2FIXA

Structure of human liver fbpase complexed with potent benzoxazole allosteric inhibitiors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
327
structure length
318
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Benzoxazole benzenesulfonamides as allosteric inhibitors of fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 318
sequence length 327
chains with identical sequence D, H, L
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2fixA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2fixA02
2F3DA 1INPA 1RDXA 4GWYA 4GWSA 1FPGA 1EYKA 5ET8A 2Y5KA 1FTAA 4H45A 2BJIA 1EYIA 2F3BA 4N81A 1NI9A 1NV5A 1NUWA 3KBZA 4GWXA 1NV6A 1IMFA 1G0IA 1Q9DA 2QFLA 4GBWA 4GWWA 5LDZA 4HE1A 4GBVA 5EQ7A 1FSAA 2CZKA 1FBFA 1DCUA 2OX3A 3LUZA 4KXPA 5FBPA 3KC1A 3T0JA 4HE2A 2P3NA 2VT5A 3LV0A 2Q8MA 1EYJA 1NUZA 3A29A 5ET6A 2GQ1A 1FPBA 3BIGA 4I3EA 1LBWA 1IMCA 2FVZA 5EQ8A 1IMEA 4AS5A 2FIXA 1FBEA 5IZ1A 2WBDA 1NV4A 1JP4A 1SPIA 2PCRA 5EYHA 3RPLB 3ROJA 1FBCA 4AS4A 1FPIA 2CZIA 1FBHA 5DW8A 1FBPA 1FPEA 1QGXA 5ET7A 2CZHA 3BIHA 4G61A 2DDKA 5EYGA 1VDWA 1FJ6A 1FRPA 3D1RA 5IZ3A 1FPKA 2WBBA 5A5LA 5ET5A 5IZ3B 2QVVA 2FIEA 1DBZA 3KC0A 1NV3A 2FBPA 2Y5LA 4I40A 3B8BA 1G0HA 1KZ8A 4GX3A 1YZ0A 2OWZA 1KA0A 1YYZA 1LBXA 1NV2A 3RPLA 1RDYA 1CNQA 2P3VA 1KA1A 4PTKA 1DK4A 1K9ZA 3QMFA 1FBGA 5F24A 1K9YA 2R8TA 4GWZA 2QVUA 5EQAA 4QXDA 4H46A 1RDZA 3FBPA 1NUXA 1NUYA 1XI6A 1FPFA 4GX4A 1LBZA 1YXIA 1NV0A 2Q74A 4HXVA 5J16A 1FPJA 1FJ9A 1LBYA 1IMDA 2HHMA 1FPLA 4O7IA 1IMAA 5EQ9A 5I3SA 1BK4A 1LBVA 1NV7A 1LEVA 2FHYA 1FPDA 3IFAA 5T3JA 4I3YA 2WEFA 3RYDA 2JJKA 5ESYA 3IFCA 4IR8A 4MJOA 1D9QA 2QVRA 1AWBA 1NV1A 4HE0A 4GWUA 4FBPA 1FBDA 1IMBA 4GX6A
chains in the Genus database with same CATH superfamily
1EYKA 3KZGA 1Z7ME 5JK4A 4O3BA 5TPAA 1B46A 4H45A 2P2AA 1N04A 1FQAA 2O69A 1NV6A 1QUJA 4TLLB 3E78A 3D4CA 3K0VA 4GXAA 2IEEA 4OANA 1QKAA 2P3NA 2Q8MA 1QW0A 2I4BA 2KQZA 4YZZA 1OMPA 2NWJA 1BTJA 2QMXA 1NH7A 1A8FA 5EQ8A 4NF8A 1PB7A 1B3HA 3CG3A 2XXWA 4I8CA 2UXAA 1EZPA 3VLUA 2Y84A 2X7QA 5ET5A 2HAVA 1BIYA 1PEBA 2I0CA 3H6UA 3S9MC 5H8FB 5I5PA 4YB5A 3W15C 2XD3A 4PAKA 4GWZA 3KJTA 4NEDA 1M5CA 3IO4A 3ECRA 1B05A 3G7WA 4GX4A 4JVCA 2PBWA 1FQCA 3MW0A 1Y1ZA 3KOSA 1FJ9A 4F3SA 2DXRA 1H3DA 3TCGA 5AA3A 5ICTA 1MPBA 3MPKA 4MNCA 2F6PA 2VPOA 1VFEA 4KYSA 4P0GA 4YKJA 1AWBA 4EQ9A 2QS1A 3EPEA 2G29A 4I62A 3IJXB 4MEVA 5I2NB 3SKPA 1ZLQA 4N6KA 2DWIA 2Q2AA 2B3BA 1Y1MA 4P9KA 4POXA 4GBVA 4RYAA 3G3JA 1B5JA 4IGRA 3CG1A 1FW0A 4LA9A 1LCFA 2V25A 5I2KB 3PMWA 2HXRA 1FTOA 4ZZAA 1LBBA 4NF4A 4OVPA 4KCDA 3FXRA 1NV4A 3MPLA 4LONB 3RPLB 1MY1A 4NF6A 4R2FA 2ZZWA 2OBGA 1FJ6A 3M3LA 3K1NA 4PGNA 4NHBA 3S9EA 2OWSA 1MS7A 2GHBA 3TFLA 2ZZVA 3BFTA 2P3VA 4ZEIA 4U1ZA 2DOJA 4HW8A 2Y7RA 3MVYA 4HCYA 3TCHA 3W9WA 1UQWA 3N5LA 2HZLA 4PGPA 5IGAA 5J16A 3IR1A 4XTCQ 5I57A 3TQWA 1IMAA 4JWOA 2ESNA 5CBRA 3EN3A 1MXZA 1LFIA 4OQOA 2JJKA 4P0IA 3QSLA 4Q30B 5FHNA 2F7CA 3GBBA 5F1QA 1D3KA 4UACA 2GHAA 1R1NA 1P1WA 2A5SA 1XT8A 4H6DA 1H76A 4GWXA 5A5XA 1IMFA 2Q8JA 4DE8A 5TP9A 5ISUA 4MCOA 4E0WA 1O64A 2NOOA 3C32A 1JEVA 2AL4A 3IK6B 2DXYA 3ZKLA 3A29A 3BIGA 1OIBA 4ND9A 1XC1A 3FXUA 4KI0E 1I69A 4GF8A 2UVHA 5DT6A 4BDOA 3QK6A 2WYKA 2O7IA 1M5DA 1QVSA 2F97A 2XX9A 5AA2A 2ZYKA 3O6IA 1YTVA 5IZ3B 3T96B 2QVVA 2A5TB 4LVQA 3VLVA 2PX1A 3KN7A 2UVIA 5CC2A 2CZLA 1YZ0A 4DXBA 3FASA 2DSFA 1I6QA 4THIA 2DP8A 3ZKKA 3SESA 2R8TA 4Q8RA 3O6GA 2UVGA 4F3BA 5EYFA 1NV0A 2Q74A 1B7ZA 2VPNA 3S4UA 5ELVA 1XOCA 3DP8A 1EH3A 4XKRA 4JBZA 1I6BA 4OZ9A 3FVOA 2ZYNA 4ELOA 4NQ8A 4YKPA 3KSXA 1FTLA 4GLIA 4GRKA 4NE4A 4PFYA 1J1NA 1F9BA 3T9UA 2QVRA 3IB2A 4GWUA 3N6TA 1INPA 1Y3PA 4RK9A 3IB1A 4QFKA 3TCFA 4H8IA 4O3CA 3G3GA 4MLVA 5ICQA 2I49A 2VOZA 3OSQA 2H98A 3DELB 3E4RA 4XKQA 2THIA 4IO7A 4LATA 4FE8A 4Z0IA 5AA4B 3I5OA 4RPNA 4QSEA 1JVXA 2VT5A 5CMBA 1EYJA 1GGGA 3PV0E 1D9VA 1FPBA 1OLCA 3H3GA 2Y7KA 1MQIA 4AS5A 1LFGA 4KPTA 1Y4TA 3VXCA 1B6HA 4PFWA 3VLWA 4GWOA 3Q29A 4QFOA 3PPPA 4H1XA 3IJOB 2HFBA 2FIEA 1UTBB 3Q25A 3VVFA 2R9JA 2Y5LA 2XA5A 3TYHA 4ELQA 2H99A 5HBCA 4OTEA 1KA1A 1DK4A 2WKYA 2QS4A 1UIVA 1ANFA 5K2YA 4POWA 4NF5A 2D5WA 4H5FA 5L9MA 1NUXA 4XIGQ 2Y7WA 3GXAA 1Q35A 3OO7A 4HXVA 4UA8A 4PP0A 1B3EA 3L6HA 1FTKA 4DXUA 2HHMA 1ATGA 4ZS9A 2XXQA 3HSTA 3OENA 4GD5A 4R9GA 4EF1A 5T3JA 2B3FA 1Z7NE 2NUVA 