3IFAA

Human muscle fructose-1,6-bisphosphatase e69q mutant in complex with amp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
326
Chain Sequence
TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVDQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
total genus 113
structure length 326
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3ifaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3ifaA02
1JP4A 2QVUA 3A29A 4HXVA 1KZ8A 2VT5A 2FIEA 5EQ7A 4I3YA 1NV5A 3BIGA 5FBPA 1LBYA 1FPEA 4N81A 4G61A 1G0HA 4AS4A 1K9ZA 1FBHA 2F3BA 3RPLA 2Y5LA 5EYHA 1YYZA 2BJIA 2Q74A 1FSAA 2OWZA 4AS5A 2DDKA 1AWBA 2QFLA 3ROJA 1NV3A 4HE1A 1KA0A 1NUWA 2R8TA 5ET7A 4I3EA 1RDYA 4HE2A 5T3JA 5LDZA 3IFAA 4KXPA 4GWSA 3RYDA 3KC0A 3LV0A 5ESYA 1IMDA 1LBVA 2FIXA 5EYGA 4PTKA 3T0JA 4I40A 2Q8MA 4GBWA 2WEFA 1FRPA 4GWZA 1IMBA 1FJ9A 1FBFA 4QXDA 1NUYA 1LBZA 2HHMA 1FPLA 1YXIA 1FPBA 5IZ3A 2CZHA 1NI9A 5ET6A 1RDZA 1FPDA 1Q9DA 1IMCA 1FBGA 1FJ6A 3FBPA 3BIHA 1DK4A 1QGXA 1FBDA 1XI6A 4GWUA 5EQ8A 1FPGA 2CZKA 2QVRA 1LBXA 1FPJA 1NUXA 1K9YA 1NV2A 2WBBA 5ET5A 1RDXA 5IZ3B 1DCUA 1NV0A 2Y5KA 4GX6A 2PCRA 5F24A 4H46A 1FBPA 5EQAA 4GX4A 4GBVA 1FPIA 1NV6A 1YZ0A 1EYJA 4O7IA 2JJKA 1EYKA 4FBPA 1FPFA 2FVZA 1NV1A 1CNQA 5A5LA 1EYIA 5ET8A 1DBZA 1FPKA 1IMFA 1D9QA 5I3SA 2F3DA 3KBZA 2P3VA 1G0IA 5DW8A 3B8BA 2WBDA 2CZIA 2GQ1A 2FHYA 3LUZA 1IMEA 1NUZA 4GWWA 5IZ1A 2FBPA 2OX3A 1BK4A 1LEVA 3RPLB 1FBEA 4GX3A 1IMAA 3IFCA 3KC1A 3D1RA 3QMFA 2P3NA 4IR8A 2QVVA 5EQ9A 4HE0A 4MJOA 1FTAA 1INPA 1FBCA 4H45A 1NV7A 5J16A 1NV4A 1LBWA 4GWYA 1KA1A 1VDWA 4GWXA 1SPIA
chains in the Genus database with same CATH superfamily
5H8SA 3VFJA 4HXVA 1A8EA 4LATA 3OEMA 1B3LA 1LBYA 1WVJA 3CIJA 1G0HA 2XXTA 3RPLA 2Y5LA 2XWVA 3HSTA 4FEDA 1MRPA 1N04A 3B6TA 3ROJA 4HE1A 1Y1ZA 1RDYA 1EZ9A 4PFYA 1B3GA 2Z22A 3Q29A 3KN8A 4ZEKA 4H0WA 2O7IA 4H5FA 3D4GA 4GWZA 4NF5A 3T9UA 1Z7ME 1MDP1 3LSFB 1FPBA 1B0HA 3IJXB 3Q28A 3U8QA 3P7IA 4GL8A 5IKBA 3UGWA 2I4CA 4OVRA 4OVPA 4YKPA 3K00A 3PD8A 3RT8A 2RCBA 2I48A 4FIMA 4YKIA 1NNPA 3GBBA 5AA4B 4NF6A 3PMVA 3PUVE 1ZIUA 1SBPA 4F22A 2UVJA 2OPEA 3M3LA 3ECRA 3SZPA 1CNQA 3UIFA 3KSXA 5ITPA 1POTA 4O8MA 1OMPA 2V3QA 3DELB 3PU5A 1D3KA 3OO7A 3HFUA 5HBCA 3SEWA 5ITOA 4ELRA 1AMFA 2MKZA 2AL4A 1Q1KA 4JSOA 2QVVA 2F78A 1QW0A 4PQJA 4HCWA 2DOJA 4PBHA 5LOMA 4DZ1A 3I6VA 2REJA 4KHZE 1FTLA 2F36A 4MNCA 5F1QA 1LGBC 1LLSA 3CRBA 3VVDA 3T9VA 3E4RA 5DTBA 5JTYA 3VVFA 3ZS6A 2QS2A 5LDZA 2HFBA 1JVYA 1OVTA 5FTIA 1A54A 4EDPA 5JK4A 2FIXA 3W9VA 1N3WA 3B6QA 1XVYA 1NUYA 1LBZA 1H3DA 4GVOA 4N6PA 1NMUA 1NI9A 1RDZA 3OELA 2XXWA 4R6YA 1CE2A 4G8HA 1IMCA 2PFZA 4P9KA 4LZ8A 3BBRA 4UABA 3ONMA 4YKKA 1NH8A 4JWYA 3GYYA 3KGCA 2RKMA 1DTGA 4GX6A 2I0BA 1MY0A 1MY3A 5EQAA 2FNCA 3S2VA 3T66A 3V83A 1B0LA 3T1BA 3GZGA 4R75A 3UK4A 2I3WA 2PYYA 4NEDA 5CC2A 5I56A 5DW8A 4GOTA 2E0SA 2XXPA 2Q2CA 4F3GA 3W9WA 4LZ5A 5AA3A 2Z8DA 3KOSA 2G29A 2H25A 3H6VA 4ZS9A 2QMXA 5I2NB 1MY4A 4F39A 2UYFA 5FHNA 4NN3A 4YKJA 4F29A 4F3SA 2H5YA 2DVCA 4H1XA 4JWOA 2QS3A 4KR5A 1UTBB 3DP8A 3RUMA 3V8XB 3PUXE 1BP5A 2XWOA 3IOUA 3S9LC 3HHGA 4EUOA 3PPOA 3VVEA 3H6WA 2O84X 3GXAA 3RQTA 4PF6A 3O29A 3FZVA 3LSXA 4EF2A 1JVXA 3UN6A 2OLBA 3JYRA 4PE5B 5DVIA 2ABHA 4HE2A 5T3JA 3FGSA 1B5HA 3MP1A 4FEBA 5EYGA 2AYSA 2OZZA 3HN0A 2THIA 2GHBA 5ICTA 4GFRA 3RY3A 4MX6A 1QKAA 3NOHA 4N91A 2O6AA 5CRYA 2PFYA 3VLWA 2QJEA 3RNNA 4LQ2A 1FPJA 3MVWA 3PMWA 1B2HA 4NHBA 4RPNA 2RCAA 3OENA 2XX8A 3IB2A 2NWJA 4R73A 3VV5A 2E1SA 1EYIA 1B1HA 1N7WA 3EKIA 1FQCA 1ZJLA 3O6HA 4X8RA 2RF1A 5H8FB 5CMCA 2WBDA 3K6WA 2GQ1A 2FHYA 1SYIA 4R74A 1URDA 1O63A 1LFHA 3IOVA 3PTYA 3RPLB 4ZEIA 3N6TA 3UORA 4N15A 4OTEA 1MPBA 3G3FA 3VLVA 1XOCA 1DPPA 1JP4A 1Y3NA 2XX7A 2VT5A 1NNKA 2X7QA 4ECFA 2ZZXA 1YAEA 2XXVA 4R9GA 4XIGQ 4FECA 2Q74A 2PBWA 1RKMA 5K2XA 3K4UA 2QFLA 1N84A 2O68A 3USDA 1UTHB 4PFUA 1IQ7A 3MAMA 3FJ7A 4PTKA 3H03A 4XXUA 2NVUB 2O51A 3K2DA 4PFBA 1GGGA 2CEXA 3E9XA 4RK9A 4U21A 1Y3PA 3KG2A 3PUWE 3Q27A 5KCJA 1F9BA 3KN3A 3BKIB 1SI1A 5EQ8A 2DP8A 4PFIA 1SW5A 1QUIA 5H8FA 2ZNTA 1RDXA 2ZZVA 4GF8A 4E0WA 2B4LA 3D4CA 1NNTA 4QFOA 1NV6A 2PT2A 4LQ5A 3PPRA 1BIYA 3EHTA 4M4GA 3AXFA 1B58A 1JETA 3B8BA 3OSQA 1MXWA 2F7BA 2Y7PA 1DMBA 1SD3A 4XTCQ 3OXNA 5AA1A 5I7IA 1FTAA 1T0KA 2F7CA 2ESNA 2V3TA 1R9LA 4GWXA 4P1LA 4Q5TA 4PAKA 1KZ8A 