4HXVA

Crystal structure of 3'(2'),5'-bisphosphate nucleotidase1 from entamoeba histolytica in complex with amp and metal ions
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
317
structure length
317
Chain Sequence
MSFDKELALALEIVQVSCKITTSVAEHTLTDQTQIKNDKSPVTVGDYSVQAYVNKKIHETFPEDQIVAEEDTKTIPEDIFAKVCKHVQIYSDMKDDEIRKSIDLGNSTGGKGRHWVLDPIDGTLGFLRREQYAVCLAFMIDGDIKVGVLGCPNFEGGLIVAAQKGCGAKMFSVNDIKNGKDIHVSTTPKTSDMCFCESVEVSHTDQSRSKTITERLQVTKPPVRMDSQCKYMAIASGRADVYLRLPRNLSYQEKIWDHAAGYLIVKEAGGKVTDIYGNDLDFSLGRTLCNNHGIVASNGILHEETVNVVKDVLSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3'(2'),5'-bisphosphate nucleotidase, putative
publication title Structural elucidation of a dual-activity PAP phosphatase-1 from Entamoeba histolytica capable of hydrolysing both 3'-phosphoadenosine 5'-phosphate and inositol 1,4-bisphosphate
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 103
structure length 317
sequence length 317
ec nomenclature ec 3.1.3.7: 3'(2'),5'-bisphosphate nucleotidase.
pdb deposition date 2012-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4hxvA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4hxvA02
5LDZA 1SPIA 4QXDA 3RPLA 2P3NA 4GBVA 4AS5A 1NUYA 1NV3A 5EQ8A 5EYHA 4KXPA 1LBZA 4GX6A 1IMFA 1NV5A 1DBZA 1FPDA 1K9YA 1FTAA 1FPGA 2Y5KA 4PTKA 2JJKA 3IFCA 4GX3A 5ESYA 3BIHA 2GQ1A 1NI9A 1FBDA 2P3VA 5I3SA 1IMDA 1RDZA 5ET7A 5IZ3A 3B8BA 5EQ9A 1DK4A 3LV0A 5EQAA 2BJIA 2CZHA 3ROJA 2QFLA 3RPLB 1LBYA 1LBXA 2FBPA 5ET8A 2Q8MA 3LUZA 5EYGA 4N81A 4O7IA 1FBHA 2PCRA 1IMBA 4GWXA 1FBFA 1FPEA 3QMFA 2WBBA 1FPLA 1EYJA 5DW8A 1FPFA 4IR8A 1FPKA 2FIEA 4FBPA 1EYIA 1IMEA 1LBVA 1NV7A 3FBPA 4GBWA 3BIGA 5IZ3B 4HE0A 4I40A 2Y5LA 3KC0A 1FBEA 4GWZA 5T3JA 1BK4A 1KA0A 2CZIA 3KC1A 2Q74A 4GWSA 1G0HA 1LBWA 1KZ8A 2QVUA 3A29A 2FVZA 1XI6A 1VDWA 1FBGA 1YXIA 2OWZA 2F3DA 4GWUA 2QVVA 3IFAA 5J16A 1NV6A 1FPIA 1FBCA 2F3BA 1RDXA 2HHMA 1FJ6A 5EQ7A 4GX4A 4HE1A 4GWYA 5ET5A 1IMAA 2FHYA 2WBDA 1FPBA 3KBZA 2DDKA 4MJOA 4I3EA 1FRPA 1D9QA 3D1RA 4AS4A 1IMCA 1CNQA 5IZ1A 5F24A 1KA1A 2FIXA 4GWWA 5ET6A 2VT5A 1NV2A 1DCUA 1NUWA 5A5LA 1FSAA 4G61A 1G0IA 2R8TA 1K9ZA 3RYDA 2QVRA 1YYZA 1INPA 1FBPA 1EYKA 1FJ9A 1NV4A 1Q9DA 4HXVA 1NV1A 2OX3A 1AWBA 1JP4A 1NUZA 4H46A 1RDYA 2CZKA 4H45A 4HE2A 2WEFA 1NUXA 1NV0A 3T0JA 1YZ0A 1QGXA 1FPJA 1LEVA 4I3YA 5FBPA
chains in the Genus database with same CATH superfamily
3RPLA 3KG2A 3VV5A 5EQ8A 4JWYA 3MC2A 2VD3A 4ZE9A 1NV5A 1I6BA 2Y5KA 5DVFA 4O3BA 5DTBA 1IMDA 3G3FA 1NL5A 4HS7A 3LV0A 2KQZA 3PUXE 2BJIA 2H99A 1QVSA 3U92A 1NNFA 1LBYA 2YLNA 4DXCA 2DXRA 2NOOA 4MEVA 4Q5TA 4QFOA 4RPNA 4OVPA 1OIBA 3K1MA 1XVXA 3S9EA 4ESXA 3C33A 2F34A 1ZIUA 2Q88A 3HFUA 1T0KA 4YKIA 1MPDA 1Y4CA 4N6DA 1TFAA 4KPTA 2O84X 4GXSB 4FATA 3AXFA 3FVOA 3Q25A 2YPNA 4QHQA 3U8QA 4HE1A 4XKPA 2WBDA 1A55A 3HN0A 1SI1A 1IXIA 1SW2A 1CNQA 3NOHA 4JDFA 2Y7KA 1NUWA 1H43A 5J1DA 1FSAA 1TT1A 5I2NB 4NAPA 2XXVA 3N6UA 1MY1A 3SEXA 3R6UA 1Q9DA 3A3CA 1J1NA 2V3UA 4YICA 4KI0E 2NUVA 3FD3A 4X48A 2DE3A 3SEYA 1AOVA 4QXDA 4GBVA 5FHNA 4UA8A 3TPAA 3G3IA 5I56B 1LCTA 4PTKA 1CB6A 2PYYA 4R9GA 3Q29A 4LQ5A 4K3FA 4ZS9A 3T22A 2VD2A 3OOAA 1A8EA 3LUZA 1OMPA 4IO5A 3MAMA 5AA3A 1FPKA 1LBVA 2I48A 2G93A 2OCUA 3KC1A 1XVYA 2HEUA 1LBWA 1XC1A 2FVZA 2L5VA 1IITA 2UXAA 4MNCA 4OXVA 3CG3A 3K0VA 3RUMA 1SBPA 2RC8A 1FJ6A 4GX4A 5I59B 5F1QA 1ZKBA 3TFLA 2PFZA 2ZYOA 4NF8A 3DLNA 4ELRA 4PFTA 1B58A 1N3WA 1Y3QA 3PUWE 2AIXA 1OQGA 1QUIA 4DIGA 2REJA 1P1OA 2UVIA 2R8TA 3A09A 4GFRA 1FBPA 2DS9A 4H5FA 3SZPA 3T93B 1JEUA 1LAXA 1MY4A 3W9VA 2B3FA 3OEMA 1D9YA 4BDRA 3IOWA 4AB6A 3V5AA 2OPDA 5TPAB 3HSTA 2Z22A 4R75A 3K6XA 3TTMA 4H67A 4N8GA 4ELQA 2DWJA 5FHMA 3MW0A 1SW1A 4H0WA 5IKBA 2I3WA 4NF5A 3TTRA 3QUJA 2D21A 3O6GA 4IGRA 5EQ9A 3IO6A 1B51A 4NTLA 1IQ7A 1BIYA 3RY3A 2O51A 2FBPA 1P1NA 1FBHA 3HO7A 1B1HA 3U1OA 1TXFA 2FYIA 3UORA 5HBCA 1JW1A 1FPLA 4QFKA 3OO9A 4PGPA 3TMGA 3V8XB 3S2VA 2WYKA 4DE8A 2QS2A 2CZIA 4H5GA 2NXOA 5JTYA 3HV1A 3K6VA 1IEJA 3TCGA 1B9JA 2XWKA 3KSJA 4P1EA 4JWOA 5I58B 1FPIA 2DSFA 5EQ7A 3U72A 4GL0A 1RYXA 2A5TA 1SVXB 2X26A 4ELOA 5DVJA 4MF3A 2X7QA 3IX1A 1NKXA 4RYAA 2DXYA 2ZNSA 5ET6A 2VT5A 3R26A 1NV2A 2LAOA 3D4CA 1B5JA 4OMBA 1QULA 4YAHX 3IAZA 1G0IA 4ZE8A 4OVJA 5H8FB 2UVGA 3MP6A 3FJ7A 1JW5A 5I7IA 4YB5A 1YAEA 4TLMB 4FAJA 1S50A 3KOTA 2F97A 4N07A 2DVZA 3JZJA 2Z8EA 1YZ0A 2AL4A 5BUUA 2B4LA 2ZZWA 