3M3FA 4OMBA 5DEXA 4I9DA 3PMVA 2QSXA 5J1DA 3U72A 3E79A 1FBDA 2REGA 2P0SA 3A09A 1HSJA 3K6UA 1R9QA 2Y5KA 3B7DA 3T22A 1II5A 1SW4A 2F3BA 1B3FA 1NI9A 1R6ZA 4Z7EA 2XXVA 2DWJA 4KCCA 5LDZA 5LTCA 2H9BA 5EQ7A 3CFZA 3U92A 3QUJA 1B4ZA 4G2ZA 5L9SA 3CSGA 3FVNA 4Q0CA 4P1EA 3A3CA 4NX1A 4RA1A 3S9LC 5EYHA 3GYYA 2CZIA 3MVXA 3E9XA 3HPIA 3G3KA 4G61A 3N94A 1NNFA 1UTHB 1B7HA 1XVYA 3QUFA 5H8FA 4GXSB 1KZ8A 4GX3A 3MAMA 3UA8A 3IOTA 3RT8A 1OVBA 3MP6A 3RUMA 2XXKA 5FHMA 1IITA 2AYSA 1K9YA 3CFLA 3TTKA 1AIVA 1XI6A 3HO7A 4JB7A 1B3LA 4PDDA 1LBYA 1YCJA 4DCXA 5IAIA 3K00A 1Q1KA 1QUIA 1QKBA 2YJPA 3IFAA 4G4PA 2GFEA 1O7TA 1POY1 1H44A 3R7XA 1JEUA 4FAJA 3H6VA 2AIXA 3HHGA 3C36A 2F78A 3O6HA 5I2NA 3BFUA 3C33A 3KN8A 5CI5A 1OQGA 4BDRA 1FTAA 4IO4A 1DOTA 2B4MA 4OVJA 4R6YA 3E13X 4DIGA 1Y4CA 1NNTA 2XX7A 3K6VA 3LUZA 3PD8A 3NOHA 3OELA 5I2KA 4G68C 2GQ1A 1ZMGA 3TAJA 3K2DA 3FATA 2RINA 2XXYA 4IB2A 4N8GA 4EDPA 1Y3NA 2Q9TA 2VD2A 3T9HB 1FPEA 3U8QA 2HPGA 3FJ7A 3IOUA 4OVTA 5F7VA 3UN6A 2HCAA 3OO8A 3KOTA 4N91A 1WVJA 3H4ZA 4GVOA 1BLFA 1LBXA 3OSRA 3JZJA 4NMYA 4GQOA 3VXBA 2XXRA 3Q27A 4QXDA 3FVKA 2RC7A 1TT1A 4F3PA 4N13A 2H4IA 1N7XA 3K4UA 5ITPA 1MH4A 1P99A 3PUXE 3FZVA 2XXIA 2O1MA 3B6TA 1CE2A 4KFQA 4JXIA 3MZBA 3OEMA 2FNCA 1MDP1 3O9PA 1MQHA 1B4HA 4MNIA 1SVXB 4N4UA 3LR1A 4FEBA 4PFBA 1RDXA 4R6HA 1VE4A 2F34A 1EU8A 4F2OA 4JWXA 1TWYA 4G68B 4IY5A 3CFXA 1IXGA 1IEJA 4ELRA 4HE1A 4OFOA 1JETA 4GL8A 1RYOA 4YB7A 3KC1A 4KQPA 3IO6A 2XXUA 1AOVA 3SZPA 2OPDA 5AA2D 4G8NA 1MXVA 5DVJA 1SI1A 1ZIUA 4O8MA 2VGQA 3OMBA 4U4SA 1S9TA 1LB8A 5EYGA 5IZ3A 1XS5A 3LC8A 4YMBA 3FV2A 2A5TA 1DBZA 4L17A 4F22A 2O51A 1B58A 1A55A 4PQJA 1JQFA 4EXLA 5I84A 4PCDA 5H8HB 2CEYA 4DCYA 1SQYA 3W9VA 1VR5A 1MY3A 4C1TA 4QSDA 4F1VA 3DP6A 3O66A 4RXLA 2Q2CA 3U93A 5IKBA 1IXIA 1P1QA 2XXHA 3FD3A 4EUOA 1FPFA 3T1BA 2OJTA 4PFUA 3VE1B 1SD3A 3CVGA 3TMGA 3RPWA 1IMDA 1B40A 4EQBA 1NV7A 5I58B 3CR9A 2XWVA 3I3VA 2F36A 1GVCA 4KYEA 2WEFA 1MM7A 2L5VA 3UORA 2Z23A 5DVIA 4OENA 1NV1A 4HE0A 2V84A 3QYTA 5F24A 3SETA 1OLAA 3K6XA 2HEUA 3DLNA 3KSJA 1LFHA 1TXFA 4X9TA 4R2BA 4R6KA 2QS2A 2DE2A 1NV5A 3ISPA 4F39A 4GWWA 5AA4A 1FCKA 4M4GA 1XHYA 1NL5A 2H25A 3K1MA 4XFEA 5ET6A 1NNKA 2UVJA 3U94A 4KYDA 1LBWA 3HCQA 4OYVA 5CMMA 4NGUA 1QGXA 4R74A 4F1YA 3O2AA 2W7YA 3SDFA 1FPKA 1B5HA 1UTBA 1N7WA 1S50A 2YPNA 1MDQA 2V4CA 4M1VA 4N15A 4PE5B 4F19A 4QFPA 1GR2A 4KR5A 4UABA 4R75A 1SW2A 3MWBA 4PAFA 1SI0A 2Y7IA 1YXIA 4NF0A 3EHSA 2ZMBA 1A8EA 3CHGA 4U4XA 1LLSA 5I3SA 1DPEA 2QL3A 2B4LA 1N3WA 4OFLA 1JVYA 4H65A 4MJOA 1P1UA 1B0HA 2DWAA 3U1OA 2XXPA 4XXUA 2O84X 4FECA 2VHAA 4QBAA 4GWSA 1B52A 3RTWB 5KDTB 3G3IA 1LAHE 3B6QA 2BJIA 1EYIA 4NWCA 3LSWA 3UGWA 1NUWA 4N6DA 3D4GA 2QFLA 5EHSA 3PTYA 2UYEA 4RY1A 4QSCA 1FBFA 1DCUA 1TFAA 4N17A 3T0JA 1B32A 2RC9A 2ZXTA 2X7PA 2DWHA 5IZ1A 2PCRA 2O7UA 3ROJA 1P1NA 4F31B 3TUSA 3T9VA 3RT6B 4MFIA 2R71A 1UTHA 4DXCA 4P3LA 4P47A 4ZEDA 3PD9A 1JNFA 1NV3A 2XXTA 3FUZA 3B8BA 1G0HA 1MG1A 1MY0A 3FGSA 4G8HA 2G93A 3P7IA 1IXHA 1VFDA 3GBAA 5IZZA 2QRYA 3FBPA 3IORA 2Q89A 3VDFA 1DMBA 3KFMA 3ILTB 4GL0A 4AB5A 3V8XB 4O7IA 4BDNA 5M2VA 1OVTA 4YU0A 1LEVA 4F29A 2IA4A 4I3YA 2Z22A 3KBRA 4PETA 2F7BA 1CB6A 1D9QA 2O68A 3C31A 4E0XA 4LZ7A 4O3AA 2F5XA 1P1OA 2HAUA 3MVZA 1QULA 5ET8A 2VD3A 4ESXA 3PPQA 2F7AA 4EQ7A 5B70A 1MPDA 3EF7A 4IGTA 4DI3D 3KBZA 1MRPA 4XKNA 2Z8EA 1IXCA 5AA1A 4ECFA 2XX8A 5BWJA 5CMKA 2PT1A 2PFZA 1A40A 4I3EA 3A3UA 3USDA 5JTYB 1IMCA 4BDMA 3M8UA 4JDFA 5K2XA 1FBEA 2I6EA 2HXWA 4GFRA 2ANJA 1ELJA 3KGCA 4DLDA 1BKAA 3R26A 1VSOA 2V3UA 2CEXA 1USYE 2M8CA 4TLMB 4FJPA 4BDQA 3RQTA 1PBQA 1B5IA 3H03A 1LCTA 2ONRA 4ELPA 4TOZA 4U22A 2Q88A 1KA0A 3PUWE 1SYHA 5CMCA 5I59B 3RN8A 4AB6A 1PC3A 2QVUA 2XXXA 2ZNTA 5EQAA 2FA7A 1L5TA 4DDDA 4QRZA 3TDJA 3HV1A 1A99A 4OHNA 2REJA 3KG2A 2DYXA 1URSA 4ZEKA 1LSTA 2OCUA 3K1PA 4KHZE 2VP1A 2YLNA 5H8NB 3MP8A 5I56B 3UIFA 3OO6A 4OETA 4ZECA 3RYDA 3G3HA 3N6UA 2OLBA 3ONMA 1IMBA 2V3TA 3TODA 5IM2A 4GWYA 3HHFA 1PB8A 4Q5TA 1NH8A 4G68A 2DS9A 4I1DA 2QMWA 1A7LA 1POTA 1MY4A 3SEUA 4YAHX 5AE4A 2OPEA 2RCAA 4HE2A 4JVIA 4MIJA 2UYFA 2QPQA 3LV0A 2DE3A 3ZS6A 1MXYA 2Z8FA 1QJMA 1FQFA 2FIXA 1D4NA 3AXFA 1MPCA 2V3QA 1FPIA 3C34A 3IAZA 3O29A 2ZZXA 3MP1A 4O94A 4IY6A 1NFTA 4YB6A 1AMFA 1B1XA 1DSNA 3MUQA 1Y20A 2NXOA 1LAXA 4I40A 4PFIA 3C9HA 3PMXA 5H8HA 5DVFA 4OXVA 5ITOA 3RPLA 