A;  1FPE A;  1MDQ A;  4G68 B;  3G3H A;  4QSE A;  1B6H A;  4H65 A;  2GH9 A;  4R73 A;  3K6V A;  4GX3 A;  4MMP A;  1GTK A;  4ZEB A;  3RT8 A;  3PD9 A;  4ZE8 A;  1PEB A;  3K6U A;  2AL4 A;  3MYU A;  2Q2A A;  1Y1M A;  3UP9 A;  3UGW A;  1RYO A;  5ITP A;  1NV0 A;  3A3C A;  2R9J A;  4LVQ A;  4MJO A;  3R7X A;  3TUS A;  2XXU A;  5I57 B;  3MVZ A;  2FHY A;  1G0H A;  1DPP A;  1MQG A;  2HZL A;  4I9D A;  2THI A;  3RYD A;  4JVD A;  2O69 A;  4OVQ A;  4KHZ E;  4ELP A;  1Y3Q A;  4XKR A;  3HO7 A;  3EHT A;  3TQL A;  4ZED A;  2Y7W A;  2HQ0 A;  4MF3 A;  5KCJ B;  1POT A;  3K1P A;  2I0B A;  2R8T A;  1N0T A;  1VFE A;  3E79 A;  3W15 C;  2O1M A;  3TTK A;  4G77 A;  1QW0 A;  4ND9 A;  4X8R A;  1FPI A;  2L5V A;  1JEV A;  1MQH A;  1UIV A;  4MH5 A;  2D3I A;  4KQP A;  3A29 A;  4IO4 A;  3K6W A;  4PE3 A;  1NUX A;  4BDN A;  4PTK A;  5EYF A;  3H6W A;  4JVI A;  1QUJ A;  2F3B A;  3D4G A;  2QS4 A;  2I0C A;  3SES A;  5A5X B;  3PUV E;  1SW5 A;  3PGF A;  5ET7 A;  3OO9 A;  4YZZ A;  4EDP A;  3LR1 A;  2F6G A;  4O7M A;  2OCU A;  1P1N A;  2A5T B;  1RDY A;  2FIX A;  5I2K A;  4WKM A;  4G68 A;  3TOD A;  1JW5 A;  1YAE A;  2Y5L A;  3CFZ A;  4MCO A;  5ICQ A;  1YZ0 A;  2FVZ A;  1MXY A;  4OEU A;  3V89 B;  4U21 A;  1L5T A;  4F31 B;  2GHB A;  3VV5 A;  4BDR A;  4GWW A;  3IOU A;  4XKQ A;  4GQO A;  4ZEF A;  2OZZ A;  3ROJ A;  2XWV A;  3BFU A;  3CIJ A;  4EUO A;  1O63 A;  3T96 B;  3MC2 A;  5I57 A;  1NNK A;  3S2V A;  3DP4 A;  1VE4 A;  3TDJ A;  1DCU A;  1Y3P A;  4DXC A;  1NI9 A;  4PDD A;  1HSJ A;  3PPP A;  1JNF A;  1MG1 A;  3M8U A;  3PMX A;  1M5C A;  3SEU A;  2XXX A;  2ZYO A;  3C36 A;  3H4Z A;  5KCJ A;  3CSB A;  1B46 A;  1IMB A;  1NUZ A;  2VD2 A;  1LB8 A;  3FAS A;  4P56 A;  3VLU A;  2Y7P A;  4EQ7 A;  1M5B A;  4YU0 A;  1Y9U A;  2WX9 A;  4H8I A;  2RIN A;  2QPQ A;  2Z8D A;  2F7C A;  4QFP A;  4JBZ A;  1MM7 A;  3PV0 E;  1GVC A;  4IGT A;  5CBS A;  5AA1 A;  4NED A;  1FTO A;  5A5X A;  4GX6 A;  3FV2 A;  4P11 A;  5FTH A;  1LST A;  2A5T A;  1KZ8 A;  2HPG A;  5KDT B;  2YPN A;  1CE2 A;  1XT8 A;  1DTG A;  3KG2 A;  1LCF A;  2ZYN A;  1D9Q A;  4HCY A;  4OEN A;  3C33 A;  2Q88 A;  4F1Y A;  1MXU A;  2Y5K A;  1JP4 A;  2F36 A;  2VD3 A;  1B5I A;  2HAV A;  3TTL A;  4MFI A;  3IO4 A;  4G68 C;  4FEC A;  1EH3 A;  2X7Q