3JV9A 4N13A 4PFTA 1I6BA 2L5VA 4N6KA 5TU0A 4F2QA 3BIGA 4EQ7A 1ATGA 1B51A 1NH7A 3QUJA 2PX1A 3I5OA 2W7YA 1US4A 1M5EA 3IX1A 1MXUA 1MY2A 5TP9B 2A5SA 4QSEA 2VP1A 4BDRA 4P0IA 2LAOA 4YICA 2BJJX 1IUDA 2YPNA 3VXBA 4TOZA 1YXIA 3DM0A 3VXCA 4MBPA 3O6IA 1IITA 3PGFA 4GL0A 3U92A 1LAHE 5I84A 4DE8A 4PETA 2IA4A 3DP4A 2P2AA 3FATA 1EH3A 3FVNA 1XI6A 2CZKA 1MDQA 2D5WA 4LP2B 4QBAA 1LBXA 2VD2A 1NUXA 3HHFA 4BDMA 1P1QA 3FIRA 4N8GA 3CFXA 4R2BA 2REGA 5TPAB 3OMBA 4XKQA 1UIUA 1YZ0A 4YU0A 3RLFE 1XHYA 2WX9A 5CMBA 5BWJA 2UVIA 2DE3A 1ZTYA 3V5AA 1FQEA 5I3SA 1FQDA 3TCHA 1G0IA 2F97A 3TELA 4NG7A 3TODA 5DEXA 1OQHA 1Y4TA 2QS1A 3MJNA 3QMFA 2HXRA 4MJOA 3UA8A 1FBCA 1R9QA 3U94A 5B70A 1M5CA 3K1NA 1L5TA 1JEUA 3CSBA 5EQ7A 2XD2A 5LTCA 4HCYA 1GV8A 1GR2A 3GBAA 4N4UA 3G3KA 3MVXA 3MWBA 3OO8A 1AWBA 1MQHA 4PP0A 3MPLA 5ET7A 3FXQA 5L9MA 2DWIA 3FV1A 1Q35A 3TTLA 1FRPA 3R7XA 1B6HA 3H3GA 1NFTA 1FPLA 2O1MA 4ND9A 2Q88A 4PBQA 4I9DA 1Q9DA 4G2ZA 3FBPA 3BIHA 3FVKA 2B4MA 2OBGA 2A5TA 5TPAA 1FBDA 5JTYB 1HSEA 3O6GA 4PGNA 4PFWA 4RYAA 3N6UA 2Y7IA 4MNIA 5F24A 4ZE8A 3BFUA 3WAFA 4QF9A 3KFMA 1IXGA 4GBVA 2Z8EA 1PBQA 5H8HA 3M3FA 3TMGA 5A5LA 4ZECA 1D9VA 3HPIA 1DBZA 1IMFA 2F6PA 3KBZA 1JEVA 4JVIA 4Z7EA 2CZIA 1LBCA 3N5LA 1BLFA 3IO6A 3TFLA 4NF8A 3LSLA 3DLNA 1PB8A 3PPPA 3CI8A 1IMAA 5H8QB 1B7ZA 1B3EA 3B6WA 5F7VA 1DPEA 4BDOA 4O3AA 4IGTA 5J16A 1NV4A 4GWYA 4NF5B 3IORA 5I2NA 5FHOA 5EHSA 4LN5A 4C0RA 3K02A 1A99A 4JVDA 4LUBA 1TFDA 3ILUB 4DCYA 1B3FA 2OPDA 2PVUA 4C1UA 4KQPA 4Q8RA 3KC0A 3EN3A 5ELVA 4Q0CA 1URSA 2H99A 3T0JA 5CBSA 4ESWA 4WKMA 1FTOA 4O94A 5AA2D 2XXUA 5HM4B 4FJPA 3H06B 2Z8FA 4EXKA 1MQGA 1FJ6A 4KD5A 2ONSA 1DK4A 2ZNUA 2GFEA 4OERA 1K9YA 2B65A 2I58A 1IXHA 1Y20A 4H6DA 3FASA 1FBPA 4DI3D 3EF7A 1FQBA 4FAJA 3OSRA 1FPIA 4EQ9A 2V84A 1I69A 4AQ4A 4FBPA 1BKAA 2P1SA 3FUZA 3TDJA 1MG1A 5I58A 1LCTA 4KCDA 4MNPA 3EHUA 1S9TA 5I2KA 1D9YA 1NUZA 4GWWA 4Q30B 2V25A 3EPEA 3CSGA 3U1OA 3I3VA 2P3NA 1SQYA 2CZLA 1ANFA 3HO7A 1A40A 3SDFA 3A29A 4G68A 3BFTA 2F7AA 3C34A 5ICQA 1PBPA 5JEIA 5TP9A 4G61A 4AS4A 2AIXA 1UIVA 4OMBA 4PE3A 2D21A 3MZ9A 4OZ9A 1WDNA 4OFLA 4PAFA 1BTJA 1MXZA 1CB6A 1Y1MA 1B7HA 4F2OA 1IXIA 3QXMA 1HSLA 2F8DA 3TAJA 3OOAA 4GBWA 4JB7A 2HHMA 1VFDA 4IO5A 3MZ1A 3IOTA 4FE8A 1ZLQA 2O7UA 1SW2A 3SETA 2QSXA 4GLIA 4MH5A 4HW8A 3G7WA 1MXXA 2ZXTA 3ZKKA 1II5A 5IZZA 1S50A 4DDDA 1H45A 4KPTA 4GXSB 3KOTA 3LUYA 1O7TA 5IZ3B 3S9MC 3KBRA 1LCFA 5I2KB 2JJKA 4MEVA 2DYXA 4QFNA 4MF3A 1DOTA 3RGYA 4IY5A 1B05A 1A8FA 4R6HA 4TLLB 1P99A 4ZE9A 1PB7A 3R26A 2O69A 3KC1A 4U2RA 5EQ9A 1NNFA 3RPWA 4HE0A 5H8NA 1NV7A 3PPQA 2XXRA 2XXQA 2DVZA 2I49A 4P0GA 4OEUA 4XKRA 1P1NA 3FJMA 5DEXB 4ZZEA 1FPEA 5ISUA 1K9ZA 2F3BA 5L8DA 2BJIA 2HZKA 1B5IA 2CMOA 4PF8A 2UVHA 3KEIA 4DXUA 3MC2A 5KZTA 4GWSA 4P11A 2DE2A 4MIJA 4PDHA 1IMDA 3KJTA 3U72A 3TQLA 3FVOA 3IAZA 5IZ3A 3FV2A 1MQDA 1UTHA 2G93A 1D4NA 3C33A 1J1NA 3PPNA 5DYHA 2HCAA 4OWDA 1LB8A 1LAXA 1MH4A 3MP6A 4YMBA 3B7DA 4H46A 3CFZA 3IR1A 2V93A 3ZSFA 2OWSA 3E79A 3O66A 3PUYE 1A7LA 5A5XB 4LA9A 3IK6B 4GD5A 4XKNA 2P3VA 1SYHA 4HS7A 2DWJA 4P1EA 4BLAA 4YB6A 5IZ1A 3TTRA 1LEVA 1UQWA 4NWDA 1OQGA 4OETA 5FTHA 3D1RA 4OFJA 3LSWA 3PMXA 3K0VA 1INPA 2Z23A 1AH5A 2PMSA 4I62A 1POY1 4WEPA 1YPNA 4PC9A 2VGQA 2UYEA 1FQAA 2UXAA 1PB9A 3TTKA 2OWZA 4IGRA 1IZ1A 4GIZA 4YZZA 3KZGA 4OYVA 2GH9A 4BDQA 4Z0IA 1JW1A 2Q89A 1SVXB 2RINA 4PAIA 2WEFA 1USYE 1QULA 4NX1A 1LBBA 3Q25A 2VOZA 2HAVA 1LFIA 2DXYA 3WAEA 4KYSA 1MM6A 4U1OA 2ONRA 4IO2A 5I58B 3G3JA 1HSJA 3O9PA 5ET5A 5I57A 4DI4B 1QVSA 1SW4A 4OVQA 3RTWB 1P1OA 3IOWA 5J1DA 3C4MA 1D9QA 4OVTA 2YJPA 3MZBA 4OEVA 4OENA 5AA4A 1FBEA 3TPAA 3SEUA 1TXFA 1UTBA 2XXYA 2ALUA 2RC7A 4G68C 4BDLA 1VDWA 3KJ7A 1XVXA 3K1MA 3TCGA 4JVCA 3C31A 3U93A 4P3LA 1ZMGA 2QPQA 3OD7A 1DSNA 1I6QA 4I3EA 1B4ZA 4H65A 4P8BA 4X1BA 4ELPA 3HCQA 1RYXA 2H9BA 4MMPA 5H8QA 4NF8B 2GHAA 4IO4A 4JWXA 1ZBMA 3SEXA 2QRYA 2R6GE 1IIWA 5ET6A 2D3IA 2XXKA 4I8CA 4NWCA 3QIMA 4GWUA 4F3PA 1FTKA 3SEVA 2QVRA 1US5A 1Y4CA 1FTMA 2Y7RA 4POXA 4G4PA 4GRKA 4BDNA 4U23A 2XXHA 1B7UA 5DVJA 2VPNA 2HZLA 3CVGA 4OESA 1B32A 1GTKA 5L9SA 3MUQA 4EXLA 4ONYA 1Y9UA 2F3DA 1TT1A 2Q8JA 3EHSA 4LONB 2O1LA 1BK4A 2WYKA 4TLMB 4P47A 3TCFA 3H7MA 3K01A 1M5BA 4ELOA 4NF6B 4IB2A 3T96B 3CR9A 2Q9TA 4K3FA 1SPIA 4QSDA 1P1WA 4G8MA 1LAFE 2ZYMA 2FIEA 4JSDA 4QFPA 1JQFA 