1RDYA 3TTMA 1CNQA 4PBQA 3UP9A 3TTNA 3ILUB 1K9ZA 1FBGA 4OVSA 4LQ5A 3F11A 1WODA 3LSLA 3LBSA 1LBZA 3DP4A 4K3FA 4YKIA 3RGYA 5H8QB 1PB9A 4FATA 2KLFA 3PPOA 4H0WA 1Y3QA 5I58A 5EQ9A 4QF9A 1FPDA 3IL1B 4JWYA 4KD5A 4XKPA 4GIZA 3JYRA 2D21A 2NVUB 4NN3A 1I6AA 2GH9A 1US5A 4YMAA 3MYUA 3C35A 2XWIA 2DVZA 3BKIB 1TFDA 1YAEA 3ODBA 5KZTA 3Q28A 2CMOA 1B2HA 2DQVA 4PBHA 3TELA 3KEIA 3TKDA 3RTFB 2I48A 1G0IA 3N26A 3MZ9A 3V5AA 2PFYA 1ZU0A 3IX1A 2OX3A 2MKZA 4C1UA 5KCJB 4X48A 4MNPA 4NAPA 3SEVA 1LBCA 1IMEA 1LGBC 2RF1A 4AQ4A 3KJ7A 3BBRA 2DE4A 4ISUA 2I58A 3LSXA 1FTMA 1SYIA 4MBPA 5A5LA 4N8YA 5LOMA 3PGFA 1ZKBA 3SEWA 3Q26A 3H6WA 1MXWA 1SW5A 3SEXA 1KWHA 1SW1A 3EHTA 3L6GA 3VV5A 4PC9A 1Y9UA 3T9XB 2QJEA 2RC8A 1B1HA 3TQLA 3K01A 2OZZA 4P8BA 4ESWA 1EZOA 3TPAA 3E3KA 4XEQA 2ALUA 4LN5A 1S7YA 4ZE8A 4YICA 4F2QA 1FPJA 3RY3A 2B65A 4P56A 4HTGA 2O6AA 3PUVE 1O63A 5DYHA 2XWKA 4PF6A 4U2RA 3TZAA 1B3GA 4ONYA 4OVRA 5KDTA 1WDNA 4LZ5A 5TPAB 3PUYE 1QUKA 4H8JA 3GLBA 4OESA 1Q9DA 4GBWA 1URDA 2FYIA 2XD2A 5FHOA 3C4MA 1MQDA 3H6TA 2PT2A 3PU5A 4PDHA 2XWOA 5L9OA 3RNNA 4NTLA 3PPNA 3PUZE 5H8SA 4NF8B 1SPIA 2F8DA 1MQJA 1FBHA 5CBSA 3BIHA 2I4CA 3OO9A 1JW5A 5FTIA 3D1RA 3FJGA 4WKMA 3IOWA 1RYXA 4WEDA 4OWDA 2XHDA 2ONKE 2BJJX 3OOAA 4NWDA 4ZEFA 3MVWA 5BUUA 2PYYA 4U23A 3UK4A 3EHUA 3FVGA 1LB9A 4GOTA 1HSEA 4EXKA 1URGA 1N0TA 1MY2A 3K6WA 4X1BA 4DI4B 3IB0A 1LAFE 3FXQA 3U65A 4X04A 3FJMA 2I3VA 4JSOA 1FPLA 4IO2A 4XF5A 4OA4A 1LBVA 2DVCA 4QFLA 2RKMA 4BLAA 4C0RA 3IFCA 4IR8A 3MZ1A 1D9YA 5CRYA 4F18A 4GX6A 1FQEA 4OEUA 1SDXA 3CI8A 1HSLA 1JW4A 4N81A 3TTLA 4FORA 3T66A 4JSDA 1ZJLA 4KXPA 2E0SA 2ZNUA 5CM6A 5JEIA 2ABHA 2RCBA 5JTYA 2P1SA 2FVZA 2O1LA 3H06B 4X1DA 2OK2A 4NF4B 4PE3A 5FTHA 4NF6B 3VVEA 4N07A 1FBPA 1NMUA 2CZHA 1VDWA 3S9NC 4N6PA 3EQ1A 2WBBA 1IUDA 2OWTA 3KC0A 4YKKA 3S2VA 3OXNA 1MXUA 2HQ0A 4JVDA 2OWZA 1YYZA 3K02A 4H67A 5I59A 4H5GA 1XVXA 1LAGE 4PTKA 1PBPA 1SBPA 1N84A 4F3GA 4MX6A 3CIJA 4RPOA 2LAOA 5EHMA 1RDZA 1NUYA 3G3FA 1YPNA 4ZDMA 1PDAA 5DTBA 1M5BA 4RJZA 5I57B 1IIWA 1OQHA 5H8NA 4P1LA 5I56A 1M5FA 3V89B 1FQBA 5HM4B 1N3XA 5ESYA 2ZYMA 1T0KA 2WX9A 1DPPA 1B0LA 4FBPA 1NNPA 2I3WA 3TTRA 1USYH 2WYPA 1GTKA 1M5EA 3IOVA 1NKXA 2H5YA 4P11A 3DM0A 3GZGA 5A5XB 4QFNA 2CZKA 1UIUA 5TP9B 5FBPA 4X8RA 1MXXA 1H43A 1DTZA 1A54A 3T93B 3OD7A 2WBDA 4HCWA 2AL5A 4LUBA 1FTJA 2DDKA 3VVDA 5AA2B 1AL3A 3OEKA 3WAFA 3ZSFA 1GV8A 4G77A 2X26A 4QHQA 3O97A 5HPQA 4DZ1A 4F1UA 1NV2A 4PF8A 5I7IA 1MM6A 2QS3A 3QMFA 4PFRA 1ZBMA 1B9JA 4ZE9A 3QIMA 1US4A 1MQGA 1IQ7A 5H8QA 3HFUA 4G8MA 4WXJA 4BDLA 4PAIA 2ONSA 4OVQA 4R72A 4IO6A 1RKMA 3WAEA 3TEPA 1FQDA 4U1OA 4MH5A 4OFJA 2F3DA 1FPGA 3V83A 1N76A 1DTGA 4IO3A 2R6GE 3EKIA 2KR0A 3MQ9A 5TU0A 4R9FA 2PVUA 3FXBA 3THIA 1ZTYA 4LZ8A 1FSAA 3I6VA 4MHFA 3QXMA 4EF2A 5KCJA 4ZZEA 1NUZA 3MSTA 4ZEBA 2PMSA 1R9LA 4WEPA 4U21A 1JP4A 2ZNSA 3HN0A 1FBCA 4AS4A 2ZYOA 1B51A 3SERA 2D3IA 3O28A 5DW8A 5ET7A 3MC2A 4OEVA 4LP2B 2Z8DA 4OERA 4RNSA 4TQUQ 1FRPA 1IZ1A 2HZKA 4R73A 2FBPA 4NG7A 4MAGA 3KN3A 3CRBA 3MBPA 4FEDA 3M3KA 4HS7A 2Y7PA 3B50A 3LSFB 4IO5A 3JV9A 3QAXA 2E1SA 2I0BA 2GRVA 2F35A 3SEYA 4H46A 1JW1A 3B6WA 4NF5B 1EZ9A 5B7DA 1BP5A 3CSBA 4O7MA 2F6GA 4FIMA 3RLFE 4MMPA 1AH5A 4PFTA 4RK2A 3H7MA 1BK4A 1MH3A 2V93A 3LUYA 3R6UA 3FIRA 2FHYA 1B7UA 3VFJA 3FV1A 4MF3A 4LQ2A 3PPRA 3MJNA 4MLQA 5DEXB 1H45A 5L8DA
chains in the Genus database with same CATH topology
4QBAA 4OVRA 4GWSA 1EYKA 2Y5KA 5JK4A 4H45A 2BJIA 1EYIA 2F3BA 1NI9A 1NUWA 4N6DA 1NV6A 1Q9DA 2QFLA 4GBWA 5LDZA 3E78A 5LTCA 3PTYA 5EQ7A 1FBFA 1DCUA 4N17A 4OANA 3T0JA 4PDHA 2XWOA 2P3NA 2Q8MA 2KQZA 4YZZA 5EQ8A 5IZ1A 4P1EA 4NX1A 1SPIA 2PCRA 5EYHA 3ROJA 3GYYA 2CZIA 1FBHA 3BIHA 4G61A 3D1RA 4P3LA 4P47A 5ET5A 1NV3A 3B8BA 1G0HA 1KZ8A 4GX3A 5I5PA 2XXKA 1K9YA 4PAKA 4GWZA 5IZZA 3FBPA 1XI6A 4GX4A 4JVCA 4DI4B 4PDDA 3U65A 4X04A 1FJ9A 1LBYA 1FPLA 4O7IA 4XF5A 4OA4A 1LBVA 1LEVA 3IFAA 4I3YA 4MNCA 2VPOA 4PETA 3IFCA 4IR8A 1D9QA 1AWBA 4F18A 4GX6A 2F5XA 4MEVA 5ET8A 1FTAA 4N6KA 2B4MA 4N81A 4DI3D 3KBZA 4P9KA 4GBVA 3LUZA 4KXPA 3NOHA 5CM6A 2HXRA 2GQ1A 2PFZA 4I3EA 1IMCA 2FVZA 1FBEA 4OVPA 1NV4A 4N8GA 4PE3A 3RPLB 2Q9TA 1FBPA 1FPEA 2CEXA 2ZZWA 2CZHA 2HPGA 1VDWA 4OVTA 1FJ6A 2WBBA 4PGNA 3KC0A 4N91A 4NHBA 4JVDA 2ZZVA 2OWZA 1KA0A 1YYZA 1LBXA 2P3VA 4PTKA 2QVUA 5EQAA 4MX6A 4QXDA 1RDZA 1NUYA 4HCYA 