3MP8A 4ZEIA 1USYH 3W9WA 3EHUA 1LBZA 1FTAA 2HAUA 4IY5A 2I6EA 2GQ1A 4ISUA 3O66A 4QRZA 5EQAA 2ANJA 1USYE 1LFHA 1B0LA 4X1DA 5H8HB 3ZS6A 4KYEA 3OO6A 3N6TA 3VVFA 3PD9A 1IMBA 3OENA 3MYUA 2Q9TA 3IB0A 4KR5A 4RY1A 1SYHA 1B2HA 1H3DA 4OZ9A 2OWSA 1N7WA 1BK4A 3CI8A 1OVTA 1MS7A 4NE4A 3GYYA 1MQJA 4PFIA 3DP8A 3IFAA 4OVRA 2ZZXA 4GIZA 1Y20A 3FXQA 2DOJA 5I2NA 4P1LA 1QW0A 2PFYA 3TUSA 4PF8A 4P56A 4N13A 5IZ1A 3IOUA 2F78A 4DI4B 1HSJA 2XXQA 2B65A 3CIJA 4QSEA 3HHFA 4P47A 3TYHA 4DXBA 1K9ZA 2F6PA 1F9BA 4U1ZA 4TLLB 5AA2B 4PETA 3PU5A 2IA4A 2H5YA 2P0SA 4F1YA 4KHZE 4KYDA 4DCXA 2RC7A 4XFEA 3FUZA 1JNFA 5I56A 1RDYA 4XF5A 3TCHA 4PAFA 3WAFA 1DTZA 4N6KA 2XXYA 1JW4A 2O1MA 5A5XA 2OZZA 3MZ1A 1H44A 1B5IA 1IMFA 1ZU0A 1M5DA 3PD8A 4R72A 4OFOA 1SYIA 3OD7A 3PPQA 4RNSA 4XTCQ 4F2QA 5M2VA 1KWHA 1QKAA 2ZYKA 1FPEA 1VR5A 3KJ7A 4QF9A 1MM6A 3L6GA 1Y1ZA 1B4ZA 4X1BA 3RGYA 3GLBA 4H6DA 3H4ZA 4YMAA 1G0HA 4EUOA 2OBGA 3A29A 2I4CA 4LZ7A 2ZMBA 3O28A 1FBGA 1YXIA 2OWZA 4JWXA 3LSFB 1UTHA 2XX8A 2OLBA 4THIA 4DZ1A 4GQOA 3KN7A 5K2XA 3PUZE 3OO8A 4DDDA 5IGAA 2DDKA 2RCAA 2Q2AA 2VP1A 3T96B 2XX9A 3R7XA 2A5SA 3B6WA 3G3GA 4U4XA 4HCYA 4ZEFA 4XEQA 4O94A 3RT8A 4EDPA 5TPAA 1VFEA 1OQHA 3CSGA 2QVRA 1LCFA 4RK2A 5ICTA 1NV1A 1GV8A 3CG1A 3QSLA 1LBCA 1FTJA 4G4PA 1II5A 3TELA 1FPJA 3JYRA 3T1BA 5IAIA 1NUYA 4LZ5A 2BJJX 3IO4A 4F19A 4RPOA 2F8DA 2QMXA 5I2KA 1FPGA 2F6GA 1H45A 3SETA 5I3SA 4H8JA 2V4CA 3UN6A 2QS3A 1WDNA 2CZHA 1IZ1A 4MLQA 2D5WA 4GL8A 1ZJLA 1P1QA 4KCCA 1XT8A 4P0GA 5I58A 3CFZA 2DE4A 1MXXA 1B3LA 3JV9A 3TTNA 2XXRA 1IMEA 1MY2A 4LONB 5IZ3B 4I40A 4ZECA 3KC0A 4GF8A 4PP0A 4P0IA 1UIUA 1A54A 3OELA 1M5BA 3Q28A 1Y1MA 2F36A 2B4MA 1MQIA 4MHFA 3TDJA 4RJZA 3IB1A 1DPPA 1LAHE 1GVCA 2P1SA 2GHBA 4MIJA 3QYTA 2M8CA 4GOTA 5AA4A 4XIGQ 1FQEA 1Q35A 3H7MA 4DCYA 5AA1A 3ODBA 4F29A 1BKAA 2XX7A 2VPNA 3VLUA 1ATGA 4IY6A 1FQFA 1O63A 3K6WA 3MPLA 1JP4A 3E78A 3BFTA 3ONMA 1N04A 3KEIA 4TOZA 5CMKA 3V83A 5H8HA 1NV3A 3PV0E 1K9YA 3KJTA 1EZOA 2V93A 2JJKA 2XWVA 1FQCA 4NMYA 2H25A 1L5TA 2OPEA 2R71A 1S7YA 4OENA 2HZKA 4H65A 4P9KA 1PDAA 2VOZA 4LQ2A 1ZTYA 5CMBA 3PPNA 2V25A 5DEXB 3MQ9A 3KSXA 3DP6A 4X9TA 1EYJA 3T9UA 5CC2A 2XXXA 4FBPA 4I1DA 2H98A 4ONYA 5T3JA 3B7DA 4BDNA 3LSXA 3TQLA 2ZYNA 3I6VA 4IO6A 1B6HA 1HSLA 1LFGA 3Q26A 3IOTA 1CE2A 1R9LA 2F7AA 1O7TA 2HHMA 1D9VA 3VE1B 4C0RA 2QL3A 2X7PA 4NG7A 4JSOA 1FTKA 2FA7A 4F18A 1FRPA 3C4MA 3H6WA 1MM7A 2XWIA 4NF6B 1US5A 4DLDA 4JVIA 4P8BA 1LB8A 4Z0IA 1TFDA 3QUFA 3RYDA 3OMBA 2I58A 3RTWB 4PFBA 3N5LA 1QKBA 3TODA 4OFLA 3EN3A 4F3PA 2OX3A 4DXUA 4GXAA 2W7YA 3C31A 1NNPA 1FTLA 1BP5A 1WODA 4N8YA 4OEVA 5IM2A 4YMBA 5LDZA 1SPIA 4YB6A 3U65A 3GBAA 3WAEA 1QUKA 1NMUA 1A7LA 5ESYA 1B46A 1FTOA 2DQVA 2HAVA 4LP2B 3SESA 2DWHA 4ZZAA 3ZKKA 4EF2A 4N81A 3BBRA 1YPNA 2Z8FA 2Q89A 4OA4A 1B3GA 2IEEA 3PMWA 4YKPA 3IB2A 4OFJA 4F31B 1EYIA 3DM0A 5FTHA 3Q27A 4I9DA 4R6HA 1D4NA 3UIFA 2Q2CA 4O3AA 2QVUA 3UA8A 1XI6A 1LGBC 3P7IA 2RCBA 1PBPA 1Z7ME 4GWOA 4PQJA 2F3BA 4H1XA 5LOMA 3KBRA 3W15C 1IXGA 4QBAA 1MH3A 3C34A 1JVXA 1MPCA 5KDTB 4PFYA 1UTBB 4MNIA 4GWWA 4JBZA 3SDFA 2QS1A 3IK6B 3QAXA 5ELVA 1NNTA 5A5LA 1RKMA 3BFUA 4G77A 3S4UA 4IO2A 1EYKA 2VPOA 1OVBA 2NVUB 4OANA 1NUZA 4ZEBA 1N84A 4HE2A 3M3FA 3G3HA 1MG1A 1LEVA 1B52A 4OERA 3VLWA 4KD5A 2O7IA 2WKYA 4LUBA 4YU0A 2HPGA 4MAGA 4ESWA 1FPDA 2QSXA 5FTIA 1Y3PA 4FE8A 4EXLA 4PE5B 1ZLQA 5IZ3A 5CBSA 4PDHA 3PPRA 1RYOA 3FV2A 2F7CA 2QRYA 1LBBA 5L9SA 3K02A 1DTGA 1PC3A 3G3JA 3C9HA 5ISUA 1IUDA 3E13X 2XXUA 4L17A 4JB7A 3MVZA 4YKKA 3PGFA 5TP9B 1SW5A 2I4BA 5H8QB 3USDA 4BDMA 3PMXA 4UACA 4ND9A 4R74A 4G8MA 1VDWA 3F11A 3RLFE 4JSDA 4N17A 1I6QA 3EF7A 3H6UA 3EHTA 1MXZA 3HPIA 4F1VA 4I3EA 3E3KA 3SEWA 2P2AA 4PDDA 3MVYA 4PFWA 1P99A 4X04A 3PPOA 3LSLA 1KA1A 3RTFB 1URSA 4N91A 1R9QA 5I84A 3IR1A 1DPEA 3T66A 5I57B 4IB2A 1POTA 2GRVA 4PFUA 3MUQA 4WXJA 1N7XA 4PCDA 3VVDA 3S9NC 2QPQA 3HCQA 3MP1A 4KCDA 1R6ZA 2HXWA 1B5HA 1NH7A 3RQTA 3GZGA 4FECA 1UIVA 3B50A 4EQ7A 4I8CA 4EF1A 3TKDA 3K4UA 1MQDA 1AMFA 4IO7A 3IFCA 1BLFA 4ECFA 1RDZA 4R9FA 4ELPA 4MCOA 1XS5A 1A40A 1N3XA 5EYGA 4OETA 4O7IA 3K1NA 3VLVA 3KOSA 5H8NB 2WBBA 1ZMGA 2ZNUA 3ISPA 3OSRA 4IR8A 1NV7A 1MY3A 4QFNA 2Y7RA 5TU0A 4RK9A 1KA0A 1S9TA 3MJNA 3K2DA 1HSEA 4NF6A 4F39A 1MDP1 2ZZVA 3FJMA 4OVSA 3FGSA 5DYHA 1FTMA 1GR2A 4R73A 4AQ4A 5I5PA 3B6QA 1FW0A 2WYPA 5I59A 4EXKA 4G8NA 1D9QA 4N6PA 3D1RA 3SEVA 1IMCA 5L9OA 4HCWA 3OXNA 2V3QA 1B7ZA 2RINA 