A;  3IOR A;  4TOZ A;  3TAJ A;  3HHF A;  3DP6 A;  2F97 A;  5LTC A;  4H5F A;  1KA1 A;  3ISP A;  3H06 B;  5ELV A;  4Q30 B;  4H67 A;  1LBY A;  4N15 A;  4R6Y A;  1XC1 A;  2HEU A;  4IO5 A;  2DE3 A;  4IO2 A;  1A8F A;  3IR1 A;  3VFJ A;  4BDM A;  4O8M A;  3O28 A;  5KZT A;  2YLN A;  3FXR A;  1WOD A;  2Q2C A;  3MZ9 A;  2PBW A;  4E0X A;  1SQY A;  5CI5 A;  4G61 A;  4XKN A;  4PGP A;  3DEL B;  2HXR A;  1N76 A;  3HFU A;  2F7B A;  1IME A;  4YKI A;  3T9U A;  2DWJ A;  4KD5 A;  5IZ3 B;  5CBR A;  3FBP A;  1K9Z A;  1FPJ A;  5EYH A;  4AS5 A;  2QS1 A;  2ANJ A;  4MNI A;  5EHM A;  1B51 A;  3QUF A;  1URS A;  4GBV A;  4PAK A;  3E13 X;  3S9L C;  1H76 A;  5KDT A;  5DVI A;  2F7A A;  4R2F A;  3D4C A;  4I8C A;  4OZ9 A;  1B2H A;  3PMW A;  4TLM B;  1NL5 A;  3TQW A;  4NTL A;  3IOV A;  2FBP A;  4ESW A;  1FBC A;  2UVJ A;  1LBZ A;  5B70 A;  4QFO A;  2FIE A;  3MP1 A;  3LSL A;  2R6G E;  4KR5 A;  2OX3 A;  4X04 A;  1NNF A;  2RC7 A;  3FVG A;  1USY E;  4R2B A;  2OWS A;  5DTB A;  2DOJ A;  3SEW A;  3O6G A;  1IMD A;  1FRP A;  4DI3 D;  2PT2 A;  1FBG A;  1LCT A;  4OTE A;  3N94 A;  3JV9 A;  2H5Y A;  4O3C A;  2A5S A;  1OLA A;  3UK4 A;  2XXK A;  4LZ8 A;  4ZDM A;  4OFO A;  4JDF A;  4FED A;  4OXV A;  2XX7 A;  3TPA A;  2G93 A;  2WYP A;  2XWI A;  4H6D A;  1BKA A;  2ZZV A;  4PQJ A;  1LAF E;  5IZ3 A;  1YYZ A;  5FBP A;  4PBQ A;  3O66 A;  2NOO A;  5L8D A;  4FEB A;  1S50 A;  4MNC A;  3PUZ E;  5CC2 A;  2B3B A;  2QMX A;  1Y1Z A;  1SYI A;  3LUZ A;  1B05 A;  2P3N A;  2B4M A;  3GZG A;  2RC8 A;  4R75 A;  3G3J A;  4GWU A;  4HXV A;  4PAI A;  3T9X B;  3RPW A;  4N6K A;  1MRP A;  4IO6 A;  2XXR A;  2YJP A;  4LAT A;  3VLV A;  1NV3 A;  3ILT B;  3IFA A;  4YIC A;  1LAG E;  4OVP A;  4OES A;  4NF6 B;  3IL1 B;  1N3W A;  2E1S A;  4GL8 A;  4XIG Q;  4NF5 B;  4G8M A;  3LUY A;  4PP0 A;  1SYH A;  4IGR A;  4M1V A;  4ELR A;  5EQ9 A;  4OET A;  2H4I A;  1I6A A;  4PF8 A;  3PPN A;  1B5J A;  3ONM A;  3EQ1 A;  2V84 A;  2WYK A;  3HHG A;  4I3Y A;  3VXB A;  4QFL A;  3E3K A;  4YMB A;  2WEF A;  2PT1 A;  1NNT A;  4YB5 A;  3C4M A;  1A7L A;  4GWZ A;  3LSX A;  3KC0 A;  4RYA A;  3ODB A;  3AXF A;  4H1X A;  3TTM A;  4OA4 A;  4LZ5 A;  3G3G A;  3JYR A;  4H0W A;  4IY5 A;  3U8Q A;  2PFZ A;  1TFA A;  4KYD A;  2H25 A;  2GRV A;  1UTB