4GWSA

Crystal structure of amp complexes of porcine liver fructose-1,6-bisphosphatase with filled central cavity
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
327
Chain Sequence
NIVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAIHRAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMVNGVNCFMYDPAIGEFILVDRDVKIKKKGSIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVPTDIHQRAPIILGSPEDVTELLEIYQKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Hydrophobic Central Cavity in Fructose-1,6-bisphosphatase is Essential for the Synergism in AMP/Fructose 2,6-bisphosphate Inhibition
rcsb
source organism Sus scrofa
total genus 101
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4gwsA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4gwsA02
1IMCA 1NV0A 1FJ6A 3KBZA 4GWSA 1G0IA 4G61A 1RDXA 1FBPA 1NUXA 1FPDA 4GBWA 1FJ9A 4I3YA 5IZ3B 4H46A 2QVRA 1FBDA 1Q9DA 2F3DA 2FBPA 5I3SA 1AWBA 1FPBA 5EYHA 5J16A 1YZ0A 3RPLB 1NV6A 2CZIA 3BIGA 5ET6A 3ROJA 4HE1A 1QGXA 1DK4A 4HE2A 1NV4A 3D1RA 4GBVA 4GWUA 2GQ1A 4QXDA 1DBZA 1FPEA 1NUWA 1FSAA 1FRPA 5T3JA 1FPFA 2JJKA 1EYIA 1YXIA 2CZKA 1K9YA 4GWXA 5ET7A 4O7IA 1FPLA 5EQ8A 2WBDA 5IZ1A 1IMBA 4MJOA 5EQ9A 2OX3A 4AS5A 1IMFA 1FBHA 1G0HA 1FPKA 2Q8MA 3LV0A 3RYDA 3KC1A 1FBFA 1SPIA 4H45A 2QVUA 2Q74A 1NUYA 1JP4A 5ET8A 1BK4A 1KA0A 4N81A 1EYKA 3LUZA 4FBPA 1IMAA 3BIHA 5EYGA 1FBEA 1KA1A 1LBYA 1RDYA 5FBPA 1FPJA 1NV3A 1NV2A 1NV5A 5LDZA 2HHMA 5ESYA 5IZ3A 1IMEA 2CZHA 3B8BA 2P3VA 1FPGA 5F24A 4I40A 1NV7A 2DDKA 3A29A 3QMFA 1EYJA 2FHYA 4GWWA 1NV1A 1NI9A 4GX6A 4GWYA 4I3EA 1D9QA 3FBPA 4PTKA 1LBWA 2Y5KA 1INPA 2FIXA 3T0JA 4AS4A 1FTAA 1VDWA 2QFLA 1DCUA 1LBXA 4IR8A 1KZ8A 5EQ7A 1LEVA 4GX3A 1LBZA 4GWZA 1FBGA 1K9ZA 3IFAA 4HXVA 3KC0A 2FIEA 2FVZA 2R8TA 5DW8A 2WEFA 4HE0A 5ET5A 2OWZA 3RPLA 3IFCA 1CNQA 1LBVA 2QVVA 5EQAA 1RDZA 1FPIA 2BJIA 2WBBA 4KXPA 2P3NA 1YYZA 2Y5LA 4GX4A 5A5LA 2F3BA 2PCRA 1NUZA 1IMDA 1FBCA 2VT5A 1XI6A
chains in the Genus database with same CATH superfamily
5AE4A 4F1VA 2XX8A 2ZYMA 2P2AA 1AWBA 1PC3A 3ZKKA 4YICA 5JTYB 2OPDA 4N6KA 4Z0IA 5H8FA 2I3VA 4P0IA 2E1SA 5LTCA 4RJZA 3U92A 4G77A 3KOTA 2L5VA 4X8RA 1XHYA 4NGUA 4DI4B 3O29A 3TDJA 3FIRA 4NF5A 4H0WA 1PEBA 3C32A 5ITPA 2VP1A 3PUXE 1QUIA 5L9OA 1B3GA 2XXQA 1BTJA 1LAXA 1LFGA 1XOCA 3TCHA 3E4RA 4ESWA 4H5GA 1QUJA 1LAFE 4KCCA 1JVYA 2RCBA 1MS7A 1D9QA 2FIXA 4AS4A 1AIVA 3GZGA 4ZS9A 4YU0A 4RA1A 2B65A 2ZNTA 3VFJA 4PFYA 1JW5A 1A54A 1LAGE 5TU0A 2DSFA 5I84A 1ZMGA 3M3FA 4DLDA 1XVXA 4IO3A 3RNNA 4IO7A 3B6WA 3ONMA 4PQJA 2LAOA 3U93A 3IB1A 4E0XA 1S7YA 2F5XA 1QKAA 3SDFA 5F1QA 4G68B 5J16A 3RPLB 1D3KA 3ROJA 2QS3A 3KN3A 4QXDA 3MPKA 3GBAA 3K1MA 3ZS6A 5I56B 5I5PA 1BIYA 4GWXA 4O7IA 3K1NA 3W15C 1B1HA 5EQ9A 3ILTB 4AQ4A 4BDOA 1EZOA 3OO8A 1URGA 4PFTA 2O51A 3VE1B 4N81A 3OD7A 3I3VA 4YKKA 1NKXA 2YPNA 2G29A 4OETA 3T93B 1MY2A 2Z8FA 2DQVA 2O7UA 4YKPA 2DXRA 3N94A 4IO6A 2D21A 1LGBC 3PTYA 5DTBA 4U1ZA 4OZ9A 2P3VA 1ZU0A 3B50A 5DVFA 4ZEFA 1NV1A 1SVXB 5A5XB 1INPA 3AXFA 4FJPA 4LUBA 1EH3A 4F19A 2R8TA 1OVTA 4PF6A 4KD5A 3U72A 3RPLA 4PFUA 3UIFA 1LLSA 5HBCA 1Y1ZA 1LBVA 2GHBA 1NNKA 3G3IA 4OEVA 2Y5LA 5H8QA 2PCRA 2ZXTA 1NUZA 1FPDA 4U22A 5AA4B 1B5HA 5I3SA 4BDRA 4O3BA 1DK4A 1NV4A 1S9TA 4UA8A 1N0TA 3A3UA 4EXLA 2NVUB 2H9BA 2RF1A 3P7IA 1FPLA 4R74A 4G2ZA 1B3HA 1ZBMA 4GVOA 2Q74A 3UGWA 2ZZVA 3UORA 4TQUQ 3RTFB 3TTLA 2F36A 2DE2A 1AMFA 2FA7A 1A7LA 3OO7A 1MQJA 2QS2A 3VXBA 5IZ3A 2V3QA 4X1BA 4KYEA 4DXUA 3OO9A 4IO5A 5I59A 4I40A 1B46A 3R7XA 1HSJA 4UACA 4GWWA 2VD2A 4LN5A 2ZZXA 2X7QA 3M3LA 3FBPA 3H4ZA 2DE4A 4G68C 4ELRA 4XIGQ 2QFLA 3H6VA 1KZ8A 4GD5A 2OK2A 1MM6A 2WKYA 3TKDA 3EHUA 2OWZA 1QJMA 4THIA 1I6BA 4ZEBA 2WYKA 5FTIA 5EHMA 4R2BA 2KQZA 4O3AA 4G4PA 3HO7A 1SQYA 4KCDA 4OESA 3TTNA 5EHSA 2CEYA 1IXHA 5B70A 3KFMA 3T96B 4EQ7A 1AOVA 4Q8RA 3QAXA 3O9PA 1SW5A 1TFDA 1XC1A 5LOMA 2DOJA 3MZBA 4JWOA 3GBBA 1H3DA 3TPAA 4N8GA 1G0HA 1SW4A 3N6TA 3IOUA 4R9GA 4HCYA 1MH3A 4ZEDA 2QVUA 1JP4A 1B7ZA 1TWYA 3CHGA 2ONSA 2R9JA 1P1UA 4ZE8A 2R71A 3FZVA 2NOOA 4PC9A 1SW1A 5LDZA 1OVBA 5ITOA 4FATA 4GRKA 1A8FA 4R6YA 4MAGA 3EPEA 2RC9A 1DPPA 3LSLA 3QK6A 1FPGA 1OLAA 1MXYA 2FHYA 5KCJB 3SEXA 3G3KA 4H67A 1M5DA 4YKJA 2Q88A 3SZPA 2F97A 3BKIB 1II5A 1LEVA 1P1WA 2I49A 1NNPA 2WX9A 1UQWA 3MPLA 1YTVA 3CR9A 4ISUA 3PPPA 2BJIA 1CB6A 2M8CA 1YYZA 4GF8A 1Y9UA 