3IFAA

Human muscle fructose-1,6-bisphosphatase e69q mutant in complex with amp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
326
Chain Sequence
TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVDQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 326
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3ifaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3ifaA02
1XI6A 1K9ZA 5ET7A 4GX6A 4GBVA 5IZ1A 1FBDA 1EYJA 2FVZA 1FPIA 5ESYA 1G0HA 2FBPA 4MJOA 3KBZA 5DW8A 3RYDA 2QVVA 1LBYA 1FBPA 1FPEA 2BJIA 1FPGA 1CNQA 3T0JA 1FPDA 3BIHA 5EQAA 4IR8A 4GWUA 4QXDA 4GX3A 2HHMA 5FBPA 1FBFA 5A5LA 3LUZA 2PCRA 2CZKA 4FBPA 1VDWA 2Y5KA 1FBCA 1YZ0A 1K9YA 4N81A 1FPBA 1LBWA 1FPJA 5ET6A 1NUYA 4O7IA 5F24A 5IZ3A 1FTAA 2F3DA 1IMBA 1IMDA 1DBZA 3LV0A 1FBGA 4GWXA 2Q8MA 3ROJA 2FIXA 1LBVA 1NV0A 5LDZA 1FPLA 1NV1A 1AWBA 1EYKA 4I3YA 4AS5A 5T3JA 1G0IA 5EQ7A 3QMFA 1Q9DA 1FSAA 1BK4A 2WBDA 4GWYA 2OX3A 1LBXA 1YXIA 2Q74A 1LBZA 1DK4A 5EQ9A 1DCUA 1NUZA 1IMFA 2QVRA 1QGXA 5ET8A 1FPFA 1KA1A 1NI9A 2CZHA 2GQ1A 3FBPA 1LEVA 5EYHA 2QFLA 4GX4A 1NV6A 3RPLB 1KZ8A 1RDYA 5EQ8A 1NV2A 1EYIA 1NV4A 1SPIA 4I40A 5J16A 4GBWA 2FHYA 4HE2A 1IMEA 4HE0A 2DDKA 3B8BA 3IFCA 1NV3A 4GWZA 3A29A 2VT5A 5ET5A 1FRPA 2P3NA 4GWWA 2R8TA 3KC1A 2P3VA 4GWSA 2JJKA 1D9QA 2Y5LA 1FJ6A 4HXVA 2WBBA 1IMAA 2OWZA 4H45A 1FJ9A 1FPKA 2QVUA 4PTKA 1INPA 3BIGA 1IMCA 4H46A 1FBHA 3KC0A 1FBEA 2FIEA 2F3BA 4KXPA 4G61A 3IFAA 1NUXA 1NV7A 1RDZA 2CZIA 1YYZA 5EYGA 3RPLA 4AS4A 1NUWA 1JP4A 1NV5A 4I3EA 3D1RA 5IZ3B 5I3SA 1RDXA 2WEFA 4HE1A 1KA0A
chains in the Genus database with same CATH superfamily
1B7UA 2Y84A 4EQ9A 2VPNA 1FPIA 3MJNA 4OFLA 1ANFA 2H9BA 5DEXB 2OWTA 3LR1A 4QXDA 4JSOA 3QIMA 5HPQA 2OLBA 1ZMGA 3S9LC 3PUZE 1ZLQA 1B3FA 4RA1A 4GIZA 3EHSA 3WAEA 1NV0A 5A5XA 3HV1A 2VHAA 1DOTA 4POXA 2F35A 2XXXA 3K6XA 2Y7KA 3K1MA 3CG3A 3QYTA 2ZMBA 2QL3A 1A7LA 3PD9A 4OZ9A 1FCKA 1SYHA 2PBWA 5AA1A 1RDYA 4PE5B 4PGPA 2HZKA 2XXIA 1DPPA 4IGRA 4KFQA 1IMEA 4HE0A 3E78A 3VXCA 1XOCA 1B58A 4NG7A 2KR0A 2ESNA 2ALUA 3O6HA 5DEXA 3THIA 5JEIA 3KN8A 4H5GA 1IMAA 4RK2A 2YPNA 1MY3A 1USYE 4PFBA 1WDNA 3DP8A 2Q2CA 3LUYA 4Z7EA 1PB9A 4N17A 3IFAA 2O7UA 1NUXA 1AH5A 1RDZA 2UYFA 4IY6A 4PFTA 4AS4A 1TFDA 1SQYA 4YMBA 4NX1A 3RT8A 1LB9A 4DI4B 4YKKA 3M8UA 5CM6A 2VOZA 2QRYA 4X1DA 1D9VA 4RPNA 3MP1A 2ABHA 2RCBA 1ATGA 3IO4A 1IIWA 3KBZA 5AA2B 1BTJA 3DP4A 3IR1A 1HSLA 4F3GA 3ISPA 2ZZWA 4NGUA 4QSDA 5EQAA 2HEUA 1OQHA 3OENA 2D5WA 1Y3QA 1FBCA 1GTKA 2REGA 1FQAA 4DI3D 3I5OA 2F7BA 4LQ5A 3RGYA 3OD7A 3TKDA 4JXIA 1LCTA 3C31A 4KCDA 3W15C 5IGAA 4YKJA 5T3JA 1DSNA 1A99A 2DYXA 1B52A 2UYEA 2WBDA 1VR5A 3MZ9A 2LAOA 1IMFA 4U23A 3RQTA 5IAIA 4XF5A 1QULA 1LB8A 3H06B 1O64A 5DVFA 3MZ1A 1N3XA 3LBSA 1MM7A 1KWHA 2VT5A 3PMWA 4M1VA 3MPLA 1GVCA 5TPAB 2PX1A 4OQOA 1FJ9A 1FQBA 3IOUA 1S7YA 4DZ1A 2AYSA 5CC2A 2FNCA 3QXMA 5I2NB 2Z22A 1P1OA 3C35A 5DTBA 4QSCA 1OQGA 5HM4B 3CIJA 3W9WA 4OVQA 3IOVA 4EUOA 3U72A 1USYH 4YB7A 2Y7WA 4X8RA 2H98A 1RYXA 3RN8A 5H8QA 4DIGA 1YCJA 4QFOA 3H6UA 3LUZA 2PCRA 2CZKA 2RF1A 2Z8DA 4KI0E 2ZYNA 4N8YA 4ELOA 5KDTB 1QVSA 2QJEA 4TLMB 1CE2A 5I5PA 2OPDA 3FVOA 2OCUA 3ROJA 4UABA 1UIVA 4UACA 4H8JA 5ITOA 5EQ7A 1FQDA 3KSJA 2Z8EA 1FSAA 5I2NA 1Q35A 5I58A 1VFDA 2XX8A 1DCUA 1B40A 2O1LA 1SBPA 5ICTA 3RTWB 4MX6A 3O28A 3B8BA 3EHTA 3A29A 4U4SA 4GD5A 1MXVA 1NH7A 1YAEA 3EKIA 4KYSA 3O6IA 1B5IA 1TT1A 3TYHA 3M3FA 3B7DA 3KJTA 5CRYA 2F36A 1Y3PA 3G3GA 3C36A 5DT6A 1H76A 2WYKA 2XXRA 3QUJA 1I6BA 5KDTA 5H8SA 4I3EA 5F7VA 1P1QA 5ISUA 3PTYA 4FE8A 2G29A 3LSXA 1G0HA 3K6UA 3MC2A 4DE8A 3V83A 2O6AA 1JETA 3RYDA 3E9XA 3MAMA 4KPTA 3BFTA 1AL3A 4ELRA 4GWUA 3FXUA 5KCJB 1MRPA 4N6PA 1SW5A 4EQBA 2HQ0A 3K6WA 2DSFA 3V8XB 3G3JA 1AMFA 3FJ7A 1MQJA 2HXRA 4G8MA 2FIXA 3FXQA 4R6YA 1PBQA 4NWCA 1B2HA 1B3LA 4AB6A 4F1UA 4N8GA 2PT1A 1NFTA 3M3KA 2XD3A 3ZSFA 1MXXA 3AXFA 4NF8A 2DE3A 3T66A 3VLUA 5L9MA 4GLIA 1MXUA 1FW0A 3K1PA 3TDJA 4OA4A 1FQFA 3C34A 4H67A 4JVIA 4EF1A 2QVUA 5KCJA 3IK6B 1US5A 2V4CA 4OESA 4N13A 3KC0A 2H25A 4P1LA 4R2BA 4G61A 5H8NA 3T1BA 2XXUA 4FEDA 2YJPA 5CMMA 4R72A 3CSGA 3KJ7A 3ECRA 3ONMA 3PU5A 4AQ4A 1NMUA 1R6ZA 3QAXA 3OEKA 4ZEIA 2I6EA 5ET7A 1QW0A 4PDHA 2VP1A 4BDMA 3FJMA 1LAHE 2XWOA 4JWYA 1FBPA 3TODA 4PP0A 2B3FA 4RYAA 4XXUA 4DCYA 4PFYA 3QUFA 1MQGA 1EH3A 4GQOA 3O29A 