3IFAA

Human muscle fructose-1,6-bisphosphatase e69q mutant in complex with amp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
326
Chain Sequence
TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVDQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 113
structure length 326
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3ifaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3ifaA02
1IMAA 5EQ9A 3BIGA 1FBCA 2OWZA 2F3BA 1FBFA 4I3EA 5I3SA 2P3NA 5IZ1A 3KC1A 2BJIA 1DBZA 1FTAA 2FIXA 3IFAA 5T3JA 1NUZA 1FBEA 3KC0A 1FJ6A 1JP4A 2R8TA 3B8BA 1YYZA 2F3DA 5A5LA 3LUZA 4IR8A 1KA1A 3ROJA 1D9QA 2FBPA 4GWZA 2QVUA 1NUXA 4GX3A 2Q8MA 5J16A 1IMEA 5DW8A 5F24A 1NUWA 1NV5A 2FHYA 4O7IA 1FPFA 1LBVA 1LBXA 1CNQA 4GBWA 1IMFA 4GX4A 2WBDA 4HE2A 4FBPA 4MJOA 1YZ0A 2CZKA 1NV7A 5ET7A 1YXIA 3D1RA 1LBWA 3LV0A 4GWXA 1XI6A 4GWWA 1DCUA 1FPJA 1VDWA 1QGXA 4GWUA 4N81A 4KXPA 1FBHA 4HE1A 4H45A 2PCRA 4QXDA 4I3YA 1RDXA 1FJ9A 5EYHA 1INPA 1G0IA 3A29A 1LBYA 1IMDA 1LEVA 1RDZA 4H46A 2GQ1A 2WEFA 1RDYA 1K9YA 1Q9DA 2CZHA 2HHMA 5ESYA 3BIHA 1EYKA 1IMCA 1BK4A 1FBPA 1FPBA 5EQ7A 1KA0A 1NV4A 1FPKA 2QVRA 3KBZA 1FBDA 2VT5A 2WBBA 5IZ3B 3T0JA 3FBPA 5EYGA 4I40A 1IMBA 1FRPA 4AS5A 4GWSA 1LBZA 1DK4A 2P3VA 3RPLB 1NV2A 5ET5A 5ET6A 1FPEA 2CZIA 5ET8A 2FVZA 5EQAA 2FIEA 2OX3A 1NV0A 5EQ8A 1FSAA 1NV6A 4HE0A 1NI9A 1SPIA 4HXVA 1AWBA 1NV3A 1FBGA 1K9ZA 4G61A 2JJKA 1FPLA 5IZ3A 2Q74A 2Y5LA 3IFCA 1EYJA 1FPIA 1NV1A 2QVVA 1EYIA 3RPLA 1G0HA 4GX6A 1FPGA 4GBVA 3QMFA 4PTKA 2Y5KA 2QFLA 5FBPA 5LDZA 3RYDA 1KZ8A 2DDKA 1NUYA 4GWYA 4AS4A 1FPDA
chains in the Genus database with same CATH superfamily
3BIGA 1SW2A 3PMWA 3G3HA 1BLFA 1FBFA 4G2ZA 2WKYA 3LC8A 2LAOA 4G68B 1Q35A 2XXPA 4R6HA 1OVBA 4O3CA 1B5JA 3TCFA 4GWZA 3OO9A 1MXUA 2V3QA 5FTIA 4DCYA 4GX4A 4OMBA 3MBPA 4DXBA 2H5YA 4MJOA 3PV0E 3B50A 4GLIA 3TAJA 4GWWA 4F3GA 2I49A 5IM2A 5H8SA 4MX6A 1UTHB 1XVXA 5ITPA 3TYHA 1B52A 3FIRA 4JSOA 3PUWE 1MDQA 4XEQA 3OEKA 1LSTA 4EQBA 3KSJA 3ZKKA 3QIMA 5L9MA 1FBDA 3MVWA 1BKAA 3G7WA 4MLQA 4OVSA 1LBZA 1NV2A 3H06B 4Q5TA 3PPOA 2CZIA 1SI0A 3UA8A 4G8HA 4OVJA 3T9HB 4MBPA 4ZS9A 4U1OA 3RLFE 4P0GA 3KZGA 3C31A 2V84A 3U94A 1N04A 3CRBA 3PPRA 4MHFA 4POWA 4OANA 1URSA 1XHYA 4ELPA 1NH7A 1LBCA 5J1DA 5A5XA 3ODBA 3ILUB 3G3FA 1FQEA 3K6UA 2ZXTA 1A54A 1WVJA 4YKKA 4JSDA 4R6KA 1SDXA 2OZZA 2HZLA 4MNPA 1NMUA 3IO4A 2P0SA 4IO3A 2DQVA 4PFYA 2F5XA 2QVUA 2XHDA 1B5IA 4DXCA 3MPKA 3IOTA 2FYIA 1R9QA 4O7IA 4F39A 4MCOA 1OQHA 3N6TA 3PUVE 1DTGA 4X8RA 1LAGE 4OZ9A 2F6PA 1N0TA 4G68A 2YPNA 4M1VA 4E0WA 2DE2A 3IORA 3PD8A 2E1SA 4MLVA 1PBPA 2R9JA 3HV1A 3FATA 2G29A 3P7IA 1MXYA 4GXAA 3TTRA 2OPDA 3ZKLA 1P99A 4YB6A 4U4XA 1ZJLA 2V93A 3GBBA 5F1QA 2XWKA 4O3BA 5CBSA 3KBZA 1GGGA 2WBBA 2ZZXA 1GVCA 1IMBA 1PC3A 4C1TA 4UACA 4PCDA 4LQ5A 3R6UA 1UTHA 4F2OA 5KDTB 3T22A 4RJZA 1QJMA 4PC9A 3MP8A 1AMFA 4RXLA 1B7HA 4KYEA 3B7DA 1O64A 1VR5A 2QS4A 4ZECA 3I6VA 2ZYKA 5H8HB 1A40A 2IA4A 1FPGA 1B05A 5L9OA 1B7ZA 1ZBMA 2RCAA 1F9BA 4ELOA 4R6YA 5CI5A 4PQJA 3UP9A 2Y7IA 2P3NA 4Q0CA 3IB2A 3VVDA 3SKPA 2RKMA 4N8YA 3M3FA 2BJJX 4GIZA 3IK6B 4KHZE 1L5TA 1MM7A 1TFDA 3ROJA 1ZMGA 2R71A 1NUXA 3CHGA 3VLUA 4QFOA 3EHUA 4FE8A 2RC8A 3FUZA 3MZ1A 1TFAA 2Q2AA 4MNCA 4EQ7A 4N6DA 1YZ0A 4N6PA 3UIFA 2I48A 3TCHA 2REJA 4WEPA 2DS9A 2A5TB 3T66A 4MIJA 3W9WA 2QRYA 4BDRA 2Y7RA 1IEJA 2ZNTA 3E4RA 1MQDA 2GH9A 3H6TA 3Q26A 5FHNA 3FVOA 1BK4A 4MEVA 4RA1A 1MH3A 1SBPA 1MY1A 4I40A 2RCBA 1WDNA 3S9NC 5I5PA 5ET8A 4OFOA 1JVYA 2L5VA 3QYTA 4DXUA 1OLCA 2VPOA 3MC2A 3EF7A 2P2AA 1JVXA 2RC9A 1IUDA 3E79A 5I84A 4KFQA 1FBGA 3LUYA 3IFCA 4MH5A 1EYJA 4ZEFA 3N26A 2QVVA 3FVGA 2NVUB 2P1SA 4ELQA 2XXVA 1O7TA 5CC2A 5ISUA 5KDTA 2XXUA 4FEBA 1IXHA 1FBEA 1B4ZA 4KPTA 4H0WA 5H8HA 3LUZA 1CE2A 3MZBA 3KN8A 4N8GA 4WXJA 1DTZA 4N91A 2XXKA 1FPFA 5HBCA 3LR1A 3A3CA 4R74A 3M8UA 1IXGA 4BDOA 5AA2B 2OK2A 2XD3A 1BTJA 4OXVA 5IAIA 2AL4A 2CMOA 1VDWA 3OO8A 3RPWA 3VFJA 3OD7A 4N81A 1YAEA 3O66A 2PCRA 4P56A 1RDXA 2PFYA 1FTKA 2QPQA 1B6HA 2ALUA 4MMPA 3H4ZA 3QUJA 4TLLB 1B5HA 4QFNA 2XX7A 1SYHA 1NV4A 1N3WA 2A5TA 4L17A 1M5DA 1OLAA 1H44A 2DXYA 4OESA 5BUUA 4MAGA 3N6UA 4N6KA 1FPIA 4XKNA 2VP1A 4IGTA 2V4CA 5CM6A 1ZU0A 5B70A 1OIBA 2ESNA 1M5BA 3K1PA 3FXQA 2ZZWA 5EQ9A 4F31B 2Y84A 4Z7EA 2O68A 1MXWA 4I3EA 2I3WA 3KOSA 4N07A 4YU0A 3IFAA 