1I6AA 4N81A 1EZOA 4H67A 3MVZA 1TWYA 3N26A 2V3UA 2DDKA 4KYDA 3H4ZA 1B46A 4IO7A 3FD3A 4LZ7A 5ESYA 2ZNSA 4N8YA 3M8UA 4U4XA 1FPDA 4KCCA 2PT1A 2Y84A 4MLVA 4ZZAA 1N7XA 3THIA 1B52A 5I59B 2DQVA 2QS4A 4C1TA 3RN8A 4ESXA 3ILTB 3K6XA 4UACA 4F1VA 2NOOA 2WBBA 3G3GA 2XA5A 4YMAA 1XT8A 3TTNA 3MBPA 4F31B 3G3IA 4O7IA 3C9HA 3HV1A 1SDXA 3M3KA 2FVZA 3V89B 1NV1A 3TUSA 4L17A 5IGAA 5ET8A 2HAUA 2VHAA 3G3HA 2B3FA 3CHGA 4DXCA 2QMWA 1OIBA 4YAHX 1YTVA 4PDDA 3KSJA 4RJZA 3LUZA 1IMEA 2NXOA 3TEPA 3ODBA 5AA2B 3IO4A 2I6EA 4UA8A 1WODA 4OQOA 4GXAA 2F5XA 1H43A 4FORA 2KLFA 4PFRA 4ELQA 3CG1A 2R9JA 3CG3A 1B3HA 4RNSA 2HEUA 5CMMA 1LSTA 4N17A 4OVJA 1YCJA 1USYH 2HQ0A 4ZEBA 4I3YA 1NV5A 1OLAA 4X48A 2NUVA 3K6VA 2I4BA 1JW4A 4QSCA 5KDTB 3OEKA 3ZKLA 4KXPA 4THIA 4GQOA 1LBVA 3IB1A 4H8IA 3O97A 3C36A 1FBFA 4O3CA 5CMKA 1QUKA 2A5TB 4G77A 2CZHA 4X04A 4N07A 4OANA 4OVSA 4NQ8A 1FBGA 2ZYKA 3L6HA 1ZKBA 3PUZE 5FHMA 5IM2A 4G68B 1MQIA 3RT6B 3K1PA 5DVFA 5I56B 1N3XA 3OO9A 4F1UA 3T9HB 2ZMBA 5KCJB 2F34A 4WXJA 3C35A 2DWHA 4OXVA 4R6KA 4YB5A 1QJMA 2XXIA 2XXXA 5I57B 4LVQA 5CBRA 3LR1A 2FBPA 2OX3A 2QL3A 4U1ZA 3UP9A 4R9FA 3PV0E 3SKPA 1O64A 1FTJA 4MCOA 1P1UA 3A3UA 3QK6A 4MLQA 4M1VA 4DXBA 4H45A 1PDAA 1H44A 2OK2A 4R2FA 3IFCA 2QVUA 1JW5A 4RA1A 1S7YA 4TQUQ 4IO3A 2FYIA 3MYUA 3FJGA 5K2YA 2V4CA 1KWHA 4DLDA 2X7PA 4AS5A 2GRVA 2OCUA 1ZU0A 3TKDA 5H8NB 3VDFA 4R72A 1NV3A 5B7DA 1NUWA 1MH3A 2IEEA 4NF0A 2X26A 1OVBA 1M5FA 2FA7A 2DS9A 1IMBA 1FJ9A 1PC3A 4NF4A 2I0CA 2XD3A 4QRZA 2ZYOA 3FXRA 4HTGA 4NMYA 1QGXA 2ZYNA 4MHFA 1FPGA 3FVGA 2XX9A 3F11A 4F18A 1NV0A 3VE1B 4I1DA 2PCRA 3B50A 1N0TA 4GX4A 3GLBA 1EU8A 4ZDMA 1VSOA 1FPFA 4XKPA 2DSFA 1FPKA 4RPOA 1MXYA 1FQFA 2B3BA 3MW0A 3QAXA 3U65A 4OHNA 1EZPA 2M8CA 5KDTA 1TFAA 3OO6A 5M2VA 4GX3A 3QSLA 3TTMA 5HPQA 3A3CA 4PCDA 3O2AA 1XC1A 5AA2A 1Y3QA 4IR8A 4P56A 2WKYA 1N76A 4NGUA 4X9TA 3KN7A 3T9XB 1XS5A 1LBWA 4QHQA 1MPDA 3T93B 1A55A 1VR5A 4ZEFA 3CFLA 2XWKA 5AE4A 4NE4A 4IO6A 5EHMA 1FBHA 2H4IA 1YYZA 1FSAA 2HPGA 4EQBA 1B9JA 1B5JA 1AL3A 2HXWA 5IAIA 3PD9A 3W15C 1KA0A 4NF4B 4JDFA 4MFIA 3N94A 4U22A 3LV0A 3JZJA 2AL5A 2I3VA 3IB0A 1MQJA 2Q8MA 1QUJA 2H98A 3TYHA 5BUUA 3RTFB 2ANJA 3MPKA 1DTZA 5L9OA 3IL1B 1ELJA 1PEBA 3TQWA 2Y7WA 2VPOA 3DP6A 5DT6A 3LC8A 1QKBA 4U4SA 1MY1A 3MP8A 4DIGA 1FCKA 1H76A 2ONKE 2Y5KA 3E13X 2XWIA 4QFKA 1NKXA 4EF1A 4O3BA 2F35A 5I5PA 3SESA 1EYJA 2DWAA 5I59A 4NTLA 2R71A 4DCXA 3MSTA 4XF5A 3E3KA 4KYEA 3QUFA 3TZAA 3FXBA 2YLNA 1FW0A 2P0SA 2ZZWA 4AB5A 1OLCA 4KI0E 4MAGA 1MM7A 2RC9A 3H6UA 1Z7NE 1MXVA 1JNFA 1MS7A 4H8JA 4ISUA 4OFOA 5FBPA 3MQ9A 4POWA 2RC8A 1B4HA 4KFQA 5EYHA 1URGA 4QFLA 1IXCA 3QYTA 1R1NA 4YB7A 4E0XA 1RYOA 4F3BA 2R8TA 3IFAA 3T22A 3O28A 2DE4A 3RYDA 4F1YA 4RY1A 3L6GA 4WEDA 5CM6A 1MPCA 2CEYA 3K6UA 1M5DA 5EYFA 4I40A 1R6ZA 2KQZA 4QXDA 2WYPA 2OWTA 2F6GA 4RXLA 5CI5A 2VD3A 1B1XA 3S9EA 1LB9A 3MVYA 1VE4A 2OJTA 1AOVA 1IEJA 1LFGA 4JBZA 3LBSA 1NV2A 4O7MA 4FATA 5A5XA 4F19A 3H6TA 1GVCA 1DCUA 3VLUA 3FXUA 4X1DA 1B40A 4RK2A 4XFEA 1EYKA 3SEYA 2Y7KA 3EQ1A 3Q26A 4GWOA 4AB6A 4N6DA 5H8HB 1SW1A 4JXIA 3E78A 3ISPA 2KR0A 1AIVA 3C32A 2DXRA 1VFEA 3A09A 3IJOB 1LAGE 4PGPA 2Q2AA 4G8NA 4NAPA 4H5GA 1NL5A 2XHDA 3S4UA 1SI0A 4IY6A 3R6UA 4XEQA 4ZEDA 3S9NC 4OA4A 1KA1A 2UVGA 3SERA
chains in the Genus database with same CATH topology
1JP4A 2QVUA 3A29A 4N17A 4HXVA 1KZ8A 4PAKA 2VT5A 2FIEA 5EQ7A 4MNCA 4I3YA 2L5VA 1NV5A 2XWKA 4HCYA 2XWOA 4N6KA 5LTCA 3BIGA 5FBPA 4JVCA 1LBYA 1FPEA 4N81A 4G61A 1G0HA 3MYUA 4AS4A 1K9ZA 1FBHA 2ZZXA 2F3BA 4PC9A 3RPLA 4LN5A 2Y5LA 2V4CA 4N4UA 4P1LA 5EYHA 1YYZA 2XWVA 4P3LA 2BJIA 4PF6A 2HZKA 4PE3A 2Q74A 1FSAA 2HPGA 2OWZA 4AS5A 2QPQA 4JVDA 4PF8A 2DDKA 1AWBA 4PAFA 2QFLA 3ROJA 1NV3A 4HE1A 1KA0A 1NUWA 4YZZA 2R8TA 5ET7A 4I3EA 1RDYA 4HE2A 5T3JA 5LDZA 3IFAA 4KXPA 4GWSA 4P8BA 4NF0A 2DE4A 3RYDA 4F18A 3KC0A 2DE2A 3LV0A 4MIJA 4PDHA 5ESYA 1IMDA 1LBVA 5JK4A 5CM6A 2FIXA 5EYGA 4PTKA 3T0JA 2CEYA 4I40A 3W9VA 4N8YA 2Q8MA 4MMPA 4PAIA 4YICA 4GBWA 2WEFA 1FRPA 4GWZA 1IMBA 1FJ9A 4O94A 1FBFA 2KQZA 4QXDA 1NUYA 1LBZA 2HHMA 2WYPA 4NX1A 1FPLA 1YXIA 4X8RA 1FPBA 5IZ3A 4MX6A 2CZHA 4PBQA 4PFBA 1NI9A 5ET6A 2CEXA 3NOHA 1RDZA 4X04A 1FPDA 2XXKA 4N91A 4OANA 1Q9DA 4OVSA 4NQ8A 4PETA 1IMCA 2PFYA 1FBGA 1FJ6A 3FBPA 2PFZA 3BIHA 4P9KA 1DK4A 1QGXA 4UABA 2VPOA 2B4MA 4MHFA 1FBDA 