4MMPA 4P0GA 2F7AA 5L9SA 2B4MA 2DWAA 2O51A 1WVJA 3IL1B 4LONB 2B4LA 2IA4A 3MYUA 1SI0A 3KN7A 3EF7A 1B1XA 4QFKA 5EHMA 2PT2A 3L6HA 4QRZA 4R9FA 4OMBA 2XWVA 4DCXA 1OVTA 3HHFA 2FHYA 3PGFA 3IORA 2QMXA 1ZKBA 3IFCA 4JWXA 4Q30B 4ZE8A 5AA3A 2XXTA 4Q8RA 2ZZXA 3SEVA 3KC1A 3L6GA 1I6QA 3KFMA 4UA8A 2VGQA 2WBBA 2XXKA 4H45A 1NH8A 2CZLA 3T9UA 4H5FA 3CG1A 4KXPA 3Q26A 4RXLA 3H03A 1QKBA 1A40A 1ZBMA 5FTHA 3FJGA 5I3SA 2VD2A 1PDAA 3V5AA 3HN0A 1Y1ZA 4WXJA 4MLVA 1JVXA 4ESXA 3HPIA 3KN3A 1FPEA 1FPGA 4OFOA 4QSEA 1M5DA 3OSRA 1N7WA 3UIFA 4FBPA 2O1MA 1YZ0A 4PAFA 1DTGA 1SW4A 5BUUA 3KGCA 4HTGA 4OHNA 4WEPA 4R9GA 3P7IA 3LV0A 4ZDMA 3R6UA 2XD2A 3CSBA 5K2XA 3SDFA 1A55A 1G0IA 1MY4A 1P1WA 3MBPA 1MQIA 3TCGA 2FA7A 4NHBA 1BK4A 3K00A 4O7MA 3TUSA 2DVCA 3CR9A 4QFLA 4E0WA 3FZVA 3S2VA 4EF2A 2FYIA 1Z7ME 3PPOA 3V89B 4I8CA 1EYIA 1NV4A 1MS7A 2HAVA 1NV3A 1O63A 1VSOA 4WKMA 3TTMA 4NWDA 3O66A 2R8TA 4NN3A 2JJKA 2O69A 4KQPA 3VE1B 1LFHA 1FPKA 1D9YA 3OO9A 4ELPA 3U65A 3I3VA 4Z0IA 5HBCA 4ZEBA 2YLNA 1MXYA 3MVYA 1B6HA 2XWKA 1NUWA 3UP9A 1JW5A 4DXUA 4HE1A 2DWHA 5FHOA 3TCFA 3ZKKA 2PFYA 4GX6A 2ZZVA 3JZJA 2GFEA 4OENA 4BDQA 2XXYA 5LTCA 2I0CA 4OVRA 4X48A 3FVNA 2E1SA 4BDOA 1OMPA 2Q89A 3JYRA 4GX3A 5L9OA 1LFIA 4PE3A 3EPEA 1UTBA 2AL4A 4GF8A 2QS4A 1N04A 5IZ3A 4MHFA 4IY5A 1RYOA 4FAJA 3OXNA 3MQ9A 3FXRA 4KYEA 1FQEA 1YPNA 1YTVA 4LQ2A 4G77A 2NOOA 4AS5A 1B5JA 2HPGA 4MNIA 4OEVA 1ZU0A 1SVXB 5J1DA 3CFLA 2A5TB 2XX7A 1QGXA 2CEXA 2H4IA 3MWBA 1QUIA 2DQVA 2THIA 3TAJA 2DWIA 4JDFA 4X1BA 2AIXA 4F19A 3OSQA 5EYFA 3PPQA 4PAKA 5M2VA 2V25A 1GV8A 1Y4TA 4LATA 4OWDA 1S50A 5FHNA 5H8QB 4P11A 4ZE9A 4H1XA 3Q25A 4YU0A 1B0HA 2F3BA 3SESA 4MIJA 3T9VA 2XWIA 4OVSA 1LGBC 1A8FA 2UVGA 1JQFA 3MZBA 5CBSA 2UVIA 4P0IA 1Y1MA 3H7MA 2M8CA 3G3FA 5I2KA 1B05A 1K9ZA 3ZKLA 3A3UA 3IOTA 3CI8A 5L8DA 1FTLA 4RPOA 4YICA 4N91A 2H5YA 1FTKA 5DW8A 4H65A 1VE4A 2A5TA 5JK4A 1PBPA 5I58B 3VV5A 1PEBA 1H45A 3E3KA 3EQ1A 3U8QA 3H4ZA 2I3WA 1SDXA 4FEBA 2ZYOA 2Q9TA 4JBZA 1MXZA 4GVOA 3RY3A 4O7IA 1M5BA 2XHDA 1DPEA 1URGA 1IMDA 2Q8MA 3G3HA 4X9TA 2F34A 1B3GA 3KG2A 1QJMA 2I48A 1NNKA 3GYYA 3W9VA 4R74A 3TFLA 3VFJA 5H8FA 1NI9A 2CZHA 4NF0A 3UK4A 2XXQA 1IXCA 5I84A 4NEDA 3KBRA 5JTYB 1CB6A 1IXGA 3BFUA 2ONRA 2PYYA 2ZNUA 1IQ7A 4PAIA 3FGSA 3FIRA 4Q0CA 5I56B 2Y5LA 2HCAA 2MKZA 4LA9A 5F1QA 1LAGE 1NKXA 4GXSB 4NF4B 3ILUB 5CI5A 1A54A 3BBRA 4TOZA 3SEUA 1QUJA 2CZIA 1J1NA 3RPLA 3MUQA 4H6DA 5B7DA 5IM2A 4GL8A 1XI6A 4YMAA 1JW1A 2I49A 4O8MA 2OWSA 2DXYA 4K3FA 5FHMA 2W7YA 3A3CA 3HSTA 3QK6A 3CFZA 1IUDA 2ONKE 3O2AA 2I4BA 3RLFE 5A5LA 3TMGA 1B0LA 4MH5A 4ZZAA 4NF8B 5JTYA 1ZTYA 2P0SA 4IO7A 3VVDA 1R9QA 3FD3A 3K1NA 4O3CA 4O94A 3DELB 1FTAA 3K2DA 3TTNA 2UVJA 2QS1A 3H6WA 4KR5A 4M4GA 5I56A 2CEYA 3G7WA 1IXHA 2H99A 3T96B 1B3EA 4NF4A 4AB5A 1B7ZA 3QMFA 1Q9DA 3ZS6A 2XX9A 4P1EA 3K0VA 1LBXA 4XKNA 2I58A 4DDDA 1MH3A 3I6VA 5H8NB 5EYHA 4PC9A 1BKAA 4R73A 1LBBA 4EXKA 4I62A 4PQJA 4F1YA 3UA8A 2BJJX 5I57A 4MFIA 1T0KA 1TXFA 4LUBA 3FV1A 2RC7A 2R9JA 4ZEFA 2RCAA 1URDA 2P1SA 3TTRA 1D3KA 3PPNA 2OWZA 4XTCQ 3SEXA 1D4NA 3FV2A 4O3AA 1YYZA 4JSDA 4L17A 1LLSA 2O68A 1FQCA 3LC8A 4LP2B 2V3QA 3TQWA 1RDXA 3SEYA 3HCQA 3H6TA 1MPDA 4GWOA 4DXCA 1Q1KA 2GRVA 5ESYA 3KEIA 4F3BA 2OPEA 1UTHA 2AL5A 4ZECA 3T0JA 2DWJA 4XKQA 3G3KA 3TELA 1P1NA 2UXAA 4GXAA 4C1UA 2WX9A 1P99A 1N84A 3GBAA 3MP8A 3TEPA 1B4ZA 5F24A 4OERA 2F3DA 1H3DA 2HFBA 1DBZA 2KQZA 1FBGA 1US4A 5ELVA 3TCHA 1R1NA 2QS2A 1FPLA 4PFUA 4I3YA 3USDA 1B4HA 4LN5A 4RNSA 1LBZA 4HCWA 4OXVA 5AA2D 4ZEDA 3MW0A 4DXBA 2QFLA 2D3IA 3UORA 3CRBA 1AIVA 4I40A 5J16A 1ELJA 2DXRA 1N3WA 4NF5B 3PUYE 1S9TA 2B3BA 2GHBA 1Y3NA 1P1UA 4N15A 1UIUA 2L5VA 4HXVA 1FTMA 1IMCA 2FIEA 1B3HA 3OMBA 4N4UA 3C33A 2UVHA 1B7HA 2ZYKA 4G68B 4P8BA 3T93B 1WODA 3BKIB 4U4XA 3GBBA 3E4RA 1SW2A 4MAGA 1MY0A 3H3GA 5IZ1A 1FBDA 1JW4A 3IB1A 3Q27A 4EDPA 1LBYA 2PFZA 4XKPA 2BJIA 3N94A 1CNQA 4F39A 1FPDA 3BIHA 1N0TA 4LZ7A 4NF6B 3GLBA 4THIA 2DP8A 1FBFA 4ND9A 4ONYA 3B6QA 3UN6A 1K9YA 4NF5A 1FPBA 3IJOB 3TTKA 4PCDA 2D21A 3S9NC 4G4PA 1AOVA 2WYPA 1OLAA 4IO4A 4O3BA 1LFGA 2ZYMA 4MNPA 2NUVA 4ECFA 4TQUQ 1NNPA 4H0WA 3VLVA 3F11A 1RKMA 3OEMA 4G68A 4GX4A 3SEWA 1OLCA 2F6GA 5KZTA 3DLNA 2DDKA 3PD8A 4PDDA 2HAUA 4BDLA 1ZJLA 5ET5A 4PFIA 4GWWA 2ONSA 2P3VA 2XXPA 1FJ6A 2QPQA 4IO2A 4NF6A 4X04A 3OELA 2Z8FA 5H8HB 3MSTA 