4LQ2A 2B3BA 2F78A 4FAJA 2XXIA 4IY6A 4IR8A 4H65A 1URDA 2Q8MA 3U72A 5J16A 4LZ8A 2HCAA 2PFZA 2XA5A 4OYVA 1FTMA 1H43A 1P1QA 1SQYA 1NV7A 1D3KA 3PTYA 3TPAA 3OXNA 1XC1A 1LCTA 2ONSA 1B7UA 4NWDA 3FD3A 3IB0A 4JXIA 1DCUA 1FCKA 3B6WA 4AB6A 2Y7WA 4KXPA 2O1LA 3IR1A 4I3YA 3BFUA 2RINA 1B9JA 2QJEA 2YLNA 4KR5A 4YMAA 3O2AA 2CZHA 5AA2A 4QFPA 1EYKA 3MUQA 2ABHA 4OA4A 4ZEDA 2DOJA 2UVJA 4N17A 1DPEA 3KG2A 3O9PA 1ZLQA 4PFTA 3T1BA 4IO5A 3E3KA 3LSWA 4I9DA 4THIA 3RTWB 1DMBA 1QVSA 3SESA 4U4SA 3DELB 1US5A 3M3LA 1DOTA 1H3DA 5FTHA 4E0XA 3I5OA 2YJPA 3B6TA 2ANJA 3MSTA 4U22A 3T96B 2GRVA 1I6BA 5LDZA 4F29A 4OEUA 3SEYA 2O69A 1TWYA 2HXWA 4C1UA 3OO6A 1SI1A 4O94A 2UYEA 4OEVA 3S2VA 1HSJA 1GV8A 1S9TA 1CB6A 4QSCA 3ECRA 3VE1B 2HFBA 2I58A 4YB5A 4ZZEA 4G8MA 4P1LA 3CG3A 3KJ7A 1LB9A 1MY2A 2FHYA 3O6HA 3K2DA 3H7MA 1A7LA 1SVXB 4OQOA 4F3PA 4O3AA 4YAHX 1JEVA 4OENA 3SZPA 3FASA 2H99A 4ND9A 2ONKE 4ISUA 4F1VA 4UABA 3DLNA 4JWOA 2QVRA 3USDA 1NNPA 2VOZA 5ET5A 4YZZA 2PBWA 5JTYB 2FVZA 3V5AA 5EQ8A 1H76A 4BDNA 4N13A 1BIYA 3O97A 4PAKA 4MFIA 1NL5A 2Q74A 1LAHE 2DE4A 4NGUA 5L8DA 3VLVA 2Z8DA 4WEDA 2AIXA 3VXBA 2QFLA 4F1YA 4ESXA 1RKMA 1PDAA 2ZZVA 3CI8A 3GYYA 3EHTA 1D4NA 2AYSA 3JV9A 3SETA 4OHNA 5KCJB 4EXLA 2NXOA 3ILTB 2R8TA 3ISPA 5A5LA 3C35A 1D9VA 1KA1A 2B4LA 1D9QA 2HQ0A 5DVIA 5JK4A 4GL0A 2O1MA 5TPAB 5EHMA 4QFLA 4HS7A 4PFWA 2M8CA 1MG1A 1LB8A 2O51A 1FTOA 4PDHA 3KN3A 3FZVA 2F35A 2QMXA 2CZKA 4P1EA 4R2FA 3RN8A 4XIGQ 4N15A 3RQTA 1MQGA 2DYXA 2H98A 2OWSA 4QXDA 1MXVA 3K00A 1MXZA 1P1WA 1LBBA 2Y7PA 3MYUA 5EHSA 1MQHA 4O7MA 2I4BA 2PX1A 1NNTA 2H4IA 4DI4B 3CFZA 1B3GA 3U92A 3FXUA 4GVOA 4QBAA 4U1ZA 3PUXE 1SW5A 4F3SA 3RY3A 1FTJA 3MP1A 1NV6A 3IX1A 4RY1A 3ZSFA 3OOAA 1N76A 1JW5A 2A5SA 4RK2A 5LOMA 3V8XB 4P47A 4EF1A 3H3GA 2VD2A 1XS5A 3BKIB 1YCJA 1NV1A 3N94A 1EYIA 3FXRA 4GX6A 3NOHA 4R72A 1MPDA 2F97A 1B3FA 2HZKA 2ZYMA 2XX8A 5JTYA 5ICTA 3PPNA 1FPDA 4U21A 1P1OA 3SEVA 3JYRA 3ONMA 4XF5A 3KC0A 1LLSA 1MY3A 2XWIA 1Y20A 1B58A 3E9XA 1DPPA 4ZZAA 4ZEIA 2CEYA 3U8QA 4R75A 4PF8A 3R26A 4GX3A 4JVDA 1IMEA 1N7WA 3IOWA 3TEPA 1LBXA 1S7YA 2WBDA 3D4CA 3TMGA 4LP2B 5KCJA 1PB9A 2ZNSA 3FJMA 4NAPA 2Y7KA 3H6WA 4NEDA 2ZMBA 5TPAA 4H45A 2XXHA 3VXCA 5EYHA 1IMDA 1LEVA 2ZYOA 3QAXA 4XKQA 3SEXA 4RPOA 1FBPA 1US4A 4LN5A 4NG7A 1FPKA 3F11A 4OETA 4PE3A 5M2VA 3T9UA 1AIVA 3R7XA 4OWDA 1UQWA 1Y3QA 1B0LA 4RYAA 1PEBA 3S4UA 5DT6A 5EQAA 2FIEA 3IOUA 1NV0A 1FQAA 3GBAA 1SPIA 4GFRA 3T9VA 2Z8EA 3MQ9A 4WKMA 5I2NB 1Y9UA 3CSGA 3HPIA 1EZPA 3V89B 4PAFA 3PMXA 3RYDA 3D4GA 2DVCA 5I59B 4U2RA 2QS3A 4GQOA 3RTFB 5AA2D 1OQGA 1SW4A 1NUZA 3MZ9A 4G77A 2DP8A 4H8JA 5H8FB 1MDP1 3TELA 3PD9A 3Q27A 4ZDMA 3CFXA 5ITOA 1URGA 2NOOA 3DM0A 3PUZE 3IJXB 4EXKA 2Q89A 4PFBA 4NHBA 4Z0IA 3H6VA 4LVQA 3RNNA 3O29A 1Y3PA 2V25A 2B3FA 2NUVA 4GF8A 5L9SA 4DDDA 3K1MA 3RGYA 4IO6A 1MQJA 3C32A 3C9HA 1LCFA 1USYE 1XI6A 1EH3A 1QGXA 3PPPA 1IQ7A 2RF1A 4BDQA 1FBHA 2V3TA 2G93A 3SDFA 3TTLA 1LBYA 2GHBA 1AL3A 4X04A 1Q9DA 3BFTA 4YKPA 2ZYNA 3K4UA 1OMPA 3KN7A 3EN3A 5IZ3B 1MY0A 5EYGA 1RYXA 4YKIA 3RPLB 4U23A 4LONB 1B3HA 4X48A 4JVIA 5CMMA 3H6UA 2Z23A 3IOVA 4I1DA 3V83A 2O84X 4FJPA 3C36A 1NNFA 5DVFA 1G0HA 1POY1 2XXRA 4FECA 2XXYA 1HSLA 2F36A 4IB2A 1O63A 3G3IA 2DXRA 2OWZA 1PB7A 4DZ1A 2FIXA 5I2NA 4QSDA 1Y1ZA 4UA8A 4ZE8A 1YYZA 1LGBC 1QUIA 4JVCA 2XXXA 3CFLA 5DW8A 3WAFA 4F1UA 5I59A 1UIUA 4ZEKA 5ELVA 3TFLA 1SW1A 4Q30B 5H8FA 4ZE9A 3WAEA 5CMCA 4LZ7A 4OVRA 3LV0A 1LBWA 2X26A 2QMWA 5CMBA 2OLBA 3MVXA 1MH4A 4IY5A 4ELRA 1R1NA 3VDFA 3G3GA 3A29A 3OMBA 2DWAA 1Y3NA 3THIA 1EZOA 2GQ1A 1B4HA 3EKIA 1S50A 4F18A 1UIVA 5EQ7A 3FVKA 5H8NB 1B3LA 2VT5A 1LFHA 2QS2A 4IO7A 4XKRA 2GFEA 5I2KB 3FJ7A 1JQFA 2P3VA 2CEXA 3KJTA 4BDMA 5IZZA 3KOTA 3K6WA 5I58B 1RYOA 2NWJA 1YPNA 1MQIA 4HXVA 1P1UA 1MRPA 4KCDA 4IO4A 5IZ3A 4F3BA 4LA9A 3LSXA 4XXUA 3FJGA 3RPLA 3QMFA 4JBZA 2HAUA 5DYHA 3K01A 1KZ8A 4GWYA 2V3UA 4PFRA 2I4CA 1FBCA 4NF4B 2H25A 3KC1A 4POXA 2BJIA 4OVTA 3OSRA 2PVUA 2D3IA 1A55A 4RNSA 3FV1A 2UVGA 4F2QA 1M5CA 2I0CA 1ELJA 3E13X 4FIMA 4H1XA 1NV5A 3CVGA 4I62A 4HW8A 1CNQA 5LTCA 5KZTA 1PBQA 4QFKA 1M5FA 4OTEA 5ET7A 4GRKA 3SERA 2VD3A 3S9MC 1J1NA 1GTKA 2H9BA 2XWOA 3HO7A 5HPQA 3TQWA 3S9LC 2XX9A 2F8DA 4AQ4A 4JDFA 4GD5A 1K9YA 3TTMA 1FPBA 2OPEA 1QW0A 4ONYA 2Q8JA 2UVIA 4EQ9A 2HXRA 3FBPA 4KCCA 1FRPA 1DK4A 4LATA 4LZ5A 3JZJA 