3W9WA 2HZLA 4PGPA 5IGAA 5J16A 1IMAA 4P1LA 3RYDA 2JJKA 5ESYA 2WX9A 4MNIA 4FBPA 4N4UA 1IMBA 5IM2A 4PFBA 1RDXA 4GWYA 2WYPA 4GWXA 1IMFA 4HE1A 4MCOA 2CZKA 5FBPA 4X8RA 3KC1A 4HE2A 4JVIA 4MIJA 2QPQA 3LV0A 2DE3A 3A29A 3BIGA 3SZPA 2FIXA 2WBDA 4HCWA 4O8MA 2WYKA 2V3QA 1FPIA 2DDKA 5EYGA 2ZZXA 5IZ3A 4O94A 5IZ3B 2QVVA 1DBZA 4I40A 4PFIA 4PCDA 1YZ0A 2CEYA 4F1UA 3W9VA 1NV2A 3RPLA 1RDYA 4PF8A 4F1VA 1CNQA 5I7IA 4PBQA 1K9ZA 3QMFA 1FBGA 4PFRA 4OVSA 2R8TA 1FPFA 1LBZA 3T1BA 1NV0A 2Q74A 2VPNA 3HFUA 1IMDA 5EQ9A 4PAIA 1NV7A 4OVQA 1FPDA 2XWVA 4NQ8A 2WEFA 2L5VA 4NN3A 2QVRA 1NV1A 4HE0A 4GWUA 5F24A 3MYUA 2XWIA 2DVZA 2F3DA 1INPA 1FPGA 3EKIA 4PBHA 4X9TA 2KR0A 2DE2A 1NV5A 3ISPA 1G0IA 3FXBA 4GWWA 2PFYA 1FSAA 2OX3A 4MHFA 2MKZA 4XFEA 2VT5A 1EYJA 1NUZA 5ET6A 4MNPA 3MSTA 1FPBA 4NAPA 1LBWA 1IMEA 4AS5A 1JP4A 1FBCA 4AS4A 2DE4A 5DW8A 4NGUA 1QGXA 5ET7A 1FRPA 1FPKA 5A5LA 2HZKA 4N8YA 2FIEA 2FBPA 4NG7A 4MAGA 2Y5LA 2XA5A 2V4CA 4M1VA 4N15A 3B50A 4F19A 1KA1A 1DK4A 4PC9A 4UABA 4H46A 4PAFA 1NUXA 4P8BA 1YXIA 4O7MA 4HXVA 4XEQA 4NF0A 4LN5A 4MMPA 4YICA 1FPJA 2HHMA 3CHGA 5I3SA 4P56A 1BK4A 2FHYA 2B4LA 5T3JA 2XWKA 4PF6A 4MJOA 5J1DA 3E79A 1FBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3D A;  1INP A;  1RDX A;  4GWY A;  4GWS A;  1FPG A;  1EYK A;  5ET8 A;  2Y5K A;  1FTA A;  4H45 A;  2BJI A;  1EYI A;  2F3B A;  4N81 A;  1NI9 A;  1NV5 A;  1NUW A;  3KBZ A;  4GWX A;  1NV6 A;  1IMF A;  1G0I A;  1Q9D A;  2QFL A;  4GBW A;  4GWW A;  5LDZ A;  4HE1 A;  4GBV A;  5EQ7 A;  1FSA A;  2CZK A;  1FBF A;  1DCU A;  2OX3 A;  3LUZ A;  4KXP A;  5FBP A;  3KC1 A;  3T0J A;  4HE2 A;  2P3N A;  2VT5 A;  3LV0 A;  2Q8M A;  1EYJ A;  1NUZ A;  3A29 A;  5ET6 A;  2GQ1 A;  1FPB A;  3BIG A;  4I3E A;  1LBW A;  1IMC A;  2FVZ A;  5EQ8 A;  1IME A;  4AS5 A;  2FIX A;  1FBE A;  5IZ1 A;  2WBD A;  1NV4 A;  1JP4 A;  1SPI A;  2PCR A;  5EYH A;  3RPL B;  3ROJ A;  1FBC A;  4AS4 A;  1FPI A;  2CZI A;  1FBH A;  5DW8 A;  1FBP A;  1FPE A;  1QGX A;  5ET7 A;  2CZH A;  3BIH A;  4G61 A;  2DDK A;  5EYG A;  1VDW A;  1FJ6 A;  1FRP A;  3D1R A;  5IZ3 A;  1FPK A;  2WBB A;  5A5L A;  5ET5 A;  5IZ3 B;  2QVV A;  2FIE A;  1DBZ A;  3KC0 A;  1NV3 A;  2FBP A;  2Y5L A;  4I40 A;  3B8B A;  1G0H A;  1KZ8 A;  4GX3 A;  1YZ0 A;  2OWZ A;  1KA0 A;  1YYZ A;  1LBX A;  1NV2 A;  3RPL A;  1RDY A;  1CNQ A;  2P3V A;  1KA1 A;  4PTK A;  1DK4 A;  1K9Z A;  3QMF A;  1FBG A;  5F24 A;  1K9Y A;  2R8T A;  4GWZ A;  2QVU A;  5EQA A;  4QXD A;  4H46 A;  1RDZ A;  3FBP A;  1NUX A;  1NUY A;  1XI6 A;  1FPF A;  4GX4 A;  1LBZ A;  1YXI A;  1NV0 A;  2Q74 A;  4HXV A;  5J16 A;  1FPJ A;  1FJ9 A;  1LBY A;  1IMD A;  2HHM A;  1FPL A;  4O7I A;  1IMA A;  5EQ9 A;  5I3S A;  1BK4 A;  1LBV A;  1NV7 A;  1LEV A;  2FHY A;  1FPD A;  3IFA A;  5T3J A;  4I3Y A;  2WEF A;  3RYD A;  2JJK A;  5ESY A;  3IFC A;  4IR8 A;  4MJO A;  1D9Q A;  2QVR A;  1AWB A;  1NV1 A;  4HE0 A;  4GWU A;  4FBP A;  1FBD A;  1IMB A;  4GX6 A; 
#chains in the Genus database with same CATH topology
 1EYK A;  3KZG A;  1Z7M E;  5JK4 A;  4O3B A;  5TPA A;  1B46 A;  4H45 A;  2P2A A;  1N04 A;  1FQA A;  2O69 A;  1NV6 A;  1QUJ A;  4TLL B;  3E78 A;  3D4C A;  3K0V A;  4GXA A;  2IEE A;  4OAN A;  1QKA A;  2P3N A;  2Q8M A;  1QW0 A;  2I4B A;  2KQZ A;  4YZZ A;  1OMP A;  2NWJ A;  1BTJ A;  2QMX A;  1NH7 A;  1A8F A;  5EQ8 A;  4NF8 A;  1PB7 A;  1B3H A;  3CG3 A;  2XXW A;  4I8C A;  2UXA A;  1EZP A;  3VLU A;  2Y84 A;  2X7Q A;  5ET5 A;  2HAV A;  1BIY A;  1PEB A;  2I0C A;  3H6U A;  3S9M C;  5H8F B;  5I5P A;  4YB5 A;  3W15 C;  2XD3 A;  4PAK A;  4GWZ A;  3KJT A;  4NED A;  1M5C A;  3IO4 A;  3ECR A;  1B05 A;  3G7W A;  4GX4 A;  4JVC A;  2PBW A;  1FQC A;  3MW0 A;  1Y1Z A;  3KOS A;  1FJ9 A;  4F3S A;  2DXR A;  1H3D A;  3TCG A;  5AA3 A;  5ICT A;  1MPB A;  3MPK A;  4MNC A;  2F6P A;  2VPO A;  1VFE A;  4KYS A;  4P0G A;  4YKJ A;  1AWB A;  4EQ9 A;  2QS1 A;  3EPE A;  2G29 A;  4I62 A;  3IJX B;  4MEV A;  5I2N B;  3SKP A;  1ZLQ A;  4N6K A;  2DWI A;  2Q2A A;  2B3B A;  1Y1M A;  4P9K A;  4POX A;  4GBV A;  4RYA A;  3G3J A;  1B5J A;  4IGR A;  3CG1 A;  1FW0 A;  4LA9 A;  1LCF A;  2V25 A;  5I2K B;  3PMW A;  2HXR A;  1FTO A;  4ZZA A;  1LBB A;  4NF4 A;  4OVP A;  4KCD A;  3FXR A;  1NV4 A;  3MPL A;  4LON B;  3RPL B;  1MY1 A;  4NF6 