3TZAA 3BIGA 1B9JA 3LSWA 2Y7IA 2XXHA 1EZ9A 4GOTA 1I69A 1UTBB 4GL0A 1MH4A 4F3SA 1MM6A 4JB7A 5EYGA 3K4UA 1F9BA 1B46A 3IB0A 5IZ3B 3C4MA 3UGWA 3N5LA 4OFJA 3EHUA 3C32A 3B6TA 4PF6A 5CBRA 4GBVA 4MNCA 4YB6A 1JEVA 4MJOA 1NNFA 3NOHA 4R75A 1EZOA 1NNTA 4IB2A 4PFRA 3MVXA 3GZGA 4P3LA 4NMYA 1XS5A 3C9HA 5K2YA 2Y5KA 4IGTA 3T9XB 2X7QA 1XT8A 1NUYA 4HCYA 3ODBA 4U21A 3PUXE 2XXVA 4GWXA 4QFPA 3U94A 1LBVA 5BWJA 1AWBA 1EYKA 4OVJA 5H8HA 4F31B 2OBGA 1VFEA 1LCFA 1ZIUA 4XEQA 1SW1A 4ZZEA 1NL5A 4OVTA 2V93A 1XVYA 3OO6A 1DK4A 3RPWA 4DLDA 1NUZA 4WEDA 1EZPA 5IZZA 4R6HA 3N26A 3FBPA 4G8HA 4NAPA 1FTJA 4OEUA 2X7PA 3MVWA 3JV9A 2V3UA 4R6KA 4GWZA 5I2KB 3IX1A 5B70A 1BLFA 4HS7A 4N6DA 4GWSA 4ESWA 3FATA 2I0BA 3MP6A 4PETA 1MG1A 3ILTB 2V3TA 5FTIA 1Y20A 1NV7A 3B50A 1MQDA 4F22A 4ZEKA 4U22A 2RINA 3IAZA 3KZGA 4NTLA 3SZPA 3S9MC 4MCOA 2PVUA 4F3PA 3QSLA 4QF9A 4G8NA 1B51A 4FIMA 4MF3A 3VLWA 4IO3A 2Z23A 2Q8JA 5H8FB 4XFEA 2I4CA 5FBPA 2VD3A 2Q2AA 1SI1A 4F2OA 3O9PA 1SD3A 2DE2A 4ISUA 3D4GA 3GXAA 1MPBA 3TTLA 2V84A 2RC8A 3RT6B 2WKYA 5AA2A 2XXWA 4G68C 5AA4B 2OJTA 2OZZA 1MY2A 1OIBA 4GWYA 1O7TA 4RY1A 4OYVA 4YZZA 3K01A 1HSJA 1BIYA 4C1TA 3M3LA 3SETA 2GQ1A 3PMVA 4BDRA 3RPLB 1PB8A 1URSA 4KD5A 4IO5A 1SPIA 1OVBA 4I9DA 4MLQA 3R26A 1POY1 2P3NA 1A8EA 3MVZA 2PMSA 3Q28A 2HZLA 2GH9A 4H46A 5ITPA 2DE4A 4XKRA 2G93A 4YKIA 4ZS9A 3VVEA 3LSLA 4G2ZA 1JP4A 5DVJA 4N6KA 3D1RA 3FASA 1GR2A 3H6VA 2DOJA 1IZ1A 5TPAA 2FVZA 1QKAA 5EHSA 5AA4A 3KOSA 3WAFA 1BP5A 4PBHA 4E0XA 1LSTA 4YB5A 1DMBA 2F6PA 2Q88A 3G3IA 3PUWE 2HHMA 1VDWA 4N81A 4N07A 5ET6A 5I57B 2O84X 1II5A 3Q29A 1SYIA 1JNFA 4NE4A 4EQ7A 5I7IA 3FVKA 1JVYA 1JEUA 1POTA 4RK9A 2REJA 4KCCA 1H44A 3CFXA 4ELQA 4YKPA 3FUZA 1YXIA 4F18A 3S9EA 4RJZA 5CMKA 3N6UA 5EQ9A 3KOTA 1PB7A 3E79A 2ZXTA 2R71A 1NV2A 4KYDA 4JVDA 4GBWA 3HHGA 4JWOA 1EU8A 3A09A 3IOWA 4LVQA 1FRPA 2B65A 4FJPA 1D9QA 2X26A 1UTHB 4F2QA 4C0RA 3VXBA 1FBHA 1LBCA 2QS3A 1FBEA 4EXLA 4NQ8A 4GRKA 1M5EA 3CHGA 3IB2A 1KA0A 1HSEA 4KHZE 3PMXA 2Y7RA 1EYJA 4HW8A 2FBPA 4GFRA 4OANA 2QVVA 3TQLA 4XIGQ 1Z7NE 3IO6A 5I59B 2QSXA 1H43A 1MY1A 1L5TA 2F5XA 2F7CA 4FORA 4FATA 1Y9UA 4I1DA 3B6WA 4QBAA 3MPKA 1TWYA 5LDZA 2DS9A 5TP9B 2GHAA 2DVZA 5DYHA 2HXWA 1UQWA 1PC3A 2OX3A 2Q74A 3PV0E 2QVRA 4OTEA 3PPRA 3SKPA 2QMWA 1LEVA 4U2RA 1KZ8A 1MPCA 4FECA 2OK2A 3LSFB 4PBQA 4YAHX 2ZNSA 3OO8A 1QUKA 1LAFE 1M5CA 1IITA 2O7IA 4BLAA 5I59A 3N6TA 3R7XA 3O6GA 1R9LA 4OVPA 5ICQA 3S4UA 4TLLB 1INPA 3VVFA 1MDP1 3K02A 3VDFA 1NV5A 4LZ8A 4Q5TA 2WEFA 1DTZA 1IEJA 3HO7A 1XC1A 2NWJA 4P56A 1I6AA 5TP9A 3HFUA 2A5SA 4POWA 4PFWA 5IKBA 3TPAA 2RC9A 2ZNTA 4JVCA 1IXIA 1M5FA 4P9KA 4IO6A 4BDNA 2ANJA 2R6GE 5CMBA 2NVUB 3E13X 1MQHA 3D4CA 4IR8A 2KLFA 4R2FA 3CVGA 2VPOA 3EN3A 3T9HB 4P47A 3U1OA 1XVXA 3IJXB 1LBWA 1FPJA 3O97A 4U1ZA 3FXBA 3SERA 1IMBA 3U93A 2F97A 2E0SA 1NV1A 4LZ5A 3KSXA 5AE4A 2F78A 4OETA 5DVIA 4H8IA 2P2AA 5LOMA 1N7XA 3RNNA 4QFNA 3OO7A 1N76A 3RUMA 2Y7PA 5ET8A 1FPFA 1B5HA 1KA1A 3PPPA 2RKMA 3DP6A 1NV6A 5EQ8A 4PGNA 1FTOA 4HE2A 3DM0A 1XHYA 1Y4CA 3OOAA 4F29A 2IEEA 3T22A 1MDQA 5CMCA 1B32A 3RTFB 5A5XB 4PF8A 1MXWA 3FVGA 5TU0A 4MBPA 3K6VA 4PTKA 3U92A 1GGGA 3PUVE 2XA5A 4QHQA 4MEVA 1B1HA 1TFAA 4F1VA 4U1OA 2NXOA 2F8DA 1LAXA 2I3VA 2CMOA
chains in the Genus database with same CATH topology
1XI6A 5ET7A 4PDHA 2VPNA 4O8MA 1FPIA 2XWOA 1FBPA 4QXDA 4XFEA 5FBPA 5A5LA 4O94A 2DE2A 4MMPA 1FTAA 2B4MA 2CEYA 1NV0A 2B4LA 3MYUA 3QMFA 1Q9DA 4P1EA 4GWYA 1LBXA 4YZZA 2GQ1A 2XWVA 4PC9A 5EYHA 3RPLB 1RDYA 4PGPA 2HZKA 1SPIA 2FHYA 1IMEA 4HE0A 3E78A 3IFCA 4NG7A 2ZZXA 2P3NA 2KR0A 3KC1A 2WBBA 1IMAA 2XXKA 2OWZA 4H45A 2HZLA 4PFBA 4H46A 4KXPA 2DE4A 4N17A 3IFAA 1NUXA 1RDZA 1YYZA 4AS4A 1JP4A 4N6KA 3D1RA 2V3QA 5I3SA 1RDXA 4NX1A 4DI4B 5CM6A 2FVZA 5ESYA 3KBZA 1FPEA 3ISPA 2ZZWA 1FPGA 4PBHA 4NGUA 3T0JA 5EQAA 2HHMA 4FBPA 1VDWA 1FBCA 1YZ0A 4PAFA 4N81A 2WX9A 5ET6A 4DI3D 5F24A 2F3DA 1DBZA 2KQZA 3LV0A 1FBGA 5I7IA 1FPLA 4I3YA 5IGAA 5T3JA 1G0IA 4NHBA 4LN5A 1BK4A 2WBDA 4O7MA 1YXIA 4F18A 1LBZA 5EQ9A 1IMFA 4HCWA 3E79A 4XF5A 2QFLA 1NV2A 1EYIA 1NV4A 4I40A 5J16A 4JVDA 4GBWA 1NV3A 2VT5A 4M1VA 1FRPA 2R8TA 4NN3A 2JJKA 1D9QA 4N15A 2L5VA 4HXVA 1FJ9A 1FPKA 3U65A 1IMCA 1FBHA 1FBEA 2FIEA 4N4UA 2XWKA 1NUWA 4P8BA 4NQ8A 3W9WA 4HE1A 4OVQA 3CHGA 4MAGA 1KA0A 2PFYA 4GX6A 5IZ1A 2ZZVA 1FBDA 1EYJA 