1XI6A 5IZZA 4GWUA 5EQ8A 1FPGA 4PFIA 2CZKA 4QBAA 4OVRA 5IM2A 2QVRA 4OVPA 1LBXA 1FPJA 4NHBA 1NUXA 1K9YA 4PGNA 4F1VA 4O7MA 1NV2A 2WBBA 5ET5A 3GYYA 1RDXA 4N8GA 2ZZVA 4F19A 2XA5A 5IZ3B 1DCUA 1NV0A 2Y5KA 4MNIA 4GX6A 2PCRA 5F24A 2B4LA 2XWIA 4DI4B 3B50A 4H46A 1FBPA 5EQAA 4DI3D 4GX4A 4GBVA 4OVQA 3E79A 1FPIA 1NV6A 5I5PA 1YZ0A 1EYJA 4F1UA 4O7IA 2JJKA 4XFEA 3T1BA 1EYKA 2VPNA 4FBPA 1FPFA 2FVZA 2WX9A 1NV1A 3SZPA 1CNQA 2HZLA 5A5LA 5IGAA 1EYIA 5ET8A 4MEVA 5J1DA 3MSTA 2DE3A 1DBZA 1FPKA 1IMFA 4XF5A 3EKIA 1D9QA 5I3SA 3CHGA 4O8MA 3U65A 2F3DA 3KBZA 2P3VA 4N6DA 2V3QA 4MNPA 1G0IA 4JVIA 5DW8A 4OVTA 3B8BA 3E78A 2WBDA 2CZIA 2GQ1A 3ISPA 3FXBA 2FHYA 4NG7A 4P1EA 4PDDA 2KR0A 2Q9TA 3LUZA 1IMEA 3HFUA 1NUZA 4GWWA 5IZ1A 2ZZWA 2FBPA 2OX3A 3W9WA 1BK4A 3PTYA 1LEVA 3RPLB 2WYKA 1FBEA 4GX3A 4P47A 4MAGA 4PCDA 4N15A 2MKZA 1IMAA 3IFCA 3KC1A 3D1RA 3QMFA 4MCOA 2P3NA 2HXRA 4IR8A 2QVVA 2F5XA 4PGPA 5EQ9A 4NAPA 4HE0A 4P56A 4MJOA 5I7IA 1FTAA 4M1VA 1INPA 1FBCA 4NGUA 4PFRA 4H45A 4NN3A 1NV7A 4X9TA 5J16A 4XEQA 1NV4A 4HCWA 4OA4A 1LBWA 4PBHA 4GWYA 1KA1A 2DVZA 1VDWA 4GWXA 1SPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JP4 A;  2QVU A;  3A29 A;  4HXV A;  1KZ8 A;  2VT5 A;  2FIE A;  5EQ7 A;  4I3Y A;  1NV5 A;  3BIG A;  5FBP A;  1LBY A;  1FPE A;  4N81 A;  4G61 A;  1G0H A;  4AS4 A;  1K9Z A;  1FBH A;  2F3B A;  3RPL A;  2Y5L A;  5EYH A;  1YYZ A;  2BJI A;  2Q74 A;  1FSA A;  2OWZ A;  4AS5 A;  2DDK A;  1AWB A;  2QFL A;  3ROJ A;  1NV3 A;  4HE1 A;  1KA0 A;  1NUW A;  2R8T A;  5ET7 A;  4I3E A;  1RDY A;  4HE2 A;  5T3J A;  5LDZ A;  3IFA A;  4KXP A;  4GWS A;  3RYD A;  3KC0 A;  3LV0 A;  5ESY A;  1IMD A;  1LBV A;  2FIX A;  5EYG A;  4PTK A;  3T0J A;  4I40 A;  2Q8M A;  4GBW A;  2WEF A;  1FRP A;  4GWZ A;  1IMB A;  1FJ9 A;  1FBF A;  4QXD A;  1NUY A;  1LBZ A;  2HHM A;  1FPL A;  1YXI A;  1FPB A;  5IZ3 A;  2CZH A;  1NI9 A;  5ET6 A;  1RDZ A;  1FPD A;  1Q9D A;  1IMC A;  1FBG A;  1FJ6 A;  3FBP A;  3BIH A;  1DK4 A;  1QGX A;  1FBD A;  1XI6 A;  4GWU A;  5EQ8 A;  1FPG A;  2CZK A;  2QVR A;  1LBX A;  1FPJ A;  1NUX A;  1K9Y A;  1NV2 A;  2WBB A;  5ET5 A;  1RDX A;  5IZ3 B;  1DCU A;  1NV0 A;  2Y5K A;  4GX6 A;  2PCR A;  5F24 A;  4H46 A;  1FBP A;  5EQA A;  4GX4 A;  4GBV A;  1FPI A;  1NV6 A;  1YZ0 A;  1EYJ A;  4O7I A;  2JJK A;  1EYK A;  4FBP A;  1FPF A;  2FVZ A;  1NV1 A;  1CNQ A;  5A5L A;  1EYI A;  5ET8 A;  1DBZ A;  1FPK A;  1IMF A;  1D9Q A;  5I3S A;  2F3D A;  3KBZ A;  2P3V A;  1G0I A;  5DW8 A;  3B8B A;  2WBD A;  2CZI A;  2GQ1 A;  2FHY A;  3LUZ A;  1IME A;  1NUZ A;  4GWW A;  5IZ1 A;  2FBP A;  2OX3 A;  1BK4 A;  1LEV A;  3RPL B;  1FBE A;  4GX3 A;  1IMA A;  3IFC A;  3KC1 A;  3D1R A;  3QMF A;  2P3N A;  4IR8 A;  2QVV A;  5EQ9 A;  4HE0 A;  4MJO A;  1FTA A;  1INP A;  1FBC A;  4H45 A;  1NV7 A;  5J16 A;  1NV4 A;  1LBW A;  4GWY A;  1KA1 A;  1VDW A;  4GWX A;  1SPI A; 
#chains in the Genus database with same CATH topology
 5H8S A;  3VFJ A;  4HXV A;  1A8E A;  4LAT A;  3OEM A;  1B3L A;  1LBY A;  1WVJ A;  3CIJ A;  1G0H A;  2XXT A;  3RPL A;  2Y5L A;  2XWV A;  3HST A;  4FED A;  1MRP A;  1N04 A;  3B6T A;  3ROJ A;  4HE1 A;  1Y1Z A;  1RDY A;  1EZ9 A;  4PFY A;  1B3G A;  2Z22 A;  3Q29 A;  3KN8 A;  4ZEK A;  4H0W A;  2O7I A;  4H5F A;  3D4G A;  4GWZ A;  4NF5 A;  3T9U A;  1Z7M E;  1MDP 1;  3LSF B;  1FPB A;  1B0H A;  3IJX B;  3Q28 A;  3U8Q A;  3P7I A;  4GL8 A;  5IKB A;  3UGW A;  2I4C A;  4OVR A;  4OVP A;  4YKP A;  3K00 A;  3PD8 A;  3RT8 A;  2RCB A;  2I48 A;  4FIM A;  4YKI A;  1NNP A;  3GBB A;  5AA4 B;  4NF6 A;  3PMV A;  3PUV E;  1ZIU A;  1SBP A;  4F22 A;  2UVJ A;  2OPE A;  3M3L A;  3ECR A;  3SZP A;  1CNQ A;  3UIF A;  3KSX A;  5ITP A;  1POT A;  4O8M A;  1OMP A;  2V3Q A;  3DEL B;  3PU5 A;  1D3K A;  3OO7 A;  3HFU A;  5HBC A;  3SEW A;  5ITO A;  4ELR A;  1AMF A;  2MKZ A;  2AL4 A;  1Q1K A;  4JSO A;  2QVV A;  2F78 A;  1QW0 A;  4PQJ A;  4HCW A;  2DOJ A;  4PBH A;  5LOM A;  4DZ1 A;  3I6V A;  2REJ A;  4KHZ E;  1FTL A;  2F36 A;  4MNC A;  5F1Q A;  1LGB C;  1LLS A;  3CRB A;  3VVD A;  3T9V A;  3E4R A;  5DTB A;  5JTY A;  3VVF A;  3ZS6 A;  2QS2 A;  5LDZ A;  2HFB A;  1JVY A;  1OVT A;  5FTI A;  1A54 A;  4EDP A;  5JK4 A;  2FIX A;  3W9V A;  1N3W A;  3B6Q A;  1XVY A;  1NUY A;  1LBZ A;  