2YJPA 1Y9UA 2RF1A 2XXIA 4XKRA 3FVGA 1FQBA 3H03A 2R9JA 2CZKA 4H45A 4HTGA 4OYVA 4R6KA 4KFQA 4EQBA 3T0JA 3CFXA 3HHGA 4JVDA 3FIRA 1EZ9A 2R6GE 5EYHA 1IXHA 5EHMA 4FEDA 4OHNA 1P1WA 4PC9A 2O1LA 3QXMA 3UGWA 3ROJA 4MNPA 2Q8MA 2XXPA 3T9XB 5JEIA 4DI3D 4U23A 1B0HA 1B7HA 4GWXA 2HFBA 1LB9A 1M5EA 4GRKA 4C1UA 3ILTB 4LN5A 4O7MA 5JTYB 4Q30B 2Y5LA 1H76A 4GWZA 5CMMA 3EKIA 4POXA 2RC9A 4KQPA 2UVJA 5KDTA 1MXWA 4BDLA 4N15A 3TEPA 3E79A 1IMAA 3PTYA 3ILUB 2CZLA 2KLFA 3VXCA 4OVQA 3LSWA 4AS4A 2Q8JA 1SQYA 2XA5A 2DWAA 4MX6A 1DCUA 3ZKLA 3S9LC 4C1TA 2RKMA 2THIA 1LAFE 4N4UA 1YYZA 1INPA 1B05A 3C36A 2B3BA 5FHOA 3G3KA 5H8FA 5AE4A 4Z7EA 2KR0A 1D3KA 4HW8A 1NUXA 1MH4A 1NH8A 1EZPA 3ZSFA 1SI0A 4MMPA 4NF0A 1MQGA 3FASA 3K00A 2ONKE 3K6UA 4WEPA 4NN3A 3U94A 4G68B 1M5CA 4U2RA 2E1SA 4NEDA 1PB9A 4FORA 1DK4A 4YZZA 4OQOA 2V84A 5TP9A 3FVNA 2AL5A 5H8QA 5ET8A 1QUJA 3VDFA 3SKPA 2PCRA 4R2FA 3IJOB 4M1VA 4G68C 3DELB 1SD3A 3E4RA 3GBBA 3MBPA 5DW8A 3TTLA 4PF6A 2FIEA 4GBWA 2AYSA 3FBPA 3PPPA 4HE0A 4OTEA 2PT2A 4GLIA 1ZBMA 2XHDA 3MSTA 4QFLA 5EYFA 3TZAA 4F3SA 1YCJA 2QVVA 3FJGA 5I57A 3C32A 3G7WA 3H06B 2DP8A 4PBQA 4YKJA 3QK6A 3N94A 3E9XA 3K01A 2FNCA 4XKNA 2ZNTA 4NX1A 1FJ9A 3O6HA 3O29A 4EQ9A 4NF4B 2GH9A 4X8RA 1AWBA 1JVYA 5AA2A 1AH5A 1MQHA 5HPQA 2HZLA 2WEFA 2REGA 2F5XA 5A5XB 3FXRA 3CRBA 4I3YA 5FBPA 3EQ1A 1YTVA 2OK2A 1EU8A 4JXIA 4R6YA 2P3NA 4FIMA 3CFLA 4KXPA 3DP4A 1B3HA 1DBZA 3LBSA 3VVEA 2F7BA 2PMSA 4RXLA 5H8NA 2Y7PA 3BIHA 3BKIB 5ET7A 1FQAA 1I69A 4FEBA 2XXKA 4E0XA 2I0CA 2QS4A 5JK4A 3MVXA 4E0WA 2HQ0A 1PB8A 2XXWA 4BLAA 3QMFA 3PMVA 3EHSA 3VXBA 1PBQA 5EHSA 3OEKA 1TWYA 3IL1B 1NFTA 4AB5A 1UTHB 3FATA 3IJXB 2PT1A 3L6HA 1PB7A 5KCJB 2H4IA 2FHYA 1MPBA 4Q8RA 3MPKA 4F3BA 3H6VA 2Y84A 4NGUA 2F35A 1FQDA 1FCKA 1XOCA 3T9HB 2ZXTA 2UYEA 3RNNA 5AA2D 3A3UA 4G2ZA 1ELJA 5F7VA 4PAIA 1MRPA 5CBRA 3U93A 2ESNA 4UABA 2WX9A 1URGA 1P1UA 2OWTA 3MVWA 1Y3NA 4POWA 2GFEA 1QGXA 3KGCA 3RN8A 1DSNA 1B7UA 5I2KB 4O8MA 1Q1KA 1B3EA 4LATA 4MLVA 4F22A 1QJMA 3PUYE 1FBDA 1Y4TA 3OSQA 2H9BA 2PBWA 4IGTA 1B32A 2QFLA 3RPLB 4MFIA 4XKQA 1I6AA 1FBFA 2O7UA 2Z8DA 2VGQA 2XD2A 4Q0CA 4G8HA 1MXVA 4U4SA 2Q74A 1SDXA 5CM6A 1UQWA 1LSTA 5HM4B 3KN8A 1Z7NE 3VFJA 1NV6A 1RDXA 4NWCA 2DWIA 1VSOA 2OJTA 1POY1 5AA4B 3IORA 3RPWA 4XXUA 3FV1A 3PUVE 1NNKA 2ZYMA 4JVCA 4QSCA 4U21A 2O68A 5B70A 3RT6B 4RA1A 1GGGA 5DT6A 2E0SA 2QMWA 1URDA 2XXHA 2UVHA 1ANFA 2QJEA 4IO4A 3O6IA 4QSDA 1NV4A 2ONRA 4HXVA 3LUYA 4ZEKA 3KFMA 3TCFA 3FXUA 4G68A 2PX1A 1A99A 3H3GA 1NV0A 4PFRA 3T9VA 1B40A 4F1UA 4OVTA 4PE3A 1O64A 4YB7A 4AS5A 3CSBA 4F2OA 5KZTA 4GD5A 3MZBA 4GX3A 1MXYA 2VHAA 1DOTA 3QIMA 5CI5A 1NI9A 5CRYA 2P3VA 3B8BA 3SERA 3I3VA 3CHGA 2G29A 3H6TA 3KZGA 4QFPA 3FXBA 4LA9A 1IXCA 4IO3A 4NQ8A 5DEXA 2Y7IA 4KYSA 1GTKA 1FBEA 1LLSA 1OLCA 4GWSA 4LZ8A 1LFIA 3CVGA 3LR1A 3TTKA 3MWBA 4MH5A 2ABHA 4GWYA 1US4A 3B6TA 2NWJA 5ET5A 1FPBA 1DMBA 2I0BA 4NF4A 2GHAA 3ECRA 1WVJA 4I62A 4PBHA 3CR9A 3O9PA 4G61A 2UYFA 2Y7WA 3SEUA 4NF8B 1AL3A 1N0TA 5CMCA 5ITPA 4ZZEA 2XXTA 3FVKA 1JQFA 2I49A 3TQWA 3C35A 1MDQA 5K2YA 1MXUA 3KN3A 4OESA 2CEYA 3M3KA 1XHYA 2CMOA 3OO7A 1B4HA 1A8FA 3GXAA 4O3CA 1BTJA 1B1XA 4GX6A 1AIVA 3THIA 4P3LA 4WKMA 3FZVA 4OWDA 1LBXA 5H8SA 2XD3A 2HCAA 5ICQA 2CEXA 5IZZA 2HXRA 3O2AA 4MBPA 2Z23A 4M4GA 4NF5B 1PEBA 3S9MC 1FPFA 1R1NA 2DVCA 3M3LA 3BIGA 5KCJA 2O69A 1KZ8A 4PAKA 1JETA 4LVQA 4PGNA 3UP9A 2F3DA 3O97A 4H8IA 4WEDA 4GWUA 2ONSA 1VE4A 5ITOA 2I3VA 5J16A 5LTCA 1FBCA 1N76A 3D4GA 2D3IA 1M5FA 5L9MA 4P11A 4U1OA 3KBZA 4MJOA 3MZ9A 4OEUA 1SW4A 1OLAA 3EPEA 2V3TA 4NHBA 3I5OA 3LC8A 5F24A 4NWDA 2FIXA 2MKZA 1EH3A 3K1PA 3M8UA 1LAGE 4GVOA 1UTBA 2DYXA 5L8DA 2O6AA 2PVUA 2A5TB 4BDOA 3UK4A 3TAJA 4F3GA 3V89B 3N26A 1IIWA 4TQUQ 2DE2A 1B3FA 4ZEDA 5BWJA 1VFDA 4BDQA 2ALUA 4H46A 5B7DA 1JEVA 2XWOA 3IOVA 4U22A 4R2BA 1MY0A 4ZDMA 4FJPA 5DVIA
chains in the Genus database with same CATH topology