4X8RA 2FBPA 5LTCA 4OANA 2QVVA 1LBYA 4OVRA 2PFZA 2BJIA 1CNQA 1FPDA 3BIHA 4GX3A 1FBFA 4PE3A 3LUZA 2PCRA 2CZKA 2F5XA 1K9YA 4N8YA 1FPBA 4PCDA 5IZ3A 4MHFA 5I5PA 2WYPA 4QBAA 3ROJA 5LDZA 4UABA 2DVZA 4MNPA 4AS5A 5EQ7A 2HPGA 4MNIA 1FSAA 2OX3A 2Q74A 5J1DA 1DCUA 2QVRA 1QGXA 2CEXA 1LEVA 4GX4A 1KZ8A 4MX6A 4F19A 2DDKA 3B8BA 4PBQA 3A29A 4PDDA 4PAKA 3EKIA 5ET5A 4PFIA 4GWWA 2P3VA 1FJ6A 4OVPA 2QPQA 4X04A 3MSTA 1INPA 3BIGA 2F3BA 4MIJA 2WYKA 2XWIA 4OVSA 5EYGA 1NV5A 4I3EA 5IZ3B 2WEFA 4P56A 3HFUA 3PTYA 4PF6A 1K9ZA 4GBVA 4MNCA 4YICA 4N91A 1G0HA 4JVCA 4MJOA 3NOHA 5DW8A 4P9KA 3RYDA 5JK4A 4IR8A 4GWUA 4PFRA 2VPOA 4P3LA 4P47A 2Y5KA 1LBWA 1FPJA 1NUYA 2Q9TA 4HCYA 4O7IA 3FXBA 1IMBA 1IMDA 2HXRA 2Q8MA 4GWXA 2FIXA 1LBVA 1NV1A 4X9TA 1AWBA 1EYKA 3GYYA 3W9VA 4F1UA 4N8GA 4XEQA 4OVTA 1DK4A 1NUZA 5IZZA 5ET8A 1FPFA 1KA1A 1NI9A 2CZHA 3FBPA 4NF0A 1NV6A 4NAPA 5EQ8A 2DE3A 4PGNA 4HE2A 4GWZA 4PAIA 4N6DA 4GWSA 2Y5LA 4OA4A 4PF8A 2MKZA 4JVIA 4PETA 2QVUA 4PTKA 2V4CA 3KC0A 4P1LA 2XA5A 4G61A 4MEVA 1NV7A 3B50A 3T1BA 2CZIA 3RPLA 4F1VA 5IM2A 3SZPA 4MCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XI6 A;  1K9Z A;  5ET7 A;  4GX6 A;  4GBV A;  5IZ1 A;  1FBD A;  1EYJ A;  2FVZ A;  1FPI A;  5ESY A;  1G0H A;  2FBP A;  4MJO A;  3KBZ A;  5DW8 A;  3RYD A;  2QVV A;  1LBY A;  1FBP A;  1FPE A;  2BJI A;  1FPG A;  1CNQ A;  3T0J A;  1FPD A;  3BIH A;  5EQA A;  4IR8 A;  4GWU A;  4QXD A;  4GX3 A;  2HHM A;  5FBP A;  1FBF A;  5A5L A;  3LUZ A;  2PCR A;  2CZK A;  4FBP A;  1VDW A;  2Y5K A;  1FBC A;  1YZ0 A;  1K9Y A;  4N81 A;  1FPB A;  1LBW A;  1FPJ A;  5ET6 A;  1NUY A;  4O7I A;  5F24 A;  5IZ3 A;  1FTA A;  2F3D A;  1IMB A;  1IMD A;  1DBZ A;  3LV0 A;  1FBG A;  4GWX A;  2Q8M A;  3ROJ A;  2FIX A;  1LBV A;  1NV0 A;  5LDZ A;  1FPL A;  1NV1 A;  1AWB A;  1EYK A;  4I3Y A;  4AS5 A;  5T3J A;  1G0I A;  5EQ7 A;  3QMF A;  1Q9D A;  1FSA A;  1BK4 A;  2WBD A;  4GWY A;  2OX3 A;  1LBX A;  1YXI A;  2Q74 A;  1LBZ A;  1DK4 A;  5EQ9 A;  1DCU A;  1NUZ A;  1IMF A;  2QVR A;  1QGX A;  5ET8 A;  1FPF A;  1KA1 A;  1NI9 A;  2CZH A;  2GQ1 A;  3FBP A;  1LEV A;  5EYH A;  2QFL A;  4GX4 A;  1NV6 A;  3RPL B;  1KZ8 A;  1RDY A;  5EQ8 A;  1NV2 A;  1EYI A;  1NV4 A;  1SPI A;  4I40 A;  5J16 A;  4GBW A;  2FHY A;  4HE2 A;  1IME A;  4HE0 A;  2DDK A;  3B8B A;  3IFC A;  1NV3 A;  4GWZ A;  3A29 A;  2VT5 A;  5ET5 A;  1FRP A;  2P3N A;  4GWW A;  2R8T A;  3KC1 A;  2P3V A;  4GWS A;  2JJK A;  1D9Q A;  2Y5L A;  1FJ6 A;  4HXV A;  2WBB A;  1IMA A;  2OWZ A;  4H45 A;  1FJ9 A;  1FPK A;  2QVU A;  4PTK A;  1INP A;  3BIG A;  1IMC A;  4H46 A;  1FBH A;  3KC0 A;  1FBE A;  2FIE A;  2F3B A;  4KXP A;  4G61 A;  3IFA A;  1NUX A;  1NV7 A;  1RDZ A;  2CZI A;  1YYZ A;  5EYG A;  3RPL A;  4AS4 A;  1NUW A;  1JP4 A;  1NV5 A;  4I3E A;  3D1R A;  5IZ3 B;  5I3S A;  1RDX A;  2WEF A;  4HE1 A;  1KA0 A; 
#chains in the Genus database with same CATH topology
 1B7U A;  2Y84 A;  4EQ9 A;  2VPN A;  1FPI A;  3MJN A;  4OFL A;  1ANF A;  2H9B A;  5DEX B;  2OWT A;  3LR1 A;  4QXD A;  4JSO A;  3QIM A;  5HPQ A;  2OLB A;  1ZMG A;  3S9L C;  3PUZ E;  1ZLQ A;  1B3F A;  4RA1 A;  4GIZ A;  3EHS A;  3WAE A;  1NV0 A;  5A5X A;  3HV1 A;  2VHA A;  1DOT A;  4POX A;  2F35 A;  2XXX A;  3K6X A;  2Y7K A;  3K1M A;  3CG3 A;  3QYT A;  2ZMB A;  2QL3 A;  1A7L A;  3PD9 A;  4OZ9 A;  1FCK A;  1SYH A;  2PBW A;  5AA1 A;  1RDY A;  4PE5 B;  4PGP A;  2HZK A;  2XXI A;  1DPP A;  4IGR A;  4KFQ A;  1IME A;  4HE0 A;  3E78 A;  3VXC A;  1XOC A;  1B58 A;  4NG7 A;  2KR0 A;  2ESN A;  2ALU A;  3O6H A;  5DEX A;  3THI A;  5JEI A;  3KN8 A;  4H5G A;  1IMA A;  4RK2 A;  2YPN A;  1MY3 A;  1USY E;  4PFB A;  1WDN A;  3DP8 A;  2Q2C A;  3LUY A;  4Z7E A;  1PB9 A;  4N17 A;  3IFA A;  2O7U A;  1NUX A;  1AH5 A;  1RDZ A;  2UYF A;  4IY6 A;  4PFT A;  4AS4 A;  1TFD A;  1SQY A;  4YMB A;  4NX1 A;  3RT8 A;  1LB9 A;  4DI4 B;  4YKK A;  3M8U A;  5CM6 A;  2VOZ A;  2QRY A;  4X1D A;  1D9V A;  4RPN A;  3MP1 A;  2ABH A;  2RCB A;  1ATG A;  3IO4 A;  1IIW A;  3KBZ A;  5AA2 B;  1BTJ A;  3DP4 A;  3IR1 A;  1HSL A;  4F3G A;  3ISP A;  2ZZW A;  4NGU A;  4QSD A;  5EQA A;  2HEU A;  1OQH A;  3OEN A;  2D5W A;  1Y3Q A;  1FBC A;  1GTK A;  2REG A;  1FQA A;  4DI3 D;  3I5O A;  2F7B A;  4LQ5 A;  3RGY A;  