B;  2VHA A;  1GGG A;  3UA8 A;  4F2Q A;  2QS3 A;  3HPI A;  1IZ1 A;  1HSE A;  1JVX A;  4FIM A;  2OBG A;  4RXL A;  2XXH A;  2O1L A;  1O7T A;  5JK4 A;  1FPG A;  3SDF A;  3MP8 A;  2Z22 A;  2XD3 A;  1SVX B;  4JWY A;  2ZYK A;  3L6G A;  3G3K A;  2ZNT A;  4F3P A;  5A5L A;  3QAX A;  4PFI A;  4Z0I A;  3QIM A;  3IX1 A;  2E0S A;  4P8B A;  5EHS A;  4JVC A;  2O7U A;  2OLB A;  4F39 A;  4WED A;  4LN5 A;  2VP1 A;  3PTY A;  4P47 A;  4NF6 A;  2G29 A;  4G2Z A;  2CMO A;  3O2A A;  3CG1 A;  1AIV A;  4NF5 A;  4JXI A;  2DWI A;  3PMV A;  2F5X A;  3TEP A;  4YB7 A;  5BUU A;  3MST A;  4OAN A;  1Z7M E;  5DVF A;  4L17 A;  3FJ7 A;  1QUK A;  4F1V A;  3PD8 A;  2ALU A;  1ZJL A;  1POY 1;  3T9H B;  1RDX A;  3MJN A;  2B3F A;  4GD5 A;  4F29 A;  4Q0C A;  4PFW A;  1USY H;  1NV2 A;  5CM6 A;  2XD2 A;  3T9V A;  1SDX A;  1ZIU A;  4NAP A;  3Q25 A;  1NV6 A;  1LBB A;  3S9E A;  2IA4 A;  2H9B A;  1NNP A;  4QFN A;  1GV8 A;  4NF8 B;  2RKM A;  2OJT A;  1Y3N A;  3VVD A;  1DPE A;  1UTB A;  2UVH A;  2DSF A;  3D1R A;  1IMF A;  2F34 A;  1SW1 A;  4YKK A;  2D21 A;  1I6B A;  4LON B;  3KBZ A;  1PC3 A;  5I2N B;  4OFJ A;  1MPB A;  3K6X A;  2V25 A;  4KPT A;  3CR9 A;  1QKB A;  4GWS A;  4TLL B;  4ZEC A;  2ABH A;  3LC8 A;  4N13 A;  1N04 A;  3MPK A;  1DSN A;  5LOM A;  3N6T A;  1M5F A;  3C31 A;  4RY1 A;  1QKA A;  1LFI A;  1I69 A;  3THI A;  1MM6 A;  3IB2 A;  4YKJ A;  5BWJ A;  2DVC A;  2X7P A;  1IIW A;  2ZNU A;  4KCC A;  4KFQ A;  4NWC A;  1R9L A;  1JW4 A;  2Q9T A;  1B7U A;  3BBR A;  4OQO A;  3PPO A;  1FTL A;  4HE1 A;  3OEM A;  1FQF A;  1JEU A;  1B0H A;  2ZMB A;  3B7D A;  4UA8 A;  1A54 A;  3EN3 A;  2ESN A;  3OOA A;  4POW A;  2WBB A;  3TKD A;  4O3A A;  4X1B A;  4OVR A;  3MWB A;  1LBW A;  2ZZW A;  4HTG A;  3TTR A;  1FTM A;  4Q8R A;  1CB6 A;  1I6Q A;  1SW2 A;  4NMY A;  3HN0 A;  5JTY B;  3FIR A;  3H3G A;  1SW4 A;  4JB7 A;  4E0W A;  2LAO A;  2RF1 A;  2UVG A;  3KSJ A;  4P1L A;  4NF8 A;  1PB7 A;  5HBC A;  3TEL A;  3FVO A;  3L6H A;  2H98 A;  3GBA A;  1P1U A;  2XX8 A;  2Y7K A;  5ICT A;  5DVJ A;  3V83 A;  1FBE A;  5H8H B;  1PB8 A;  3H6U A;  5I2N A;  1FBP A;  4RK2 A;  1Q9D A;  2Q8J A;  3QYT A;  3T22 A;  2IEE A;  1LAH E;  2NUV A;  5IZ1 A;  1B1H A;  3EF7 A;  1XI6 A;  1CNQ A;  1ELJ A;  1S7Y A;  3B50 A;  