2VGQA 2XXQA 4MNIA 4H8IA 1N7XA 1MPCA 2O6AA 5K2YA 5H8NA 4P11A 4XKPA 3N5LA 1LAXA 1VFEA 4OFLA 5I2KA 4FEDA 3UGWA 5I58A 5FBPA 2PYYA 2DDKA 4QSEA 4AS4A 1XVYA 4M4GA 1FW0A 5EYFA 3SEUA 4AB5A 5I3SA 2PMSA 4QRZA 2OWTA 2QS1A 3PU5A 3GLBA 2F3DA 3HCQA 1QUKA 4IO2A 3QSLA 1MS7A 3CG1A 3KFMA 4H6DA 4NN3A 3FVNA 4EDPA 5F24A 5AA3A 1NUWA 2HPGA 5I7IA 1LBVA 2AL5A 4NF4A 4NF8B 3MW0A 3VV5A 4R73A 1WODA 4XTCQ 4FBPA 3CSBA 1R6ZA 1YTVA 4OFJA 3IAZA 2F6GA 3L6HA 4NTLA 3GXAA 4BLAA 3B6QA 4PFUA 2DWHA 2DWIA 4NX1A 2IEEA 1FQFA 4R9GA 3TQLA 3K6XA 1MPBA 1AH5A 4ESWA 4KD5A 5FHOA 3M3KA 1Z7NE 1QKBA 3IB1A 5ET6A 4YB7A 1FPEA 3MWBA 3MVYA 3KBRA 1Y1MA 5BWJA 1USYH 1B2HA 5ICQA 1NI9A 4GWOA 3IO6A 2Q9TA 1R9LA 3S9EA 5H8QB 3UORA 4PFIA 3DP6A 3K02A 4OVPA 3C4MA 3K6VA 1Q1KA 1ZKBA 1QULA 3MJNA 4PTKA 2Q2CA 4ZEBA 4YMBA 4QHQA 4TLMB 2F3BA 3C33A 3EQ1A 4NF0A 1FTAA 5CMKA 1N3XA 1Y4TA 2FBPA 2O7UA 3IJOB 3MP6A 3U1OA 3OSQA 3FXBA 3FV2A 3AXFA 5TU0A 1FQBA 1LFGA 5TP9B 1ATGA 2Z8FA 4Q8RA 1JEUA 1IXCA 4NE4A 4BDLA 4EF2A 2E0SA 4QF9A 1QUJA 3MVZA 4NMYA 2DE3A 1INPA 1G0IA 4NF8A 1RDZA 5I57B 1Z7ME 3Q28A 3UK4A 4IGRA 1OVTA 1N84A 1GR2A 3BIHA 2XXWA 3O6IA 2HEUA 1KA0A 4NF5B 4G68C 1KWHA 4FATA 3LSFB 1XT8A 4X9TA 4TOZA 3PGFA 1TT1A 5DVJA 2XWVA 4KQPA 4YKJA 4MF3A 2QSXA 1PB8A 4PBHA 3C34A 2PT2A 3RUMA 1AOVA 1B32A 1I69A 4HCWA 3K1NA 2QL3A 1K9ZA 3HSTA 3BBRA 4H5FA 1NFTA 1VFDA 1NUYA 2D21A 1UTBB 1IMAA 3GZGA 3O28A 5AE4A 3TKDA 3W9VA 5IZ1A 1FQDA 3DP8A 3VVFA 2REGA 1DBZA 1POTA 4C0RA 5H8QA 4DE8A 1FJ6A 2KR0A 3B8BA 1EZ9A 4O8MA 4OVQA 3FGSA 4XFEA 4I8CA 2KLFA 1B46A 2FA7A 1NKXA 2FNCA 4HE2A 3HFUA 2XD2A 2B4MA 2UYFA 2PT1A 4HTGA 4JB7A 3SEWA 1YXIA 5DEXB 3TCGA 3HHFA 2OJTA 1EU8A 4HCYA 3LSLA 5DTBA 3PMVA 4RK9A 3A3UA 2WEFA 1RDYA 3QK6A 1FTLA 4X1BA 3CR9A 3UN6A 5TP9A 4KYDA 2F7AA 1B1HA 1A8FA 2W7YA 4GXSB 4PE5B 5F7VA 5I57A 2I6EA 5JEIA 3H03A 4DLDA 1AWBA 4P3LA 1IZ1A 3MAMA 3U93A 2HAVA 4NF5A 1NV3A 5HM4B 2F7CA 4G61A 2JJKA 2Y5LA 4DCXA 4NQ8A 2KQZA 4PAIA 4FORA 1BP5A 2WX9A 1B51A 1MM6A 3Q29A 5T3JA 5AA4B 2Z22A 5AA1A 4GL8A 4YICA 1LAFE 3I3VA 5IKBA 1TXFA 5I56B 4H67A 2OCUA 1B1XA 4PGPA 1ZTYA 5CBRA 2VPNA 1UTBA 1DSNA 4PF6A 3QXMA 4KYSA 2CZLA 3D1RA 4GWXA 2DWJA 1T0KA 4NF6B 1FPJA 5IGAA 3T9XB 4P8BA 4F22A 4HE1A 1VSOA 2THIA 2VHAA 4EUOA 1FJ9A 5K2XA 1NH8A 3MPLA 1IITA 3KGCA 3OO7A 4N4UA 4P9KA 1SYIA 2GHAA 3DP4A 1FQCA 4PBQA 3T93B 3VLWA 5ESYA 3CIJA 1IMCA 1H45A 2WYPA 3G3KA 3W15C 5DEXA 3T0JA 5B7DA 4KI0E 4GWSA 4OERA 4TQUQ 3A09A 1I6QA 1A99A 2ZNUA 3QUFA 4NWCA 4DIGA 1MXXA 4PDDA 1I6AA 4P0IA 4RPNA 2DVZA 1SD3A 3EHSA 1A8EA 1HSEA 4R2BA 2Y5KA 3LBSA 3RT6B 2WYKA 3L6GA 1II5A 1B40A 5CRYA 3HN0A 2R6GE 1Y4CA 1JETA 3TUSA 4LUBA 3O6GA 3KSXA 4DI3D 4PGNA 2I3VA 1ANFA 1JP4A 2OBGA 2Q88A 4X1DA 3OENA 2O7IA 2XXTA 1MY4A 1P1NA 3TODA 3TTKA 3OEMA 4GBWA 4G8NA 1IMFA 4ECFA 3G3JA 5AA4A 1XOCA 1ZIUA 4H5GA 2ONRA 1QKAA 3EPEA 2RC7A 3KEIA 3IL1B 5I56A 3E78A 1IXIA 1JW1A 1M5EA 3TZAA 3TTNA 4GWUA 2UXAA 3K0VA 3TDJA 1B0HA 4H46A 2X7QA 2UVHA 1JW4A 2HHMA 4F19A 1NNKA 3PPQA 2F34A 4JWYA 4JWXA 1IIWA 3PUYE 1D9YA 3U65A 4NF6A 3RT8A 4K3FA 2MKZA 4AS5A 3HHGA 1VE4A 5A5XB 2X7PA 4GOTA 1LFIA 1JNFA 2OX3A 3VVEA 2B65A 1FSAA 4HE0A 2F7BA 2D5WA 3OELA 5FHMA 1FPLA 4PETA 4G4PA 4R9FA 4PP0A 4GBVA 2DSFA 3ZS6A 1B3EA 2I0BA 3Q25A
chains in the Genus database with same CATH topology
2ZZWA 5EQ9A 3BIGA 2F3BA 1FBFA 4I3EA 4NF0A 1FTAA 3IFAA 1NUZA 4IR8A 2FBPA 4GWZA 2Q8MA 5J16A 4PFBA 2PFZA 4NHBA 2V3QA 3FXBA 2XA5A 4GX4A 4MJOA 1NV7A 3B50A 3PTYA 1XI6A 4GWWA 1DCUA 1QGXA 5IM2A 4MX6A 4KXPA 1FBHA 4I3YA 2DE3A 1INPA 1G0IA 1LBYA 1RDZA 4X04A 1Q9DA 4XEQA 2CZHA 3BIHA 1EYKA 1KA0A 1FBDA 5IZ3B 4OA4A 5EYGA 4X9TA 4N17A 4OVSA 1LBZA 3RPLB 2XWVA 1NV2A 2CZIA 4JVIA 3T1BA 4PBHA 4HCWA 1K9ZA 4MHFA 4OANA 3MSTA 1G0HA 5J1DA 5LDZA 1NUYA 1IMAA 2OWZA 3W9VA 5IZ1A 4O94A 1DBZA 2FIXA 2HZLA 1FJ6A 2KR0A 3B8BA 4MNPA 4O8MA 1YYZA 4JVCA 4OVQA 4XFEA 2F5XA 4P1LA 2QVUA 5DW8A 4F1UA 2FHYA 4O7IA 4MCOA 4HE2A 3HFUA 2B4MA 4X8RA 1YXIA 4M1VA 4OVRA 3LV0A 1LBWA 2DE2A 4HCYA 3A29A 3SZPA 2GQ1A 2WEFA 1RDYA 3EKIA 2XWKA 4F18A 5EQ7A 4F1VA 4UABA 2QVRA 3KBZA 2WBBA 2VT5A 2ZZXA 1IMBA 4PCDA 2P3VA 5ET5A 2CEXA 4YZZA 5IZZA 2FVZA 5EQ8A 4PC9A 4HXVA 1AWBA 4P3LA 4PAKA 1NV3A 4G61A 2JJKA 5IZ3A 2Q74A 2Y5LA 2DE4A 4NGUA 4NQ8A 3RPLA 2KQZA 4PAIA 1FPGA 3QMFA 2QFLA 1KZ8A 4GWYA 2WX9A 2ZZVA 4PFRA 