3OD7 A;  3TKD A;  4JXI A;  1LCT A;  3C31 A;  4KCD A;  3W15 C;  5IGA A;  4YKJ A;  5T3J A;  1DSN A;  1A99 A;  2DYX A;  1B52 A;  2UYE A;  2WBD A;  1VR5 A;  3MZ9 A;  2LAO A;  1IMF A;  4U23 A;  3RQT A;  5IAI A;  4XF5 A;  1QUL A;  1LB8 A;  3H06 B;  1O64 A;  5DVF A;  3MZ1 A;  1N3X A;  3LBS A;  1MM7 A;  1KWH A;  2VT5 A;  3PMW A;  4M1V A;  3MPL A;  1GVC A;  5TPA B;  2PX1 A;  4OQO A;  1FJ9 A;  1FQB A;  3IOU A;  1S7Y A;  4DZ1 A;  2AYS A;  5CC2 A;  2FNC A;  3QXM A;  5I2N B;  2Z22 A;  1P1O A;  3C35 A;  5DTB A;  4QSC A;  1OQG A;  5HM4 B;  3CIJ A;  3W9W A;  4OVQ A;  3IOV A;  4EUO A;  3U72 A;  1USY H;  4YB7 A;  2Y7W A;  4X8R A;  2H98 A;  1RYX A;  3RN8 A;  5H8Q A;  4DIG A;  1YCJ A;  4QFO A;  3H6U A;  3LUZ A;  2PCR A;  2CZK A;  2RF1 A;  2Z8D A;  4KI0 E;  2ZYN A;  4N8Y A;  4ELO A;  5KDT B;  1QVS A;  2QJE A;  4TLM B;  1CE2 A;  5I5P A;  2OPD A;  3FVO A;  2OCU A;  3ROJ A;  4UAB A;  1UIV A;  4UAC A;  4H8J A;  5ITO A;  5EQ7 A;  1FQD A;  3KSJ A;  2Z8E A;  1FSA A;  5I2N A;  1Q35 A;  5I58 A;  1VFD A;  2XX8 A;  1DCU A;  1B40 A;  2O1L A;  1SBP A;  5ICT A;  3RTW B;  4MX6 A;  3O28 A;  3B8B A;  3EHT A;  3A29 A;  4U4S A;  4GD5 A;  1MXV A;  1NH7 A;  1YAE A;  3EKI A;  4KYS A;  3O6I A;  1B5I A;  1TT1 A;  3TYH A;  3M3F A;  3B7D A;  3KJT A;  5CRY A;  2F36 A;  1Y3P A;  3G3G A;  3C36 A;  5DT6 A;  1H76 A;  2WYK A;  2XXR A;  3QUJ A;  1I6B A;  5KDT A;  5H8S A;  4I3E A;  5F7V A;  1P1Q A;  5ISU A;  3PTY A;  4FE8 A;  2G29 A;  3LSX A;  1G0H A;  3K6U A;  3MC2 A;  4DE8 A;  3V83 A;  2O6A A;  1JET A;  3RYD A;  3E9X A;  3MAM A;  4KPT A;  3BFT A;  1AL3 A;  4ELR A;  4GWU A;  3FXU A;  5KCJ B;  1MRP A;  4N6P A;  1SW5 A;  4EQB A;  2HQ0 A;  3K6W A;  2DSF A;  3V8X B;  3G3J A;  1AMF A;  3FJ7 A;  1MQJ A;  2HXR A;  4G8M A;  2FIX A;  3FXQ A;  4R6Y A;  1PBQ A;  4NWC A;  1B2H A;  1B3L A;  4AB6 A;  4F1U A;  4N8G A;  2PT1 A;  1NFT A;  3M3K A;  2XD3 A;  3ZSF A;  1MXX A;  3AXF A;  4NF8 A;  2DE3 A;  3T66 A;  3VLU A;  5L9M A;  4GLI A;  1MXU A;  1FW0 A;  3K1P A;  3TDJ A;  4OA4 A;  1FQF A;  3C34 A;  4H67 A;  4JVI A;  4EF1 A;  2QVU A;  5KCJ A;  3IK6 B;  1US5 A;  2V4C A;  4OES A;  4N13 A;  3KC0 A;  2H25 A;  4P1L A;  4R2B A;  4G61 A;  5H8N A;  3T1B A;  2XXU A;  4FED A;  2YJP A;  5CMM A;  4R72 A;  3CSG A;  3KJ7 A;  3ECR A;  3ONM A;  3PU5 A;  4AQ4 A;  1NMU A;  1R6Z A;  3QAX A;  3OEK A;  4ZEI A;  2I6E A;  5ET7 A;  1QW0 A;  4PDH A;  2VP1 A;  4BDM A;  3FJM A;  1LAH E;  2XWO A;  4JWY A;  1FBP A;  3TOD A;  4PP0 A;  2B3F A;  4RYA A;  4XXU A;  4DCY A;  4PFY A;  3QUF A;  1MQG A;  1EH3 A;  4GQO A;  3O29 A;  4MMP A;  4P0G A;  2F7A A;  5L9S A;  2B4M A;  2DWA A;  2O51 A;  1WVJ A;  3IL1 B;  4LON B;  2B4L A;  2IA4 A;  3MYU A;  1SI0 A;  3KN7 A;  3EF7 A;  1B1X A;  4QFK A;  5EHM A;  2PT2 A;  3L6H A;  4QRZ A;  4R9F A;  4OMB A;  2XWV A;  4DCX A;  1OVT A;  3HHF A;  2FHY A;  3PGF A;  3IOR A;  2QMX A;  1ZKB A;  3IFC A;  4JWX A;  4Q30 B;  4ZE8 A;  5AA3 A;  2XXT A;  4Q8R A;  2ZZX A;  3SEV A;  3KC1 A;  3L6G A;  1I6Q A;  3KFM A;  4UA8 A;  2VGQ A;  2WBB A;  2XXK A;  4H45 A;  1NH8 A;  2CZL A;  3T9U A;  4H5F A;  3CG1 A;  4KXP A;  3Q26 A;  4RXL A;  3H03 A;  1QKB A;  1A40 A;  1ZBM A;  5FTH A;  3FJG A;  5I3S A;  2VD2 A;  1PDA A;  3V5A A;  3HN0 A;  1Y1Z A;  4WXJ A;  4MLV A;  1JVX A;  4ESX A;  3HPI A;  3KN3 A;  1FPE A;  1FPG A;  4OFO A;  4QSE A;  1M5D A;  3OSR A;  1N7W A;  3UIF A;  4FBP A;  2O1M A;  1YZ0 A;  4PAF A;  1DTG A;  1SW4 A;  5BUU A;  3KGC A;  4HTG A;  4OHN A;  4WEP A;  4R9G A;  3P7I A;  3LV0 A;  4ZDM A;  3R6U A;  2XD2 A;  3CSB A;  5K2X A;  3SDF A;  1A55 A;  1G0I A;  1MY4 A;  1P1W A;  3MBP A;  1MQI A;  3TCG A;  2FA7 A;  4NHB A;  1BK4 A;  3K00 A;  4O7M A;  3TUS A;  2DVC A;  3CR9 A;  4QFL A;  4E0W A;  3FZV A;  3S2V A;  4EF2 A;  2FYI A;  1Z7M E;  3PPO A;  3V89 B;  4I8C A;  1EYI A;  1NV4 A;  1MS7 A;  2HAV A;  1NV3 A;  1O63 A;  1VSO A;  4WKM A;  3TTM A;  4NWD A;  3O66 A;  2R8T A;  4NN3 A;  2JJK A;  2O69 A;  4KQP A;  3VE1 B;  1LFH A;  1FPK A;  1D9Y A;  3OO9 A;  4ELP A;  3U65 A;  3I3V A;  4Z0I A;  5HBC A;  4ZEB A;  2YLN A;  1MXY A;  3MVY A;  1B6H A;  2XWK A;  1NUW A;  3UP9 A;  1JW5 A;  4DXU A;  4HE1 A;  2DWH A;  5FHO A;  3TCF A;  3ZKK A;  2PFY A;  4GX6 