1H3D A;  4GVO A;  4N6P A;  1NMU A;  1NI9 A;  1RDZ A;  3OEL A;  2XXW A;  4R6Y A;  1CE2 A;  4G8H A;  1IMC A;  2PFZ A;  4P9K A;  4LZ8 A;  3BBR A;  4UAB A;  3ONM A;  4YKK A;  1NH8 A;  4JWY A;  3GYY A;  3KGC A;  2RKM A;  1DTG A;  4GX6 A;  2I0B A;  1MY0 A;  1MY3 A;  5EQA A;  2FNC A;  3S2V A;  3T66 A;  3V83 A;  1B0L A;  3T1B A;  3GZG A;  4R75 A;  3UK4 A;  2I3W A;  2PYY A;  4NED A;  5CC2 A;  5I56 A;  5DW8 A;  4GOT A;  2E0S A;  2XXP A;  2Q2C A;  4F3G A;  3W9W A;  4LZ5 A;  5AA3 A;  2Z8D A;  3KOS A;  2G29 A;  2H25 A;  3H6V A;  4ZS9 A;  2QMX A;  5I2N B;  1MY4 A;  4F39 A;  2UYF A;  5FHN A;  4NN3 A;  4YKJ A;  4F29 A;  4F3S A;  2H5Y A;  2DVC A;  4H1X A;  4JWO A;  2QS3 A;  4KR5 A;  1UTB B;  3DP8 A;  3RUM A;  3V8X B;  3PUX E;  1BP5 A;  2XWO A;  3IOU A;  3S9L C;  3HHG A;  4EUO A;  3PPO A;  3VVE A;  3H6W A;  2O84 X;  3GXA A;  3RQT A;  4PF6 A;  3O29 A;  3FZV A;  3LSX A;  4EF2 A;  1JVX A;  3UN6 A;  2OLB A;  3JYR A;  4PE5 B;  5DVI A;  2ABH A;  4HE2 A;  5T3J A;  3FGS A;  1B5H A;  3MP1 A;  4FEB A;  5EYG A;  2AYS A;  2OZZ A;  3HN0 A;  2THI A;  2GHB A;  5ICT A;  4GFR A;  3RY3 A;  4MX6 A;  1QKA A;  3NOH A;  4N91 A;  2O6A A;  5CRY A;  2PFY A;  3VLW A;  2QJE A;  3RNN A;  4LQ2 A;  1FPJ A;  3MVW A;  3PMW A;  1B2H A;  4NHB A;  4RPN A;  2RCA A;  3OEN A;  2XX8 A;  3IB2 A;  2NWJ A;  4R73 A;  3VV5 A;  2E1S A;  1EYI A;  1B1H A;  1N7W A;  3EKI A;  1FQC A;  1ZJL A;  3O6H A;  4X8R A;  2RF1 A;  5H8F B;  5CMC A;  2WBD A;  3K6W A;  2GQ1 A;  2FHY A;  1SYI A;  4R74 A;  1URD A;  1O63 A;  1LFH A;  3IOV A;  3PTY A;  3RPL B;  4ZEI A;  3N6T A;  3UOR A;  4N15 A;  4OTE A;  1MPB A;  3G3F A;  3VLV A;  1XOC A;  1DPP A;  1JP4 A;  1Y3N A;  2XX7 A;  2VT5 A;  1NNK A;  2X7Q A;  4ECF A;  2ZZX A;  1YAE A;  2XXV A;  4R9G A;  4XIG Q;  4FEC A;  2Q74 A;  2PBW A;  1RKM A;  5K2X A;  3K4U A;  2QFL A;  1N84 A;  2O68 A;  3USD A;  1UTH B;  4PFU A;  1IQ7 A;  3MAM A;  3FJ7 A;  4PTK A;  3H03 A;  4XXU A;  2NVU B;  2O51 A;  3K2D A;  4PFB A;  1GGG A;  2CEX A;  3E9X A;  4RK9 A;  4U21 A;  1Y3P A;  3KG2 A;  3PUW E;  3Q27 A;  5KCJ A;  1F9B A;  3KN3 A;  3BKI B;  1SI1 A;  5EQ8 A;  2DP8 A;  4PFI A;  1SW5 A;  1QUI A;  5H8F A;  2ZNT A;  1RDX A;  2ZZV A;  4GF8 A;  4E0W A;  2B4L A;  3D4C A;  1NNT A;  4QFO A;  1NV6 A;  2PT2 A;  4LQ5 A;  3PPR A;  1BIY A;  3EHT A;  4M4G A;  3AXF A;  1B58 A;  1JET A;  3B8B A;  3OSQ A;  1MXW A;  2F7B A;  2Y7P A;  1DMB A;  1SD3 A;  4XTC Q;  3OXN A;  5AA1 A;  5I7I A;  1FTA A;  1T0K A;  2F7C A;  2ESN A;  2V3T A;  1R9L A;  4GWX A;  4P1L A;  4Q5T A;  4PAK A;  1KZ8 A;  3JV9 A;  4N13 A;  4PFT A;  1I6B A;  2L5V A;  4N6K A;  5TU0 A;  4F2Q A;  3BIG A;  4EQ7 A;  1ATG A;  1B51 A;  1NH7 A;  3QUJ A;  2PX1 A;  3I5O A;  2W7Y A;  1US4 A;  1M5E A;  3IX1 A;  1MXU A;  1MY2 A;  5TP9 B;  2A5S A;  4QSE A;  2VP1 A;  4BDR A;  4P0I A;  2LAO A;  4YIC A;  2BJJ X;  1IUD A;  2YPN A;  3VXB A;  4TOZ A;  1YXI A;  3DM0 A;  3VXC A;  4MBP A;  3O6I A;  1IIT A;  3PGF A;  4GL0 A;  3U92 A;  1LAH E;  5I84 A;  4DE8 A;  4PET A;  2IA4 A;  3DP4 A;  2P2A A;  3FAT A;  1EH3 A;  3FVN A;  1XI6 A;  2CZK A;  1MDQ A;  2D5W A;  4LP2 B;  4QBA A;  1LBX A;  2VD2 A;  1NUX A;  3HHF A;  4BDM A;  1P1Q A;  3FIR A;  4N8G A;  3CFX A;  4R2B A;  2REG A;  5TPA B;  3OMB A;  4XKQ A;  1UIU A;  1YZ0 A;  4YU0 A;  3RLF E;  1XHY A;  2WX9 A;  5CMB A;  5BWJ A;  2UVI A;  2DE3 A;  1ZTY A;  3V5A A;  1FQE A;  5I3S A;  1FQD A;  3TCH A;  1G0I A;  2F97 A;  3TEL A;  4NG7 A;  3TOD A;  5DEX A;  1OQH A;  1Y4T A;  2QS1 A;  3MJN A;  3QMF A;  2HXR A;  4MJO A;  3UA8 A;  1FBC A;  1R9Q A;  3U94 A;  5B70 A;  1M5C A;  3K1N A;  1L5T A;  1JEU A;  3CSB A;  5EQ7 A;  2XD2 A;  5LTC A;  4HCY A;  1GV8 A;  1GR2 A;  3GBA A;  4N4U A;  3G3K A;  3MVX A;  3MWB A;  3OO8 A;  1AWB A;  1MQH A;  4PP0 A;  3MPL A;  5ET7 A;  3FXQ A;  5L9M A;  2DWI A;  3FV1 A;  1Q35 A;  3TTL A;  1FRP A;  3R7X A;  1B6H A;  3H3G A;  1NFT A;  1FPL A;  2O1M A;  4ND9 A;  2Q88 A;  4PBQ A;  4I9D A;  1Q9D A;  4G2Z A;  3FBP A;  3BIH A;  3FVK A;  2B4M A;  2OBG A;  2A5T A;  5TPA A;  1FBD A;  5JTY B;  1HSE A;  3O6G A;  4PGN A;  4PFW A;  4RYA A;  3N6U A;  2Y7I A;  4MNI A;  5F24 A;  4ZE8 A;  3BFU A;  3WAF A;  4QF9 A;  3KFM A;  1IXG A;  4GBV A;  2Z8E A;  1PBQ A;  5H8H A;  3M3F A;  3TMG A;  5A5L A;  4ZEC A;  1D9V A;  3HPI A;  1DBZ A;  1IMF A;  2F6P A;  3KBZ A;  1JEV A;  4JVI A;  4Z7E A;  2CZI A;  1LBC A;  3N5L A;  1BLF A;  3IO6 A;  3TFL A;  4NF8 A;  3LSL A;  3DLN A;  1PB8 A;  3PPP A;  3CI8 A;  1IMA A;  5H8Q B;  1B7Z A;  1B3E A;  3B6W A;  5F7V A;  1DPE A;  4BDO A;  4O3A A;  4IGT A;  5J16 A;  1NV4 A;  4GWY A;  4NF5 B;  3IOR A;  5I2N A;  5FHO A;  5EHS A;  4LN5 A;  4C0R A;  3K02 A;  1A99 A;  4JVD A;  4LUB A;  1TFD A;  3ILU B;  4DCY A;  1B3F A;  2OPD A;  2PVU A;  4C1U A;  4KQP A;  4Q8R A;  3KC0 A;  3EN3 A;  5ELV A;  4Q0C A;  1URS A;  2H99 A;  3T0J A;  5CBS A;  4ESW A;  4WKM A;  1FTO A;  4O94 A;  5AA2 D;  2XXU A;  5HM4 B;  4FJP A;  3H06 B;  2Z8F A;  4EXK A;  1MQG A;  1FJ6 A;  4KD5 A;  2ONS A;  1DK4 A;  2ZNU A;  2GFE A;  4OER A;  1K9Y A;  2B65 A;  2I58 A;  1IXH A;  1Y20 A;  4H6D A;  3FAS A;  1FBP A;  4DI3 D;  3EF7 A;  1FQB A;  4FAJ A;  3OSR A;  1FPI A;  4EQ9 A;  2V84 A;  1I69 A;  4AQ4 A;  4FBP A;  1BKA A;  2P1S A;  3FUZ A;  3TDJ A;  1MG1 A;  5I58 A;  1LCT A;  4KCD A;  4MNP A;  3EHU A;  1S9T A;  5I2K A;  1D9Y A;  1NUZ A;  4GWW A;  4Q30 B;  2V25 A;  3EPE A;  3CSG A;  3U1O A;  3I3V A;  2P3N A;  1SQY A;  2CZL A;  1ANF A;  3HO7 A;  1A40 A;  3SDF A;  3A29 A;  4G68 A;  3BFT A;  2F7A A;  3C34 A;  5ICQ A;  1PBP A;  5JEI A;  5TP9 A;  4G61 A;  4AS4 A;  2AIX A;  1UIV A;  4OMB A;  4PE3 A;  2D21 A;  3MZ9 A;  4OZ9 A;  1WDN A;  4OFL A;  4PAF A;  1BTJ A;  1MXZ A;  1CB6 A;  1Y1M A;  1B7H A;  4F2O A;  1IXI A;  3QXM A;  1HSL A;  2F8D A;  3TAJ A;  3OOA A;  4GBW A;  4JB7 A;  2HHM A;  1VFD A;  4IO5 A;  3MZ1 A;  3IOT A;  4FE8 A;  1ZLQ A;  2O7U A;  1SW2 A;  3SET A;  2QSX A;  4GLI A;  4MH5 A;  4HW8 A;  3G7W A;  1MXX A;  2ZXT A;  3ZKK A;  1II5 A;  5IZZ A;  1S50 A;  4DDD A;  1H45 A;  4KPT A;  4GXS B;  3KOT A;  3LUY A;  1O7T A;  5IZ3 B;  3S9M C;  3KBR A;  1LCF A;  5I2K B;  2JJK A;  4MEV A;  2DYX A;  4QFN A;  4MF3 A;  1DOT A;  3RGY A;  4IY5 A;  1B05 A;  1A8F A;  4R6H A;  4TLL B;  1P99 A;  4ZE9 A;  1PB7 A;  3R26 A;  2O69 A;  3KC1 A;  4U2R A;  5EQ9 A;  1NNF A;  3RPW A;  4HE0 A;  5H8N A;  1NV7 A;  3PPQ A;  2XXR A;  2XXQ A;  2DVZ A;  2I49 A;  4P0G A;  4OEU A;  4XKR A;  1P1N A;  3FJM A;  5DEX B;  4ZZE A;  1FPE A;  5ISU A;  1K9Z A;  2F3B A;  5L8D A;  2BJI A;  2HZK A;  1B5I A;  2CMO A;  4PF8 A;  2UVH A;  3KEI A;  4DXU A;  3MC2 A;  5KZT A;  4GWS A;  4P11 A;  2DE2 A;  4MIJ A;  4PDH A;  1IMD A;  3KJT A;  3U72 A;  3TQL A;  3FVO A;  3IAZ A;  5IZ3 A;  3FV2 A;  1MQD A;  1UTH A;  2G93 A;  1D4N A;  3C33 A;  1J1N A;  3PPN A;  5DYH A;  2HCA A;  4OWD A;  1LB8 A;  1LAX A;  1MH4 A;  3MP6 A;  4YMB A;  3B7D A;  4H46 A;  3CFZ A;  3IR1 A;  2V93 A;  3ZSF A;  2OWS A;  3E79 A;  3O66 A;  3PUY E;  1A7L A;  5A5X B;  4LA9 A;  3IK6 B;  4GD5 A;  4XKN A;  2P3V A;  1SYH A;  4HS7 A;  2DWJ A;  4P1E A;  4BLA A;  4YB6 A;  5IZ1 A;  3TTR A;  1LEV A;  1UQW A;  4NWD A;  1OQG A;  4OET A;  5FTH A;  3D1R A;  4OFJ A;  3LSW A;  3PMX A;  3K0V A;  1INP A;  2Z23 A;  1AH5 A;  2PMS A;  4I62 A;  1POY 1;  4WEP A;  1YPN A;  4PC9 A;  2VGQ A;  2UYE A;  1FQA A;  2UXA A;  1PB9 A;  3TTK A;  2OWZ A;  4IGR A;  1IZ1 A;  4GIZ A;  4YZZ A;  3KZG A;  4OYV A;  2GH9 A;  4BDQ A;  4Z0I A;  1JW1 A;  2Q89 A;  1SVX B;  2RIN A;  4PAI A;  2WEF A;  1USY E;  1QUL A;  4NX1 A;  1LBB A;  3Q25 A;  2VOZ A;  2HAV A;  1LFI A;  2DXY A;  3WAE A;  4KYS A;  1MM6 A;  4U1O A;  2ONR A;  4IO2 A;  5I58 B;  3G3J A;  1HSJ A;  3O9P A;  5ET5 A;  5I57 A;  4DI4 B;  1QVS A;  1SW4 A;  4OVQ A;  3RTW B;  1P1O A;  3IOW A;  5J1D A;  3C4M A;  1D9Q A;  4OVT A;  2YJP A;  3MZB A;  4OEV A;  4OEN A;  5AA4 A;  1FBE A;  3TPA A;  3SEU A;  1TXF A;  1UTB A;  2XXY A;  2ALU A;  2RC7 A;  4G68 C;  4BDL A;  1VDW A;  3KJ7 A;  1XVX A;  3K1M A;  3TCG A;  4JVC A;  3C31 A;  3U93 A;  4P3L A;  1ZMG A;  2QPQ A;  3OD7 A;  1DSN A;  1I6Q A;  4I3E A;  1B4Z A;  4H65 A;  4P8B A;  4X1B A;  4ELP A;  3HCQ A;  1RYX A;  2H9B A;  4MMP A;  5H8Q A;  4NF8 B;  2GHA A;  4IO4 A;  4JWX A;  1ZBM A;  3SEX A;  2QRY A;  2R6G E;  1IIW A;  5ET6 A;  2D3I A;  2XXK A;  4I8C A;  4NWC A;  3QIM A;  4GWU A;  4F3P A;  1FTK A;  3SEV A;  2QVR A;  1US5 A;  1Y4C A;  1FTM A;  2Y7R A;  4POX A;  4G4P A;  4GRK