3GYYA 1FBCA 2P3NA 3KC1A 2BJIA 5T3JA 4N8YA 4OVTA 4YICA 2R8TA 3ISPA 5A5LA 1KA1A 3ROJA 1D9QA 2B4LA 4PGPA 1NUXA 3CHGA 5JK4A 2VPNA 1NV5A 4PF6A 1CNQA 5LTCA 4PDHA 4MNCA 4N6DA 1YZ0A 2CZKA 4P1EA 5ET7A 4N15A 3D1RA 4GWXA 4MIJA 3W9WA 2XWOA 1FPJA 5IGAA 4P8BA 4HE1A 4QXDA 1FJ9A 4N4UA 4P9KA 1K9YA 4PBQA 5ESYA 1FPBA 1IMCA 1BK4A 3MYUA 4MEVA 2WYPA 4O7MA 3T0JA 2HXRA 3FBPA 4DI4B 4I40A 1FRPA 4QBAA 4GWSA 1DK4A 5I5PA 5ET8A 2L5VA 1NV6A 2VPOA 4MNIA 3E79A 4PDDA 4P47A 1FBGA 2DVZA 3IFCA 1EYJA 1NV1A 2QVVA 1EYIA 4GX6A 3NOHA 2HZKA 2Y5KA 5FBPA 2DDKA 4AS4A 2WYKA 1FPDA 5I3SA 1FBEA 4XF5A 3KC0A 4DI3D 2XWIA 4PGNA 1JP4A 2F3DA 3LUZA 2CEYA 4N8GA 4NN3A 4PF8A 4GX3A 4JVDA 1IMEA 5F24A 1NUWA 2HPGA 2XXKA 4N91A 5I7IA 1FPFA 1LBVA 1LBXA 4GBWA 1IMFA 2WBDA 4FBPA 4NAPA 3E78A 4GWUA 1VDWA 4N81A 4H45A 2PCRA 4P56A 1RDXA 5EYHA 2PFYA 1IMDA 1LEVA 4H46A 4NX1A 2QPQA 2HHMA 4F19A 4MMPA 1FBPA 4LN5A 1NV4A 4NG7A 1FPKA 3U65A 2MKZA 4PE3A 4AS5A 5ET6A 1FPEA 5EQAA 2FIEA 2OX3A 1NV0A 1FSAA 4HE0A 1NI9A 1SPIA 4MAGA 2Q9TA 1FPLA 4N6KA 4PFIA 4PETA 1FPIA 4OVPA 2V4CA 5CM6A 4GBVA 4PTKA 4PAFA 3RYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMA A;  5EQ9 A;  3BIG A;  1FBC A;  2OWZ A;  2F3B A;  1FBF A;  4I3E A;  5I3S A;  2P3N A;  5IZ1 A;  3KC1 A;  2BJI A;  1DBZ A;  1FTA A;  2FIX A;  3IFA A;  5T3J A;  1NUZ A;  1FBE A;  3KC0 A;  1FJ6 A;  1JP4 A;  2R8T A;  3B8B A;  1YYZ A;  2F3D A;  5A5L A;  3LUZ A;  4IR8 A;  1KA1 A;  3ROJ A;  1D9Q A;  2FBP A;  4GWZ A;  2QVU A;  1NUX A;  4GX3 A;  2Q8M A;  5J16 A;  1IME A;  5DW8 A;  5F24 A;  1NUW A;  1NV5 A;  2FHY A;  4O7I A;  1FPF A;  1LBV A;  1LBX A;  1CNQ A;  4GBW A;  1IMF A;  4GX4 A;  2WBD A;  4HE2 A;  4FBP A;  4MJO A;  1YZ0 A;  2CZK A;  1NV7 A;  5ET7 A;  1YXI A;  3D1R A;  1LBW A;  3LV0 A;  4GWX A;  1XI6 A;  4GWW A;  1DCU A;  1FPJ A;  1VDW A;  1QGX A;  4GWU A;  4N81 A;  4KXP A;  1FBH A;  4HE1 A;  4H45 A;  2PCR A;  4QXD A;  4I3Y A;  1RDX A;  1FJ9 A;  5EYH A;  1INP A;  1G0I A;  3A29 A;  1LBY A;  1IMD A;  1LEV A;  1RDZ A;  4H46 A;  2GQ1 A;  2WEF A;  1RDY A;  1K9Y A;  1Q9D A;  2CZH A;  2HHM A;  5ESY A;  3BIH A;  1EYK A;  1IMC A;  1BK4 A;  1FBP A;  1FPB A;  5EQ7 A;  1KA0 A;  1NV4 A;  1FPK A;  2QVR A;  3KBZ A;  1FBD A;  2VT5 A;  2WBB A;  5IZ3 B;  3T0J A;  3FBP A;  5EYG A;  4I40 A;  1IMB A;  1FRP A;  4AS5 A;  4GWS A;  1LBZ A;  1DK4 A;  2P3V A;  3RPL B;  1NV2 A;  5ET5 A;  5ET6 A;  1FPE A;  2CZI A;  5ET8 A;  2FVZ A;  5EQA A;  2FIE A;  2OX3 A;  1NV0 A;  5EQ8 A;  1FSA A;  1NV6 A;  4HE0 A;  1NI9 A;  1SPI A;  4HXV A;  1AWB A;  1NV3 A;  1FBG A;  1K9Z A;  4G61 A;  2JJK A;  1FPL A;  5IZ3 A;  2Q74 A;  2Y5L A;  3IFC A;  1EYJ A;  1FPI A;  1NV1 A;  2QVV A;  1EYI A;  3RPL A;  1G0H A;  4GX6 A;  1FPG A;  4GBV A;  3QMF A;  4PTK A;  2Y5K A;  2QFL A;  5FBP A;  5LDZ A;  3RYD A;  1KZ8 A;  2DDK A;  1NUY A;  4GWY A;  4AS4 A;  1FPD A; 
#chains in the Genus database with same CATH topology
 3BIG A;  1SW2 A;  3PMW A;  3G3H A;  1BLF A;  1FBF A;  4G2Z A;  2WKY A;  3LC8 A;  2LAO A;  4G68 B;  1Q35 A;  2XXP A;  4R6H A;  1OVB A;  4O3C A;  1B5J A;  3TCF A;  4GWZ A;  3OO9 A;  1MXU A;  2V3Q A;  5FTI A;  4DCY A;  4GX4 A;  4OMB A;  3MBP A;  4DXB A;  2H5Y A;  4MJO A;  3PV0 E;  3B50 A;  4GLI A;  3TAJ A;  4GWW A;  4F3G A;  2I49 A;  5IM2 A;  5H8S A;  4MX6 A;  1UTH B;  1XVX A;  5ITP A;  3TYH A;  1B52 A;  3FIR A;  4JSO A;  3PUW E;  1MDQ A;  4XEQ A;  3OEK A;  1LST A;  4EQB A;  3KSJ A;  3ZKK A;  3QIM A;  5L9M A;  1FBD A;  3MVW A;  1BKA A;  3G7W A;  4MLQ A;  4OVS A;  1LBZ A;  1NV2 A;  3H06 B;  4Q5T A;  3PPO A;  2CZI A;  1SI0 A;  3UA8 A;  4G8H A;  4OVJ A;  3T9H B;  4MBP A;  4ZS9 A;  4U1O A;  3RLF E;  4P0G A;  3KZG A;  3C31 A;  2V84 A;  3U94 A;  1N04 A;  3CRB A;  3PPR A;  4MHF A;  4POW A;  4OAN A;  1URS A;  1XHY A;  4ELP A;  1NH7 A;  1LBC A;  5J1D A;  5A5X A;  3ODB A;  3ILU B;  3G3F A;  1FQE A;  3K6U A;  2ZXT A;  1A54 A;  1WVJ A;  4YKK A;  4JSD A;  4R6K A;  1SDX A;  2OZZ A;  2HZL A;  4MNP A;  1NMU A;  3IO4 A;  2P0S A;  4IO3 A;  2DQV A;  4PFY A;  2F5X A;  2QVU A;  2XHD A;  1B5I A;  4DXC A;  3MPK A;  3IOT A;  2FYI A;  1R9Q A;  4O7I A;  4F39 A;  4MCO A;  1OQH A;  3N6T A;  3PUV E;  1DTG A;  4X8R A;  1LAG E;  4OZ9 A;  2F6P A;  1N0T A;  4G68 A;  2YPN A;  4M1V A;  4E0W A;  2DE2 A;  3IOR A;  3PD8 A;  2E1S A;  4MLV A;  1PBP A;  2R9J A;  3HV1 A;  3FAT A;  2G29 A;  3P7I A;  1MXY A;  4GXA A;  3TTR A;  2OPD A;  3ZKL A;  1P99 A;  4YB6 A;  4U4X A;  1ZJL A;  2V93 A;  3GBB A;  5F1Q A;  2XWK A;  4O3B A;  5CBS A;  3KBZ A;  1GGG A;  2WBB A;  2ZZX A;  1GVC A;  1IMB A;  1PC3 A;  4C1T A;  4UAC A;  4PCD A;  4LQ5 A;  3R6U A;  1UTH A;  4F2O A;  5KDT B;  3T22 A;  4RJZ A;  1QJM A;  4PC9 A;  3MP8 A;  1AMF A;  4RXL A;  1B7H A;  4KYE A;  3B7D A;  1O64 A;  1VR5 A;  2QS4 A;  4ZEC A;  3I6V A;  2ZYK A;  5H8H B;  1A40 A;  2IA4 A;  1FPG A;  1B05 A;  5L9O A;  1B7Z A;  1ZBM A;  2RCA A;  1F9B A;  4ELO A;  4R6Y A;  5CI5 A;  4PQJ A;  3UP9 A;  2Y7I A;  2P3N A;  4Q0C A;  3IB2 A;  3VVD A;  3SKP A;  2RKM A;  4N8Y A;  3M3F A;  2BJJ X;  4GIZ A;  3IK6 B;  4KHZ E;  1L5T A;  1MM7 A;  1TFD A;  3ROJ A;  1ZMG A;  2R71 A;  1NUX A;  3CHG A;  3VLU A;  4QFO A;  3EHU A;  4FE8 A;  2RC8 A;  3FUZ A;  3MZ1 A;  1TFA A;  2Q2A A;  4MNC A;  4EQ7 A;  4N6D A;  1YZ0 A;  4N6P A;  3UIF A;  2I48 A;  3TCH A;  2REJ A;  4WEP A;  2DS9 A;  2A5T B;  3T66 A;  4MIJ A;  3W9W A;  2QRY A;  4BDR A;  2Y7R A;  1IEJ A;  2ZNT A;  3E4R A;  1MQD A;  2GH9 A;  3H6T A;  3Q26 A;  5FHN A;  3FVO A;  1BK4 A;  4MEV A;  4RA1 A;  1MH3 A;  1SBP A;  1MY1 A;  4I40 A;  2RCB A;  1WDN A;  3S9N C;  5I5P A;  5ET8 A;  4OFO A;  1JVY A;  2L5V A;  3QYT A;  4DXU A;  1OLC A;  2VPO A;  3MC2 A;  3EF7 A;  2P2A A;  1JVX A;  2RC9 A;  1IUD A;  3E79 A;  5I84 A;  4KFQ A;  1FBG A;  3LUY A;  3IFC A;  4MH5 A;  1EYJ A;  4ZEF A;  3N26 A;  2QVV A;  3FVG A;  2NVU B;  2P1S A;  4ELQ A;  2XXV A;  1O7T A;  5CC2 A;  5ISU A;  5KDT A;  2XXU A;  4FEB A;  1IXH A;  1FBE A;  1B4Z A;  4KPT A;  4H0W A;  5H8H A;  3LUZ A;  1CE2 A;  3MZB A;  3KN8 A;  4N8G A;  4WXJ A;  1DTZ A;  4N91 A;  2XXK A;  1FPF A;  5HBC A;  3LR1 A;  3A3C A;  4R74 A;  3M8U A;  1IXG A;  4BDO A;  5AA2 B;  2OK2 A;  2XD3 A;  1BTJ A;  4OXV A;  5IAI A;  2AL4 A;  2CMO A;  1VDW A;  3OO8 A;  3RPW A;  3VFJ A;  3OD7 A;  4N81 A;  1YAE A;  3O66 A;  2PCR A;  4P56 A;  1RDX A;  2PFY A;  1FTK A;  2QPQ A;  1B6H A;  2ALU A;  4MMP A;  3H4Z A;  3QUJ A;  4TLL B;  1B5H A;  4QFN A;  2XX7 A;  1SYH A;  1NV4 A;  1N3W A;  2A5T A;  4L17 A;  1M5D A;  1OLA A;  1H44 A;  2DXY A;  4OES A;  5BUU A;  4MAG A;  3N6U A;  4N6K A;  1FPI A;  4XKN A;  2VP1 A;  4IGT A;  2V4C A;  5CM6 A;  1ZU0 A;  5B70 A;  1OIB A;  2ESN A;  1M5B A;  3K1P A;  3FXQ A;  2ZZW A;  5EQ9 A;  4F31 B;  2Y84 A;  4Z7E A;  2O68 A;  1MXW A;  4I3E A;  2I3W A;  3KOS A;  4N07 A;  4YU0 A;  3IFA A;  4LQ2 A;  2B3B A;  2F78 A;  4FAJ A;  2XXI A;  4IY6 A;  4IR8 A;  4H65 A;  1URD A;  2Q8M A;  3U72 A;  5J16 A;  4LZ8 A;  2HCA A;  2PFZ A;  2XA5 A;  4OYV A;  1FTM A;  1H43 A;  1P1Q A;  1SQY A;  1NV7 A;  1D3K A;  3PTY A;  3TPA A;  3OXN A;  1XC1 A;  1LCT A;  2ONS A;  1B7U A;  4NWD A;  3FD3 A;  3IB0 A;  4JXI A;  1DCU A;  1FCK A;  3B6W A;  4AB6 A;  2Y7W A;  4KXP A;  2O1L A;  3IR1 A;  4I3Y A;  3BFU A;  2RIN A;  1B9J A;  2QJE A;  2YLN A;  4KR5 A;  4YMA A;  3O2A A;  2CZH A;  5AA2 A;  4QFP A;  1EYK A;  3MUQ A;  2ABH A;  4OA4 A;  4ZED A;  2DOJ A;  2UVJ A;  4N17 A;  1DPE A;  3KG2 A;  3O9P A;  1ZLQ A;  4PFT A;  3T1B A;  4IO5 A;  3E3K A;  3LSW A;  4I9D A;  4THI A;  3RTW B;  1DMB A;  1QVS A;  3SES A;  4U4S A;  3DEL B;  1US5 A;  3M3L A;  1DOT A;  1H3D A;  5FTH A;  4E0X A;  3I5O A;  2YJP A;  3B6T A;  2ANJ A;  3MST A;  4U22 A;  3T96 B;  2GRV A;  1I6B A;  5LDZ A;  4F29 A;  4OEU A;  3SEY A;  2O69 A;  1TWY A;  2HXW A;  4C1U A;  3OO6 A;  1SI1 A;  4O94 A;  2UYE A;  4OEV A;  3S2V A;  1HSJ A;  1GV8 A;  1S9T A;  1CB6 A;  4QSC A;  3ECR A;  3VE1 B;  2HFB A;  2I58 A;  4YB5 A;  4ZZE A;  4G8M A;  4P1L A;  3CG3 A;  3KJ7 A;  1LB9 A;  1MY2 A;  2FHY A;  3O6H A;  3K2D A;  3H7M A;  1A7L A;  1SVX B;  4OQO A;  4F3P A;  4O3A A;  4YAH X;  1JEV A;  4OEN A;  3SZP A;  3FAS A;  2H99 A;  4ND9 A;  2ONK E;  4ISU A;  4F1V A;  4UAB A;  3DLN A;  4JWO A;  2QVR A;  3USD A;  1NNP A;  2VOZ A;  5ET5 A;  4YZZ A;  2PBW A;  5JTY B;  2FVZ A;  3V5A A;  5EQ8 A;  1H76 A;  4BDN A;  4N13 A;  1BIY A;  3O97 A;  4PAK A;  4MFI A;  1NL5 A;  2Q74 A;  1LAH E;  2DE4 A;  4NGU A;  5L8D A;  3VLV A;  2Z8D A;  4WED A;  2AIX A;  