5CM6A 3D4CA 4YKIA 1UTBA 3ODBA 3KBZA 2QRYA 4FAJA 2RC7A 4XKQA 4OFOA 4H1XA 3Q28A 4NF0A 2Y84A 4F2OA 1NMUA 4OA4A 4P11A 1MXWA 1JVXA 1FPEA 5L9MA 1NUWA 1LAHE 1SW2A 4LQ2A 5I2NA 3FASA 2PYYA 3JV9A 5TPAB 3PD9A 4BDLA 5AA3A 1IMFA 4JDFA 5DVJA 1P1OA 3FXUA 3I6VA 3FATA 4NF4B 5ISUA 2XXPA 2QPQA 4N15A 2ANJA 5I57B 4MHFA 2A5TB 1A99A 1FQFA 2Z23A 3IO4A 2H25A 3OEKA 5I2KA 1VFDA 1OLCA 4ELOA 2HHMA 5AA2A 1IMEA 3HV1A 5EYFA 4N13A 4E0WA 5H8FB 1GTKA 2QSXA 1NV7A 2VGQA 1PB8A 4IY6A 1DPEA 4GL0A 3Q25A 2XD3A 4M4GA 3TTKA 4JB7A 1B51A 3G3JA 3KJ7A 2B3BA 4NF5B 4OANA 2ONKE 4PFBA 2PT1A 1Y1MA 4FE8A 3HN0A 3FV2A 2O7IA 4DZ1A 4N8YA 3MVZA 5DEXB 4P0GA 1R6ZA 3E79A 1FJ9A 2QVRA 1FBDA 3DM0A 1NV6A 4PF8A 2OWTA 4GWUA 2XXXA 1UIVA 1UTHA 3G3GA 3ECRA 3O97A 2Z8DA 4QBAA 3S9NC 1N3XA 4PAKA 1DTGA 3U65A 4AS5A 2H5YA 2PMSA 2GFEA 3KJTA 3KC1A 4WXJA 4GL8A 3RPWA 1ZTYA 2CMOA 2F7BA 3MBPA 1FW0A 1FQCA 3E78A 5CBSA 4JBZA 1NV2A 3FUZA 4OQOA 4XFEA 1P1QA 3OMBA 4RNSA 3C4MA 3K1PA 1MXZA 3MC2A 3IJXB 4KQPA 1LBCA 1MY0A 2F8DA 4F18A 1QVSA 1FQAA 4MX6A 4RY1A 3BFTA 4AB5A 1NNTA 5BUUA 3V89B 4ZZAA 2O1LA 3JYRA 3PPNA 5DEXA 3W9VA 1K9ZA 4PDHA 5DW8A 3PUWE 1LCTA 5L8DA 3T66A 1O63A 4O8MA 1IZ1A 3IFCA 4XKPA 4PETA 1O64A 2ZZWA 3CI8A 1R9QA 4ZDMA 2V4CA 3PUYE 1DTZA 1AH5A 1DMBA 3SESA 3FVNA 1FJ6A 1MXVA 4PDDA 2REJA 4H46A 4U2RA 4PFIA 1IITA 3M8UA 3SEUA 4NF8A 1B4ZA 1TXFA 1RYOA 1EZ9A 3KEIA 5CMKA 3C36A 3D1RA 1NFTA 1Q35A 4IB2A 2Y7RA 1FCKA 1FPFA 2AIXA 4G8NA 3KSXA 2PBWA 2WBDA 4EQBA 1US5A 4ND9A 2V93A 3LV0A 4BDQA 2F7CA 4ZE9A 4ESXA 2OZZA 2THIA 1JEVA 5H8QB 1MY4A 1KWHA 4R72A 1J1NA 4JXIA 3HHFA 5TP9A 2X7PA 2UVGA 3RQTA 4QFOA 4DDDA 1SD3A 4KI0E 4KPTA 3FJGA 1MPDA 1YCJA 2UXAA 1RYXA 3A09A 4N17A 2ZYNA 3ILUB 3DP4A 3TQWA 2XX9A 3T0JA 3HHGA 3KOSA 1LBXA 3MP8A 4G8MA 3N5LA 2I4BA 3K6WA 1GGGA 3VLVA 3BBRA 2IA4A 2WYPA 4DIGA 5CBRA 5ET5A 2UVIA 1Y3PA 3G7WA 2HPGA 3B7DA 3HCQA 3OOAA 1ANFA 2H99A 2R6GE 1N84A 5IGAA 4KYDA 2O69A 2UVHA 4QSDA 1D4NA 4G61A 1US4A 1VFEA 4YAHX 4GXAA 4IGTA 1WDNA 5IZ3B 4PGPA 1DOTA 2V3UA 1JW1A 3USDA 2CZIA 4P1LA 3BIGA 5I59B 1B3LA 2QMWA 2AL5A 3OENA 2NXOA 1EYIA 3KSJA 1K9YA 3G3FA 4F39A 3OXNA 4ELQA 1MY1A 2ZMBA 3E9XA 1B5JA 1SPIA 4LZ7A 1MXUA 4IO4A 1KA0A 4PGNA 4ZZEA 2O68A 3W9WA 1NH7A 3BIHA 3CVGA 4RPNA 5CMCA 2P0SA 2I6EA 3SERA 2QL3A 1N04A 2OBGA 2RINA 5F7VA 4YB5A 2HZKA 4F3BA 3KBRA 3FD3A 4FORA 3ISPA 2B4MA 3SKPA 4U21A 1FTAA 3CFLA 1XVYA 1MQDA 1MDQA 4POWA 1FTLA 4QFNA 1FTKA 4C1UA 4PP0A 4H5FA 2PFYA 4U4SA 4GFRA 4BLAA 4OVRA 4OENA 5CMMA 3U94A 5I58A 4PBHA 3KZGA 3O6GA 2HEUA 3V8XB 3IO6A 2HQ0A 3SEVA 1I6QA 2PVUA 4OEUA 4R6KA 1FBPA 1IUDA 3PD8A 4P47A 1MY3A 1FPBA 3VVEA 3MW0A 4YB7A 1XT8A 2HAVA 3TEPA 3H3GA 5FHOA 5K2XA 2ALUA 2I48A 1PDAA 5EQ8A 1N7WA 3LC8A 4JWYA 2I58A 2XXVA 2XWKA 1ELJA 4OHNA 4OYVA 5CRYA 4R73A 1BP5A 1ZIUA 3RN8A 4R6HA 4OXVA 1M5BA 2Z22A 3VDFA 1LBYA 4JSOA 4MIJA 3IB0A 1UTBB 1NV5A 2Q89A 3PUVE 2UYFA 3PMXA 3IOVA 4NF6A 3V83A 1B52A 2PX1A 4NWCA 1LBBA 4LONB 4XEQA 4I3EA 4OVQA 5I2NB 1I69A 4ONYA 4NWDA 4F29A 5FHMA 3EHSA 3RT8A 1B32A 3FXRA 2OJTA 4GWOA 4P9KA 4ZEIA 4C0RA 3QXMA 3S9LC 2WBBA 3MVWA 1ZJLA 5K2YA 1P99A 2X26A 5I2KB 1NV0A 4QHQA 5I7IA 4R2FA 3TCGA 1Y3QA 1G0IA 1B9JA 1RDXA 4FEDA 4MMPA 4QFPA 5KDTA 5H8NA 4QSCA 5AA2B 4PE3A 4KHZE 3D4GA 2F3DA 5EYHA 1B05A 1YZ0A 4YZZA 4NX1A 1N7XA 3IL1B 4JVIA 2DWJA 3S2VA 1H43A 3TCFA 1FSAA 1SI0A 5T3JA 4P1EA 2JJKA 1A8EA 1DSNA 2O1MA 1Z7NE 4X1DA 4LZ5A 1R1NA 1B58A 3RUMA 4DCXA 2AL4A 1FBFA 2Y7IA 3R26A 1BK4A 3FXBA 3OELA 1IMAA 2XX7A 5EYGA 3MZ9A 1KA1A 1UIUA 3OSQA 5FBPA 1IXIA 3HSTA 5HM4B 3IOTA 1YPNA 3L6HA 3UK4A 3H6WA 3B6QA 2B4LA 1MRPA 2VHAA 3QIMA 1GVCA 1UTHB 1LB9A 4XXUA 3H06B 1USYE 4GX6A 2F6GA 4QF9A 3MP6A 2F7AA 4KR5A 3HPIA 3TUSA 3OSRA 1VE4A 4H6DA 2WEFA 1QULA 4HE0A 2O6AA 1QW0A 4EF1A 4GIZA 2F34A 1FPIA 4Z7EA 2P3NA 2F3BA 3QYTA 1LFIA 5IM2A 4GX3A 4JVDA 4PCDA 1B1XA 2KR0A 4UABA 1JW4A 2VPNA 4I3YA 2DP8A 3K0VA 5KZTA 3K02A 4EF2A 3IORA 3FJ7A 4OVJA 5ICQA 4QFKA 1B40A 4KFQA 4QSEA 5B7DA 3TODA 2DYXA 2GH9A 3O28A 3KGCA 3PUZE 4AB6A 2GQ1A 1JETA 2W7YA 4N91A 4PFRA 4EXKA 4N07A 2NUVA 4I1DA 2CZKA 2ONRA 5CI5A 3A3CA 4ZEKA 4NE4A 3SEYA 2OX3A 2YJPA 3T9HB 1OIBA 3TELA 2XXYA 4HTGA 3RLFE 3GLBA 1SI1A 1SBPA 3PPOA 1Y20A 3LUZA 4U23A 1RDYA 4QFLA 1H44A 1OQHA 2VPOA 2VD3A 4IY5A 4NQ8A 1NH8A 3CG1A 2RCAA 3VXCA 1BLFA 1PBPA 2BJJX 3JZJA 3PMWA 4WEDA 3PPRA 4NF8B 2DVZA 3BFUA 4MNCA 2ABHA 5F24A 4BDNA 