3RPLA 2P3NA 5EQ8A 4KXPA 2HPGA 4MAGA 1IMFA 1NV5A 1DBZA 1FPDA 2Y5KA 3BIHA 1IMDA 5ET7A 5IZ3A 4PDHA 3LV0A 2KQZA 2BJIA 2XXKA 1LBYA 5JK4A 1FPEA 3QMFA 4MEVA 4OVPA 3HFUA 1G0HA 4N6DA 3A29A 1VDWA 1FBGA 1YXIA 2OWZA 4N17A 4HE1A 2FHYA 2WBDA 5IGAA 4F1VA 2DDKA 4I3EA 4NGUA 4PDDA 4X04A 1CNQA 1KA1A 3NOHA 4HCYA 4N91A 4XEQA 4O94A 1NUWA 5J1DA 1FSAA 4NAPA 2QVRA 4PAIA 1Q9DA 1NV1A 4PCDA 4UABA 2WX9A 4YICA 2QPQA 1QGXA 1FPJA 2DE3A 4QXDA 3B50A 3T1BA 4GBVA 1NUYA 4O8MA 4F19A 1FPGA 4PTKA 3IFCA 1FBDA 5I3SA 1RDZA 2V4CA 2CZHA 4MCOA 2QFLA 3RPLB 3LUZA 5EYGA 4O7IA 1FBFA 2WBBA 2DE4A 3ISPA 4IR8A 1FPKA 1IMEA 1LBVA 1NV7A 5IZ3B 4I40A 3KC0A 1KA0A 3KC1A 2Q74A 1LBWA 5CM6A 2L5VA 2FVZA 4MNCA 2ZZVA 4OVSA 1NV6A 1RDXA 1FJ6A 2B4MA 4GX4A 5I5PA 4MHFA 2PFZA 2WYPA 1D9QA 3D1RA 1IMCA 4MIJA 4JVCA 4HCWA 2V3QA 2R8TA 1FBPA 1NV4A 2VPNA 3SZPA 4HXVA 1JP4A 3E78A 3W9VA 2CZKA 4H45A 1NV0A 4PFRA 3T0JA 4JVDA 4F1UA 4OVTA 4PE3A 4AS5A 1NV3A 4N8GA 5EYHA 1K9YA 2JJKA 4GX3A 2XWVA 1NI9A 2P3VA 3B8BA 5EQ9A 4PC9A 3ROJA 2HZKA 4P9KA 4MNPA 2FBPA 2Q8MA 3CHGA 4DI3D 1FBHA 3FXBA 4GWXA 4X9TA 4NQ8A 1FPLA 1EYJA 4PGPA 4LN5A 4FBPA 4O7MA 2WYKA 2Y5LA 1FBEA 4GWZA 5T3JA 3EKIA 2CZIA 4GWSA 2XWKA 4N15A 4P1EA 1FPIA 2HHMA 3E79A 5EQ7A 4GWYA 5ET5A 1IMAA 4NG7A 1FPBA 3PTYA 4F18A 1FRPA 4OVQA 4AS4A 2XWIA 5ET6A 2VT5A 2XA5A 1NV2A 4MX6A 4JVIA 1DCUA 4P8BA 4PBHA 4G61A 1G0IA 3RYDA 4PFBA 4N4UA 1YYZA 1INPA 5I7IA 2OX3A 2KR0A 2DVZA 1NUXA 1YZ0A 2B4LA 4N8YA 5IM2A 2ZZWA 2CEYA 5LDZA 1SPIA 4MMPA 4NF0A 3U65A 3W9WA 1LBZA 4GX6A 4NN3A 4P3LA 1FTAA 5ESYA 2GQ1A 1DK4A 5EQAA 4YZZA 1LBXA 5ET8A 4N81A 2CEXA 2PCRA 5IZZA 4M1VA 2HXRA 1IMBA 4OA4A 3MYUA 2Q9TA 5DW8A 1FPFA 2FIEA 4GBWA 1EYIA 4PF6A 3FBPA 3BIGA 4HE0A 1BK4A 3GYYA 4PFIA 1KZ8A 2QVUA 4PAKA 1XI6A 3MSTA 4PGNA 2F3DA 4GWUA 2QVVA 3IFAA 4OVRA 2ZZXA 5J16A 5LTCA 1FBCA 2F3BA 4P1LA 3KBZA 4QBAA 4MJOA 2PFYA 4PBQA 4PF8A 4NHBA 4P56A 5IZ1A 5F24A 4DI4B 2FIXA 4MNIA 2MKZA 4GWWA 4P47A 5A5LA 1K9ZA 2DE2A 4NX1A 4PETA 1EYKA 1FJ9A 2VPOA 4OANA 4X8RA 1AWBA 4XFEA 1NUZA 4H46A 1RDYA 4XF5A 4PAFA 2XWOA 4HE2A 2HZLA 2WEFA 4N6KA 2F5XA 1LEVA 4I3YA 5FBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LDZ A;  1SPI A;  4QXD A;  3RPL A;  2P3N A;  4GBV A;  4AS5 A;  1NUY A;  1NV3 A;  5EQ8 A;  5EYH A;  4KXP A;  1LBZ A;  4GX6 A;  1IMF A;  1NV5 A;  1DBZ A;  1FPD A;  1K9Y A;  1FTA A;  1FPG A;  2Y5K A;  4PTK A;  2JJK A;  3IFC A;  4GX3 A;  5ESY A;  3BIH A;  2GQ1 A;  1NI9 A;  1FBD A;  2P3V A;  5I3S A;  1IMD A;  1RDZ A;  5ET7 A;  5IZ3 A;  3B8B A;  5EQ9 A;  1DK4 A;  3LV0 A;  5EQA A;  2BJI A;  2CZH A;  3ROJ A;  2QFL A;  3RPL B;  1LBY A;  1LBX A;  2FBP A;  5ET8 A;  2Q8M A;  3LUZ A;  5EYG A;  4N81 A;  4O7I A;  1FBH A;  2PCR A;  1IMB A;  4GWX A;  1FBF A;  1FPE A;  3QMF A;  2WBB A;  1FPL A;  1EYJ A;  5DW8 A;  1FPF A;  4IR8 A;  1FPK A;  2FIE A;  4FBP A;  1EYI A;  1IME A;  1LBV A;  1NV7 A;  3FBP A;  4GBW A;  3BIG A;  5IZ3 B;  4HE0 A;  4I40 A;  2Y5L A;  3KC0 A;  1FBE A;  4GWZ A;  5T3J A;  1BK4 A;  1KA0 A;  2CZI A;  3KC1 A;  2Q74 A;  4GWS A;  1G0H A;  1LBW A;  1KZ8 A;  2QVU A;  3A29 A;  2FVZ A;  1XI6 A;  1VDW A;  1FBG A;  1YXI A;  2OWZ A;  2F3D A;  4GWU A;  2QVV A;  3IFA A;  5J16 A;  1NV6 A;  1FPI A;  1FBC A;  2F3B A;  1RDX A;  2HHM A;  1FJ6 A;  5EQ7 A;  4GX4 A;  4HE1 A;  4GWY A;  5ET5 A;  1IMA A;  2FHY A;  2WBD A;  1FPB A;  3KBZ A;  2DDK A;  4MJO A;  4I3E A;  1FRP A;  1D9Q A;  3D1R A;  4AS4 A;  1IMC A;  1CNQ A;  5IZ1 A;  5F24 A;  1KA1 A;  2FIX A;  4GWW A;  5ET6 A;  2VT5 A;  1NV2 A;  1DCU A;  1NUW A;  5A5L A;  1FSA A;  4G61 A;  1G0I A;  2R8T A;  1K9Z A;  3RYD A;  2QVR A;  1YYZ A;  1INP A;  1FBP A;  1EYK A;  1FJ9 A;  1NV4 A;  1Q9D A;  4HXV A;  1NV1 A;  2OX3 A;  1AWB A;  1JP4 A;  1NUZ A;  4H46 A;  1RDY A;  2CZK A;  4H45 A;  4HE2 A;  2WEF A;  1NUX A;  1NV0 A;  3T0J A;  1YZ0 A;  1QGX A;  1FPJ A;  1LEV A;  4I3Y A;  5FBP A; 
#chains in the Genus database with same CATH topology
 3RPL A;  3KG2 A;  3VV5 A;  5EQ8 A;  4JWY A;  3MC2 A;  2VD3 A;  4ZE9 A;  1NV5 A;  1I6B A;  2Y5K A;  5DVF A;  4O3B A;  5DTB A;  1IMD A;  3G3F A;  1NL5 A;  4HS7 A;  3LV0 A;  2KQZ A;  3PUX E;  2BJI A;  2H99 A;  1QVS A;  3U92 A;  1NNF A;  1LBY A;  2YLN A;  4DXC A;  2DXR A;  2NOO A;  4MEV A;  4Q5T A;  4QFO A;  4RPN A;  4OVP A;  1OIB A;  3K1M A;  1XVX A;  3S9E A;  4ESX A;  3C33 A;  2F34 A;  1ZIU A;  2Q88 A;  3HFU A;  1T0K A;  4YKI A;  1MPD A;  1Y4C A;  4N6D A;  1TFA A;  4KPT A;  2O84 X;  4GXS B;  4FAT A;  3AXF A;  3FVO A;  3Q25 A;  2YPN A;  4QHQ A;  3U8Q A;  4HE1 A;  4XKP A;  2WBD A;  1A55 A;  3HN0 A;  1SI1 A;  1IXI A;  1SW2 A;  1CNQ A;  3NOH A;  4JDF A;  2Y7K A;  1NUW A;  1H43 A;  5J1D A;  1FSA A;  1TT1 A;  5I2N B;  4NAP A;  2XXV A;  3N6U A;  1MY1 A;  3SEX A;  3R6U A;  1Q9D A;  3A3C A;  1J1N A;  2V3U A;  4YIC A;  4KI0 E;  2NUV A;  3FD3 A;  4X48 A;  2DE3 A;  3SEY A;  1AOV A;  4QXD A;  