A;  4R2F A;  2ZZW A;  2OBG A;  1FJ6 A;  3M3L A;  3K1N A;  4PGN A;  4NHB A;  3S9E A;  2OWS A;  1MS7 A;  2GHB A;  3TFL A;  2ZZV A;  3BFT A;  2P3V A;  4ZEI A;  4U1Z A;  2DOJ A;  4HW8 A;  2Y7R A;  3MVY A;  4HCY A;  3TCH A;  3W9W A;  1UQW A;  3N5L A;  2HZL A;  4PGP A;  5IGA A;  5J16 A;  3IR1 A;  4XTC Q;  5I57 A;  3TQW A;  1IMA A;  4JWO A;  2ESN A;  5CBR A;  3EN3 A;  1MXZ A;  1LFI A;  4OQO A;  2JJK A;  4P0I A;  3QSL A;  4Q30 B;  5FHN A;  2F7C A;  3GBB A;  5F1Q A;  1D3K A;  4UAC A;  2GHA A;  1R1N A;  1P1W A;  2A5S A;  1XT8 A;  4H6D A;  1H76 A;  4GWX A;  5A5X A;  1IMF A;  2Q8J A;  4DE8 A;  5TP9 A;  5ISU A;  4MCO A;  4E0W A;  1O64 A;  2NOO A;  3C32 A;  1JEV A;  2AL4 A;  3IK6 B;  2DXY A;  3ZKL A;  3A29 A;  3BIG A;  1OIB A;  4ND9 A;  1XC1 A;  3FXU A;  4KI0 E;  1I69 A;  4GF8 A;  2UVH A;  5DT6 A;  4BDO A;  3QK6 A;  2WYK A;  2O7I A;  1M5D A;  1QVS A;  2F97 A;  2XX9 A;  5AA2 A;  2ZYK A;  3O6I A;  1YTV A;  5IZ3 B;  3T96 B;  2QVV A;  2A5T B;  4LVQ A;  3VLV A;  2PX1 A;  3KN7 A;  2UVI A;  5CC2 A;  2CZL A;  1YZ0 A;  4DXB A;  3FAS A;  2DSF A;  1I6Q A;  4THI A;  2DP8 A;  3ZKK A;  3SES A;  2R8T A;  4Q8R A;  3O6G A;  2UVG A;  4F3B A;  5EYF A;  1NV0 A;  2Q74 A;  1B7Z A;  2VPN A;  3S4U A;  5ELV A;  1XOC A;  3DP8 A;  1EH3 A;  4XKR A;  4JBZ A;  1I6B A;  4OZ9 A;  3FVO A;  2ZYN A;  4ELO A;  4NQ8 A;  4YKP A;  3KSX A;  1FTL A;  4GLI A;  4GRK A;  4NE4 A;  4PFY A;  1J1N A;  1F9B A;  3T9U A;  2QVR A;  3IB2 A;  4GWU A;  3N6T A;  1INP A;  1Y3P A;  4RK9 A;  3IB1 A;  4QFK A;  3TCF A;  4H8I A;  4O3C A;  3G3G A;  4MLV A;  5ICQ A;  2I49 A;  2VOZ A;  3OSQ A;  2H98 A;  3DEL B;  3E4R A;  4XKQ A;  2THI A;  4IO7 A;  4LAT A;  4FE8 A;  4Z0I A;  5AA4 B;  3I5O A;  4RPN A;  4QSE A;  1JVX A;  2VT5 A;  5CMB A;  1EYJ A;  1GGG A;  3PV0 E;  1D9V A;  1FPB A;  1OLC A;  3H3G A;  2Y7K A;  1MQI A;  4AS5 A;  1LFG A;  4KPT A;  1Y4T A;  3VXC A;  1B6H A;  4PFW A;  3VLW A;  4GWO A;  3Q29 A;  4QFO A;  3PPP A;  4H1X A;  3IJO B;  2HFB A;  2FIE A;  1UTB B;  3Q25 A;  3VVF A;  2R9J A;  2Y5L A;  2XA5 A;  3TYH A;  4ELQ A;  2H99 A;  5HBC A;  4OTE A;  1KA1 A;  1DK4 A;  2WKY A;  2QS4 A;  1UIV A;  1ANF A;  5K2Y A;  4POW A;  4NF5 A;  2D5W A;  4H5F A;  5L9M A;  1NUX A;  4XIG Q;  2Y7W A;  3GXA A;  1Q35 A;  3OO7 A;  4HXV A;  4UA8 A;  4PP0 A;  1B3E A;  3L6H A;  1FTK A;  4DXU A;  2HHM A;  1ATG A;  4ZS9 A;  2XXQ A;  3HST A;  3OEN A;  4GD5 A;  4R9G A;  4EF1 A;  5T3J A;  2B3F A;  1Z7N E;  2NUV A;  3M3F A;  4OMB A;  5DEX A;  4I9D A;  3PMV A;  2QSX A;  5J1D A;  3U72 A;  3E79 A;  1FBD A;  2REG A;  2P0S A;  3A09 A;  1HSJ A;  3K6U A;  1R9Q A;  2Y5K A;  3B7D A;  3T22 A;  1II5 A;  1SW4 A;  2F3B A;  1B3F A;  1NI9 A;  1R6Z A;  4Z7E A;  2XXV A;  2DWJ A;  4KCC A;  5LDZ A;  5LTC A;  2H9B A;  5EQ7 A;  3CFZ A;  3U92 A;  3QUJ A;  1B4Z A;  4G2Z A;  5L9S A;  3CSG A;  3FVN A;  4Q0C A;  4P1E A;  3A3C A;  4NX1 A;  4RA1 A;  3S9L C;  5EYH A;  3GYY A;  2CZI A;  3MVX A;  3E9X A;  3HPI A;  3G3K A;  4G61 A;  3N94 A;  1NNF A;  1UTH B;  1B7H A;  1XVY A;  3QUF A;  5H8F A;  4GXS B;  1KZ8 A;  4GX3 A;  3MAM A;  3UA8 A;  3IOT A;  3RT8 A;  1OVB A;  3MP6 A;  3RUM A;  2XXK A;  5FHM A;  1IIT A;  2AYS A;  1K9Y A;  3CFL A;  3TTK A;  1AIV A;  1XI6 A;  3HO7 A;  4JB7 A;  1B3L A;  4PDD A;  1LBY A;  1YCJ A;  4DCX A;  5IAI A;  3K00 A;  1Q1K A;  1QUI A;  1QKB A;  2YJP A;  3IFA A;  4G4P A;  2GFE A;  1O7T A;  1POY 1;  1H44 A;  3R7X A;  1JEU A;  4FAJ A;  3H6V A;  2AIX A;  3HHG A;  3C36 A;  2F78 A;  3O6H A;  5I2N A;  3BFU A;  3C33 A;  3KN8 A;  5CI5 A;  1OQG A;  4BDR A;  1FTA A;  4IO4 A;  1DOT A;  2B4M A;  4OVJ A;  4R6Y A;  3E13 X;  4DIG A;  1Y4C A;  1NNT A;  2XX7 A;  3K6V A;  3LUZ A;  3PD8 A;  3NOH A;  3OEL A;  5I2K A;  4G68 C;  2GQ1 A;  1ZMG A;  3TAJ A;  3K2D A;  3FAT A;  2RIN A;  2XXY A;  4IB2 A;  4N8G A;  4EDP A;  1Y3N A;  2Q9T A;  2VD2 A;  3T9H B;  1FPE A;  3U8Q A;  2HPG A;  3FJ7 A;  3IOU A;  4OVT A;  5F7V A;  3UN6 A;  2HCA A;  3OO8 A;  3KOT A;  4N91 A;  1WVJ A;  3H4Z A;  4GVO A;  1BLF A;  1LBX A;  3OSR A;  3JZJ A;  4NMY A;  4GQO A;  3VXB A;  2XXR A;  3Q27 A;  4QXD A;  3FVK A;  2RC7 A;  1TT1 A;  4F3P A;  4N13 A;  2H4I A;  1N7X A;  3K4U A;  5ITP A;  1MH4 A;  1P99 A;  3PUX E;  3FZV A;  2XXI A;  