A;  4BDN A;  4U23 A;  2XXH A;  1B7U A;  5DVJ A;  2VPN A;  2HZL A;  3CVG A;  4OES A;  1B32 A;  1GTK A;  5L9S A;  3MUQ A;  4EXL A;  4ONY A;  1Y9U A;  2F3D A;  1TT1 A;  2Q8J A;  3EHS A;  4LON B;  2O1L A;  1BK4 A;  2WYK A;  4TLM B;  4P47 A;  3TCF A;  3H7M A;  3K01 A;  1M5B A;  4ELO A;  4NF6 B;  4IB2 A;  3T96 B;  3CR9 A;  2Q9T A;  4K3F A;  1SPI A;  4QSD A;  1P1W A;  4G8M A;  1LAF E;  2ZYM A;  2FIE A;  4JSD A;  4QFP A;  1JQF A;  1I6A A;  4N81 A;  1EZO A;  4H67 A;  3MVZ A;  1TWY A;  3N26 A;  2V3U A;  2DDK A;  4KYD A;  3H4Z A;  1B46 A;  4IO7 A;  3FD3 A;  4LZ7 A;  5ESY A;  2ZNS A;  4N8Y A;  3M8U A;  4U4X A;  1FPD A;  4KCC A;  2PT1 A;  2Y84 A;  4MLV A;  4ZZA A;  1N7X A;  3THI A;  1B52 A;  5I59 B;  2DQV A;  2QS4 A;  4C1T A;  3RN8 A;  4ESX A;  3ILT B;  3K6X A;  4UAC A;  4F1V A;  2NOO A;  2WBB A;  3G3G A;  2XA5 A;  4YMA A;  1XT8 A;  3TTN A;  3MBP A;  4F31 B;  3G3I A;  4O7I A;  3C9H A;  3HV1 A;  1SDX A;  3M3K A;  2FVZ A;  3V89 B;  1NV1 A;  3TUS A;  4L17 A;  5IGA A;  5ET8 A;  2HAU A;  2VHA A;  3G3H A;  2B3F A;  3CHG A;  4DXC A;  2QMW A;  1OIB A;  4YAH X;  1YTV A;  4PDD A;  3KSJ A;  4RJZ A;  3LUZ A;  1IME A;  2NXO A;  3TEP A;  3ODB A;  5AA2 B;  3IO4 A;  2I6E A;  4UA8 A;  1WOD A;  4OQO A;  4GXA A;  2F5X A;  1H43 A;  4FOR A;  2KLF A;  4PFR A;  4ELQ A;  3CG1 A;  2R9J A;  3CG3 A;  1B3H A;  4RNS A;  2HEU A;  5CMM A;  1LST A;  4N17 A;  4OVJ A;  1YCJ A;  1USY H;  2HQ0 A;  4ZEB A;  4I3Y A;  1NV5 A;  1OLA A;  4X48 A;  2NUV A;  3K6V A;  2I4B A;  1JW4 A;  4QSC A;  5KDT B;  3OEK A;  3ZKL A;  4KXP A;  4THI A;  4GQO A;  1LBV A;  3IB1 A;  4H8I A;  3O97 A;  3C36 A;  1FBF A;  4O3C A;  5CMK A;  1QUK A;  2A5T B;  4G77 A;  2CZH A;  4X04 A;  4N07 A;  4OAN A;  4OVS A;  4NQ8 A;  1FBG A;  2ZYK A;  3L6H A;  1ZKB A;  3PUZ E;  5FHM A;  5IM2 A;  4G68 B;  1MQI A;  3RT6 B;  3K1P A;  5DVF A;  5I56 B;  1N3X A;  3OO9 A;  4F1U A;  3T9H B;  2ZMB A;  5KCJ B;  2F34 A;  4WXJ A;  3C35 A;  2DWH A;  4OXV A;  4R6K A;  4YB5 A;  1QJM A;  2XXI A;  2XXX A;  5I57 B;  4LVQ A;  5CBR A;  3LR1 A;  2FBP A;  2OX3 A;  2QL3 A;  4U1Z A;  3UP9 A;  4R9F A;  3PV0 E;  3SKP A;  1O64 A;  1FTJ A;  4MCO A;  1P1U A;  3A3U A;  3QK6 A;  4MLQ A;  4M1V A;  4DXB A;  4H45 A;  1PDA A;  1H44 A;  2OK2 A;  4R2F A;  3IFC A;  2QVU A;  1JW5 A;  4RA1 A;  1S7Y A;  4TQU Q;  4IO3 A;  2FYI A;  3MYU A;  3FJG A;  5K2Y A;  2V4C A;  1KWH A;  4DLD A;  2X7P A;  4AS5 A;  2GRV A;  2OCU A;  1ZU0 A;  3TKD A;  5H8N B;  3VDF A;  4R72 A;  1NV3 A;  5B7D A;  1NUW A;  1MH3 A;  2IEE A;  4NF0 A;  2X26 A;  1OVB A;  1M5F A;  2FA7 A;  2DS9 A;  1IMB A;  1FJ9 A;  1PC3 A;  4NF4 A;  2I0C A;  2XD3 A;  4QRZ A;  2ZYO A;  3FXR A;  4HTG A;  4NMY A;  1QGX A;  2ZYN A;  4MHF A;  1FPG A;  3FVG A;  2XX9 A;  3F11 A;  4F18 A;  1NV0 A;  3VE1 B;  4I1D A;  2PCR A;  3B50 A;  1N0T A;  4GX4 A;  3GLB A;  1EU8 A;  4ZDM A;  1VSO A;  1FPF A;  4XKP A;  2DSF A;  1FPK A;  4RPO A;  1MXY A;  1FQF A;  2B3B A;  3MW0 A;  3QAX A;  3U65 A;  4OHN A;  1EZP A;  2M8C A;  5KDT A;  1TFA A;  3OO6 A;  5M2V A;  4GX3 A;  3QSL A;  3TTM A;  5HPQ A;  3A3C A;  4PCD A;  3O2A A;  1XC1 A;  5AA2 A;  1Y3Q A;  4IR8 A;  4P56 A;  2WKY A;  1N76 A;  4NGU A;  4X9T A;  3KN7 A;  3T9X B;  1XS5 A;  1LBW A;  4QHQ A;  1MPD A;  3T93 B;  1A55 A;  1VR5 A;  4ZEF A;  3CFL A;  2XWK A;  5AE4 A;  4NE4 A;  4IO6 A;  5EHM A;  1FBH A;  2H4I A;  1YYZ A;  1FSA A;  2HPG A;  4EQB A;  1B9J A;  1B5J A;  1AL3 A;  2HXW A;  5IAI A;  3PD9 A;  3W15 C;  1KA0 A;  4NF4 B;  4JDF A;  4MFI A;  3N94 A;  4U22 A;  3LV0 A;  3JZJ A;  2AL5 A;  2I3V A;  3IB0 A;  1MQJ A;  2Q8M A;  1QUJ A;  2H98 A;  3TYH A;  5BUU A;  3RTF B;  2ANJ A;  3MPK A;  1DTZ A;  5L9O A;  3IL1 B;  1ELJ A;  1PEB A;  3TQW A;  2Y7W A;  2VPO A;  3DP6 A;  5DT6 A;  3LC8 A;  1QKB A;  4U4S A;  1MY1 A;  3MP8 A;  4DIG A;  1FCK A;  1H76 A;  2ONK E;  2Y5K A;  3E13 X;  2XWI A;  4QFK A;  1NKX A;  4EF1 A;  4O3B A;  2F35 A;  5I5P A;  3SES A;  1EYJ A;  2DWA A;  5I59 A;  4NTL A;  2R71 A;  4DCX A;  3MST A;  4XF5 A;  3E3K A;  4KYE A;  3QUF A;  3TZA A;  3FXB A;  2YLN A;  1FW0 A;  2P0S A;  2ZZW A;  4AB5 A;  1OLC A;  4KI0 E;  4MAG A;  1MM7 A;  2RC9 A;  3H6U A;  1Z7N E;  1MXV A;  1JNF A;  1MS7 A;  4H8J A;  4ISU A;  4OFO