3VXB A;  2QFL A;  4F1Y A;  4ESX A;  1RKM A;  1PDA A;  2ZZV A;  3CI8 A;  3GYY A;  3EHT A;  1D4N A;  2AYS A;  3JV9 A;  3SET A;  4OHN A;  5KCJ B;  4EXL A;  2NXO A;  3ILT B;  2R8T A;  3ISP A;  5A5L A;  3C35 A;  1D9V A;  1KA1 A;  2B4L A;  1D9Q A;  2HQ0 A;  5DVI A;  5JK4 A;  4GL0 A;  2O1M A;  5TPA B;  5EHM A;  4QFL A;  4HS7 A;  4PFW A;  2M8C A;  1MG1 A;  1LB8 A;  2O51 A;  1FTO A;  4PDH A;  3KN3 A;  3FZV A;  2F35 A;  2QMX A;  2CZK A;  4P1E A;  4R2F A;  3RN8 A;  4XIG Q;  4N15 A;  3RQT A;  1MQG A;  2DYX A;  2H98 A;  2OWS A;  4QXD A;  1MXV A;  3K00 A;  1MXZ A;  1P1W A;  1LBB A;  2Y7P A;  3MYU A;  5EHS A;  1MQH A;  4O7M A;  2I4B A;  2PX1 A;  1NNT A;  2H4I A;  4DI4 B;  3CFZ A;  1B3G A;  3U92 A;  3FXU A;  4GVO A;  4QBA A;  4U1Z A;  3PUX E;  1SW5 A;  4F3S A;  3RY3 A;  1FTJ A;  3MP1 A;  1NV6 A;  3IX1 A;  4RY1 A;  3ZSF A;  3OOA A;  1N76 A;  1JW5 A;  2A5S A;  4RK2 A;  5LOM A;  3V8X B;  4P47 A;  4EF1 A;  3H3G A;  2VD2 A;  1XS5 A;  3BKI B;  1YCJ A;  1NV1 A;  3N94 A;  1EYI A;  3FXR A;  4GX6 A;  3NOH A;  4R72 A;  1MPD A;  2F97 A;  1B3F A;  2HZK A;  2ZYM A;  2XX8 A;  5JTY A;  5ICT A;  3PPN A;  1FPD A;  4U21 A;  1P1O A;  3SEV A;  3JYR A;  3ONM A;  4XF5 A;  3KC0 A;  1LLS A;  1MY3 A;  2XWI A;  1Y20 A;  1B58 A;  3E9X A;  1DPP A;  4ZZA A;  4ZEI A;  2CEY A;  3U8Q A;  4R75 A;  4PF8 A;  3R26 A;  4GX3 A;  4JVD A;  1IME A;  1N7W A;  3IOW A;  3TEP A;  1LBX A;  1S7Y A;  2WBD A;  3D4C A;  3TMG A;  4LP2 B;  5KCJ A;  1PB9 A;  2ZNS A;  3FJM A;  4NAP A;  2Y7K A;  3H6W A;  4NED A;  2ZMB A;  5TPA A;  4H45 A;  2XXH A;  3VXC A;  5EYH A;  1IMD A;  1LEV A;  2ZYO A;  3QAX A;  4XKQ A;  3SEX A;  4RPO A;  1FBP A;  1US4 A;  4LN5 A;  4NG7 A;  1FPK A;  3F11 A;  4OET A;  4PE3 A;  5M2V A;  3T9U A;  1AIV A;  3R7X A;  4OWD A;  1UQW A;  1Y3Q A;  1B0L A;  4RYA A;  1PEB A;  3S4U A;  5DT6 A;  5EQA A;  2FIE A;  3IOU A;  1NV0 A;  1FQA A;  3GBA A;  1SPI A;  4GFR A;  3T9V A;  2Z8E A;  3MQ9 A;  4WKM A;  5I2N B;  1Y9U A;  3CSG A;  3HPI A;  1EZP A;  3V89 B;  4PAF A;  3PMX A;  3RYD A;  3D4G A;  2DVC A;  5I59 B;  4U2R A;  2QS3 A;  4GQO A;  3RTF B;  5AA2 D;  1OQG A;  1SW4 A;  1NUZ A;  3MZ9 A;  4G77 A;  2DP8 A;  4H8J A;  5H8F B;  1MDP 1;  3TEL A;  3PD9 A;  3Q27 A;  4ZDM A;  3CFX A;  5ITO A;  1URG A;  2NOO A;  3DM0 A;  3PUZ E;  3IJX B;  4EXK A;  2Q89 A;  4PFB A;  4NHB A;  4Z0I A;  3H6V A;  4LVQ A;  3RNN A;  3O29 A;  1Y3P A;  2V25 A;  2B3F A;  2NUV A;  4GF8 A;  5L9S A;  4DDD A;  3K1M A;  3RGY A;  4IO6 A;  1MQJ A;  3C32 A;  3C9H A;  1LCF A;  1USY E;  1XI6 A;  1EH3 A;  1QGX A;  3PPP A;  1IQ7 A;  2RF1 A;  4BDQ A;  1FBH A;  2V3T A;  2G93 A;  3SDF A;  3TTL A;  1LBY A;  2GHB A;  1AL3 A;  4X04 A;  1Q9D A;  3BFT A;  4YKP A;  2ZYN A;  3K4U A;  1OMP A;  3KN7 A;  3EN3 A;  5IZ3 B;  1MY0 A;  5EYG A;  1RYX A;  4YKI A;  3RPL B;  4U23 A;  4LON B;  1B3H A;  4X48 A;  4JVI A;  5CMM A;  3H6U A;  2Z23 A;  3IOV A;  4I1D A;  3V83 A;  2O84 X;  4FJP A;  3C36 A;  1NNF A;  5DVF A;  1G0H A;  1POY 1;  2XXR A;  4FEC A;  2XXY A;  1HSL A;  2F36 A;  4IB2 A;  1O63 A;  3G3I A;  2DXR A;  2OWZ A;  1PB7 A;  4DZ1 A;  2FIX A;  5I2N A;  4QSD A;  1Y1Z A;  4UA8 A;  4ZE8 A;  1YYZ A;  1LGB C;  1QUI A;  4JVC A;  2XXX A;  3CFL A;  5DW8 A;  3WAF A;  4F1U A;  5I59 A;  1UIU A;  4ZEK A;  5ELV A;  3TFL A;  1SW1 A;  4Q30 B;  5H8F A;  4ZE9 A;  3WAE A;  5CMC A;  4LZ7 A;  4OVR A;  3LV0 A;  1LBW A;  2X26 A;  2QMW A;  5CMB A;  2OLB A;  3MVX A;  1MH4 A;  4IY5 A;  4ELR A;  1R1N A;  3VDF A;  3G3G A;  3A29 A;  3OMB A;  2DWA A;  1Y3N A;  3THI A;  1EZO A;  2GQ1 A;  1B4H A;  3EKI A;  1S50 A;  4F18 A;  1UIV A;  5EQ7 A;  3FVK A;  5H8N B;  1B3L A;  2VT5 A;  1LFH A;  2QS2 A;  4IO7 A;  4XKR A;  2GFE A;  5I2K B;  3FJ7 A;  1JQF A;  2P3V A;  2CEX A;  3KJT A;  4BDM A;  5IZZ A;  3KOT A;  3K6W A;  5I58 B;  1RYO A;  2NWJ A;  1YPN A;  1MQI A;  4HXV A;  1P1U A;  1MRP A;  4KCD A;  4IO4 A;  5IZ3 A;  4F3B A;  4LA9 A;  3LSX A;  4XXU A;  3FJG A;  3RPL A;  3QMF A;  4JBZ A;  2HAU A;  5DYH A;  3K01 A;  1KZ8 A;  4GWY A;  2V3U A;  4PFR A;  2I4C A;  1FBC A;  4NF4 B;  2H25 A;  3KC1 A;  4POX A;  2BJI A;  4OVT A;  3OSR A;  2PVU A;  2D3I A;  1A55 A;  4RNS A;  3FV1 A;  2UVG A;  4F2Q A;  1M5C A;  2I0C A;  1ELJ A;  