A;  2ZZV A;  3JZJ A;  2GFE A;  4OEN A;  4BDQ A;  2XXY A;  5LTC A;  2I0C A;  4OVR A;  4X48 A;  3FVN A;  2E1S A;  4BDO A;  1OMP A;  2Q89 A;  3JYR A;  4GX3 A;  5L9O A;  1LFI A;  4PE3 A;  3EPE A;  1UTB A;  2AL4 A;  4GF8 A;  2QS4 A;  1N04 A;  5IZ3 A;  4MHF A;  4IY5 A;  1RYO A;  4FAJ A;  3OXN A;  3MQ9 A;  3FXR A;  4KYE A;  1FQE A;  1YPN A;  1YTV A;  4LQ2 A;  4G77 A;  2NOO A;  4AS5 A;  1B5J A;  2HPG A;  4MNI A;  4OEV A;  1ZU0 A;  1SVX B;  5J1D A;  3CFL A;  2A5T B;  2XX7 A;  1QGX A;  2CEX A;  2H4I A;  3MWB A;  1QUI A;  2DQV A;  2THI A;  3TAJ A;  2DWI A;  4JDF A;  4X1B A;  2AIX A;  4F19 A;  3OSQ A;  5EYF A;  3PPQ A;  4PAK A;  5M2V A;  2V25 A;  1GV8 A;  1Y4T A;  4LAT A;  4OWD A;  1S50 A;  5FHN A;  5H8Q B;  4P11 A;  4ZE9 A;  4H1X A;  3Q25 A;  4YU0 A;  1B0H A;  2F3B A;  3SES A;  4MIJ A;  3T9V A;  2XWI A;  4OVS A;  1LGB C;  1A8F A;  2UVG A;  1JQF A;  3MZB A;  5CBS A;  2UVI A;  4P0I A;  1Y1M A;  3H7M A;  2M8C A;  3G3F A;  5I2K A;  1B05 A;  1K9Z A;  3ZKL A;  3A3U A;  3IOT A;  3CI8 A;  5L8D A;  1FTL A;  4RPO A;  4YIC A;  4N91 A;  2H5Y A;  1FTK A;  5DW8 A;  4H65 A;  1VE4 A;  2A5T A;  5JK4 A;  1PBP A;  5I58 B;  3VV5 A;  1PEB A;  1H45 A;  3E3K A;  3EQ1 A;  3U8Q A;  3H4Z A;  2I3W A;  1SDX A;  4FEB A;  2ZYO A;  2Q9T A;  4JBZ A;  1MXZ A;  4GVO A;  3RY3 A;  4O7I A;  1M5B A;  2XHD A;  1DPE A;  1URG A;  1IMD A;  2Q8M A;  3G3H A;  4X9T A;  2F34 A;  1B3G A;  3KG2 A;  1QJM A;  2I48 A;  1NNK A;  3GYY A;  3W9V A;  4R74 A;  3TFL A;  3VFJ A;  5H8F A;  1NI9 A;  2CZH A;  4NF0 A;  3UK4 A;  2XXQ A;  1IXC A;  5I84 A;  4NED A;  3KBR A;  5JTY B;  1CB6 A;  1IXG A;  3BFU A;  2ONR A;  2PYY A;  2ZNU A;  1IQ7 A;  4PAI A;  3FGS A;  3FIR A;  4Q0C A;  5I56 B;  2Y5L A;  2HCA A;  2MKZ A;  4LA9 A;  5F1Q A;  1LAG E;  1NKX A;  4GXS B;  4NF4 B;  3ILU B;  5CI5 A;  1A54 A;  3BBR A;  4TOZ A;  3SEU A;  1QUJ A;  2CZI A;  1J1N A;  3RPL A;  3MUQ A;  4H6D A;  5B7D A;  5IM2 A;  4GL8 A;  1XI6 A;  4YMA A;  1JW1 A;  2I49 A;  4O8M A;  2OWS A;  2DXY A;  4K3F A;  5FHM A;  2W7Y A;  3A3C A;  3HST A;  3QK6 A;  3CFZ A;  1IUD A;  2ONK E;  3O2A A;  2I4B A;  3RLF E;  5A5L A;  3TMG A;  1B0L A;  4MH5 A;  4ZZA A;  4NF8 B;  5JTY A;  1ZTY A;  2P0S A;  4IO7 A;  3VVD A;  1R9Q A;  3FD3 A;  3K1N A;  4O3C A;  4O94 A;  3DEL B;  1FTA A;  3K2D A;  3TTN A;  2UVJ A;  2QS1 A;  3H6W A;  4KR5 A;  4M4G A;  5I56 A;  2CEY A;  3G7W A;  1IXH A;  2H99 A;  3T96 B;  1B3E A;  4NF4 A;  4AB5 A;  1B7Z A;  3QMF A;  1Q9D A;  3ZS6 A;  2XX9 A;  4P1E A;  3K0V A;  1LBX A;  4XKN A;  2I58 A;  4DDD A;  1MH3 A;  3I6V A;  5H8N B;  5EYH A;  4PC9 A;  1BKA A;  4R73 A;  1LBB A;  4EXK A;  4I62 A;  4PQJ A;  4F1Y A;  3UA8 A;  2BJJ X;  5I57 A;  4MFI A;  1T0K A;  1TXF A;  4LUB A;  3FV1 A;  2RC7 A;  2R9J A;  4ZEF A;  2RCA A;  1URD A;  2P1S A;  3TTR A;  1D3K A;  3PPN A;  2OWZ A;  4XTC Q;  3SEX A;  1D4N A;  3FV2 A;  4O3A A;  1YYZ A;  4JSD A;  4L17 A;  1LLS A;  2O68 A;  1FQC A;  3LC8 A;  4LP2 B;  2V3Q A;  3TQW A;  1RDX A;  3SEY A;  3HCQ A;  3H6T A;  1MPD A;  4GWO A;  4DXC A;  1Q1K A;  2GRV A;  5ESY A;  3KEI A;  4F3B A;  2OPE A;  1UTH A;  2AL5 A;  4ZEC A;  3T0J A;  2DWJ A;  4XKQ A;  3G3K A;  3TEL A;  1P1N A;  2UXA A;  4GXA A;  4C1U A;  2WX9 A;  1P99 A;  1N84 A;  3GBA A;  3MP8 A;  3TEP A;  1B4Z A;  5F24 A;  4OER A;  2F3D A;  1H3D A;  2HFB A;  1DBZ A;  2KQZ A;  1FBG A;  1US4 A;  5ELV A;  3TCH A;  1R1N A;  2QS2 A;  1FPL A;  4PFU A;  4I3Y A;  3USD A;  1B4H A;  4LN5 A;  4RNS A;  1LBZ A;  4HCW A;  4OXV A;  5AA2 D;  4ZED A;  3MW0 A;  4DXB A;  2QFL A;  2D3I A;  3UOR A;  3CRB A;  1AIV A;  4I40 A;  5J16 A;  1ELJ A;  2DXR A;  1N3W A;  4NF5 B;  3PUY E;  1S9T A;  2B3B A;  2GHB A;  1Y3N A;  1P1U A;  4N15 A;  1UIU A;  2L5V A;  4HXV A;  1FTM A;  1IMC A;  2FIE A;  1B3H A;  3OMB A;  4N4U A;  3C33 A;  2UVH A;  1B7H A;  2ZYK A;  4G68 B;  4P8B A;  3T93 B;  1WOD A;  3BKI B;  4U4X A;  3GBB A;  3E4R A;  1SW2 A;  4MAG A;  1MY0 A;  3H3G A;  5IZ1 A;  1FBD A;  1JW4 A;  3IB1 A;  3Q27 A;  4EDP A;  1LBY A;  2PFZ A;  4XKP A;  2BJI A;  3N94 A;  1CNQ A;  4F39 A;  1FPD A;  3BIH A;  1N0T A;  4LZ7 A;  4NF6 B;  3GLB A;  4THI A;  2DP8 A;  1FBF A;  4ND9 A;  4ONY A;  3B6Q A;  3UN6 A;  1K9Y A;  4NF5 A;  1FPB A;  3IJO