3F11 A;  1AOV A;  3K1N A;  2DYX A;  3Q27 A;  1NH7 A;  3C34 A;  3DP8 A;  1H3D A;  1MH4 A;  2GFE A;  3Q29 A;  2RCA A;  4M4G A;  4HE0 A;  4OVJ A;  2QMW A;  3KC1 A;  3N5L A;  1OQG A;  2W7Y A;  2P2A A;  3EPE A;  5L9O A;  3E78 A;  1IMA A;  3IB0 A;  3JZJ A;  1FSA A;  5I59 B;  4DCX A;  4LQ2 A;  3KEI A;  1JVY A;  1B4Z A;  1MH3 A;  2XX9 A;  1A8E A;  1VFD A;  3IB1 A;  3TCH A;  2NXO A;  5AA3 A;  4H46 A;  1QUL A;  3FV1 A;  5JTY A;  3H6T A;  4ZE9 A;  1DBZ A;  1YCJ A;  2V3U A;  2HFB A;  4N8Y A;  4PFB A;  2BJJ X;  4N07 A;  3OEL A;  2PMS A;  1OVB A;  3PU5 A;  2DXY A;  4KCD A;  4YMA A;  1YTV A;  2DWA A;  4EF1 A;  4FAJ A;  4NE4 A;  1OVT A;  3FXB A;  3P7I A;  4HE2 A;  5M2V A;  4BDO A;  4PFT A;  4RPN A;  5I58 B;  2I6E A;  4ELO A;  5H8H A;  3SEV A;  4DIG A;  4OVS A;  4NX1 A;  1OLC A;  3FUZ A;  4GWX A;  3KJ7 A;  2UYF A;  3B6Q A;  4R9F A;  3U94 A;  4X1D A;  4XFE A;  1DOT A;  4UAB A;  5H8N B;  4PGN A;  3PUY E;  4BDL A;  1Q1K A;  1FQC A;  2Z8E A;  2PCR A;  1MXZ A;  1XS5 A;  4F19 A;  1LFH A;  4OYV A;  1ANF A;  4JSO A;  4NHB A;  2QFL A;  5IAI A;  4WXJ A;  3K00 A;  4QSD A;  4P3L A;  2X26 A;  1ZBM A;  1B4H A;  3QMF A;  3MW0 A;  3EKI A;  1B9J A;  4THI A;  3TZA A;  4LQ5 A;  5I7I A;  5K2X A;  2ONK E;  4EQB A;  2QS2 A;  4OVT A;  1FPL A;  1IUD A;  5I59 A;  1YPN A;  4EXK A;  1PBQ A;  4I62 A;  4QFK A;  4AS4 A;  4R72 A;  1Y20 A;  3MPL A;  3CSG A;  1N7W A;  1SPI A;  2KQZ A;  2VT5 A;  1ZU0 A;  2DWH A;  2DS9 A;  4N17 A;  3QSL A;  3FZV A;  1URG A;  3M3F A;  2WBD A;  4X48 A;  2UYE A;  2Y7I A;  4QXD A;  3OSQ A;  1MQD A;  1LFG A;  1LBV A;  2ONR A;  3KZG A;  4C1T A;  1VSO A;  2O84 X;  4FBP A;  3O9P A;  2DE2 A;  3RTW B;  2V93 A;  4F2O A;  5I58 A;  3ILU B;  2CZL A;  1LGB C;  3TCF A;  4EF2 A;  3KOT A;  4EQ9 A;  3T0J A;  3LBS A;  1FCK A;  1DTZ A;  2VPO A;  1P1O A;  2QRY A;  1KA0 A;  3MBP A;  3DM0 A;  3RNN A;  2QSX A;  3V5A A;  1FBD A;  3WAE A;  1FTA A;  1OMP A;  4ONY A;  5ET5 A;  1MQJ A;  4QSC A;  3RLF E;  2F35 A;  1B1X A;  4JWX A;  4KXP A;  1IEJ A;  1R9Q A;  4OWD A;  1TT1 A;  4FE8 A;  4C0R A;  3IJX B;  3KN3 A;  2B4L A;  3KN7 A;  2XXQ A;  1FQD A;  2I4C A;  3B6W A;  4ZEI A;  4N91 A;  1YXI A;  1NH8 A;  2Q74 A;  1N7X A;  3O29 A;  5ITO A;  2P3V A;  4GIZ A;  3FD3 A;  2OK2 A;  