A;  5FBP A;  3MQ9 A;  4POW A;  2RC8 A;  1B4H A;  4KFQ A;  5EYH A;  1URG A;  4QFL A;  1IXC A;  3QYT A;  1R1N A;  4YB7 A;  4E0X A;  1RYO A;  4F3B A;  2R8T A;  3IFA A;  3T22 A;  3O28 A;  2DE4 A;  3RYD A;  4F1Y A;  4RY1 A;  3L6G A;  4WED A;  5CM6 A;  1MPC A;  2CEY A;  3K6U A;  1M5D A;  5EYF A;  4I40 A;  1R6Z A;  2KQZ A;  4QXD A;  2WYP A;  2OWT A;  2F6G A;  4RXL A;  5CI5 A;  2VD3 A;  1B1X A;  3S9E A;  1LB9 A;  3MVY A;  1VE4 A;  2OJT A;  1AOV A;  1IEJ A;  1LFG A;  4JBZ A;  3LBS A;  1NV2 A;  4O7M A;  4FAT A;  5A5X A;  4F19 A;  3H6T A;  1GVC A;  1DCU A;  3VLU A;  3FXU A;  4X1D A;  1B40 A;  4RK2 A;  4XFE A;  1EYK A;  3SEY A;  2Y7K A;  3EQ1 A;  3Q26 A;  4GWO A;  4AB6 A;  4N6D A;  5H8H B;  1SW1 A;  4JXI A;  3E78 A;  3ISP A;  2KR0 A;  1AIV A;  3C32 A;  2DXR A;  1VFE A;  3A09 A;  3IJO B;  1LAG E;  4PGP A;  2Q2A A;  4G8N A;  4NAP A;  4H5G A;  1NL5 A;  2XHD A;  3S4U A;  1SI0 A;  4IY6 A;  3R6U A;  4XEQ A;  4ZED A;  3S9N C;  4OA4 A;  1KA1 A;  2UVG A;  3SER A; 
#chains in the Genus database with same CATH homology
 1JP4 A;  2QVU A;  3A29 A;  4N17 A;  4HXV A;  1KZ8 A;  4PAK A;  2VT5 A;  2FIE A;  5EQ7 A;  4MNC A;  4I3Y A;  2L5V A;  1NV5 A;  2XWK A;  4HCY A;  2XWO A;  4N6K A;  5LTC A;  3BIG A;  5FBP A;  4JVC A;  1LBY A;  1FPE A;  4N81 A;  4G61 A;  1G0H A;  3MYU A;  4AS4 A;  1K9Z A;  1FBH A;  2ZZX A;  2F3B A;  4PC9 A;  3RPL A;  4LN5 A;  2Y5L A;  2V4C A;  4N4U A;  4P1L A;  5EYH A;  1YYZ A;  2XWV A;  4P3L A;  2BJI A;  4PF6 A;  2HZK A;  4PE3 A;  2Q74 A;  1FSA A;  2HPG A;  2OWZ A;  4AS5 A;  2QPQ A;  4JVD A;  4PF8 A;  2DDK A;  1AWB A;  4PAF A;  2QFL A;  3ROJ A;  1NV3 A;  4HE1 A;  1KA0 A;  1NUW A;  4YZZ A;  2R8T A;  5ET7 A;  4I3E A;  1RDY A;  4HE2 A;  5T3J A;  5LDZ A;  3IFA A;  4KXP A;  4GWS A;  4P8B A;  4NF0 A;  2DE4 A;  3RYD A;  4F18 A;  3KC0 A;  2DE2 A;  3LV0 A;  4MIJ A;  4PDH A;  5ESY A;  1IMD A;  1LBV A;  5JK4 A;  5CM6 A;  2FIX A;  5EYG A;  4PTK A;  3T0J A;  2CEY A;  4I40 A;  3W9V A;  4N8Y A;  2Q8M A;  4MMP A;  4PAI A;  4YIC A;  4GBW A;  2WEF A;  1FRP A;  4GWZ A;  1IMB A;  1FJ9 A;  4O94 A;  1FBF A;  2KQZ A;  4QXD A;  1NUY A;  1LBZ A;  2HHM A;  2WYP A;  4NX1 A;  1FPL A;  1YXI A;  4X8R A;  1FPB A;  5IZ3 A;  4MX6 A;  2CZH A;  4PBQ A;  4PFB A;  1NI9 A;  5ET6 A;  2CEX A;  3NOH A;  1RDZ A;  4X04 A;  1FPD A;  2XXK A;  4N91 A;  4OAN A;  1Q9D A;  4OVS A;  4NQ8 A;  4PET A;  1IMC A;  2PFY A;  1FBG A;  1FJ6 A;  3FBP A;  2PFZ A;  3BIH A;  4P9K A;  1DK4 A;  1QGX A;  4UAB A;  2VPO A;  2B4M A;  4MHF A;  1FBD A;  1XI6 A;  5IZZ A;  4GWU A;  5EQ8 A;  1FPG A;  4PFI A;  2CZK A;  4QBA A;  4OVR A;  5IM2 A;  2QVR A;  4OVP A;  1LBX A;  1FPJ A;  4NHB A;  1NUX A;  1K9Y A;  4PGN A;  4F1V A;  4O7M A;  1NV2 A;  2WBB A;  5ET5 A;  3GYY A;  1RDX A;  4N8G A;  2ZZV A;  4F19 A;  2XA5 A;  5IZ3 B;  1DCU A;  1NV0 A;  2Y5K A;  4MNI A;  4GX6 A;  2PCR A;  5F24 A;  2B4L A;  2XWI A;  4DI4 B;  3B50 A;  4H46 A;  1FBP A;  5EQA A;  4DI3 D;  4GX4 A;  4GBV A;  4OVQ A;  3E79 A;  1FPI A;  1NV6 A;  5I5P A;  1YZ0 A;  1EYJ A;  4F1U A;  4O7I A;  2JJK A;  4XFE A;  3T1B A;  1EYK A;  2VPN A;  4FBP A;  1FPF A;  2FVZ A;  2WX9 A;  1NV1 A;  3SZP A;  1CNQ A;  2HZL A;  5A5L A;  5IGA A;  1EYI A;  5ET8 A;  4MEV A;  5J1D A;  3MST A;  2DE3 A;  1DBZ A;  1FPK A;  1IMF A;  4XF5 A;  3EKI A;  1D9Q A;  5I3S A;  3CHG A;  4O8M A;  3U65 A;  2F3D A;  3KBZ A;  2P3V A;  4N6D A;  2V3Q A;  4MNP A;  1G0I A;  4JVI A;  5DW8 A;  4OVT A;  3B8B A;  3E78 A;  2WBD A;  2CZI A;  2GQ1 A;  3ISP A;  3FXB A;  2FHY A;  4NG7 A;  4P1E A;  4PDD A;  2KR0 A;  2Q9T A;  3LUZ A;  1IME A;  3HFU A;  1NUZ A;  4GWW A;  5IZ1 A;  2ZZW A;  2FBP A;  2OX3 A;  3W9W A;  1BK4 A;  3PTY A;  1LEV A;  3RPL B;  2WYK A;  1FBE A;  4GX3 A;  4P47 A;  4MAG A;  4PCD A;  4N15 A;  2MKZ A;  1IMA A;  3IFC A;  3KC1 A;  3D1R A;  3QMF A;  4MCO A;  2P3N A;  2HXR A;  4IR8 A;  2QVV A;  2F5X A;  4PGP A;  5EQ9 A;  4NAP A;  4HE0 A;  4P56 A;  4MJO A;  5I7I A;  1FTA A;  4M1V A;  1INP A;  1FBC A;  4NGU A;  4PFR A;  4H45 A;  4NN3 A;  1NV7 A;  4X9T A;  5J16 A;  4XEQ A;  1NV4 A;  4HCW A;  4OA4 A;  1LBW A;  4PBH A;  4GWY A;  1KA1 A;  2DVZ A;  1VDW A;  4GWX A;  1SPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...