3E13 X;  4FIM A;  4H1X A;  1NV5 A;  3CVG A;  4I62 A;  4HW8 A;  1CNQ A;  5LTC A;  5KZT A;  1PBQ A;  4QFK A;  1M5F A;  4OTE A;  5ET7 A;  4GRK A;  3SER A;  2VD3 A;  3S9M C;  1J1N A;  1GTK A;  2H9B A;  2XWO A;  3HO7 A;  5HPQ A;  3TQW A;  3S9L C;  2XX9 A;  2F8D A;  4AQ4 A;  4JDF A;  4GD5 A;  1K9Y A;  3TTM A;  1FPB A;  2OPE A;  1QW0 A;  4ONY A;  2Q8J A;  2UVI A;  4EQ9 A;  2HXR A;  3FBP A;  4KCC A;  1FRP A;  1DK4 A;  4LAT A;  4LZ5 A;  3JZJ A;  2VGQ A;  2XXQ A;  4MNI A;  4H8I A;  1N7X A;  1MPC A;  2O6A A;  5K2Y A;  5H8N A;  4P11 A;  4XKP A;  3N5L A;  1LAX A;  1VFE A;  4OFL A;  5I2K A;  4FED A;  3UGW A;  5I58 A;  5FBP A;  2PYY A;  2DDK A;  4QSE A;  4AS4 A;  1XVY A;  4M4G A;  1FW0 A;  5EYF A;  3SEU A;  4AB5 A;  5I3S A;  2PMS A;  4QRZ A;  2OWT A;  2QS1 A;  3PU5 A;  3GLB A;  2F3D A;  3HCQ A;  1QUK A;  4IO2 A;  3QSL A;  1MS7 A;  3CG1 A;  3KFM A;  4H6D A;  4NN3 A;  3FVN A;  4EDP A;  5F24 A;  5AA3 A;  1NUW A;  2HPG A;  5I7I A;  1LBV A;  2AL5 A;  4NF4 A;  4NF8 B;  3MW0 A;  3VV5 A;  4R73 A;  1WOD A;  4XTC Q;  4FBP A;  3CSB A;  1R6Z A;  1YTV A;  4OFJ A;  3IAZ A;  2F6G A;  3L6H A;  4NTL A;  3GXA A;  4BLA A;  3B6Q A;  4PFU A;  2DWH A;  2DWI A;  4NX1 A;  2IEE A;  1FQF A;  4R9G A;  3TQL A;  3K6X A;  1MPB A;  1AH5 A;  4ESW A;  4KD5 A;  5FHO A;  3M3K A;  1Z7N E;  1QKB A;  3IB1 A;  5ET6 A;  4YB7 A;  1FPE A;  3MWB A;  3MVY A;  3KBR A;  1Y1M A;  5BWJ A;  1USY H;  1B2H A;  5ICQ A;  1NI9 A;  4GWO A;  3IO6 A;  2Q9T A;  1R9L A;  3S9E A;  5H8Q B;  3UOR A;  4PFI A;  3DP6 A;  3K02 A;  4OVP A;  3C4M A;  3K6V A;  1Q1K A;  1ZKB A;  1QUL A;  3MJN A;  4PTK A;  2Q2C A;  4ZEB A;  4YMB A;  4QHQ A;  4TLM B;  2F3B A;  3C33 A;  3EQ1 A;  4NF0 A;  1FTA A;  5CMK A;  1N3X A;  1Y4T A;  2FBP A;  2O7U A;  3IJO B;  3MP6 A;  3U1O A;  3OSQ A;  3FXB A;  3FV2 A;  3AXF A;  5TU0 A;  1FQB A;  1LFG A;  5TP9 B;  1ATG A;  2Z8F A;  4Q8R A;  1JEU A;  1IXC A;  4NE4 A;  4BDL A;  4EF2 A;  2E0S A;  4QF9 A;  1QUJ A;  3MVZ A;  4NMY A;  2DE3 A;  1INP A;  1G0I A;  4NF8 A;  1RDZ A;  5I57 B;  1Z7M E;  3Q28 A;  3UK4 A;  4IGR A;  1OVT A;  1N84 A;  1GR2 A;  3BIH A;  2XXW A;  3O6I A;  2HEU A;  1KA0 A;  4NF5 B;  4G68 C;  1KWH A;  4FAT A;  3LSF B;  1XT8 A;  4X9T A;  4TOZ A;  3PGF A;  1TT1 A;  5DVJ A;  2XWV A;  4KQP A;  4YKJ A;  4MF3 A;  2QSX A;  1PB8 A;  4PBH A;  3C34 A;  2PT2 A;  3RUM A;  1AOV A;  1B32 A;  1I69 A;  4HCW A;  3K1N A;  2QL3 A;  1K9Z A;  3HST A;  3BBR A;  4H5F A;  1NFT A;  1VFD A;  1NUY A;  2D21 A;  1UTB B;  1IMA A;  3GZG A;  3O28 A;  5AE4 A;  3TKD A;  3W9V A;  5IZ1 A;  1FQD A;  3DP8 A;  3VVF A;  2REG A;  1DBZ A;  1POT A;  4C0R A;  5H8Q A;  4DE8 A;  1FJ6 A;  2KR0 A;  3B8B A;  1EZ9 A;  4O8M A;  4OVQ A;  3FGS A;  4XFE A;  4I8C A;  2KLF A;  1B46 A;  2FA7 A;  1NKX A;  2FNC A;  4HE2 A;  3HFU A;  2XD2 A;  2B4M A;  2UYF A;  2PT1 A;  4HTG A;  4JB7 A;  3SEW A;  1YXI A;  5DEX B;  3TCG A;  3HHF A;  2OJT A;  1EU8 A;  4HCY A;  3LSL A;  5DTB A;  3PMV A;  4RK9 A;  3A3U A;  2WEF A;  1RDY A;  3QK6 A;  1FTL A;  4X1B A;  3CR9 A;  3UN6 A;  5TP9 A;  4KYD A;  2F7A A;  1B1H A;  1A8F A;  2W7Y A;  4GXS B;  4PE5 B;  5F7V A;  5I57 A;  2I6E A;  5JEI A;  3H03 A;  4DLD A;  1AWB A;  4P3L A;  1IZ1 A;  3MAM A;  3U93 A;  2HAV A;  4NF5 A;  1NV3 A;  5HM4 B;  2F7C A;  4G61 A;  2JJK A;  2Y5L A;  4DCX A;  4NQ8 A;  2KQZ A;  4PAI A;  4FOR A;  1BP5 A;  2WX9 A;  1B51 A;  1MM6 A;  3Q29 A;  5T3J A;  5AA4 B;  2Z22 A;  5AA1 A;  4GL8 A;  4YIC A;  1LAF E;  3I3V A;  5IKB A;  1TXF A;  5I56 B;  4H67 A;  2OCU A;  1B1X A;  4PGP A;  1ZTY A;  5CBR A;  2VPN A;  1UTB A;  1DSN A;  4PF6 A;  3QXM A;  4KYS A;  2CZL A;  3D1R A;  4GWX A;  2DWJ A;  1T0K A;  4NF6 B;  1FPJ A;  5IGA A;  3T9X B;  4P8B A;  4F22 A;  4HE1 A;  1VSO A;  2THI A;  2VHA A;  4EUO A;  1FJ9 A;  5K2X A;  1NH8 A;  3MPL A;  1IIT A;  3KGC A;  3OO7 A;  4N4U A;  4P9K A;  1SYI A;  2GHA A;  3DP4 A;  1FQC A;  4PBQ A;  3T93 B;  3VLW A;  5ESY A;  3CIJ A;  1IMC A;  1H45 A;  2WYP A;  3G3K A;  3W15 C;  5DEX A;  3T0J A;  5B7D A;  4KI0 E;  4GWS A;  4OER A;  4TQU Q;  3A09 A;  1I6Q A;  1A99 A;  2ZNU A;  3QUF A;  4NWC A;  4DIG A;  1MXX A;  4PDD A;  1I6A A;  4P0I A;  4RPN A;  2DVZ A;  1SD3 A;  3EHS A;  1A8E A;  1HSE A;  4R2B