2PX1 A;  4NWD A;  2XWO A;  2V3Q A;  1GR2 A;  1M5E A;  1FPK A;  2OWZ A;  3K1M A;  1MXX A;  3CI8 A;  3FXQ A;  4XF5 A;  1FQA A;  2I58 A;  4X9T A;  4DCY A;  1ZKB A;  1EYI A;  4R74 A;  4ISU A;  2DVZ A;  2Q89 A;  5IKB A;  5ET8 A;  1EYK A;  5DT6 A;  3PPQ A;  5FHM A;  3R6U A;  4GXA A;  4JWO A;  4XXU A;  2REG A;  3BIH A;  4H45 A;  2F8D A;  4XTC Q;  2CEX A;  5T3J A;  1MY1 A;  1NV7 A;  1B3L A;  1FJ9 A;  1QGX A;  4F1U A;  4HS7 A;  3R26 A;  4ECF A;  1H43 A;  1UQW A;  3G7W A;  2ZNS A;  3IK6 B;  4O7I A;  4ZZE A;  1DMB A;  2I4B A;  4PCD A;  1FJ6 A;  1MQI A;  3USD A;  3Q26 A;  1Q35 A;  4ZZA A;  2XWK A;  1EZ9 A;  5DYH A;  1QJM A;  2XXV A;  2F3D A;  1MPC A;  2XXI A;  4PC9 A;  1MS7 A;  3MQ9 A;  1K9Y A;  2HHM A;  2QVR A;  5HPQ A;  1VR5 A;  1G0I A;  3ZKL A;  1J1N A;  2VPN A;  3FJG A;  5DW8 A;  5EYG A;  3VVE A;  3S4U A;  3GXA A;  4NN3 A;  1IXG A;  3TYH A;  1LEV A;  4YAH X;  4MLV A;  2I3V A;  3KN8 A;  5ISU A;  3N6U A;  1IIT A;  1JET A;  4AB5 A;  1FBF A;  2XXT A;  1HSL A;  2O7I A;  1FPD A;  1RDZ A;  1II5 A;  3IJO B;  1B3G A;  3IO6 A;  2FYI A;  2I48 A;  1P1W A;  3QK6 A;  4PFU A;  4GFR A;  3U92 A;  4MLQ A;  3SZP A;  5J16 A;  2PFY A;  2F6P A;  3G3I A;  3RTF B;  2AIX A;  3CFX A;  1JW1 A;  4U2R A;  3ZS6 A;  4I40 A;  1UTH B;  1SI1 A;  2Q8M A;  2M8C A;  3U72 A;  5I2K B;  2GHA A;  4N81 A;  1LBX A;  3IAZ A;  4RPO A;  2GQ1 A;  5LDZ A;  2R71 A;  3RY3 A;  1IXH A;  1PB9 A;  1NUY A;  1H44 A;  5I56 B;  5L9M A;  3GYY A;  3UIF A;  4OFL A;  3RQT A;  4BLA A;  3I5O A;  3O97 A;  3W9V A;  3Q28 A;  1MY3 A;  3T1B A;  3M3L A;  2MKZ A;  3MVX A;  3K01 A;  1US4 A;  4XKP A;  1MDP 1;  5I3S A;  1NV4 A;  4F3G A;  1P1Q A;  1XVX A;  5IGA A;  4MX6 A;  5H8F B;  4N6D A;  3OMB A;  1A99 A;  2HZK A;  3RUM A;  3SEX A;  2Y7R A;  3A3U A;  4PET A;  1B32 A;  1LB9 A;  3V8X B;  4MBP A;  3M3K A;  2OPE A;  1O64 A;  3I6V A;  4MEV A;  3QXM A;  3UN6 A;  1FPB A;  1N3X A;  1D4N A;  1URD A;  4PBH A;  1AL3 A;  1DK4 A;  3KBR A;  3MAM A;  4JSD A;  4P1E A;  4UAC A;  1UTH A;  1MPD A;  1B3F A;  1US5 A;  3IOW A;  4PE5 B;  4ZS9 A;  4R6K A;  3TFL A;  4LP2 B;  5AA2 B;  5JEI A;  3CFL A;  4DXU A;  4H8J A;  5IZZ A;  1D9Y A;  2FNC A;  4DLD A;  2ZXT A;  1RYX A;  1LLS A;  1MXW A;  5ESY A;  1PBP A;  2DXR A;  2P1S A;  