4OVPA 4DXBA 1M5FA 3IOWA 1EYJA 3VV5A 1QUKA 2CEXA 3E13X 3LSFB 1SYHA 2D3IA 3TAJA 4PE5B 4U1OA 1PBQA 4ECFA 5H8HA 3O2AA 1EZPA 5IZZA 4MBPA 2I3WA 1D9VA 3F11A 3LSXA 2H98A 3PV0E 1CNQA 1D9YA 4NG7A 4KXPA 4BDMA 4MLQA 4H8JA 1HSEA 3TTMA 4FEBA 3OO6A 3MP1A 1IMCA 2XXIA 5TP9B 2F35A 1IXGA 3MAMA 1A40A 4F3GA 4WEPA 2E0SA 4F1YA 5ET6A 4EUOA 4HE1A 2QS1A 3FJMA 4PBQA 4HE2A 4NMYA 1DBZA 1LB8A 2GHAA 3DELB 3FV1A 3UN6A 5IZ1A 4MJOA 3CSGA 1FBHA 4QRZA 3E3KA 1GV8A 2Q2CA 4XKNA 2QJEA 2HXRA 1USYH 1WODA 4FIMA 3TFLA 2NWJA 4OWDA 1NUYA 2QMXA 2XD2A 4F3SA 4MCOA 4XKRA 4FBPA 2HXWA 5CMBA 3T9UA 1FQBA 3Q26A 3MUQA 2Q8JA 2XXHA 4X9TA 3FGSA 2V84A 1IQ7A 1Z7ME 4G8HA 1ZKBA 2CZHA 3CG3A 5DYHA 3VVDA 5JTYA 3O6IA 1H76A 4JVCA 3QMFA 3MYUA 4PTKA 3NOHA 2Y5KA 1SDXA 4IR8A 1ATGA 5EQ7A 1R9LA 1XS5A 4GWZA 2RKMA 5IAIA 2XWOA 4GQOA 1LCFA 3S9EA 2A5SA 1H45A 4O94A 1I6AA 4RPOA 5EQAA 5AA1A 2YLNA 1MXXA 3IFAA 1FBCA 3CRBA 3IX1A 1LSTA 2F78A 3RTWB 3CFXA 4GBWA 3OEMA 3TZAA 1N3WA 1Q9DA 1MG1A 3T9VA 1B0HA 1QGXA 4GBVA 4P8BA 4HW8A 2ZYOA 3EQ1A 3QUFA 1YXIA 5ET7A 2MKZA 2HZLA 4GLIA 1B5IA 3R6UA 4YB6A 5FHNA 4Q30B 4OFLA 3ZKLA 2ESNA 2Q2AA 1NL5A 1FTMA 5H8SA 3LR1A 5I58B 3LUYA 4C1TA 3H7MA 3S9MC 1FPJA 3T9XB 3I5OA 1B6HA 5ESYA 3L6GA 4G68A 1FQEA 1MDP1 1MQGA 2HCAA 4NAPA 3RY3A 2Q9TA 1BKAA 3B8BA 3GXAA 3FXQA 1YAEA 3SEWA 1OMPA 4L17A 4OTEA 2REGA 2OLBA 4MFIA 5I56A 2UYEA 4MLVA 2D5WA 1VDWA 3H03A 3FVOA 3TYHA 4LATA 2OWSA 2FVZA 3HFUA 4N4UA 1FQDA 3IR1A 4LP2B 3K6UA 5L9SA 4O3CA 4F1UA 1N76A 4GX4A 5A5LA 3U8QA 3ZSFA 1B2HA 2HFBA 1OQGA 4NF6B 2Y7WA 3DLNA 2UVJA 2FBPA 3VLWA 4MEVA 5M2VA 1TFAA 4R75A 1RKMA 3IAZA 4GXSB 3EHTA 4X48A 5A5XA 2Y7KA 2GRVA 3C31A 4I9DA 3IK6B 3VVFA 1FPKA 3DP8A 4DXCA 1VR5A 5J1DA 4O7MA 3SETA 1IIWA 2I0BA 4FECA 3N6UA 2PFZA 1IXCA 2OPEA 1FBEA 4PFWA 1Y3NA 5KDTB 4Q0CA 5AA4A 5H8NB 3WAFA 4EQ9A 2DWIA 1M5CA 2DVCA 4RK9A 4P56A 1B7UA 4NN3A 1M5EA 2OCUA 4ZECA 5JK4A 1F9BA 1Q1KA 4NTLA 2DWHA 3UP9A 4MNPA 3H6TA 4YMBA 3QUJA 3V5AA 3M3KA 3U1OA 1A55A 3EF7A 4N6PA 1LBZA 2CZLA 1FBGA 3KC0A 1PB9A 4IGRA 4I62A 2O84X 4TOZA 4X04A 4MF3A 2QVVA 4TLLB 2H4IA 2VOZA 4DCYA 2XHDA 3Q29A 4U4XA 2VT5A 3C35A 5ICTA 4GWSA 4LZ8A 2I0CA 4EDPA 3TTRA 3S4UA 4HS7A 3PU5A 1JEUA 2HAUA 1MQHA 3T1BA 1VSOA 3CFZA 4JWXA 4K3FA 1PB7A 2QS4A 3C34A 2V3TA 4RYAA 3KN8A 1FRPA 3RT6B 2XWIA 3THIA 1GR2A 1WVJA 2F6PA 1IMBA 1EU8A 4R9FA 2Q8MA 2B3FA 3RYDA 4NEDA 2V25A 5JEIA 4H45A 1B0LA 4WKMA 2XXUA 4F31B 2ZNUA 5ET8A 1S50A 1AL3A 5DT6A 4GOTA 1EYKA 4I8CA 1MM7A 3MWBA 3MQ9A 2PT2A 1POTA 4F22A 4XF5A 1MH4A 3C33A 5IKBA 3UA8A 5BWJA 1SYIA 1JQFA 1FTJA 2P1SA 3K4UA 3N26A 4ELPA 2DE3A 3K6VA 1B3EA 3A29A 4IO2A 3IJOB 4DI3D 1NI9A 2DS9A 4RK2A 2FYIA 4GWYA 4TLMB 3FVGA 1LBWA 1HSLA 1MQIA 2ZNSA 1URDA 2Y7PA 3O66A 4HXVA 2FIEA 2XXKA 3MVYA 4OVSA 2XA5A 4LVQA 3PGFA 1B7HA 5DVIA 3K6XA 3Q27A 2G93A 1POY1 3H6UA 3KG2A 1P1NA 3PPQA 4PAIA 2XWVA 1NNFA 1XI6A 2IEEA 3MSTA 5FTHA 3MZ1A 4P3LA 4XTCQ 3WAEA 1NUXA 3QSLA 1T0KA 2I4CA 2AYSA 1Y4TA 2FNCA 3PMVA 1Y4CA 4DE8A 3TMGA 1L5TA 3T22A 4F3PA 3CIJA 4HCWA 1MPBA 5HPQA 1B3FA 4MNIA 5KCJA 4RXLA 3MVXA 1FTOA 2KLFA 5H8HB 3LBSA 3RGYA 4N6DA 4OMBA 3EN3A 4OFJA 3VLUA 1QKBA 1MPCA 4Q5TA 3IB2A 1CE2A 4LQ5A 5ELVA 5CC2A 3CSBA 2ZYKA 2XXTA 1NV3A 4H8IA 3K00A 2DXYA 3C9HA 3EKIA 3FVKA 1URSA 4H65A 1JNFA 4JSDA 2XXRA 3O6HA 4OVTA 1ZLQA 2DDKA 5AA2D 3GYYA 1LFHA 2XXWA 3K2DA 4PAFA 1DCUA 3B6TA 4OERA 5TPAA 4M1VA 3DP6A 3K01A 1IEJA 4POXA 1O7TA 4NF4A 2Z8EA 2RC8A 3MJNA 4F2QA 4LA9A 3LSWA 1TT1A 4KYSA 5I57A 1RDZA 4NHBA 4MH5A 3G3HA 3KN7A 1B4HA 2A5TA 4YMAA 3TQLA 2DWAA 1IMDA
chains in the Genus database with same CATH topology
3KBZA 4F1VA 1FBPA 4GBWA 4NF0A 4P47A 1Q9DA 1AWBA 1FPBA 4YICA 4OA4A 4N6KA 1QGXA 4GBVA 5LTCA 1FPEA 1NUWA 4P8BA 1YXIA 5ET7A 5EQ8A 2MKZA 2HZLA 1IMFA 2L5VA 4X8RA 4NGUA 4DI4B 2XWKA 2QPQA 4N15A 4MHFA 1LBYA 4MIJA 1FPJA 1NV5A 2HHMA 5ESYA 1IMEA 4NAPA 2Q9TA 3B8BA 1NV7A 4XEQA 4I3EA 4OVQA 1D9QA 2FIXA 4AS4A 1VDWA 2FVZA 3HFUA 4N4UA 4P9KA 4OANA 4PFBA 4F1UA 2WBBA 1IMDA 4GX4A 5A5LA 4N8YA 1NV0A 5I7IA 2F5XA 1G0IA 3E79A 1RDXA 4MMPA 1FJ9A 2QVRA 1FBDA 4PE3A 2F3DA 2FBPA 4MEVA 5EYHA 5J16A 1YZ0A 3RPLB 4YZZA 1NV6A 4NX1A 4JVIA 3ROJA 4PF8A 4GWUA 4QXDA 1FSAA 5T3JA 4P1EA 2JJKA 5I5PA 4QBAA 4GWXA 4O7IA 5EQ9A 4PAKA 3U65A 4AS5A 1FPKA 5J1DA 3KC1A 1FBFA 4O7MA 1BK4A 4N81A 2PFZA 3FXBA 1IMAA 5EYGA 1FBEA 1KA1A 3E78A 5FBPA 1NV2A 4XFEA 4P56A 3PTYA 4NN3A 