4GBV A;  5FHN A;  4UA8 A;  3TPA A;  3G3I A;  5I56 B;  1LCT A;  4PTK A;  1CB6 A;  2PYY A;  4R9G A;  3Q29 A;  4LQ5 A;  4K3F A;  4ZS9 A;  3T22 A;  2VD2 A;  3OOA A;  1A8E A;  3LUZ A;  1OMP A;  4IO5 A;  3MAM A;  5AA3 A;  1FPK A;  1LBV A;  2I48 A;  2G93 A;  2OCU A;  3KC1 A;  1XVY A;  2HEU A;  1LBW A;  1XC1 A;  2FVZ A;  2L5V A;  1IIT A;  2UXA A;  4MNC A;  4OXV A;  3CG3 A;  3K0V A;  3RUM A;  1SBP A;  2RC8 A;  1FJ6 A;  4GX4 A;  5I59 B;  5F1Q A;  1ZKB A;  3TFL A;  2PFZ A;  2ZYO A;  4NF8 A;  3DLN A;  4ELR A;  4PFT A;  1B58 A;  1N3W A;  1Y3Q A;  3PUW E;  2AIX A;  1OQG A;  1QUI A;  4DIG A;  2REJ A;  1P1O A;  2UVI A;  2R8T A;  3A09 A;  4GFR A;  1FBP A;  2DS9 A;  4H5F A;  3SZP A;  3T93 B;  1JEU A;  1LAX A;  1MY4 A;  3W9V A;  2B3F A;  3OEM A;  1D9Y A;  4BDR A;  3IOW A;  4AB6 A;  3V5A A;  2OPD A;  5TPA B;  3HST A;  2Z22 A;  4R75 A;  3K6X A;  3TTM A;  4H67 A;  4N8G A;  4ELQ A;  2DWJ A;  5FHM A;  3MW0 A;  1SW1 A;  4H0W A;  5IKB A;  2I3W A;  4NF5 A;  3TTR A;  3QUJ A;  2D21 A;  3O6G A;  4IGR A;  5EQ9 A;  3IO6 A;  1B51 A;  4NTL A;  1IQ7 A;  1BIY A;  3RY3 A;  2O51 A;  2FBP A;  1P1N A;  1FBH A;  3HO7 A;  1B1H A;  3U1O A;  1TXF A;  2FYI A;  3UOR A;  5HBC A;  1JW1 A;  1FPL A;  4QFK A;  3OO9 A;  4PGP A;  3TMG A;  3V8X B;  3S2V A;  2WYK A;  4DE8 A;  2QS2 A;  2CZI A;  4H5G A;  2NXO A;  5JTY A;  3HV1 A;  3K6V A;  1IEJ A;  3TCG A;  1B9J A;  2XWK A;  3KSJ A;  4P1E A;  4JWO A;  5I58 B;  1FPI A;  2DSF A;  5EQ7 A;  3U72 A;  4GL0 A;  1RYX A;  2A5T A;  1SVX B;  2X26 A;  4ELO A;  5DVJ A;  4MF3 A;  2X7Q A;  3IX1 A;  1NKX A;  4RYA A;  2DXY A;  2ZNS A;  5ET6 A;  2VT5 A;  3R26 A;  1NV2 A;  2LAO A;  3D4C A;  1B5J A;  4OMB A;  1QUL A;  4YAH X;  3IAZ A;  1G0I A;  4ZE8 A;  4OVJ A;  5H8F B;  2UVG A;  3MP6 A;  3FJ7 A;  1JW5 A;  5I7I A;  4YB5 A;  1YAE A;  4TLM B;  4FAJ A;  1S50 A;  3KOT A;  2F97 A;  4N07 A;  2DVZ A;  3JZJ A;  2Z8E A;  1YZ0 A;  2AL4 A;  5BUU A;  2B4L A;  2ZZW A;  3MP8 A;  4ZEI A;  1USY H;  3W9W A;  3EHU A;  1LBZ A;  1FTA A;  2HAU A;  4IY5 A;  2I6E A;  2GQ1 A;  4ISU A;  3O66 A;  4QRZ A;  5EQA A;  2ANJ A;  1USY E;  1LFH A;  1B0L A;  4X1D A;  5H8H B;  3ZS6 A;  4KYE A;  3OO6 A;  3N6T A;  3VVF A;  3PD9 A;  1IMB A;  3OEN A;  3MYU A;  2Q9T A;  3IB0 A;  4KR5 A;  4RY1 A;  1SYH A;  1B2H A;  1H3D A;  4OZ9 A;  2OWS A;  1N7W A;  1BK4 A;  3CI8 A;  1OVT A;  1MS7 A;  4NE4 A;  3GYY A;  1MQJ A;  4PFI A;  3DP8 A;  3IFA A;  4OVR A;  2ZZX A;  4GIZ A;  1Y20 A;  3FXQ A;  2DOJ A;  5I2N A;  4P1L A;  1QW0 A;  2PFY A;  3TUS A;  4PF8 A;  4P56 A;  4N13 A;  5IZ1 A;  3IOU A;  2F78 A;  4DI4 B;  1HSJ A;  2XXQ A;  2B65 A;  3CIJ A;  4QSE A;  3HHF A;  4P47 A;  3TYH A;  4DXB A;  1K9Z A;  2F6P A;  1F9B A;  4U1Z A;  4TLL B;  5AA2 B;  4PET A;  3PU5 A;  2IA4 A;  2H5Y A;  2P0S A;  4F1Y A;  4KHZ E;  4KYD A;  4DCX A;  2RC7 A;  4XFE A;  3FUZ A;  1JNF A;  5I56 A;  1RDY A;  4XF5 A;  3TCH A;  4PAF A;  3WAF A;  1DTZ A;  4N6K A;  2XXY A;  1JW4 A;  2O1M A;  5A5X A;  2OZZ A;  3MZ1 A;  1H44 A;  1B5I A;  1IMF A;  1ZU0 A;  1M5D A;  3PD8 A;  4R72 A;  4OFO A;  1SYI A;  3OD7 A;  3PPQ A;  4RNS A;  4XTC Q;  4F2Q A;  5M2V A;  1KWH A;  1QKA A;  2ZYK A;  1FPE A;  1VR5 A;  3KJ7 A;  4QF9 A;  1MM6 A;  3L6G A;  1Y1Z A;  1B4Z A;  4X1B A;  3RGY A;  3GLB A;  4H6D A;  3H4Z A;  4YMA A;  1G0H A;  4EUO A;  2OBG A;  3A29 A;  2I4C A;  4LZ7 A;  2ZMB A;  3O28 A;  1FBG A;  1YXI A;  2OWZ A;  4JWX A;  3LSF B;  1UTH A;  2XX8 A;  2OLB A;  4THI A;  4DZ1 A;  4GQO A;  3KN7 A;  5K2X A;  3PUZ E;  3OO8 A;  4DDD A;  5IGA A;  2DDK A;  2RCA A;  2Q2A A;  2VP1 A;  3T96 B;  2XX9 A;  3R7X A;  2A5S A;  3B6W A;  3G3G A;  4U4X A;  4HCY A;  4ZEF A;  4XEQ A;  4O94 A;  3RT8 A;  4EDP A;  5TPA A;  1VFE A;  1OQH A;  3CSG A;  2QVR A;  1LCF A;  4RK2 A;  5ICT A;  1NV1 A;  1GV8 A;  3CG1 A;  3QSL A;  1LBC A;  1FTJ A;  4G4P A;  1II5 A;  3TEL A;  1FPJ A;  3JYR A;  3T1B A;  5IAI A;  1NUY A;  4LZ5 A;  2BJJ X;  3IO4 A;  4F19 A;  4RPO A;  2F8D A;  2QMX A;  5I2K A;  1FPG A;  2F6G A;  1H45 A;  3SET A;  5I3S A;  4H8J A;  2V4C A;  3UN6 A;  2QS3 A;  1WDN A;  2CZH A;  1IZ1 A;  4MLQ A;  2D5W A;  4GL8 A;  1ZJL A;  1P1Q A;  4KCC A;  1XT8 A;  4P0G A;  5I58 A;  3CFZ A;  2DE4 A;  1MXX A;  1B3L A;  3JV9 A;  3TTN A;  2XXR A;  1IME A;  1MY2 A;  4LON B;  5IZ3 B;  4I40 A;  4ZEC A;  3KC0 A;  4GF8 A;  4PP0 