5J1D A;  3FAT A;  3OD7 A;  4N6P A;  4GWO A;  1B3E A;  4PFR A;  5I56 A;  2P0S A;  3OEN A;  1KWH A;  3U93 A;  3EHU A;  5CMC A;  3K0V A;  1AWB A;  4Q5T A;  4I3E A;  3VLW A;  1BTJ A;  2AL5 A;  4LZ7 A;  5ET6 A;  3ZKK A;  5FHN A;  4PF6 A;  2NVU B;  1QVS A;  2CEY A;  1WDN A;  2O51 A;  4RK9 A;  1SI0 A;  1OIB A;  4MHF A;  1TXF A;  3VVF A;  1D3K A;  5B7D A;  3MVW A;  2CZH A;  1OQH A;  4OMB A;  4OER A;  1VDW A;  1AH5 A;  4U4X A;  5AE4 A;  2I3W A;  4O3B A;  1RKM A;  4DZ1 A;  4BDQ A;  3MP6 A;  5TP9 B;  5H8F A;  3C9H A;  3BKI B;  1IXC A;  4F22 A;  3CRB A;  5F7V A;  4H5G A;  4GL0 A;  1P99 A;  1FTK A;  1S9T A;  1UIU A;  1MY2 A;  4IY6 A;  5I5P A;  4PDH A;  4ZEK A;  5AA4 B;  1NV5 A;  4FOR A;  4LUB A;  1TFD A;  4GF8 A;  1SD3 A;  4YB6 A;  3CHG A;  4G8N A;  2F78 A;  2HXW A;  5AA2 D;  1TWY A;  5HM4 B;  1MXV A;  4GBW A;  2XHD A;  2OPD A;  1XOC A;  4QHQ A;  1Y4T A;  5FTI A;  5AA2 A;  3RPL B;  1BK4 A;  4F3S A;  4P9K A;  1T0K A;  4YKP A;  3OSR A;  5EQ7 A;  2REJ A;  4GLI A;  3B8B A;  4KYS A;  5CMB A;  3ECR A;  3VXC A;  1D9V A;  4G4P A;  1LBC A;  3IOT A;  3RT6 B;  3TCG A;  1MY0 A;  4QF9 A;  5H8S A;  4HCW A;  1IXI A;  1QUI A;  4IR8 A;  5TPA B;  2FA7 A;  2VGQ A;  4RA1 A;  1R6Z A;  1ATG A;  4NF4 B;  3O6I A;  1PDA A;  1IQ7 A;  1EZO A;  3KOS A;  2KLF A;  2H99 A;  2UXA A;  3K4U A;  5TP9 A;  4P0I A;  2ONS A;  3SET A;  2XXY A;  3VDF A;  3KGC A;  4XEQ A;  3MZB A;  3TTN A;  3IFC A;  3SKP A;  1EU8 A;  1WVJ A;  1B5H A;  4LA9 A;  2QL3 A;  3FVN A;  1JQF A;  4C1U A;  1B0L A;  3MZ1 A;  4I1D A;  4RJZ A;  2CZI A;  2ZYM A;  3BFT A;  5EQ8 A;  5AA4 A;  1NMU A;  2PVU A;  2O68 A;  3SER A;  1Z7N E;  3UOR A;  2RCB A;  4DXB A;  3MUQ A;  4N4U A;  3KSX A;  4F3B A;  3I3V A;  2O6A A;  1MY4 A;  1EZP A;  4PFY A;  2DP8 A;  4POX A;  1B3H A;  5IM2 A;  1R1N A;  3RPL A;  2BJI A;  2HCA A;  3T66 A;  1FPF A;  5F24 A;  2KR0 A;  1B52 A;  1EYJ A;  2QVU A;  4NGU A;  2PYY A;  4G8H A;  4ELQ A;  3H7M A;  1BP5 A;  1B58 A;  4Z7E A;  1B40 A;  4F18 A;  2HAU A;  3FXU A;  3C32 A;  5TPA A;  3U1O A;  5I84 A;  1FBH A;  2OWT A;  4GXS B;  1A55 A;  1FTJ A;  4U22 A;  3PUW E;  4U1O A;  3OO8 A;  1INP A;  3DLN A;  4NF4 A;  1NUW A;  5H8N A;  4OHN A;  5CMM A;  2QJE A;  4FJP A;  2JJK A;  3LV0 A;  3OEK A;  4MIJ A;  