2B4LA 2P3VA 5JK4A 4F18A 3B50A 4MNPA 4MX6A 1NV1A 4GX6A 1INPA 1LBZA 4F19A 1FBGA 3W9VA 1K9ZA 3KC0A 4PDHA 2R8TA 5DW8A 2WEFA 4PF6A 4HE0A 4O8MA 3RPLA 4X04A 3IFCA 4PETA 2ZZWA 1LBVA 2QVVA 1FPIA 2P3NA 2V4CA 2Y5LA 2F3BA 2PCRA 1NUZA 5IM2A 2VT5A 1FPDA 4GX3A 1FJ6A 4JVDA 4PCDA 4GWSA 2KR0A 4UABA 2VPNA 4PDDA 4I3YA 4H46A 4PFIA 5I3SA 3T1BA 1DK4A 1NV4A 3D1RA 2GQ1A 4N91A 1FRPA 1FPFA 4PFRA 2XWIA 2CZKA 1FPLA 2WBDA 1IMBA 2OX3A 2Q8MA 3LV0A 3RYDA 4H45A 2Q74A 5ET8A 2ZZVA 1EYKA 3LUZA 4XF5A 1RDYA 2DE2A 2VPOA 4NQ8A 5IZ3A 2DVZA 2V3QA 4MNCA 5F24A 4I40A 4OVPA 2DE3A 3A29A 4GWWA 1EYJA 4LN5A 4DI3D 2ZZXA 1NI9A 2CEXA 4N17A 4GWYA 3FBPA 1LBWA 3T0JA 2DE4A 2QFLA 1LBXA 1KZ8A 4HXVA 5IZZA 2FIEA 2XXKA 4OVSA 2XA5A 2WYPA 5ET5A 2OWZA 1CNQA 2HPGA 2WYKA 4NG7A 4KXPA 2KQZA 4PAIA 2XWVA 5IGAA 1XI6A 3MSTA 1IMCA 4P3LA 4G61A 1NUXA 5IZ3B 4PGPA 2CEYA 2CZIA 4P1LA 3BIGA 5ET6A 4HE1A 4PBQA 4HE2A 1DBZA 4HCWA 4MNIA 1EYIA 1K9YA 5IZ1A 4MJOA 4N8GA 1FBHA 1G0HA 4N6DA 4HCYA 2HXRA 1SPIA 2QVUA 1NUYA 1JP4A 1KA0A 4MCOA 4PGNA 4FBPA 3W9WA 3CHGA 3BIHA 4PC9A 1NV3A 5LDZA 4X9TA 3EKIA 4MAGA 2HZKA 2CZHA 1FPGA 4JVCA 4OVTA 2DDKA 3QMFA 2FHYA 3ISPA 3GYYA 4PAFA 3NOHA 3MYUA 4PTKA 2B4MA 2Y5KA 3SZPA 1FTAA 1DCUA 4IR8A 5EQ7A 1LEVA 4M1VA 4GWZA 2XWOA 2WX9A 4O94A 2PFYA 5EQAA 4OVRA 1RDZA 4NHBA 2BJIA 1YYZA 4PBHA 5CM6A 3IFAA 1FBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMC A;  1NV0 A;  1FJ6 A;  3KBZ A;  4GWS A;  1G0I A;  4G61 A;  1RDX A;  1FBP A;  1NUX A;  1FPD A;  4GBW A;  1FJ9 A;  4I3Y A;  5IZ3 B;  4H46 A;  2QVR A;  1FBD A;  1Q9D A;  2F3D A;  2FBP A;  5I3S A;  1AWB A;  1FPB A;  5EYH A;  5J16 A;  1YZ0 A;  3RPL B;  1NV6 A;  2CZI A;  3BIG A;  5ET6 A;  3ROJ A;  4HE1 A;  1QGX A;  1DK4 A;  4HE2 A;  1NV4 A;  3D1R A;  4GBV A;  4GWU A;  2GQ1 A;  4QXD A;  1DBZ A;  1FPE A;  1NUW A;  1FSA A;  1FRP A;  5T3J A;  1FPF A;  2JJK A;  1EYI A;  1YXI A;  2CZK A;  1K9Y A;  4GWX A;  5ET7 A;  4O7I A;  1FPL A;  5EQ8 A;  2WBD A;  5IZ1 A;  1IMB A;  4MJO A;  5EQ9 A;  2OX3 A;  4AS5 A;  1IMF A;  1FBH A;  1G0H A;  1FPK A;  2Q8M A;  3LV0 A;  3RYD A;  3KC1 A;  1FBF A;  1SPI A;  4H45 A;  2QVU A;  2Q74 A;  1NUY A;  1JP4 A;  5ET8 A;  1BK4 A;  1KA0 A;  4N81 A;  1EYK A;  3LUZ A;  4FBP A;  1IMA A;  3BIH A;  5EYG A;  1FBE A;  1KA1 A;  1LBY A;  1RDY A;  5FBP A;  1FPJ A;  1NV3 A;  1NV2 A;  1NV5 A;  5LDZ A;  2HHM A;  5ESY A;  5IZ3 A;  1IME A;  2CZH A;  3B8B A;  2P3V A;  1FPG A;  5F24 A;  4I40 A;  1NV7 A;  2DDK A;  3A29 A;  3QMF A;  1EYJ A;  2FHY A;  4GWW A;  1NV1 A;  1NI9 A;  4GX6 A;  4GWY A;  4I3E A;  1D9Q A;  3FBP A;  4PTK A;  1LBW A;  2Y5K A;  1INP A;  2FIX A;  3T0J A;  4AS4 A;  1FTA A;  1VDW A;  2QFL A;  1DCU A;  1LBX A;  4IR8 A;  1KZ8 A;  5EQ7 A;  1LEV A;  4GX3 A;  1LBZ A;  4GWZ A;  1FBG A;  1K9Z A;  3IFA A;  4HXV A;  3KC0 A;  2FIE A;  2FVZ A;  2R8T A;  5DW8 A;  2WEF A;  4HE0 A;  5ET5 A;  2OWZ A;  3RPL A;  3IFC A;  1CNQ A;  1LBV A;  2QVV A;  5EQA A;  1RDZ A;  1FPI A;  2BJI A;  2WBB A;  4KXP A;  2P3N A;  1YYZ A;  2Y5L A;  4GX4 A;  5A5L A;  2F3B A;  2PCR A;  1NUZ A;  1IMD A;  1FBC A;  2VT5 A;  1XI6 A; 
#chains in the Genus database with same CATH topology
 5AE4 A;  4F1V A;  2XX8 A;  2ZYM A;  2P2A A;  1AWB A;  1PC3 A;  3ZKK A;  4YIC A;  5JTY B;  2OPD A;  4N6K A;  4Z0I A;  5H8F A;  2I3V A;  4P0I A;  2E1S A;  5LTC A;  4RJZ A;  3U92 A;  4G77 A;  3KOT A;  2L5V A;  4X8R A;  1XHY A;  4NGU A;  4DI4 B;  3O29 A;  3TDJ A;  3FIR A;  4NF5 A;  4H0W A;  1PEB A;  3C32 A;  5ITP A;  2VP1 A;  3PUX E;  1QUI A;  5L9O A;  1B3G A;  2XXQ A;  1BTJ A;  1LAX A;  1LFG A;  1XOC A;  3TCH A;  3E4R A;  4ESW A;  4H5G A;  1QUJ A;  1LAF E;  4KCC A;  1JVY A;  2RCB A;  1MS7 A;  1D9Q A;  2FIX A;  4AS4 A;  1AIV A;  3GZG A;  4ZS9 A;  4YU0 A;  4RA1 A;  2B65 A;  2ZNT A;  3VFJ A;  4PFY A;  1JW5 A;  1A54 A;  1LAG E;  5TU0 A;  2DSF A;  5I84 A;  1ZMG A;  3M3F A;  4DLD A;  1XVX A;  4IO3 A;  3RNN A;  4IO7 A;  3B6W A;  3ONM A;  4PQJ A;  2LAO A;  3U93 A;  3IB1 A;  4E0X A;  1S7Y A;  2F5X A;  1QKA A;  3SDF A;  5F1Q A;  4G68 B;  5J16 A;  3RPL B;  1D3K A;  3ROJ A;  2QS3 A;  3KN3 A;  4QXD A;  3MPK A;  3GBA A;  3K1M A;  3ZS6 A;  5I56 B;  5I5P A;  1BIY A;  4GWX A;  4O7I A;  3K1N A;  3W15 C;  1B1H A;  5EQ9 A;  3ILT B;  4AQ4 A;  4BDO A;  1EZO A;  3OO8 A;  1URG A;  4PFT A;  