B;  3TTK A;  4PCD A;  2D21 A;  3S9N C;  4G4P A;  1AOV A;  2WYP A;  1OLA A;  4IO4 A;  4O3B A;  1LFG A;  2ZYM A;  4MNP A;  2NUV A;  4ECF A;  4TQU Q;  1NNP A;  4H0W A;  3VLV A;  3F11 A;  1RKM A;  3OEM A;  4G68 A;  4GX4 A;  3SEW A;  1OLC A;  2F6G A;  5KZT A;  3DLN A;  2DDK A;  3PD8 A;  4PDD A;  2HAU A;  4BDL A;  1ZJL A;  5ET5 A;  4PFI A;  4GWW A;  2ONS A;  2P3V A;  2XXP A;  1FJ6 A;  2QPQ A;  4IO2 A;  4NF6 A;  4X04 A;  3OEL A;  2Z8F A;  5H8H B;  3MST A;  3TZA A;  3BIG A;  1B9J A;  3LSW A;  2Y7I A;  2XXH A;  1EZ9 A;  4GOT A;  1I69 A;  1UTB B;  4GL0 A;  1MH4 A;  4F3S A;  1MM6 A;  4JB7 A;  5EYG A;  3K4U A;  1F9B A;  1B46 A;  3IB0 A;  5IZ3 B;  3C4M A;  3UGW A;  3N5L A;  4OFJ A;  3EHU A;  3C32 A;  3B6T A;  4PF6 A;  5CBR A;  4GBV A;  4MNC A;  4YB6 A;  1JEV A;  4MJO A;  1NNF A;  3NOH A;  4R75 A;  1EZO A;  1NNT A;  4IB2 A;  4PFR A;  3MVX A;  3GZG A;  4P3L A;  4NMY A;  1XS5 A;  3C9H A;  5K2Y A;  2Y5K A;  4IGT A;  3T9X B;  2X7Q A;  1XT8 A;  1NUY A;  4HCY A;  3ODB A;  4U21 A;  3PUX E;  2XXV A;  4GWX A;  4QFP A;  3U94 A;  1LBV A;  5BWJ A;  1AWB A;  1EYK A;  4OVJ A;  5H8H A;  4F31 B;  2OBG A;  1VFE A;  1LCF A;  1ZIU A;  4XEQ A;  1SW1 A;  4ZZE A;  1NL5 A;  4OVT A;  2V93 A;  1XVY A;  3OO6 A;  1DK4 A;  3RPW A;  4DLD A;  1NUZ A;  4WED A;  1EZP A;  5IZZ A;  4R6H A;  3N26 A;  3FBP A;  4G8H A;  4NAP A;  1FTJ A;  4OEU A;  2X7P A;  3MVW A;  3JV9 A;  2V3U A;  4R6K A;  4GWZ A;  5I2K B;  3IX1 A;  5B70 A;  1BLF A;  4HS7 A;  4N6D A;  4GWS A;  4ESW A;  3FAT A;  2I0B A;  3MP6 A;  4PET A;  1MG1 A;  3ILT B;  2V3T A;  5FTI A;  1Y20 A;  1NV7 A;  3B50 A;  1MQD A;  4F22 A;  4ZEK A;  4U22 A;  2RIN A;  3IAZ A;  3KZG A;  4NTL A;  3SZP A;  3S9M C;  4MCO A;  2PVU A;  4F3P A;  3QSL A;  4QF9 A;  4G8N A;  1B51 A;  4FIM A;  4MF3 A;  3VLW A;  4IO3 A;  2Z23 A;  2Q8J A;  5H8F B;  4XFE A;  2I4C A;  5FBP A;  2VD3 A;  2Q2A A;  1SI1 A;  4F2O A;  3O9P A;  1SD3 A;  2DE2 A;  4ISU A;  3D4G A;  3GXA A;  1MPB A;  3TTL A;  2V84 A;  2RC8 A;  3RT6 B;  2WKY A;  5AA2 A;  2XXW A;  4G68 C;  5AA4 B;  2OJT A;  2OZZ A;  1MY2 A;  1OIB A;  4GWY A;  1O7T A;  4RY1 A;  4OYV A;  4YZZ A;  3K01 A;  1HSJ A;  1BIY A;  4C1T A;  3M3L A;  3SET A;  2GQ1 A;  3PMV A;  4BDR A;  3RPL B;  1PB8 A;  1URS A;  4KD5 A;  4IO5 A;  1SPI A;  1OVB A;  4I9D A;  4MLQ A;  3R26 A;  1POY 1;  2P3N A;  1A8E A;  3MVZ A;  2PMS A;  3Q28 A;  2HZL A;  2GH9 A;  4H46 A;  5ITP A;  2DE4 A;  4XKR A;  2G93 A;  4YKI A;  4ZS9 A;  3VVE A;  3LSL A;  4G2Z A;  1JP4 A;  5DVJ A;  4N6K A;  3D1R A;  3FAS A;  1GR2 A;  3H6V A;  2DOJ A;  1IZ1 A;  5TPA A;  2FVZ A;  1QKA A;  5EHS A;  5AA4 A;  3KOS A;  3WAF A;  1BP5 A;  4PBH A;  4E0X A;  1LST A;  4YB5 A;  1DMB A;  2F6P A;  2Q88 A;  3G3I A;  3PUW E;  2HHM A;  1VDW A;  4N81 A;  4N07 A;  5ET6 A;  5I57 B;  2O84 X;  1II5 A;  3Q29 A;  1SYI A;  1JNF A;  4NE4 A;  4EQ7 A;  5I7I A;  3FVK A;  1JVY A;  1JEU A;  1POT A;  4RK9 A;  2REJ A;  4KCC A;  1H44 A;  3CFX A;  4ELQ A;  4YKP A;  3FUZ A;  1YXI A;  4F18 A;  3S9E A;  4RJZ A;  5CMK A;  3N6U A;  5EQ9 A;  3KOT A;  1PB7 A;  3E79 A;  2ZXT A;  2R71 A;  1NV2 A;  4KYD A;  4JVD A;  4GBW A;  3HHG A;  4JWO A;  1EU8 A;  3A09 A;  3IOW A;  4LVQ A;  1FRP A;  2B65 A;  4FJP A;  1D9Q A;  2X26 A;  1UTH B;  4F2Q A;  4C0R A;  3VXB A;  1FBH A;  1LBC A;  2QS3 A;  1FBE A;  4EXL A;  4NQ8 A;  4GRK A;  1M5E A;  3CHG A;  3IB2 A;  1KA0 A;  1HSE A;  4KHZ E;  3PMX A;  2Y7R A;  1EYJ A;  4HW8 A;  2FBP A;  4GFR A;  4OAN A;  2QVV A;  3TQL A;  4XIG Q;  1Z7N E;  3IO6 A;  5I59 B;  2QSX A;  1H43 A;  1MY1 A;  1L5T A;  2F5X A;  2F7C A;  4FOR A;  4FAT A;  1Y9U A;  4I1D A;  3B6W A;  4QBA A;  3MPK A;  1TWY A;  5LDZ A;  2DS9 A;  5TP9 B;  2GHA A;  2DVZ A;  5DYH A;  2HXW A;  1UQW A;  1PC3 A;  2OX3 A;  2Q74 A;  3PV0 E;  2QVR A;  4OTE A;  3PPR A;  3SKP A;  2QMW A;  1LEV A;  4U2R A;  1KZ8 A;  1MPC A;  4FEC A;  2OK2 A;  3LSF B;  4PBQ A;  4YAH X;  2ZNS A;  3OO8 A;  1QUK A;  1LAF E;  1M5C A;  1IIT A;  2O7I A;  4BLA A;  5I59 A;  3N6T A;  3R7X A;  3O6G A;  1R9L A;  4OVP A;  5ICQ A;  3S4U A;  4TLL B;  1INP A;  3VVF A;  1MDP 1;  3K02 A;  3VDF A;  1NV5 A;  4LZ8 A;  4Q5T A;  2WEF A;  1DTZ A;  1IEJ A;  3HO7 A;  1XC1 A;  2NWJ A;  4P56 A;  1I6A A;  