1SBP A;  3FGS A;  1FW0 A;  1FQE A;  3K2D A;  2D5W A;  2I49 A;  1M5D A;  5DEX B;  3K02 A;  2XXP A;  4U23 A;  2Z23 A;  4EXL A;  4KYE A;  4NG7 A;  3GLB A;  4R9G A;  4HW8 A;  1AMF A;  3OXN A;  4PAF A;  2XA5 A;  2RC9 A;  1ZMG A;  3S9N C;  5CRY A;  1NKX A;  3OO6 A;  1ZLQ A;  2ZZX A;  3RN8 A;  1XVY A;  4KI0 E;  1BIY A;  1ZTY A;  3BIG A;  4K3F A;  3G3F A;  3FVK A;  2DE4 A;  1IMC A;  3O6H A;  2V3T A;  4GRK A;  3E9X A;  1NFT A;  5H8Q B;  3CVG A;  2CZK A;  3PPR A;  4U1Z A;  3H03 A;  3E4R A;  4AQ4 A;  2WKY A;  5L9S A;  3MVY A;  3A09 A;  3LSW A;  4ESX A;  3RGY A;  3S9M C;  3KJT A;  3VE1 B;  3U65 A;  4IO3 A;  1B7Z A;  3QUJ A;  5F1Q A;  4QRZ A;  4GWY A;  4N8G A;  2VOZ A;  5CMK A;  3PUX E;  1F9B A;  4O94 A;  2B65 A;  4GX4 A;  4MAG A;  5DEX A;  3W9W A;  3KFM A;  3C35 A;  4P0G A;  4FAT A;  1Y4C A;  2V4C A;  2DQV A;  4NQ8 A;  2AYS A;  4GOT A;  4WEP A;  3CG3 A;  1H45 A;  5FHO A;  4R6H A;  3HST A;  3ZSF A;  4MNP A;  3HV1 A;  1BLF A;  2Y84 A;  1N84 A;  3SEY A;  4DI4 B;  4IO7 A;  1NV1 A;  4NF0 A;  3GBB A;  1B7H A;  3LSF B;  4OEV A;  2Z8F A;  2XXW A;  5EQA A;  4GVO A;  4AB6 A;  3B6T A;  5K2Y A;  4U4S A;  4DDD A;  5TU0 A;  3TMG A;  3WAF A;  1XHY A;  5H8Q A;  4TQU Q;  2QVV A;  4IB2 A;  3HCQ A;  1LAX A;  3EHS A;  4RNS A;  3N26 A;  4DE8 A;  3T93 B;  3FJM A; 
#chains in the Genus database with same CATH homology
 3LUZ A;  4XFE A;  4PFR A;  4UAB A;  2P3N A;  4PGN A;  2B4M A;  1AWB A;  2DDK A;  4GWU A;  4HXV A;  4PAI A;  4I3E A;  4N6K A;  3NOH A;  4QBA A;  2PCR A;  1FPE A;  5ET6 A;  4F19 A;  1NV3 A;  4PF6 A;  3IFA A;  2CEY A;  4YIC A;  4GX3 A;  4NHB A;  2QFL A;  4MMP A;  4OVP A;  4MHF A;  4P3L A;  3QMF A;  2CZH A;  3MYU A;  1VDW A;  1NV0 A;  3EKI A;  5I7I A;  4MJO A;  4M1V A;  4OVT A;  2FHY A;  1FPL A;  1G0H A;  5EQ9 A;  4AS4 A;  2HZL A;  4PF8 A;  3RYD A;  4JVD A;  1SPI A;  2KQZ A;  4OVQ A;  2VT5 A;  2WYK A;  4I3Y A;  4N17 A;  5I5P A;  4PDH A;  2WBD A;  2WEF A;  4QXD A;  1NV5 A;  1LBV A;  4GWZ A;  3KC0 A;  3CHG A;  2R8T A;  3E79 A;  4FBP A;  4OA4 A;  2DE2 A;  4X8R A;  1FPI A;  4GBW A;  2L5V A;  2PFZ A;  3T0J A;  3A29 A;  4PE3 A;  2VPO A;  1NUX A;  3RPL B;  1BK4 A;  4PTK A;  4P9K A;  4JVI A;  1KA0 A;  2F3B A;  5JK4 A;  1FPG A;  1FBD A;  5EQ7 A;  1FTA