2O51 A;  3VE1 B;  4N81 A;  3OD7 A;  3I3V A;  4YKK A;  1NKX A;  2YPN A;  2G29 A;  4OET A;  3T93 B;  1MY2 A;  2Z8F A;  2DQV A;  2O7U A;  4YKP A;  2DXR A;  3N94 A;  4IO6 A;  2D21 A;  1LGB C;  3PTY A;  5DTB A;  4U1Z A;  4OZ9 A;  2P3V A;  1ZU0 A;  3B50 A;  5DVF A;  4ZEF A;  1NV1 A;  1SVX B;  5A5X B;  1INP A;  3AXF A;  4FJP A;  4LUB A;  1EH3 A;  4F19 A;  2R8T A;  1OVT A;  4PF6 A;  4KD5 A;  3U72 A;  3RPL A;  4PFU A;  3UIF A;  1LLS A;  5HBC A;  1Y1Z A;  1LBV A;  2GHB A;  1NNK A;  3G3I A;  4OEV A;  2Y5L A;  5H8Q A;  2PCR A;  2ZXT A;  1NUZ A;  1FPD A;  4U22 A;  5AA4 B;  1B5H A;  5I3S A;  4BDR A;  4O3B A;  1DK4 A;  1NV4 A;  1S9T A;  4UA8 A;  1N0T A;  3A3U A;  4EXL A;  2NVU B;  2H9B A;  2RF1 A;  3P7I A;  1FPL A;  4R74 A;  4G2Z A;  1B3H A;  1ZBM A;  4GVO A;  2Q74 A;  3UGW A;  2ZZV A;  3UOR A;  4TQU Q;  3RTF B;  3TTL A;  2F36 A;  2DE2 A;  1AMF A;  2FA7 A;  1A7L A;  3OO7 A;  1MQJ A;  2QS2 A;  3VXB A;  5IZ3 A;  2V3Q A;  4X1B A;  4KYE A;  4DXU A;  3OO9 A;  4IO5 A;  5I59 A;  4I40 A;  1B46 A;  3R7X A;  1HSJ A;  4UAC A;  4GWW A;  2VD2 A;  4LN5 A;  2ZZX A;  2X7Q A;  3M3L A;  3FBP A;  3H4Z A;  2DE4 A;  4G68 C;  4ELR A;  4XIG Q;  2QFL A;  3H6V A;  1KZ8 A;  4GD5 A;  2OK2 A;  1MM6 A;  2WKY A;  3TKD A;  3EHU A;  2OWZ A;  1QJM A;  4THI A;  1I6B A;  4ZEB A;  2WYK A;  5FTI A;  5EHM A;  4R2B A;  2KQZ A;  4O3A A;  4G4P A;  3HO7 A;  1SQY A;  4KCD A;  4OES A;  3TTN A;  5EHS A;  2CEY A;  1IXH A;  5B70 A;  3KFM A;  3T96 B;  4EQ7 A;  1AOV A;  4Q8R A;  3QAX A;  3O9P A;  1SW5 A;  1TFD A;  1XC1 A;  5LOM A;  2DOJ A;  3MZB A;  4JWO A;  3GBB A;  1H3D A;  3TPA A;  4N8G A;  1G0H A;  1SW4 A;  3N6T A;  3IOU A;  4R9G A;  4HCY A;  1MH3 A;  4ZED A;  2QVU A;  1JP4 A;  1B7Z A;  1TWY A;  3CHG A;  2ONS A;  2R9J A;  1P1U A;  4ZE8 A;  2R71 A;  3FZV A;  2NOO A;  4PC9 A;  1SW1 A;  5LDZ A;  1OVB A;  5ITO A;  4FAT A;  4GRK A;  1A8F A;  4R6Y A;  4MAG A;  3EPE A;  2RC9 A;  1DPP A;  3LSL A;  3QK6 A;  1FPG A;  1OLA A;  1MXY A;  2FHY A;  5KCJ B;  3SEX A;  3G3K A;  4H67 A;  1M5D A;  4YKJ A;  2Q88 A;  3SZP A;  2F97 A;  3BKI B;  1II5 A;  1LEV A;  1P1W A;  2I49 A;  1NNP A;  2WX9 A;  1UQW A;  3MPL A;  1YTV A;  3CR9 A;  4ISU A;  3PPP A;  2BJI A;  1CB6 A;  2M8C A;  1YYZ A;  4GF8 A;  1Y9U A;  5CM6 A;  3D4C A;  4YKI A;  1UTB A;  3ODB A;  3KBZ A;  2QRY A;  4FAJ A;  2RC7 A;  4XKQ A;  4OFO A;  4H1X A;  3Q28 A;  4NF0 A;  2Y84 A;  4F2O A;  1NMU A;  4OA4 A;  4P11 A;  1MXW A;  1JVX A;  1FPE A;  5L9M A;  1NUW A;  1LAH E;  1SW2 A;  4LQ2 A;  5I2N A;  3FAS A;  2PYY A;  3JV9 A;  5TPA B;  3PD9 A;  4BDL A;  5AA3 A;  1IMF A;  4JDF A;  5DVJ A;  1P1O A;  3FXU A;  3I6V A;  3FAT A;  4NF4 B;  5ISU A;  2XXP A;  2QPQ A;  4N15 A;  2ANJ A;  5I57 B;  4MHF A;  2A5T B;  1A99 A;  1FQF A;  2Z23 A;  3IO4 A;  2H25 A;  3OEK A;  5I2K A;  1VFD A;  1OLC A;  4ELO A;  2HHM A;  5AA2 A;  1IME A;  3HV1 A;  5EYF A;  4N13 A;  4E0W A;  5H8F B;  1GTK A;  2QSX A;  1NV7 A;  2VGQ A;  1PB8 A;  4IY6 A;  1DPE A;  4GL0 A;  3Q25 A;  2XD3 A;  4M4G A;  3TTK A;  4JB7 A;  1B51 A;  3G3J A;  3KJ7 A;  2B3B A;  4NF5 B;  4OAN A;  2ONK E;  4PFB A;  2PT1 A;  1Y1M A;  4FE8 A;  3HN0 A;  3FV2 A;  2O7I A;  4DZ1 A;  4N8Y A;  3MVZ A;  5DEX B;  4P0G A;  1R6Z A;  3E79 A;  1FJ9 A;  2QVR A;  1FBD A;  3DM0 A;  1NV6 A;  4PF8 A;  2OWT A;  4GWU A;  2XXX A;  1UIV A;  1UTH A;  3G3G A;  3ECR A;  3O97 A;  2Z8D A;  4QBA A;  3S9N C;  1N3X A;  4PAK A;  1DTG A;  3U65 A;  4AS5 A;  2H5Y A;  2PMS A;  2GFE A;  3KJT A;  3KC1 A;  4WXJ A;  4GL8 A;  3RPW A;  1ZTY A;  2CMO A;  2F7B A;  3MBP A;  1FW0 A;  1FQC A;  3E78 A;  5CBS A;  4JBZ A;  1NV2 A;  3FUZ A;  4OQO A;  4XFE A;  1P1Q A;  3OMB A;  4RNS A;  3C4M A;  3K1P A;  1MXZ A;  3MC2 A;  3IJX B;  4KQP A;  1LBC A;  1MY0 A;  2F8D A;  4F18 A;  1QVS A;  1FQA A;  4MX6 A;  4RY1 A;  3BFT A;  4AB5 A;  1NNT A;  5BUU A;  3V89 B;  4ZZA A;  2O1L A;  3JYR A;  3PPN A;  5DEX A;  3W9V A;  1K9Z A;  4PDH A;  5DW8 A;  3PUW E;  1LCT A;  5L8D A;  3T66 A;  1O63 A;  4O8M A;  1IZ1 A;  3IFC A;  4XKP A;  4PET A;  1O64 A;  2ZZW A;  3CI8 A;  1R9Q A;  4ZDM A;  2V4C A;  3PUY E;  1DTZ A;  1AH5 A;  1DMB A;  3SES A;  3FVN A;  1FJ6 A;  1MXV A;  4PDD A;  2REJ A;  4H46 A;  4U2R A;  4PFI A;  1IIT A;  3M8U A;  3SEU A;  4NF8 A;  1B4Z A;  1TXF A;  