A;  4P0I A;  1UIU A;  1A54 A;  3OEL A;  1M5B A;  3Q28 A;  1Y1M A;  2F36 A;  2B4M A;  1MQI A;  4MHF A;  3TDJ A;  4RJZ A;  3IB1 A;  1DPP A;  1LAH E;  1GVC A;  2P1S A;  2GHB A;  4MIJ A;  3QYT A;  2M8C A;  4GOT A;  5AA4 A;  4XIG Q;  1FQE A;  1Q35 A;  3H7M A;  4DCY A;  5AA1 A;  3ODB A;  4F29 A;  1BKA A;  2XX7 A;  2VPN A;  3VLU A;  1ATG A;  4IY6 A;  1FQF A;  1O63 A;  3K6W A;  3MPL A;  1JP4 A;  3E78 A;  3BFT A;  3ONM A;  1N04 A;  3KEI A;  4TOZ A;  5CMK A;  3V83 A;  5H8H A;  1NV3 A;  3PV0 E;  1K9Y A;  3KJT A;  1EZO A;  2V93 A;  2JJK A;  2XWV A;  1FQC A;  4NMY A;  2H25 A;  1L5T A;  2OPE A;  2R71 A;  1S7Y A;  4OEN A;  2HZK A;  4H65 A;  4P9K A;  1PDA A;  2VOZ A;  4LQ2 A;  1ZTY A;  5CMB A;  3PPN A;  2V25 A;  5DEX B;  3MQ9 A;  3KSX A;  3DP6 A;  4X9T A;  1EYJ A;  3T9U A;  5CC2 A;  2XXX A;  4FBP A;  4I1D A;  2H98 A;  4ONY A;  5T3J A;  3B7D A;  4BDN A;  3LSX A;  3TQL A;  2ZYN A;  3I6V A;  4IO6 A;  1B6H A;  1HSL A;  1LFG A;  3Q26 A;  3IOT A;  1CE2 A;  1R9L A;  2F7A A;  1O7T A;  2HHM A;  1D9V A;  3VE1 B;  4C0R A;  2QL3 A;  2X7P A;  4NG7 A;  4JSO A;  1FTK A;  2FA7 A;  4F18 A;  1FRP A;  3C4M A;  3H6W A;  1MM7 A;  2XWI A;  4NF6 B;  1US5 A;  4DLD A;  4JVI A;  4P8B A;  1LB8 A;  4Z0I A;  1TFD A;  3QUF A;  3RYD A;  3OMB A;  2I58 A;  3RTW B;  4PFB A;  3N5L A;  1QKB A;  3TOD A;  4OFL A;  3EN3 A;  4F3P A;  2OX3 A;  4DXU A;  4GXA A;  2W7Y A;  3C31 A;  1NNP A;  1FTL A;  1BP5 A;  1WOD A;  4N8Y A;  4OEV A;  5IM2 A;  4YMB A;  5LDZ A;  1SPI A;  4YB6 A;  3U65 A;  3GBA A;  3WAE A;  1QUK A;  1NMU A;  1A7L A;  5ESY A;  1B46 A;  1FTO A;  2DQV A;  2HAV A;  4LP2 B;  3SES A;  2DWH A;  4ZZA A;  3ZKK A;  4EF2 A;  4N81 A;  3BBR A;  1YPN A;  2Z8F A;  2Q89 A;  4OA4 A;  1B3G A;  2IEE A;  3PMW A;  4YKP A;  3IB2 A;  4OFJ A;  4F31 B;  1EYI A;  3DM0 A;  5FTH A;  3Q27 A;  4I9D A;  4R6H A;  1D4N A;  3UIF A;  2Q2C A;  4O3A A;  2QVU A;  3UA8 A;  1XI6 A;  1LGB C;  3P7I A;  2RCB A;  1PBP A;  1Z7M E;  4GWO A;  4PQJ A;  2F3B A;  4H1X A;  5LOM A;  3KBR A;  3W15 C;  1IXG A;  4QBA A;  1MH3 A;  3C34 A;  1JVX A;  1MPC A;  5KDT B;  4PFY A;  1UTB B;  4MNI A;  4GWW A;  4JBZ A;  3SDF A;  2QS1 A;  3IK6 B;  3QAX A;  5ELV A;  1NNT A;  5A5L A;  1RKM A;  3BFU A;  4G77 A;  3S4U A;  4IO2 A;  1EYK A;  2VPO A;  1OVB A;  2NVU B;  4OAN A;  1NUZ A;  4ZEB A;  1N84 A;  4HE2 A;  3M3F A;  3G3H A;  1MG1 A;  1LEV A;  1B52 A;  4OER A;  3VLW A;  4KD5 A;  2O7I A;  2WKY A;  4LUB A;  4YU0 A;  2HPG A;  4MAG A;  4ESW A;  1FPD A;  2QSX A;  5FTI A;  1Y3P A;  4FE8 A;  4EXL A;  4PE5 B;  1ZLQ A;  5IZ3 A;  5CBS A;  4PDH A;  3PPR A;  1RYO A;  3FV2 A;  2F7C A;  2QRY A;  1LBB A;  5L9S A;  3K02 A;  1DTG A;  1PC3 A;  3G3J A;  3C9H A;  5ISU A;  1IUD A;  3E13 X;  2XXU A;  4L17 A;  4JB7 A;  3MVZ A;  4YKK A;  3PGF A;  5TP9 B;  1SW5 A;  2I4B A;  5H8Q B;  3USD A;  4BDM A;  3PMX A;  4UAC A;  4ND9 A;  4R74 A;  4G8M A;  1VDW A;  3F11 A;  3RLF E;  4JSD A;  4N17 A;  1I6Q A;  3EF7 A;  3H6U A;  3EHT A;  1MXZ A;  3HPI A;  4F1V A;  4I3E A;  3E3K A;  3SEW A;  2P2A A;  4PDD A;  3MVY A;  4PFW A;  1P99 A;  4X04 A;  3PPO A;  3LSL A;  1KA1 A;  3RTF B;  1URS A;  4N91 A;  1R9Q A;  5I84 A;  3IR1 A;  1DPE A;  3T66 A;  5I57 B;  4IB2 A;  1POT A;  2GRV A;  4PFU A;  3MUQ A;  4WXJ A;  1N7X A;  4PCD A;  3VVD A;  3S9N C;  2QPQ A;  3HCQ A;  3MP1 A;  4KCD A;  1R6Z A;  2HXW A;  1B5H A;  1NH7 A;  3RQT A;  3GZG A;  4FEC A;  1UIV A;  3B50 A;  4EQ7 A;  4I8C A;  4EF1 A;  3TKD A;  3K4U A;  1MQD A;  1AMF A;  4IO7 A;  3IFC A;  1BLF A;  4ECF A;  1RDZ A;  4R9F A;  4ELP A;  4MCO A;  1XS5 A;  1A40 A;  1N3X A;  5EYG A;  4OET A;  4O7I A;  3K1N A;  3VLV A;  3KOS A;  5H8N B;  2WBB A;  1ZMG A;  2ZNU A;  3ISP A;  3OSR A;  4IR8 A;  1NV7 A;  1MY3 A;  4QFN A;  2Y7R A;  5TU0 A;  4RK9 A;  1KA0 A;  1S9T A;  3MJN A;  3K2D A;  1HSE A;  4NF6 A;  4F39 A;  1MDP 1;  2ZZV A;  3FJM A;  4OVS A;  3FGS A;  5DYH A;  1FTM A;  1GR2 A;  4R73 A;  4AQ4 A;  5I5P A;  3B6Q A;  1FW0 A;  2WYP A;  5I59 A;  4EXK A;  4G8N A;  1D9Q A;  4N6P A;  3D1R A;  3SEV A;  1IMC A;  5L9O A;  4HCW A;  3OXN A;  2V3Q A;  1B7Z A;  2RIN A;  2YJP A;  1Y9U A;  2RF1 A;  2XXI A;  4XKR A;  3FVG A;  1FQB A;  3H03 A;  2R9J A;  2CZK A;  4H45 A;  4HTG A;  4OYV A;  4R6K A;  4KFQ A;  4EQB A;  3T0J A;  3CFX A;  3HHG A;  4JVD A;  3FIR A;  1EZ9 A;  2R6G