2O1M A;  3B6T A;  1CE2 A;  4KFQ A;  4JXI A;  3MZB A;  3OEM A;  2FNC A;  1MDP 1;  3O9P A;  1MQH A;  1B4H A;  4MNI A;  1SVX B;  4N4U A;  3LR1 A;  4FEB A;  4PFB A;  1RDX A;  4R6H A;  1VE4 A;  2F34 A;  1EU8 A;  4F2O A;  4JWX A;  1TWY A;  4G68 B;  4IY5 A;  3CFX A;  1IXG A;  1IEJ A;  4ELR A;  4HE1 A;  4OFO A;  1JET A;  4GL8 A;  1RYO A;  4YB7 A;  3KC1 A;  4KQP A;  3IO6 A;  2XXU A;  1AOV A;  3SZP A;  2OPD A;  5AA2 D;  4G8N A;  1MXV A;  5DVJ A;  1SI1 A;  1ZIU A;  4O8M A;  2VGQ A;  3OMB A;  4U4S A;  1S9T A;  1LB8 A;  5EYG A;  5IZ3 A;  1XS5 A;  3LC8 A;  4YMB A;  3FV2 A;  2A5T A;  1DBZ A;  4L17 A;  4F22 A;  2O51 A;  1B58 A;  1A55 A;  4PQJ A;  1JQF A;  4EXL A;  5I84 A;  4PCD A;  5H8H B;  2CEY A;  4DCY A;  1SQY A;  3W9V A;  1VR5 A;  1MY3 A;  4C1T A;  4QSD A;  4F1V A;  3DP6 A;  3O66 A;  4RXL A;  2Q2C A;  3U93 A;  5IKB A;  1IXI A;  1P1Q A;  2XXH A;  3FD3 A;  4EUO A;  1FPF A;  3T1B A;  2OJT A;  4PFU A;  3VE1 B;  1SD3 A;  3CVG A;  3TMG A;  3RPW A;  1IMD A;  1B40 A;  4EQB A;  1NV7 A;  5I58 B;  3CR9 A;  2XWV A;  3I3V A;  2F36 A;  1GVC A;  4KYE A;  2WEF A;  1MM7 A;  2L5V A;  3UOR A;  2Z23 A;  5DVI A;  4OEN A;  1NV1 A;  4HE0 A;  2V84 A;  3QYT A;  5F24 A;  3SET A;  1OLA A;  3K6X A;  2HEU A;  3DLN A;  3KSJ A;  1LFH A;  1TXF A;  4X9T A;  4R2B A;  4R6K A;  2QS2 A;  2DE2 A;  1NV5 A;  3ISP A;  4F39 A;  4GWW A;  5AA4 A;  1FCK A;  4M4G A;  1XHY A;  1NL5 A;  2H25 A;  3K1M A;  4XFE A;  5ET6 A;  1NNK A;  2UVJ A;  3U94 A;  4KYD A;  1LBW A;  3HCQ A;  4OYV A;  5CMM A;  4NGU A;  1QGX A;  4R74 A;  4F1Y A;  3O2A A;  2W7Y A;  3SDF A;  1FPK A;  1B5H A;  1UTB A;  1N7W A;  1S50 A;  2YPN A;  1MDQ A;  2V4C A;  4M1V A;  4N15 A;  4PE5 B;  4F19 A;  4QFP A;  1GR2 A;  4KR5 A;  4UAB A;  4R75 A;  1SW2 A;  3MWB A;  4PAF A;  1SI0 A;  2Y7I A;  1YXI A;  4NF0 A;  3EHS A;  2ZMB A;  1A8E A;  3CHG A;  4U4X A;  1LLS A;  5I3S A;  1DPE A;  2QL3 A;  2B4L A;  1N3W A;  4OFL A;  1JVY A;  4H65 A;  4MJO A;  1P1U A;  1B0H A;  2DWA A;  3U1O A;  2XXP A;  4XXU A;  2O84 X;  4FEC A;  2VHA A;  4QBA A;  4GWS A;  1B52 A;  3RTW B;  5KDT B;  3G3I A;  1LAH E;  3B6Q A;  2BJI A;  1EYI A;  4NWC A;  3LSW A;  3UGW A;  1NUW A;  4N6D A;  3D4G A;  2QFL A;  5EHS A;  3PTY A;  2UYE A;  4RY1 A;  4QSC A;  1FBF A;  1DCU A;  1TFA A;  4N17 A;  3T0J A;  1B32 A;  2RC9 A;  2ZXT A;  2X7P A;  2DWH A;  5IZ1 A;  2PCR A;  2O7U A;  3ROJ A;  1P1N A;  4F31 B;  3TUS A;  3T9V A;  3RT6 B;  4MFI A;  2R71 A;  1UTH A;  4DXC A;  4P3L A;  4P47 A;  4ZED A;  3PD9 A;  1JNF A;  1NV3 A;  2XXT A;  3FUZ A;  3B8B A;  1G0H A;  1MG1 A;  1MY0 A;  3FGS A;  4G8H A;  2G93 A;  3P7I A;  1IXH A;  1VFD A;  3GBA A;  5IZZ A;  2QRY A;  3FBP A;  3IOR A;  2Q89 A;  3VDF A;  1DMB A;  3KFM A;  3ILT B;  4GL0 A;  4AB5 A;  3V8X B;  4O7I A;  4BDN A;  5M2V A;  1OVT A;  4YU0 A;  1LEV A;  4F29 A;  2IA4 A;  4I3Y A;  2Z22 A;  3KBR A;  4PET A;  2F7B A;  1CB6 A;  1D9Q A;  2O68 A;  3C31 A;  4E0X A;  4LZ7 A;  4O3A A;  2F5X A;  1P1O A;  2HAU A;  3MVZ A;  1QUL A;  5ET8 A;  2VD3 A;  4ESX A;  3PPQ A;  2F7A A;  4EQ7 A;  5B70 A;  1MPD A;  3EF7 A;  4IGT A;  4DI3 D;  3KBZ A;  1MRP A;  4XKN A;  2Z8E A;  1IXC A;  5AA1 A;  4ECF A;  2XX8 A;  5BWJ A;  5CMK A;  2PT1 A;  2PFZ A;  1A40 A;  4I3E A;  3A3U A;  3USD A;  5JTY B;  1IMC A;  4BDM A;  3M8U A;  4JDF A;  5K2X A;  1FBE A;  2I6E A;  2HXW A;  4GFR A;  2ANJ A;  1ELJ A;  3KGC A;  4DLD A;  1BKA A;  3R26 A;  1VSO A;  2V3U A;  2CEX A;  1USY E;  2M8C A;  4TLM B;  4FJP A;  4BDQ A;  3RQT A;  1PBQ A;  1B5I A;  3H03 A;  1LCT A;  2ONR A;  4ELP A;  4TOZ A;  4U22 A;  2Q88 A;  1KA0 A;  3PUW E;  1SYH A;  5CMC A;  5I59 B;  3RN8 A;  4AB6 A;  1PC3 A;  2QVU A;  2XXX A;  2ZNT A;  5EQA A;  2FA7 A;  1L5T A;  4DDD A;  4QRZ A;  3TDJ A;  3HV1 A;  1A99 A;  4OHN A;  2REJ A;  3KG2 A;  2DYX A;  1URS A;  4ZEK A;  1LST A;  2OCU A;  3K1P A;  4KHZ E;  2VP1 A;  2YLN A;  5H8N B;  3MP8 A;  5I56 B;  3UIF A;  3OO6 A;  4OET A;  4ZEC A;  3RYD A;  3G3H A;  3N6U A;  2OLB A;  3ONM A;  1IMB A;  2V3T A;  3TOD A;  5IM2 A;  4GWY A;  3HHF A;  1PB8 A;  4Q5T A;  1NH8 A;  4G68 A;  2DS9 A;  4I1D A;  2QMW A;  1A7L A;  1POT A;  1MY4 A;  3SEU A;  4YAH X;  5AE4 A;  2OPE A;  2RCA A;  4HE2 A;  4JVI A;  4MIJ A;  2UYF A;  2QPQ A;  3LV0 