1RYO A;  1EZ9 A;  3KEI A;  5CMK A;  3C36 A;  3D1R A;  1NFT A;  1Q35 A;  4IB2 A;  2Y7R A;  1FCK A;  1FPF A;  2AIX A;  4G8N A;  3KSX A;  2PBW A;  2WBD A;  4EQB A;  1US5 A;  4ND9 A;  2V93 A;  3LV0 A;  4BDQ A;  2F7C A;  4ZE9 A;  4ESX A;  2OZZ A;  2THI A;  1JEV A;  5H8Q B;  1MY4 A;  1KWH A;  4R72 A;  1J1N A;  4JXI A;  3HHF A;  5TP9 A;  2X7P A;  2UVG A;  3RQT A;  4QFO A;  4DDD A;  1SD3 A;  4KI0 E;  4KPT A;  3FJG A;  1MPD A;  1YCJ A;  2UXA A;  1RYX A;  3A09 A;  4N17 A;  2ZYN A;  3ILU B;  3DP4 A;  3TQW A;  2XX9 A;  3T0J A;  3HHG A;  3KOS A;  1LBX A;  3MP8 A;  4G8M A;  3N5L A;  2I4B A;  3K6W A;  1GGG A;  3VLV A;  3BBR A;  2IA4 A;  2WYP A;  4DIG A;  5CBR A;  5ET5 A;  2UVI A;  1Y3P A;  3G7W A;  2HPG A;  3B7D A;  3HCQ A;  3OOA A;  1ANF A;  2H99 A;  2R6G E;  1N84 A;  5IGA A;  4KYD A;  2O69 A;  2UVH A;  4QSD A;  1D4N A;  4G61 A;  1US4 A;  1VFE A;  4YAH X;  4GXA A;  4IGT A;  1WDN A;  5IZ3 B;  4PGP A;  1DOT A;  2V3U A;  1JW1 A;  3USD A;  2CZI A;  4P1L A;  3BIG A;  5I59 B;  1B3L A;  2QMW A;  2AL5 A;  3OEN A;  2NXO A;  1EYI A;  3KSJ A;  1K9Y A;  3G3F A;  4F39 A;  3OXN A;  4ELQ A;  1MY1 A;  2ZMB A;  3E9X A;  1B5J A;  1SPI A;  4LZ7 A;  1MXU A;  4IO4 A;  1KA0 A;  4PGN A;  4ZZE A;  2O68 A;  3W9W A;  1NH7 A;  3BIH A;  3CVG A;  4RPN A;  5CMC A;  2P0S A;  2I6E A;  3SER A;  2QL3 A;  1N04 A;  2OBG A;  2RIN A;  5F7V A;  4YB5 A;  2HZK A;  4F3B A;  3KBR A;  3FD3 A;  4FOR A;  3ISP A;  2B4M A;  3SKP A;  4U21 A;  1FTA A;  3CFL A;  1XVY A;  1MQD A;  1MDQ A;  4POW A;  1FTL A;  4QFN A;  1FTK A;  4C1U A;  4PP0 A;  4H5F A;  2PFY A;  4U4S A;  4GFR A;  4BLA A;  4OVR A;  4OEN A;  5CMM A;  3U94 A;  5I58 A;  4PBH A;  3KZG A;  3O6G A;  2HEU A;  3V8X B;  3IO6 A;  2HQ0 A;  3SEV A;  1I6Q A;  2PVU A;  4OEU A;  4R6K A;  1FBP A;  1IUD A;  3PD8 A;  4P47 A;  1MY3 A;  1FPB A;  3VVE A;  3MW0 A;  4YB7 A;  1XT8 A;  2HAV A;  3TEP A;  3H3G A;  5FHO A;  5K2X A;  2ALU A;  2I48 A;  1PDA A;  5EQ8 A;  1N7W A;  3LC8 A;  4JWY A;  2I58 A;  2XXV A;  2XWK A;  1ELJ A;  4OHN A;  4OYV A;  5CRY A;  4R73 A;  1BP5 A;  1ZIU A;  3RN8 A;  4R6H A;  4OXV A;  1M5B A;  2Z22 A;  3VDF A;  1LBY A;  4JSO A;  4MIJ A;  3IB0 A;  1UTB B;  1NV5 A;  2Q89 A;  3PUV E;  2UYF A;  3PMX A;  3IOV A;  4NF6 A;  3V83 A;  1B52 A;  2PX1 A;  4NWC A;  1LBB A;  4LON B;  4XEQ A;  4I3E A;  4OVQ A;  5I2N B;  1I69 A;  4ONY A;  4NWD A;  4F29 A;  5FHM A;  3EHS A;  3RT8 A;  1B32 A;  3FXR A;  2OJT A;  4GWO A;  4P9K A;  4ZEI A;  4C0R A;  3QXM A;  3S9L C;  2WBB A;  3MVW A;  1ZJL A;  5K2Y A;  1P99 A;  2X26 A;  5I2K B;  1NV0 A;  4QHQ A;  5I7I A;  4R2F A;  3TCG A;  1Y3Q A;  1G0I A;  1B9J A;  1RDX A;  4FED A;  4MMP A;  4QFP A;  5KDT A;  5H8N A;  4QSC A;  5AA2 B;  4PE3 A;  4KHZ E;  3D4G A;  2F3D A;  5EYH A;  1B05 A;  1YZ0 A;  4YZZ A;  4NX1 A;  1N7X A;  3IL1 B;  4JVI A;  2DWJ A;  3S2V A;  1H43 A;  3TCF A;  1FSA A;  1SI0 A;  5T3J A;  4P1E A;  2JJK A;  1A8E A;  1DSN A;  2O1M A;  1Z7N E;  4X1D A;  4LZ5 A;  1R1N A;  1B58 A;  3RUM A;  4DCX A;  2AL4 A;  1FBF A;  2Y7I A;  3R26 A;  1BK4 A;  3FXB A;  3OEL A;  1IMA A;  2XX7 A;  5EYG A;  3MZ9 A;  1KA1 A;  1UIU A;  3OSQ A;  5FBP A;  1IXI A;  3HST A;  5HM4 B;  3IOT A;  1YPN A;  3L6H A;  3UK4 A;  3H6W A;  3B6Q A;  2B4L A;  1MRP A;  2VHA A;  3QIM A;  1GVC A;  1UTH B;  1LB9 A;  4XXU A;  3H06 B;  1USY E;  4GX6 A;  2F6G A;  4QF9 A;  3MP6 A;  2F7A A;  4KR5 A;  3HPI A;  3TUS A;  3OSR A;  1VE4 A;  4H6D A;  2WEF A;  1QUL A;  4HE0 A;  2O6A A;  1QW0 A;  4EF1 A;  4GIZ A;  2F34 A;  1FPI A;  4Z7E A;  2P3N A;  2F3B A;  3QYT A;  1LFI A;  5IM2 A;  4GX3 A;  4JVD A;  4PCD A;  1B1X A;  2KR0 A;  4UAB A;  1JW4 A;  2VPN A;  4I3Y A;  2DP8 A;  3K0V A;  5KZT A;  3K02 A;  4EF2 A;  3IOR A;  3FJ7 A;  4OVJ A;  5ICQ A;  4QFK A;  1B40 A;  4KFQ A;  4QSE A;  5B7D A;  3TOD A;  2DYX A;  2GH9 A;  3O28 A;  3KGC A;  3PUZ E;  4AB6 A;  2GQ1 A;  1JET A;  2W7Y A;  4N91 A;  4PFR A;  4EXK A;  4N07 A;  2NUV A;  4I1D A;  2CZK A;  2ONR A;  5CI5 A;  3A3C A;  4ZEK A;  4NE4 A;  3SEY A;  2OX3 A;  2YJP A;  3T9H B;  1OIB A;  3TEL A;  2XXY A;  4HTG A;  3RLF E;  3GLB A;  1SI1 A;  1SBP A;  3PPO A;  1Y20 A;  3LUZ A;  4U23 A;  1RDY A;  4QFL A;  1H44 A;  1OQH A;  2VPO A;  2VD3 A;  4IY5 A;  4NQ8 A;  1NH8 A;  3CG1 A;  2RCA A;  3VXC A;  