E;  5EYH A;  1IXH A;  5EHM A;  4FED A;  4OHN A;  1P1W A;  4PC9 A;  2O1L A;  3QXM A;  3UGW A;  3ROJ A;  4MNP A;  2Q8M A;  2XXP A;  3T9X B;  5JEI A;  4DI3 D;  4U23 A;  1B0H A;  1B7H A;  4GWX A;  2HFB A;  1LB9 A;  1M5E A;  4GRK A;  4C1U A;  3ILT B;  4LN5 A;  4O7M A;  5JTY B;  4Q30 B;  2Y5L A;  1H76 A;  4GWZ A;  5CMM A;  3EKI A;  4POX A;  2RC9 A;  4KQP A;  2UVJ A;  5KDT A;  1MXW A;  4BDL A;  4N15 A;  3TEP A;  3E79 A;  1IMA A;  3PTY A;  3ILU B;  2CZL A;  2KLF A;  3VXC A;  4OVQ A;  3LSW A;  4AS4 A;  2Q8J A;  1SQY A;  2XA5 A;  2DWA A;  4MX6 A;  1DCU A;  3ZKL A;  3S9L C;  4C1T A;  2RKM A;  2THI A;  1LAF E;  4N4U A;  1YYZ A;  1INP A;  1B05 A;  3C36 A;  2B3B A;  5FHO A;  3G3K A;  5H8F A;  5AE4 A;  4Z7E A;  2KR0 A;  1D3K A;  4HW8 A;  1NUX A;  1MH4 A;  1NH8 A;  1EZP A;  3ZSF A;  1SI0 A;  4MMP A;  4NF0 A;  1MQG A;  3FAS A;  3K00 A;  2ONK E;  3K6U A;  4WEP A;  4NN3 A;  3U94 A;  4G68 B;  1M5C A;  4U2R A;  2E1S A;  4NED A;  1PB9 A;  4FOR A;  1DK4 A;  4YZZ A;  4OQO A;  2V84 A;  5TP9 A;  3FVN A;  2AL5 A;  5H8Q A;  5ET8 A;  1QUJ A;  3VDF A;  3SKP A;  2PCR A;  4R2F A;  3IJO B;  4M1V A;  4G68 C;  3DEL B;  1SD3 A;  3E4R A;  3GBB A;  3MBP A;  5DW8 A;  3TTL A;  4PF6 A;  2FIE A;  4GBW A;  2AYS A;  3FBP A;  3PPP A;  4HE0 A;  4OTE A;  2PT2 A;  4GLI A;  1ZBM A;  2XHD A;  3MST A;  4QFL A;  5EYF A;  3TZA A;  4F3S A;  1YCJ A;  2QVV A;  3FJG A;  5I57 A;  3C32 A;  3G7W A;  3H06 B;  2DP8 A;  4PBQ A;  4YKJ A;  3QK6 A;  3N94 A;  3E9X A;  3K01 A;  2FNC A;  4XKN A;  2ZNT A;  4NX1 A;  1FJ9 A;  3O6H A;  3O29 A;  4EQ9 A;  4NF4 B;  2GH9 A;  4X8R A;  1AWB A;  1JVY A;  5AA2 A;  1AH5 A;  1MQH A;  5HPQ A;  2HZL A;  2WEF A;  2REG A;  2F5X A;  5A5X B;  3FXR A;  3CRB A;  4I3Y A;  5FBP A;  3EQ1 A;  1YTV A;  2OK2 A;  1EU8 A;  4JXI A;  4R6Y A;  2P3N A;  4FIM A;  3CFL A;  4KXP A;  3DP4 A;  1B3H A;  1DBZ A;  3LBS A;  3VVE A;  2F7B A;  2PMS A;  4RXL A;  5H8N A;  2Y7P A;  3BIH A;  3BKI B;  5ET7 A;  1FQA A;  1I69 A;  4FEB A;  2XXK A;  4E0X A;  2I0C A;  2QS4 A;  5JK4 A;  3MVX A;  4E0W A;  2HQ0 A;  1PB8 A;  2XXW A;  4BLA A;  3QMF A;  3PMV A;  3EHS A;  3VXB A;  1PBQ A;  5EHS A;  3OEK A;  1TWY A;  3IL1 B;  1NFT A;  4AB5 A;  1UTH B;  3FAT A;  3IJX B;  2PT1 A;  3L6H A;  1PB7 A;  5KCJ B;  2H4I A;  2FHY A;  1MPB A;  4Q8R A;  3MPK A;  4F3B A;  3H6V A;  2Y84 A;  4NGU A;  2F35 A;  1FQD A;  1FCK A;  1XOC A;  3T9H B;  2ZXT A;  2UYE A;  3RNN A;  5AA2 D;  3A3U A;  4G2Z A;  1ELJ A;  5F7V A;  4PAI A;  1MRP A;  5CBR A;  3U93 A;  2ESN A;  4UAB A;  2WX9 A;  1URG A;  1P1U A;  2OWT A;  3MVW A;  1Y3N A;  4POW A;  2GFE A;  1QGX A;  3KGC A;  3RN8 A;  1DSN A;  1B7U A;  5I2K B;  4O8M A;  1Q1K A;  1B3E A;  4LAT A;  4MLV A;  4F22 A;  1QJM A;  3PUY E;  1FBD A;  1Y4T A;  3OSQ A;  2H9B A;  2PBW A;  4IGT A;  1B32 A;  2QFL A;  3RPL B;  4MFI A;  4XKQ A;  1I6A A;  1FBF A;  2O7U A;  2Z8D A;  2VGQ A;  2XD2 A;  4Q0C A;  4G8H A;  1MXV A;  4U4S A;  2Q74 A;  1SDX A;  5CM6 A;  1UQW A;  1LST A;  5HM4 B;  3KN8 A;  1Z7N E;  3VFJ A;  1NV6 A;  1RDX A;  4NWC A;  2DWI A;  1VSO A;  2OJT A;  1POY 1;  5AA4 B;  3IOR A;  3RPW A;  4XXU A;  3FV1 A;  3PUV E;  1NNK A;  2ZYM A;  4JVC A;  4QSC A;  4U21 A;  2O68 A;  5B70 A;  3RT6 B;  4RA1 A;  1GGG A;  5DT6 A;  2E0S A;  2QMW A;  1URD A;  2XXH A;  2UVH A;  1ANF A;  2QJE A;  4IO4 A;  3O6I A;  4QSD A;  1NV4 A;  2ONR A;  4HXV A;  3LUY A;  4ZEK A;  3KFM A;  3TCF A;  3FXU A;  4G68 A;  2PX1 A;  1A99 A;  3H3G A;  1NV0 A;  4PFR A;  3T9V A;  1B40 A;  4F1U A;  4OVT A;  4PE3 A;  1O64 A;  4YB7 A;  4AS5 A;  3CSB A;  4F2O A;  5KZT A;  4GD5 A;  3MZB A;  4GX3 A;  1MXY A;  2VHA A;  1DOT A;  3QIM A;  5CI5 A;  1NI9 A;  5CRY A;  2P3V A;  3B8B A;  3SER A;  3I3V A;  3CHG A;  2G29 A;  3H6T A;  3KZG A;  4QFP A;  3FXB A;  4LA9 A;  1IXC A;  4IO3 A;  4NQ8 A;  5DEX A;  2Y7I A;  4KYS A;  1GTK A;  1FBE A;  1LLS A;  1OLC A;  4GWS A;  4LZ8 A;  1LFI A;  3CVG A;  3LR1 A;  3TTK A;  3MWB A;  4MH5 A;  2ABH A;  4GWY A;  1US4 A;  3B6T A;  2NWJ A;  5ET5 A;  1FPB A;  1DMB A;  2I0B A;  4NF4 A;  2GHA A;  3ECR A;  1WVJ A;  4I62 A;  4PBH A;  3CR9 A;  3O9P A;  4G61 A;  2UYF A;  2Y7W A;  3SEU A;  4NF8 B;  1AL3 A;  1N0T A;  5CMC A;  5ITP A;  4ZZE A;  2XXT A;  3FVK A;  1JQF A;  2I49 A;  3TQW A;  3C35 A;  1MDQ A;  5K2Y A;  1MXU A;  3KN3 A;  4OES A;  2CEY