A;  2DE3 A;  3ZS6 A;  1MXY A;  2Z8F A;  1QJM A;  1FQF A;  2FIX A;  1D4N A;  3AXF A;  1MPC A;  2V3Q A;  1FPI A;  3C34 A;  3IAZ A;  3O29 A;  2ZZX A;  3MP1 A;  4O94 A;  4IY6 A;  1NFT A;  4YB6 A;  1AMF A;  1B1X A;  1DSN A;  3MUQ A;  1Y20 A;  2NXO A;  1LAX A;  4I40 A;  4PFI A;  3C9H A;  3PMX A;  5H8H A;  5DVF A;  4OXV A;  5ITO A;  3RPL A;  1RDY A;  3TTM A;  1CNQ A;  4PBQ A;  3UP9 A;  3TTN A;  3ILU B;  1K9Z A;  1FBG A;  4OVS A;  4LQ5 A;  3F11 A;  1WOD A;  3LSL A;  3LBS A;  1LBZ A;  3DP4 A;  4K3F A;  4YKI A;  3RGY A;  5H8Q B;  1PB9 A;  4FAT A;  2KLF A;  3PPO A;  4H0W A;  1Y3Q A;  5I58 A;  5EQ9 A;  4QF9 A;  1FPD A;  3IL1 B;  4JWY A;  4KD5 A;  4XKP A;  4GIZ A;  3JYR A;  2D21 A;  2NVU B;  4NN3 A;  1I6A A;  2GH9 A;  1US5 A;  4YMA A;  3MYU A;  3C35 A;  2XWI A;  2DVZ A;  3BKI B;  1TFD A;  1YAE A;  3ODB A;  5KZT A;  3Q28 A;  2CMO A;  1B2H A;  2DQV A;  4PBH A;  3TEL A;  3KEI A;  3TKD A;  3RTF B;  2I48 A;  1G0I A;  3N26 A;  3MZ9 A;  3V5A A;  2PFY A;  1ZU0 A;  3IX1 A;  2OX3 A;  2MKZ A;  4C1U A;  5KCJ B;  4X48 A;  4MNP A;  4NAP A;  3SEV A;  1LBC A;  1IME A;  1LGB C;  2RF1 A;  4AQ4 A;  3KJ7 A;  3BBR A;  2DE4 A;  4ISU A;  2I58 A;  3LSX A;  1FTM A;  1SYI A;  4MBP A;  5A5L A;  4N8Y A;  5LOM A;  3PGF A;  1ZKB A;  3SEW A;  3Q26 A;  3H6W A;  1MXW A;  1SW5 A;  3SEX A;  1KWH A;  1SW1 A;  3EHT A;  3L6G A;  3VV5 A;  4PC9 A;  1Y9U A;  3T9X B;  2QJE A;  2RC8 A;  1B1H A;  3TQL A;  3K01 A;  2OZZ A;  4P8B A;  4ESW A;  1EZO A;  3TPA A;  3E3K A;  4XEQ A;  2ALU A;  4LN5 A;  1S7Y A;  4ZE8 A;  4YIC A;  4F2Q A;  1FPJ A;  3RY3 A;  2B65 A;  4P56 A;  4HTG A;  2O6A A;  3PUV E;  1O63 A;  5DYH A;  2XWK A;  4PF6 A;  4U2R A;  3TZA A;  1B3G A;  4ONY A;  4OVR A;  5KDT A;  1WDN A;  4LZ5 A;  5TPA B;  3PUY E;  1QUK A;  4H8J A;  3GLB A;  4OES A;  1Q9D A;  4GBW A;  1URD A;  2FYI A;  2XD2 A;  5FHO A;  3C4M A;  1MQD A;  3H6T A;  2PT2 A;  3PU5 A;  4PDH A;  2XWO A;  5L9O A;  3RNN A;  4NTL A;  3PPN A;  3PUZ E;  5H8S A;  4NF8 B;  1SPI A;  2F8D A;  1MQJ A;  1FBH A;  5CBS A;  3BIH A;  2I4C A;  3OO9 A;  1JW5 A;  5FTI A;  3D1R A;  3FJG A;  4WKM A;  3IOW A;  1RYX A;  4WED A;  4OWD A;  2XHD A;  2ONK E;  2BJJ X;  3OOA A;  4NWD A;  4ZEF A;  3MVW A;  5BUU A;  2PYY A;  4U23 A;  3UK4 A;  3EHU A;  3FVG A;  1LB9 A;  4GOT A;  1HSE A;  4EXK A;  1URG A;  1N0T A;  1MY2 A;  3K6W A;  4X1B A;  4DI4 B;  3IB0 A;  1LAF E;  3FXQ A;  3U65 A;  4X04 A;  3FJM A;  2I3V A;  4JSO A;  1FPL A;  4IO2 A;  4XF5 A;  4OA4 A;  1LBV A;  2DVC A;  4QFL A;  2RKM A;  4BLA A;  4C0R A;  3IFC A;  4IR8 A;  3MZ1 A;  1D9Y A;  5CRY A;  4F18 A;  4GX6 A;  1FQE A;  4OEU A;  1SDX A;  3CI8 A;  1HSL A;  1JW4 A;  4N81 A;  3TTL A;  4FOR A;  3T66 A;  4JSD A;  1ZJL A;  4KXP A;  2E0S A;  2ZNU A;  5CM6 A;  5JEI A;  2ABH A;  2RCB A;  5JTY A;  2P1S A;  2FVZ A;  2O1L A;  3H06 B;  4X1D A;  2OK2 A;  4NF4 B;  4PE3 A;  5FTH A;  4NF6 B;  3VVE A;  4N07 A;  1FBP A;  1NMU A;  2CZH A;  1VDW A;  3S9N C;  4N6P A;  3EQ1 A;  2WBB A;  1IUD A;  2OWT A;  3KC0 A;  4YKK A;  3S2V A;  3OXN A;  1MXU A;  2HQ0 A;  4JVD A;  2OWZ A;  1YYZ A;  3K02 A;  4H67 A;  5I59 A;  4H5G A;  1XVX A;  1LAG E;  4PTK A;  1PBP A;  1SBP A;  1N84 A;  4F3G A;  4MX6 A;  3CIJ A;  4RPO A;  2LAO A;  5EHM A;  1RDZ A;  1NUY A;  3G3F A;  1YPN A;  4ZDM A;  1PDA A;  5DTB A;  1M5B A;  4RJZ A;  5I57 B;  1IIW A;  1OQH A;  5H8N A;  4P1L A;  5I56 A;  1M5F A;  3V89 B;  1FQB A;  5HM4 B;  1N3X A;  5ESY A;  2ZYM A;  1T0K A;  2WX9 A;  1DPP A;  1B0L A;  4FBP A;  1NNP A;  2I3W A;  3TTR A;  1USY H;  2WYP A;  1GTK A;  1M5E A;  3IOV A;  1NKX A;  2H5Y A;  4P11 A;  3DM0 A;  3GZG A;  5A5X B;  4QFN A;  2CZK A;  1UIU A;  5TP9 B;  5FBP A;  4X8R A;  1MXX A;  1H43 A;  1DTZ A;  1A54 A;  3T93 B;  3OD7 A;  2WBD A;  4HCW A;  2AL5 A;  4LUB A;  1FTJ A;  2DDK A;  3VVD A;  5AA2 B;  1AL3 A;  3OEK A;  3WAF A;  3ZSF A;  1GV8 A;  4G77 A;  2X26 A;  4QHQ A;  3O97 A;  5HPQ A;  4DZ1 A;  4F1U A;  1NV2 A;  4PF8 A;  5I7I A;  1MM6 A;  2QS3 A;  3QMF A;  4PFR A;  1ZBM A;  1B9J A;  4ZE9 A;  3QIM A;  1US4 A;  1MQG A;  1IQ7 A;  5H8Q A;  3HFU A;  4G8M A;  4WXJ A;  4BDL A;  4PAI A;  2ONS A;  4OVQ A;  4R72 A;  4IO6 A;  1RKM A;  3WAE A;  3TEP A;  1FQD A;  4U1O A;  4MH5 A;  4OFJ A;  2F3D A;  