1BLF A;  1PBP A;  2BJJ X;  3JZJ A;  3PMW A;  4WED A;  3PPR A;  4NF8 B;  2DVZ A;  3BFU A;  4MNC A;  2ABH A;  5F24 A;  4BDN A;  4OVP A;  4DXB A;  1M5F A;  3IOW A;  1EYJ A;  3VV5 A;  1QUK A;  2CEX A;  3E13 X;  3LSF B;  1SYH A;  2D3I A;  3TAJ A;  4PE5 B;  4U1O A;  1PBQ A;  4ECF A;  5H8H A;  3O2A A;  1EZP A;  5IZZ A;  4MBP A;  2I3W A;  1D9V A;  3F11 A;  3LSX A;  2H98 A;  3PV0 E;  1CNQ A;  1D9Y A;  4NG7 A;  4KXP A;  4BDM A;  4MLQ A;  4H8J A;  1HSE A;  3TTM A;  4FEB A;  3OO6 A;  3MP1 A;  1IMC A;  2XXI A;  5TP9 B;  2F35 A;  1IXG A;  3MAM A;  1A40 A;  4F3G A;  4WEP A;  2E0S A;  4F1Y A;  5ET6 A;  4EUO A;  4HE1 A;  2QS1 A;  3FJM A;  4PBQ A;  4HE2 A;  4NMY A;  1DBZ A;  1LB8 A;  2GHA A;  3DEL B;  3FV1 A;  3UN6 A;  5IZ1 A;  4MJO A;  3CSG A;  1FBH A;  4QRZ A;  3E3K A;  1GV8 A;  2Q2C A;  4XKN A;  2QJE A;  2HXR A;  1USY H;  1WOD A;  4FIM A;  3TFL A;  2NWJ A;  4OWD A;  1NUY A;  2QMX A;  2XD2 A;  4F3S A;  4MCO A;  4XKR A;  4FBP A;  2HXW A;  5CMB A;  3T9U A;  1FQB A;  3Q26 A;  3MUQ A;  2Q8J A;  2XXH A;  4X9T A;  3FGS A;  2V84 A;  1IQ7 A;  1Z7M E;  4G8H A;  1ZKB A;  2CZH A;  3CG3 A;  5DYH A;  3VVD A;  5JTY A;  3O6I A;  1H76 A;  4JVC A;  3QMF A;  3MYU A;  4PTK A;  3NOH A;  2Y5K A;  1SDX A;  4IR8 A;  1ATG A;  5EQ7 A;  1R9L A;  1XS5 A;  4GWZ A;  2RKM A;  5IAI A;  2XWO A;  4GQO A;  1LCF A;  3S9E A;  2A5S A;  1H45 A;  4O94 A;  1I6A A;  4RPO A;  5EQA A;  5AA1 A;  2YLN A;  1MXX A;  3IFA A;  1FBC A;  3CRB A;  3IX1 A;  1LST A;  2F78 A;  3RTW B;  3CFX A;  4GBW A;  3OEM A;  3TZA A;  1N3W A;  1Q9D A;  1MG1 A;  3T9V A;  1B0H A;  1QGX A;  4GBV A;  4P8B A;  4HW8 A;  2ZYO A;  3EQ1 A;  3QUF A;  1YXI A;  5ET7 A;  2MKZ A;  2HZL A;  4GLI A;  1B5I A;  3R6U A;  4YB6 A;  5FHN A;  4Q30 B;  4OFL A;  3ZKL A;  2ESN A;  2Q2A A;  1NL5 A;  1FTM A;  5H8S A;  3LR1 A;  5I58 B;  3LUY A;  4C1T A;  3H7M A;  3S9M C;  1FPJ A;  3T9X B;  3I5O A;  1B6H A;  5ESY A;  3L6G A;  4G68 A;  1FQE A;  1MDP 1;  1MQG A;  2HCA A;  4NAP A;  3RY3 A;  2Q9T A;  1BKA A;  3B8B A;  3GXA A;  3FXQ A;  1YAE A;  3SEW A;  1OMP A;  4L17 A;  4OTE A;  2REG A;  2OLB A;  4MFI A;  5I56 A;  2UYE A;  4MLV A;  2D5W A;  1VDW A;  3H03 A;  3FVO A;  3TYH A;  4LAT A;  2OWS A;  2FVZ A;  3HFU A;  4N4U A;  1FQD A;  3IR1 A;  4LP2 B;  3K6U A;  5L9S A;  4O3C A;  4F1U A;  1N76 A;  4GX4 A;  5A5L A;  3U8Q A;  3ZSF A;  1B2H A;  2HFB A;  1OQG A;  4NF6 B;  2Y7W A;  3DLN A;  2UVJ A;  2FBP A;  3VLW A;  4MEV A;  5M2V A;  1TFA A;  4R75 A;  1RKM A;  3IAZ A;  4GXS B;  3EHT A;  4X48 A;  5A5X A;  2Y7K A;  2GRV A;  3C31 A;  4I9D A;  3IK6 B;  3VVF A;  1FPK A;  3DP8 A;  4DXC A;  1VR5 A;  5J1D A;  4O7M A;  3SET A;  1IIW A;  2I0B A;  4FEC A;  3N6U A;  2PFZ A;  1IXC A;  2OPE A;  1FBE A;  4PFW A;  1Y3N A;  5KDT B;  4Q0C A;  5AA4 A;  5H8N B;  3WAF A;  4EQ9 A;  2DWI A;  1M5C A;  2DVC A;  4RK9 A;  4P56 A;  1B7U A;  4NN3 A;  1M5E A;  2OCU A;  4ZEC A;  5JK4 A;  1F9B A;  1Q1K A;  4NTL A;  2DWH A;  3UP9 A;  4MNP A;  3H6T A;  4YMB A;  3QUJ A;  3V5A A;  3M3K A;  3U1O A;  1A55 A;  3EF7 A;  4N6P A;  1LBZ A;  2CZL A;  1FBG A;  3KC0 A;  1PB9 A;  4IGR A;  4I62 A;  2O84 X;  4TOZ A;  4X04 A;  4MF3 A;  2QVV A;  4TLL B;  2H4I A;  2VOZ A;  4DCY A;  2XHD A;  3Q29 A;  4U4X A;  2VT5 A;  3C35 A;  5ICT A;  4GWS A;  4LZ8 A;  2I0C A;  4EDP A;  3TTR A;  3S4U A;  4HS7 A;  3PU5 A;  1JEU A;  2HAU A;  1MQH A;  3T1B A;  1VSO A;  3CFZ A;  4JWX A;  4K3F A;  1PB7 A;  2QS4 A;  3C34 A;  2V3T A;  4RYA A;  3KN8 A;  1FRP A;  3RT6 B;  2XWI A;  3THI A;  1GR2 A;  1WVJ A;  2F6P A;  1IMB A;  1EU8 A;  4R9F A;  2Q8M A;  2B3F A;  3RYD A;  4NED A;  2V25 A;  5JEI A;  4H45 A;  1B0L A;  4WKM A;  2XXU A;  4F31 B;  2ZNU A;  5ET8 A;  1S50 A;  1AL3 A;  5DT6 A;  4GOT A;  1EYK A;  4I8C A;  1MM7 A;  3MWB A;  3MQ9 A;  2PT2 A;  1POT A;  4F22 A;  4XF5 A;  1MH4 A;  3C33 A;  5IKB A;  3UA8 A;  5BWJ A;  1SYI A;  1JQF A;  1FTJ A;  2P1S A;  3K4U A;  3N26 A;  4ELP A;  2DE3 A;  3K6V A;  1B3E A;  3A29 A;  4IO2 A;  3IJO B;  4DI3 D;  1NI9 A;  2DS9 A;  4RK2 A;  2FYI A;  4GWY A;  4TLM B;  3FVG A;  1LBW A;  1HSL A;  1MQI A;  2ZNS A;  1URD A;  2Y7P A;  3O66 A;  4HXV A;  2FIE A;  2XXK A;  3MVY A;  4OVS A;  2XA5 A;  4LVQ A;  3PGF A;  1B7H A;  5DVI A;  3K6X A;  3Q27 A;  2G93 A;  1POY 1;  3H6U