A;  2Y5K A;  3LBS A;  3RT6 B;  2WYK A;  3L6G A;  1II5 A;  1B40 A;  5CRY A;  3HN0 A;  2R6G E;  1Y4C A;  1JET A;  3TUS A;  4LUB A;  3O6G A;  3KSX A;  4DI3 D;  4PGN A;  2I3V A;  1ANF A;  1JP4 A;  2OBG A;  2Q88 A;  4X1D A;  3OEN A;  2O7I A;  2XXT A;  1MY4 A;  1P1N A;  3TOD A;  3TTK A;  3OEM A;  4GBW A;  4G8N A;  1IMF A;  4ECF A;  3G3J A;  5AA4 A;  1XOC A;  1ZIU A;  4H5G A;  2ONR A;  1QKA A;  3EPE A;  2RC7 A;  3KEI A;  3IL1 B;  5I56 A;  3E78 A;  1IXI A;  1JW1 A;  1M5E A;  3TZA A;  3TTN A;  4GWU A;  2UXA A;  3K0V A;  3TDJ A;  1B0H A;  4H46 A;  2X7Q A;  2UVH A;  1JW4 A;  2HHM A;  4F19 A;  1NNK A;  3PPQ A;  2F34 A;  4JWY A;  4JWX A;  1IIW A;  3PUY E;  1D9Y A;  3U65 A;  4NF6 A;  3RT8 A;  4K3F A;  2MKZ A;  4AS5 A;  3HHG A;  1VE4 A;  5A5X B;  2X7P A;  4GOT A;  1LFI A;  1JNF A;  2OX3 A;  3VVE A;  2B65 A;  1FSA A;  4HE0 A;  2F7B A;  2D5W A;  3OEL A;  5FHM A;  1FPL A;  4PET A;  4G4P A;  4R9F A;  4PP0 A;  4GBV A;  2DSF A;  3ZS6 A;  1B3E A;  2I0B A;  3Q25 A; 
#chains in the Genus database with same CATH homology
 2ZZW A;  5EQ9 A;  3BIG A;  2F3B A;  1FBF A;  4I3E A;  4NF0 A;  1FTA A;  3IFA A;  1NUZ A;  4IR8 A;  2FBP A;  4GWZ A;  2Q8M A;  5J16 A;  4PFB A;  2PFZ A;  4NHB A;  2V3Q A;  3FXB A;  2XA5 A;  4GX4 A;  4MJO A;  1NV7 A;  3B50 A;  3PTY A;  1XI6 A;  4GWW A;  1DCU A;  1QGX A;  5IM2 A;  4MX6 A;  4KXP A;  1FBH A;  4I3Y A;  2DE3 A;  1INP A;  1G0I A;  1LBY A;  1RDZ A;  4X04 A;  1Q9D A;  4XEQ A;  2CZH A;  3BIH A;  1EYK A;  1KA0 A;  1FBD A;  5IZ3 B;  4OA4 A;  5EYG A;  4X9T A;  4N17 A;  4OVS A;  1LBZ A;  3RPL B;  2XWV A;  1NV2 A;  2CZI A;  4JVI A;  3T1B A;  4PBH A;  4HCW A;  1K9Z A;  4MHF A;  4OAN A;  3MST A;  1G0H A;  5J1D A;  5LDZ A;  1NUY A;  1IMA A;  2OWZ A;  3W9V A;  5IZ1 A;  4O94 A;  1DBZ A;  2FIX A;  2HZL A;  1FJ6 A;  2KR0 A;  3B8B A;  4MNP A;  4O8M A;  1YYZ A;  4JVC A;  4OVQ A;  4XFE A;  2F5X A;  4P1L A;  2QVU A;  5DW8 A;  4F1U A;  2FHY A;  4O7I A;  4MCO A;  4HE2 A;  3HFU A;  2B4M A;  4X8R A;  1YXI A;  4M1V A;  4OVR A;  3LV0 A;  1LBW A;  2DE2 A;  4HCY A;  3A29 A;  3SZP A;  2GQ1 A;  2WEF A;  1RDY A;  3EKI A;  2XWK A;  4F18 A;  5EQ7 A;  4F1V A;  4UAB A;  2QVR A;  3KBZ A;  2WBB A;  2VT5 A;  2ZZX A;  1IMB A;  4PCD A;  2P3V A;  5ET5 A;  2CEX A;  4YZZ A;  5IZZ A;  2FVZ A;  5EQ8 A;  4PC9 A;  4HXV A;  1AWB A;  4P3L A;  4PAK A;  1NV3 A;  4G61 A;  2JJK A;  5IZ3 A;  2Q74 A;  2Y5L A;  2DE4 A;  4NGU A;  4NQ8 A;  3RPL A;  2KQZ A;  4PAI A;  1FPG A;  3QMF A;  2QFL A;  1KZ8 A;  4GWY A;  2WX9 A;  2ZZV A;  4PFR A;  3GYY A;  1FBC A;  2P3N A;  3KC1 A;  2BJI A;  5T3J A;  4N8Y A;  4OVT A;  4YIC A;  2R8T A;  3ISP A;  5A5L A;  1KA1 A;  3ROJ A;  1D9Q A;  2B4L A;  4PGP A;  1NUX A;  3CHG A;  5JK4 A;  2VPN A;  1NV5 A;  4PF6 A;  1CNQ A;  5LTC A;  4PDH A;  4MNC A;  4N6D A;  1YZ0 A;  2CZK A;  4P1E A;  5ET7 A;  4N15 A;  3D1R A;  4GWX A;  4MIJ A;  3W9W A;  2XWO A;  1FPJ A;  5IGA A;  4P8B A;  4HE1 A;  4QXD A;  1FJ9 A;  4N4U A;  4P9K A;  1K9Y A;  4PBQ A;  5ESY A;  1FPB A;  1IMC A;  1BK4 A;  3MYU A;  4MEV A;  2WYP A;  4O7M A;  3T0J A;  2HXR A;  3FBP A;  4DI4 B;  4I40 A;  1FRP A;  4QBA A;  4GWS A;  1DK4 A;  5I5P A;  5ET8 A;  2L5V A;  1NV6 A;  2VPO A;  4MNI A;  3E79 A;  4PDD A;  4P47 A;  1FBG A;  2DVZ A;  3IFC A;  1EYJ A;  1NV1 A;  2QVV A;  1EYI A;  4GX6 A;  3NOH A;  2HZK A;  2Y5K A;  5FBP A;  2DDK A;  4AS4 A;  2WYK A;  1FPD A;  5I3S A;  1FBE A;  4XF5 A;  3KC0 A;  4DI3 D;  2XWI A;  4PGN A;  1JP4 A;  2F3D A;  3LUZ A;  2CEY A;  4N8G A;  4NN3 A;  4PF8 A;  4GX3 A;  4JVD A;  1IME A;  5F24 A;  1NUW A;  2HPG A;  2XXK A;  4N91 A;  5I7I A;  1FPF A;  1LBV A;  1LBX A;  4GBW A;  1IMF A;  2WBD A;  4FBP A;  4NAP A;  3E78 A;  4GWU A;  1VDW A;  4N81 A;  4H45 A;  2PCR A;  4P56 A;  1RDX A;  5EYH A;  2PFY A;  1IMD A;  1LEV A;  4H46 A;  4NX1 A;  2QPQ A;  2HHM A;  4F19 A;  4MMP A;  1FBP A;  4LN5 A;  1NV4 A;  4NG7 A;  1FPK A;  3U65 A;  2MKZ A;  4PE3 A;  4AS5 A;  5ET6 A;  1FPE A;  5EQA A;  2FIE A;  2OX3 A;  1NV0 A;  1FSA A;  4HE0 A;  1NI9 A;  1SPI A;  4MAG A;  2Q9T A;  1FPL A;  4N6K A;  4PFI A;  4PET A;  1FPI A;  4OVP A;  2V4C A;  5CM6 A;  4GBV A;  4PTK A;  4PAF A;  3RYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...