5TP9 A;  3HFU A;  2A5S A;  4POW A;  4PFW A;  5IKB A;  3TPA A;  2RC9 A;  2ZNT A;  4JVC A;  1IXI A;  1M5F A;  4P9K A;  4IO6 A;  4BDN A;  2ANJ A;  2R6G E;  5CMB A;  2NVU B;  3E13 X;  1MQH A;  3D4C A;  4IR8 A;  2KLF A;  4R2F A;  3CVG A;  2VPO A;  3EN3 A;  3T9H B;  4P47 A;  3U1O A;  1XVX A;  3IJX B;  1LBW A;  1FPJ A;  3O97 A;  4U1Z A;  3FXB A;  3SER A;  1IMB A;  3U93 A;  2F97 A;  2E0S A;  1NV1 A;  4LZ5 A;  3KSX A;  5AE4 A;  2F78 A;  4OET A;  5DVI A;  4H8I A;  2P2A A;  5LOM A;  1N7X A;  3RNN A;  4QFN A;  3OO7 A;  1N76 A;  3RUM A;  2Y7P A;  5ET8 A;  1FPF A;  1B5H A;  1KA1 A;  3PPP A;  2RKM A;  3DP6 A;  1NV6 A;  5EQ8 A;  4PGN A;  1FTO A;  4HE2 A;  3DM0 A;  1XHY A;  1Y4C A;  3OOA A;  4F29 A;  2IEE A;  3T22 A;  1MDQ A;  5CMC A;  1B32 A;  3RTF B;  5A5X B;  4PF8 A;  1MXW A;  3FVG A;  5TU0 A;  4MBP A;  3K6V A;  4PTK A;  3U92 A;  1GGG A;  3PUV E;  2XA5 A;  4QHQ A;  4MEV A;  1B1H A;  1TFA A;  4F1V A;  4U1O A;  2NXO A;  2F8D A;  1LAX A;  2I3V A;  2CMO A; 
#chains in the Genus database with same CATH homology
 1XI6 A;  5ET7 A;  4PDH A;  2VPN A;  4O8M A;  1FPI A;  2XWO A;  1FBP A;  4QXD A;  4XFE A;  5FBP A;  5A5L A;  4O94 A;  2DE2 A;  4MMP A;  1FTA A;  2B4M A;  2CEY A;  1NV0 A;  2B4L A;  3MYU A;  3QMF A;  1Q9D A;  4P1E A;  4GWY A;  1LBX A;  4YZZ A;  2GQ1 A;  2XWV A;  4PC9 A;  5EYH A;  3RPL B;  1RDY A;  4PGP A;  2HZK A;  1SPI A;  2FHY A;  1IME A;  4HE0 A;  3E78 A;  3IFC A;  4NG7 A;  2ZZX A;  2P3N A;  2KR0 A;  3KC1 A;  2WBB A;  1IMA A;  2XXK A;  2OWZ A;  4H45 A;  2HZL A;  4PFB A;  4H46 A;  4KXP A;  2DE4 A;  4N17 A;  3IFA A;  1NUX A;  1RDZ A;  1YYZ A;  4AS4 A;  1JP4 A;  4N6K A;  3D1R A;  2V3Q A;  5I3S A;  1RDX A;  4NX1 A;  4DI4 B;  5CM6 A;  2FVZ A;  5ESY A;  3KBZ A;  1FPE A;  3ISP A;  2ZZW A;  1FPG A;  4PBH A;  4NGU A;  3T0J A;  5EQA A;  2HHM A;  4FBP A;  1VDW A;  1FBC A;  1YZ0 A;  4PAF A;  4N81 A;  2WX9 A;  5ET6 A;  4DI3 D;  5F24 A;  2F3D A;  1DBZ A;  2KQZ A;  3LV0 A;  1FBG A;  5I7I A;  1FPL A;  4I3Y A;  5IGA A;  5T3J A;  1G0I A;  4NHB A;  4LN5 A;  1BK4 A;  2WBD A;  4O7M A;  1YXI A;  4F18 A;  1LBZ A;  5EQ9 A;  1IMF A;  4HCW A;  3E79 A;  4XF5 A;  2QFL A;  1NV2 A;  1EYI A;  1NV4 A;  4I40 A;  5J16 A;  4JVD A;  4GBW A;  1NV3 A;  2VT5 A;  4M1V A;  1FRP A;  2R8T A;  4NN3 A;  2JJK A;  1D9Q A;  4N15 A;  2L5V A;  4HXV A;  1FJ9 A;  1FPK A;  3U65 A;  1IMC A;  1FBH A;  1FBE A;  2FIE A;  4N4U A;  2XWK A;  1NUW A;  4P8B A;  4NQ8 A;  3W9W A;  4HE1 A;  4OVQ A;  3CHG A;  4MAG A;  1KA0 A;  2PFY A;  4GX6 A;  5IZ1 A;  2ZZV A;  1FBD A;  1EYJ A;  4X8R A;  2FBP A;  5LTC A;  4OAN A;  2QVV A;  1LBY A;  4OVR A;  2PFZ A;  2BJI A;  1CNQ A;  1FPD A;  3BIH A;  4GX3 A;  1FBF A;  4PE3 A;  3LUZ A;  2PCR A;  2CZK A;  2F5X A;  1K9Y A;  4N8Y A;  1FPB A;  4PCD A;  5IZ3 A;  4MHF A;  5I5P A;  2WYP A;  4QBA A;  3ROJ A;  5LDZ A;  4UAB A;  2DVZ A;  4MNP A;  4AS5 A;  5EQ7 A;  2HPG A;  4MNI A;  1FSA A;  2OX3 A;  2Q74 A;  5J1D A;  1DCU A;  2QVR A;  1QGX A;  2CEX A;  1LEV A;  4GX4 A;  1KZ8 A;  4MX6 A;  4F19 A;  2DDK A;  3B8B A;  4PBQ A;  3A29 A;  4PDD A;  4PAK A;  3EKI A;  5ET5 A;  4PFI A;  4GWW A;  2P3V A;  1FJ6 A;  4OVP A;  2QPQ A;  4X04 A;  3MST A;  1INP A;  3BIG A;  2F3B A;  4MIJ A;  2WYK A;  2XWI A;  4OVS A;  5EYG A;  1NV5 A;  4I3E A;  5IZ3 B;  2WEF A;  4P56 A;  3HFU A;  3PTY A;  4PF6 A;  1K9Z A;  4GBV A;  4MNC A;  4YIC A;  4N91 A;  1G0H A;  4JVC A;  4MJO A;  3NOH A;  5DW8 A;  4P9K A;  3RYD A;  5JK4 A;  4IR8 A;  4GWU A;  4PFR A;  2VPO A;  4P3L A;  4P47 A;  2Y5K A;  1LBW A;  1FPJ A;  1NUY A;  2Q9T A;  4HCY A;  4O7I A;  3FXB A;  1IMB A;  1IMD A;  2HXR A;  2Q8M A;  4GWX A;  2FIX A;  1LBV A;  1NV1 A;  4X9T A;  1AWB A;  1EYK A;  3GYY A;  3W9V A;  4F1U A;  4N8G A;  4XEQ A;  4OVT A;  1DK4 A;  1NUZ A;  5IZZ A;  5ET8 A;  1FPF A;  1KA1 A;  1NI9 A;  2CZH A;  3FBP A;  4NF0 A;  1NV6 A;  4NAP A;  5EQ8 A;  2DE3 A;  4PGN A;  4HE2 A;  4GWZ A;  4PAI A;  4N6D A;  4GWS A;  2Y5L A;  4OA4 A;  4PF8 A;  2MKZ A;  4JVI A;  4PET A;  2QVU A;  4PTK A;  2V4C A;  3KC0 A;  4P1L A;  2XA5 A;  4G61 A;  4MEV A;  1NV7 A;  3B50 A;  3T1B A;  2CZI A;  3RPL A;  4F1V A;  5IM2 A;  3SZP A;  4MCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...