A;  3KG2 A;  1P1N A;  3PPQ A;  4PAI A;  2XWV A;  1NNF A;  1XI6 A;  2IEE A;  3MST A;  5FTH A;  3MZ1 A;  4P3L A;  4XTC Q;  3WAE A;  1NUX A;  3QSL A;  1T0K A;  2I4C A;  2AYS A;  1Y4T A;  2FNC A;  3PMV A;  1Y4C A;  4DE8 A;  3TMG A;  1L5T A;  3T22 A;  4F3P A;  3CIJ A;  4HCW A;  1MPB A;  5HPQ A;  1B3F A;  4MNI A;  5KCJ A;  4RXL A;  3MVX A;  1FTO A;  2KLF A;  5H8H B;  3LBS A;  3RGY A;  4N6D A;  4OMB A;  3EN3 A;  4OFJ A;  3VLU A;  1QKB A;  1MPC A;  4Q5T A;  3IB2 A;  1CE2 A;  4LQ5 A;  5ELV A;  5CC2 A;  3CSB A;  2ZYK A;  2XXT A;  1NV3 A;  4H8I A;  3K00 A;  2DXY A;  3C9H A;  3EKI A;  3FVK A;  1URS A;  4H65 A;  1JNF A;  4JSD A;  2XXR A;  3O6H A;  4OVT A;  1ZLQ A;  2DDK A;  5AA2 D;  3GYY A;  1LFH A;  2XXW A;  3K2D A;  4PAF A;  1DCU A;  3B6T A;  4OER A;  5TPA A;  4M1V A;  3DP6 A;  3K01 A;  1IEJ A;  4POX A;  1O7T A;  4NF4 A;  2Z8E A;  2RC8 A;  3MJN A;  4F2Q A;  4LA9 A;  3LSW A;  1TT1 A;  4KYS A;  5I57 A;  1RDZ A;  4NHB A;  4MH5 A;  3G3H A;  3KN7 A;  1B4H A;  2A5T A;  4YMA A;  3TQL A;  2DWA A;  1IMD A; 
#chains in the Genus database with same CATH homology
 3KBZ A;  4F1V A;  1FBP A;  4GBW A;  4NF0 A;  4P47 A;  1Q9D A;  1AWB A;  1FPB A;  4YIC A;  4OA4 A;  4N6K A;  1QGX A;  4GBV A;  5LTC A;  1FPE A;  1NUW A;  4P8B A;  1YXI A;  5ET7 A;  5EQ8 A;  2MKZ A;  2HZL A;  1IMF A;  2L5V A;  4X8R A;  4NGU A;  4DI4 B;  2XWK A;  2QPQ A;  4N15 A;  4MHF A;  1LBY A;  4MIJ A;  1FPJ A;  1NV5 A;  2HHM A;  5ESY A;  1IME A;  4NAP A;  2Q9T A;  3B8B A;  1NV7 A;  4XEQ A;  4I3E A;  4OVQ A;  1D9Q A;  2FIX A;  4AS4 A;  1VDW A;  2FVZ A;  3HFU A;  4N4U A;  4P9K A;  4OAN A;  4PFB A;  4F1U A;  2WBB A;  1IMD A;  4GX4 A;  5A5L A;  4N8Y A;  1NV0 A;  5I7I A;  2F5X A;  1G0I A;  3E79 A;  1RDX A;  4MMP A;  1FJ9 A;  2QVR A;  1FBD A;  4PE3 A;  2F3D A;  2FBP A;  4MEV A;  5EYH A;  5J16 A;  1YZ0 A;  3RPL B;  4YZZ A;  1NV6 A;  4NX1 A;  4JVI A;  3ROJ A;  4PF8 A;  4GWU A;  4QXD A;  1FSA A;  5T3J A;  4P1E A;  2JJK A;  5I5P A;  4QBA A;  4GWX A;  4O7I A;  5EQ9 A;  4PAK A;  3U65 A;  4AS5 A;  1FPK A;  5J1D A;  3KC1 A;  1FBF A;  4O7M A;  1BK4 A;  4N81 A;  2PFZ A;  3FXB A;  1IMA A;  5EYG A;  1FBE A;  1KA1 A;  3E78 A;  5FBP A;  1NV2 A;  4XFE A;  4P56 A;  3PTY A;  4NN3 A;  2B4L A;  2P3V A;  5JK4 A;  4F18 A;  3B50 A;  4MNP A;  4MX6 A;  1NV1 A;  4GX6 A;  1INP A;  1LBZ A;  4F19 A;  1FBG A;  3W9V A;  1K9Z A;  3KC0 A;  4PDH A;  2R8T A;  5DW8 A;  2WEF A;  4PF6 A;  4HE0 A;  4O8M A;  3RPL A;  4X04 A;  3IFC A;  4PET A;  2ZZW A;  1LBV A;  2QVV A;  1FPI A;  2P3N A;  2V4C A;  2Y5L A;  2F3B A;  2PCR A;  1NUZ A;  5IM2 A;  2VT5 A;  1FPD A;  4GX3 A;  1FJ6 A;  4JVD A;  4PCD A;  4GWS A;  2KR0 A;  4UAB A;  2VPN A;  4PDD A;  4I3Y A;  4H46 A;  4PFI A;  5I3S A;  3T1B A;  1DK4 A;  1NV4 A;  3D1R A;  2GQ1 A;  4N91 A;  1FRP A;  1FPF A;  4PFR A;  2XWI A;  2CZK A;  1FPL A;  2WBD A;  1IMB A;  2OX3 A;  2Q8M A;  3LV0 A;  3RYD A;  4H45 A;  2Q74 A;  5ET8 A;  2ZZV A;  1EYK A;  3LUZ A;  4XF5 A;  1RDY A;  2DE2 A;  2VPO A;  4NQ8 A;  5IZ3 A;  2DVZ A;  2V3Q A;  4MNC A;  5F24 A;  4I40 A;  4OVP A;  2DE3 A;  3A29 A;  4GWW A;  1EYJ A;  4LN5 A;  4DI3 D;  2ZZX A;  1NI9 A;  2CEX A;  4N17 A;  4GWY A;  3FBP A;  1LBW A;  3T0J A;  2DE4 A;  2QFL A;  1LBX A;  1KZ8 A;  4HXV A;  5IZZ A;  2FIE A;  2XXK A;  4OVS A;  2XA5 A;  2WYP A;  5ET5 A;  2OWZ A;  1CNQ A;  2HPG A;  2WYK A;  4NG7 A;  4KXP A;  2KQZ A;  4PAI A;  2XWV A;  5IGA A;  1XI6 A;  3MST A;  1IMC A;  4P3L A;  4G61 A;  1NUX A;  5IZ3 B;  4PGP A;  2CEY A;  2CZI A;  4P1L A;  3BIG A;  5ET6 A;  4HE1 A;  4PBQ A;  4HE2 A;  1DBZ A;  4HCW A;  4MNI A;  1EYI A;  1K9Y A;  5IZ1 A;  4MJO A;  4N8G A;  1FBH A;  1G0H A;  4N6D A;  4HCY A;  2HXR A;  1SPI A;  2QVU A;  1NUY A;  1JP4 A;  1KA0 A;  4MCO A;  4PGN A;  4FBP A;  3W9W A;  3CHG A;  3BIH A;  4PC9 A;  1NV3 A;  5LDZ A;  4X9T A;  3EKI A;  4MAG A;  2HZK A;  2CZH A;  1FPG A;  4JVC A;  4OVT A;  2DDK A;  3QMF A;  2FHY A;  3ISP A;  3GYY A;  4PAF A;  3NOH A;  3MYU A;  4PTK A;  2B4M A;  2Y5K A;  3SZP A;  1FTA A;  1DCU A;  4IR8 A;  5EQ7 A;  1LEV A;  4M1V A;  4GWZ A;  2XWO A;  2WX9 A;  4O94 A;  2PFY A;  5EQA A;  4OVR A;  1RDZ A;  4NHB A;  2BJI A;  1YYZ A;  4PBH A;  5CM6 A;  3IFA A;  1FBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...