1FPG A;  3V83 A;  1N76 A;  1DTG A;  4IO3 A;  2R6G E;  3EKI A;  2KR0 A;  3MQ9 A;  5TU0 A;  4R9F A;  2PVU A;  3FXB A;  3THI A;  1ZTY A;  4LZ8 A;  1FSA A;  3I6V A;  4MHF A;  3QXM A;  4EF2 A;  5KCJ A;  4ZZE A;  1NUZ A;  3MST A;  4ZEB A;  2PMS A;  1R9L A;  4WEP A;  4U21 A;  1JP4 A;  2ZNS A;  3HN0 A;  1FBC A;  4AS4 A;  2ZYO A;  1B51 A;  3SER A;  2D3I A;  3O28 A;  5DW8 A;  5ET7 A;  3MC2 A;  4OEV A;  4LP2 B;  2Z8D A;  4OER A;  4RNS A;  4TQU Q;  1FRP A;  1IZ1 A;  2HZK A;  4R73 A;  2FBP A;  4NG7 A;  4MAG A;  3KN3 A;  3CRB A;  3MBP A;  4FED A;  3M3K A;  4HS7 A;  2Y7P A;  3B50 A;  3LSF B;  4IO5 A;  3JV9 A;  3QAX A;  2E1S A;  2I0B A;  2GRV A;  2F35 A;  3SEY A;  4H46 A;  1JW1 A;  3B6W A;  4NF5 B;  1EZ9 A;  5B7D A;  1BP5 A;  3CSB A;  4O7M A;  2F6G A;  4FIM A;  3RLF E;  4MMP A;  1AH5 A;  4PFT A;  4RK2 A;  3H7M A;  1BK4 A;  1MH3 A;  2V93 A;  3LUY A;  3R6U A;  3FIR A;  2FHY A;  1B7U A;  3VFJ A;  3FV1 A;  4MF3 A;  4LQ2 A;  3PPR A;  3MJN A;  4MLQ A;  5DEX B;  1H45 A;  5L8D A; 
#chains in the Genus database with same CATH homology
 4QBA A;  4OVR A;  4GWS A;  1EYK A;  2Y5K A;  5JK4 A;  4H45 A;  2BJI A;  1EYI A;  2F3B A;  1NI9 A;  1NUW A;  4N6D A;  1NV6 A;  1Q9D A;  2QFL A;  4GBW A;  5LDZ A;  3E78 A;  5LTC A;  3PTY A;  5EQ7 A;  1FBF A;  1DCU A;  4N17 A;  4OAN A;  3T0J A;  4PDH A;  2XWO A;  2P3N A;  2Q8M A;  2KQZ A;  4YZZ A;  5EQ8 A;  5IZ1 A;  4P1E A;  4NX1 A;  1SPI A;  2PCR A;  5EYH A;  3ROJ A;  3GYY A;  2CZI A;  1FBH A;  3BIH A;  4G61 A;  3D1R A;  4P3L A;  4P47 A;  5ET5 A;  1NV3 A;  3B8B A;  1G0H A;  1KZ8 A;  4GX3 A;  5I5P A;  2XXK A;  1K9Y A;  4PAK A;  4GWZ A;  5IZZ A;  3FBP A;  1XI6 A;  4GX4 A;  4JVC A;  4DI4 B;  4PDD A;  3U65 A;  4X04 A;  1FJ9 A;  1LBY A;  1FPL A;  4O7I A;  4XF5 A;  4OA4 A;  1LBV A;  1LEV A;  3IFA A;  4I3Y A;  4MNC A;  2VPO A;  4PET A;  3IFC A;  4IR8 A;  1D9Q A;  1AWB A;  4F18 A;  4GX6 A;  2F5X A;  4MEV A;  5ET8 A;  1FTA A;  4N6K A;  2B4M A;  4N81 A;  4DI3 D;  3KBZ A;  4P9K A;  4GBV A;  3LUZ A;  4KXP A;  3NOH A;  5CM6 A;  2HXR A;  2GQ1 A;  2PFZ A;  4I3E A;  1IMC A;  2FVZ A;  1FBE A;  4OVP A;  1NV4 A;  4N8G A;  4PE3 A;  3RPL B;  2Q9T A;  1FBP A;  1FPE A;  2CEX A;  2ZZW A;  2CZH A;  2HPG A;  1VDW A;  4OVT A;  1FJ6 A;  2WBB A;  4PGN A;  3KC0 A;  4N91 A;  4NHB A;  4JVD A;  2ZZV A;  2OWZ A;  1KA0 A;  1YYZ A;  1LBX A;  2P3V A;  4PTK A;  2QVU A;  5EQA A;  4MX6 A;  4QXD A;  1RDZ A;  1NUY A;  4HCY A;  3W9W A;  2HZL A;  4PGP A;  5IGA A;  5J16 A;  1IMA A;  4P1L A;  3RYD A;  2JJK A;  5ESY A;  2WX9 A;  4MNI A;  4FBP A;  4N4U A;  1IMB A;  5IM2 A;  4PFB A;  1RDX A;  4GWY A;  2WYP A;  4GWX A;  1IMF A;  4HE1 A;  4MCO A;  2CZK A;  5FBP A;  4X8R A;  3KC1 A;  4HE2 A;  4JVI A;  4MIJ A;  2QPQ A;  3LV0 A;  2DE3 A;  3A29 A;  3BIG A;  3SZP A;  2FIX A;  2WBD A;  4HCW A;  4O8M A;  2WYK A;  2V3Q A;  1FPI A;  2DDK A;  5EYG A;  2ZZX A;  5IZ3 A;  4O94 A;  5IZ3 B;  2QVV A;  1DBZ A;  4I40 A;  4PFI A;  4PCD A;  1YZ0 A;  2CEY A;  4F1U A;  3W9V A;  1NV2 A;  3RPL A;  1RDY A;  4PF8 A;  4F1V A;  1CNQ A;  5I7I A;  4PBQ A;  1K9Z A;  3QMF A;  1FBG A;  4PFR A;  4OVS A;  2R8T A;  1FPF A;  1LBZ A;  3T1B A;  1NV0 A;  2Q74 A;  2VPN A;  3HFU A;  1IMD A;  5EQ9 A;  4PAI A;  1NV7 A;  4OVQ A;  1FPD A;  2XWV A;  4NQ8 A;  2WEF A;  2L5V A;  4NN3 A;  2QVR A;  1NV1 A;  4HE0 A;  4GWU A;  5F24 A;  3MYU A;  2XWI A;  2DVZ A;  2F3D A;  1INP A;  1FPG A;  3EKI A;  4PBH A;  4X9T A;  2KR0 A;  2DE2 A;  1NV5 A;  3ISP A;  1G0I A;  3FXB A;  4GWW A;  2PFY A;  1FSA A;  2OX3 A;  4MHF A;  2MKZ A;  4XFE A;  2VT5 A;  1EYJ A;  1NUZ A;  5ET6 A;  4MNP A;  3MST A;  1FPB A;  4NAP A;  1LBW A;  1IME A;  4AS5 A;  1JP4 A;  1FBC A;  4AS4 A;  2DE4 A;  5DW8 A;  4NGU A;  1QGX A;  5ET7 A;  1FRP A;  1FPK A;  5A5L A;  2HZK A;  4N8Y A;  2FIE A;  2FBP A;  4NG7 A;  4MAG A;  2Y5L A;  2XA5 A;  2V4C A;  4M1V A;  4N15 A;  3B50 A;  4F19 A;  1KA1 A;  1DK4 A;  4PC9 A;  4UAB A;  4H46 A;  4PAF A;  1NUX A;  4P8B A;  1YXI A;  4O7M A;  4HXV A;  4XEQ A;  4NF0 A;  4LN5 A;  4MMP A;  4YIC A;  1FPJ A;  2HHM A;  3CHG A;  5I3S A;  4P56 A;  1BK4 A;  2FHY A;  2B4L A;  5T3J A;  2XWK A;  4PF6 A;  4MJO A;  5J1D A;  3E79 A;  1FBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...