A;  3M3K A;  1XHY A;  2CMO A;  3OO7 A;  1B4H A;  1A8F A;  3GXA A;  4O3C A;  1BTJ A;  1B1X A;  4GX6 A;  1AIV A;  3THI A;  4P3L A;  4WKM A;  3FZV A;  4OWD A;  1LBX A;  5H8S A;  2XD3 A;  2HCA A;  5ICQ A;  2CEX A;  5IZZ A;  2HXR A;  3O2A A;  4MBP A;  2Z23 A;  4M4G A;  4NF5 B;  1PEB A;  3S9M C;  1FPF A;  1R1N A;  2DVC A;  3M3L A;  3BIG A;  5KCJ A;  2O69 A;  1KZ8 A;  4PAK A;  1JET A;  4LVQ A;  4PGN A;  3UP9 A;  2F3D A;  3O97 A;  4H8I A;  4WED A;  4GWU A;  2ONS A;  1VE4 A;  5ITO A;  2I3V A;  5J16 A;  5LTC A;  1FBC A;  1N76 A;  3D4G A;  2D3I A;  1M5F A;  5L9M A;  4P11 A;  4U1O A;  3KBZ A;  4MJO A;  3MZ9 A;  4OEU A;  1SW4 A;  1OLA A;  3EPE A;  2V3T A;  4NHB A;  3I5O A;  3LC8 A;  5F24 A;  4NWD A;  2FIX A;  2MKZ A;  1EH3 A;  3K1P A;  3M8U A;  1LAG E;  4GVO A;  1UTB A;  2DYX A;  5L8D A;  2O6A A;  2PVU A;  2A5T B;  4BDO A;  3UK4 A;  3TAJ A;  4F3G A;  3V89 B;  3N26 A;  1IIW A;  4TQU Q;  2DE2 A;  1B3F A;  4ZED A;  5BWJ A;  1VFD A;  4BDQ A;  2ALU A;  4H46 A;  5B7D A;  1JEV A;  2XWO A;  3IOV A;  4U22 A;  4R2B A;  1MY0 A;  4ZDM A;  4FJP A;  5DVI A; 
#chains in the Genus database with same CATH homology
 3RPL A;  2P3N A;  5EQ8 A;  4KXP A;  2HPG A;  4MAG A;  1IMF A;  1NV5 A;  1DBZ A;  1FPD A;  2Y5K A;  3BIH A;  1IMD A;  5ET7 A;  5IZ3 A;  4PDH A;  3LV0 A;  2KQZ A;  2BJI A;  2XXK A;  1LBY A;  5JK4 A;  1FPE A;  3QMF A;  4MEV A;  4OVP A;  3HFU A;  1G0H A;  4N6D A;  3A29 A;  1VDW A;  1FBG A;  1YXI A;  2OWZ A;  4N17 A;  4HE1 A;  2FHY A;  2WBD A;  5IGA A;  4F1V A;  2DDK A;  4I3E A;  4NGU A;  4PDD A;  4X04 A;  1CNQ A;  1KA1 A;  3NOH A;  4HCY A;  4N91 A;  4XEQ A;  4O94 A;  1NUW A;  5J1D A;  1FSA A;  4NAP A;  2QVR A;  4PAI A;  1Q9D A;  1NV1 A;  4PCD A;  4UAB A;  2WX9 A;  4YIC A;  2QPQ A;  1QGX A;  1FPJ A;  2DE3 A;  4QXD A;  3B50 A;  3T1B A;  4GBV A;  1NUY A;  4O8M A;  4F19 A;  1FPG A;  4PTK A;  3IFC A;  1FBD A;  5I3S A;  1RDZ A;  2V4C A;  2CZH A;  4MCO A;  2QFL A;  3RPL B;  3LUZ A;  5EYG A;  4O7I A;  1FBF A;  2WBB A;  2DE4 A;  3ISP A;  4IR8 A;  1FPK A;  1IME A;  1LBV A;  1NV7 A;  5IZ3 B;  4I40 A;  3KC0 A;  1KA0 A;  3KC1 A;  2Q74 A;  1LBW A;  5CM6 A;  2L5V A;  2FVZ A;  4MNC A;  2ZZV A;  4OVS A;  1NV6 A;  1RDX A;  1FJ6 A;  2B4M A;  4GX4 A;  5I5P A;  4MHF A;  2PFZ A;  2WYP A;  1D9Q A;  3D1R A;  1IMC A;  4MIJ A;  4JVC A;  4HCW A;  2V3Q A;  2R8T A;  1FBP A;  1NV4 A;  2VPN A;  3SZP A;  4HXV A;  1JP4 A;  3E78 A;  3W9V A;  2CZK A;  4H45 A;  1NV0 A;  4PFR A;  3T0J A;  4JVD A;  4F1U A;  4OVT A;  4PE3 A;  4AS5 A;  1NV3 A;  4N8G A;  5EYH A;  1K9Y A;  2JJK A;  4GX3 A;  2XWV A;  1NI9 A;  2P3V A;  3B8B A;  5EQ9 A;  4PC9 A;  3ROJ A;  2HZK A;  4P9K A;  4MNP A;  2FBP A;  2Q8M A;  3CHG A;  4DI3 D;  1FBH A;  3FXB A;  4GWX A;  4X9T A;  4NQ8 A;  1FPL A;  1EYJ A;  4PGP A;  4LN5 A;  4FBP A;  4O7M A;  2WYK A;  2Y5L A;  1FBE A;  4GWZ A;  5T3J A;  3EKI A;  2CZI A;  4GWS A;  2XWK A;  4N15 A;  4P1E A;  1FPI A;  2HHM A;  3E79 A;  5EQ7 A;  4GWY A;  5ET5 A;  1IMA A;  4NG7 A;  1FPB A;  3PTY A;  4F18 A;  1FRP A;  4OVQ A;  4AS4 A;  2XWI A;  5ET6 A;  2VT5 A;  2XA5 A;  1NV2 A;  4MX6 A;  4JVI A;  1DCU A;  4P8B A;  4PBH A;  4G61 A;  1G0I A;  3RYD A;  4PFB A;  4N4U A;  1YYZ A;  1INP A;  5I7I A;  2OX3 A;  2KR0 A;  2DVZ A;  1NUX A;  1YZ0 A;  2B4L A;  4N8Y A;  5IM2 A;  2ZZW A;  2CEY A;  5LDZ A;  1SPI A;  4MMP A;  4NF0 A;  3U65 A;  3W9W A;  1LBZ A;  4GX6 A;  4NN3 A;  4P3L A;  1FTA A;  5ESY A;  2GQ1 A;  1DK4 A;  5EQA A;  4YZZ A;  1LBX A;  5ET8 A;  4N81 A;  2CEX A;  2PCR A;  5IZZ A;  4M1V A;  2HXR A;  1IMB A;  4OA4 A;  3MYU A;  2Q9T A;  5DW8 A;  1FPF A;  2FIE A;  4GBW A;  1EYI A;  4PF6 A;  3FBP A;  3BIG A;  4HE0 A;  1BK4 A;  3GYY A;  4PFI A;  1KZ8 A;  2QVU A;  4PAK A;  1XI6 A;  3MST A;  4PGN A;  2F3D A;  4GWU A;  2QVV A;  3IFA A;  4OVR A;  2ZZX A;  5J16 A;  5LTC A;  1FBC A;  2F3B A;  4P1L A;  3KBZ A;  4QBA A;  4MJO A;  2PFY A;  4PBQ A;  4PF8 A;  4NHB A;  4P56 A;  5IZ1 A;  5F24 A;  4DI4 B;  2FIX A;  4MNI A;  2MKZ A;  4GWW A;  4P47 A;  5A5L A;  1K9Z A;  2DE2 A;  4NX1 A;  4PET A;  1EYK A;  1FJ9 A;  2VPO A;  4OAN A;  4X8R A;  1AWB A;  4XFE A;  1NUZ A;  4H46 A;  1RDY A;  4XF5 A;  4PAF A;  2XWO A;  4HE2 A;  2HZL A;  2WEF A;  4N6K A;  2F5X A;  1LEV A;  4I3Y A;  5FBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...