A;  5ET5 A;  5ET7 A;  3B8B A;  4YZZ A;  4O7M A;  1RDY A;  2FIX A;  5A5L A;  4PFI A;  4KXP A;  2Y5L A;  4HCW A;  2B4L A;  4IR8 A;  4MCO A;  4P8B A;  4JVC A;  1YZ0 A;  2FVZ A;  4N91 A;  4LN5 A;  1YXI A;  3PTY A;  4P47 A;  2Q74 A;  4GWW A;  2P3V A;  3ROJ A;  2XWV A;  2F5X A;  2XWO A;  2V3Q A;  1FPK A;  4XEQ A;  2OWZ A;  3MST A;  4OAN A;  3IFC A;  1DCU A;  4F1V A;  1NI9 A;  4PDD A;  4XF5 A;  1RDX A;  2CZI A;  4X9T A;  1EYI A;  5EQ8 A;  1NV2 A;  2DVZ A;  5CM6 A;  1IMB A;  4NAP A;  1NV6 A;  5ET8 A;  1NUZ A;  1EYK A;  4N4U A;  4P56 A;  3BIH A;  4H45 A;  2CEX A;  5T3J A;  2WX9 A;  1NV7 A;  3D1R A;  1IMF A;  5IM2 A;  1FJ9 A;  3RPL A;  2QPQ A;  1QGX A;  4F1U A;  2BJI A;  3KBZ A;  1FPF A;  4O7I A;  5F24 A;  2KR0 A;  4GX6 A;  1EYJ A;  2QVU A;  4PCD A;  4GWS A;  4NGU A;  1FJ6 A;  1KZ8 A;  2HPG A;  2XWK A;  4F18 A;  2F3D A;  1FBH A;  4PC9 A;  1D9Q A;  4HCY A;  1K9Y A;  2HHM A;  2QVR A;  1INP A;  1G0I A;  2Y5K A;  1JP4 A;  1NUW A;  2VPN A;  5DW8 A;  5EYG A;  2JJK A;  3LV0 A;  2Q9T A;  4MIJ A;  4NN3 A;  4HE1 A;  5LTC A;  1LEV A;  1KA1 A;  3ISP A;  4NG7 A;  1FBF A;  1LBY A;  4N15 A;  1FPD A;  1RDZ A;  2WBB A;  2DE3 A;  4OVR A;  4PAF A;  4O8M A;  1LBW A;  2XA5 A;  2ZZW A;  4G61 A;  4PGP A;  2HXR A;  3HFU A;  2ZZX A;  4P1L A;  3SZP A;  5J16 A;  2PFY A;  1IME A;  4I40 A;  3BIG A;  2Q8M A;  5IZ3 B;  2DE4 A;  3FBP A;  4N81 A;  1K9Z A;  1IMC A;  1FBE A;  1FPJ A;  1LBX A;  5EYH A;  4AS5 A;  2GQ1 A;  1FBP A;  5LDZ A;  4MNI A;  1Q9D A;  2CZK A;  4GBV A;  4PAK A;  5IZ1 A;  1NUY A;  1XI6 A;  3GYY A;  1CNQ A;  3B50 A;  3W9V A;  3T1B A;  2MKZ A;  3U65 A;  2FBP A;  1FBC A;  4HE0 A;  3KC1 A;  1LBZ A;  4GWY A;  2FIE A;  4N8G A;  5I3S A;  1NV4 A;  2OX3 A;  4X04 A;  4O94 A;  4GX4 A;  4MAG A;  3E78 A;  3W9W A;  5IGA A;  4MX6 A;  1IMA A;  4N6D A;  1FSA A;  1IMD A;  2HZK A;  2V4C A;  4NQ8 A;  1FRP A;  4DI3 D;  1FBG A;  4PET A;  4H46 A;  4MNP A;  2XXK A;  1DBZ A;  4MEV A;  4N8Y A;  1FPB A;  4PFB A;  4DI4 B;  1NV1 A;  4NF0 A;  4PBH A;  1DK4 A;  2WYP A;  5EQA A;  2XWI A;  2ZZV A;  4P1E A;  5IZ3 A;  3FXB A;  1YYZ A;  4HE2 A;  5FBP A;  4PBQ A;  4OVS A;  4NX1 A;  2QVV A;  5IZZ A;  4GWX A;  5ESY A;  4MNC A;  5J1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...