4GWSA

Crystal structure of amp complexes of porcine liver fructose-1,6-bisphosphatase with filled central cavity
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
327
Chain Sequence
NIVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAIHRAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMVNGVNCFMYDPAIGEFILVDRDVKIKKKGSIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVPTDIHQRAPIILGSPEDVTELLEIYQKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Hydrophobic Central Cavity in Fructose-1,6-bisphosphatase is Essential for the Synergism in AMP/Fructose 2,6-bisphosphate Inhibition
rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 101
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4gwsA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4gwsA02
5IZ3B 3RPLB 4I3YA 4GBWA 1EYJA 1LBXA 3RYDA 2F3BA 4HE1A 2F3DA 1FPDA 3BIGA 1DK4A 1NUZA 3IFAA 5EYGA 3T0JA 5FBPA 2JJKA 2OX3A 5EQ7A 4GWSA 5F24A 1D9QA 2QVRA 1CNQA 1IMEA 1FPLA 1NV3A 2FIXA 5ET8A 1FBPA 5ESYA 2QVUA 2FBPA 4N81A 1NV6A 4GWZA 1FJ6A 5I3SA 1IMBA 1NUXA 3B8BA 1LBYA 1LBWA 2BJIA 3QMFA 2CZKA 4HE0A 4HXVA 2DDKA 3RPLA 4AS4A 1NUWA 4GX4A 1FPIA 1YZ0A 4I3EA 1G0HA 1YXIA 4GWYA 5EQ8A 1FBHA 1NV5A 2VT5A 4G61A 2QFLA 1NV7A 1DBZA 4H46A 4HE2A 3IFCA 2WBDA 1FSAA 1FBDA 4O7IA 2QVVA 1XI6A 1AWBA 1LEVA 5EYHA 1JP4A 5IZ3A 1FBCA 1K9ZA 1FBEA 1NV4A 4PTKA 1INPA 1SPIA 1RDZA 4QXDA 2Y5LA 1FPJA 1BK4A 4GWWA 5ET7A 1IMFA 3D1RA 4H45A 1KZ8A 2GQ1A 1IMAA 5J16A 5EQAA 1FPGA 2CZIA 2Q74A 4GX3A 3LUZA 2CZHA 1EYIA 1IMCA 4IR8A 3A29A 5LDZA 2WBBA 2Q8MA 1RDXA 5DW8A 4GX6A 1FJ9A 1RDYA 1FPFA 5ET5A 5IZ1A 1FBGA 4KXPA 3KC0A 1Q9DA 3KBZA 2OWZA 1G0IA 1NV0A 2WEFA 2HHMA 5ET6A 3LV0A 3FBPA 1KA0A 2R8TA 1NV1A 1EYKA 1QGXA 4GWXA 2P3NA 1YYZA 1LBZA 3BIHA 1NV2A 5A5LA 1NUYA 3ROJA 4FBPA 1FPKA 1FPEA 4GBVA 2FIEA 4MJOA 4GWUA 1FTAA 5T3JA 1KA1A 2FHYA 4I40A 1FPBA 1VDWA 2PCRA 1IMDA 1FBFA 2P3VA 2Y5KA 5EQ9A 1K9YA 1DCUA 3KC1A 2FVZA 1LBVA 1FRPA 4AS5A 1NI9A
chains in the Genus database with same CATH superfamily
5IZ3B 1B3HA 1N3WA 3MP8A 1OVBA 4NF5A 1GR2A 1MM6A 1Q35A 1DMBA 2XD3A 3MAMA 2H99A 4LP2B 3PUXE 4POWA 1IZ1A 4OVPA 1HSJA 4AS4A 3SERA 1Z7NE 1B32A 1B5JA 1NNPA 2GFEA 1WDNA 4G61A 3PPRA 4R9GA 1UTHB 3RN8A 1A7LA 3QIMA 1LFIA 4NE4A 4TLLB 2IA4A 3IL1B 3CI8A 4XKRA 4EF2A 4H6DA 1FQEA 1FTOA 2DE4A 1N0TA 4GWWA 3M3LA 2Q9TA 2Y84A 4NF5B 4R9FA 2V93A 2R6GE 3VVDA 5DVFA 5ICTA 3OOAA 1LCFA 4JB7A 5I59A 3T9HB 4IO7A 3IR1A 4PDDA 4RJZA 3E3KA 3TTLA 3LV0A 2ONSA 2YPNA 3FBPA 1MQDA 1SYHA 3C36A 2Y7KA 2Y7IA 3RY3A 4YB5A 3W15C 3OSQA 4NG7A 2DOJA 1BLFA 4R6KA 2FHYA 4XTCQ 2BJJX 1FBFA 2P3VA 2I3WA 2PCRA 3O6IA 1FTJA 1EYJA 5I2NB 3IB2A 5CMKA 3UN6A 1I6BA 2OX3A 2H25A 3MPLA 2XX9A 2B4MA 4G68B 1IEJA 5AA4B 4GWYA 3KZGA 4R6HA 1NKXA 1FTKA 4MX6A 2QL3A 3E4RA 1P1QA 3GZGA 3FJGA 1ZU0A 2H5YA 3KN3A 2OLBA 3T22A 1MXZA 2Q88A 1INPA 3IB1A 2PFZA 3K6XA 1SW2A 5HM4B 3VDFA 1ZMGA 1MXXA 3LUZA 1PB7A 2RF1A 4XXUA 4N6DA 4H8IA 4PFYA 3MBPA 1O64A 4ZEBA 1AIVA 2WEFA 3ISPA 1B3EA 4MAGA 4WEDA 1Y4CA 3R7XA 3UK4A 2F36A 3TCFA 2D21A 2D5WA 3EHSA 4G4PA 5AA2D 4YMBA 3SEUA 3G3FA 4G68C 3PUWE 1B5HA 1R1NA 3TTNA 2H9BA 4U1ZA 3E9XA 4BDMA 3K00A 3ODBA 4QBAA 1WODA 3B6TA 1QUIA 1MY2A 3G3GA 4QF9A 1FJ6A 4PFBA 3W9VA 3G3KA 1JEUA 1KWHA 2XXKA 1B7HA 2AL5A 2B65A 4I62A 1US5A 1LAHE 2VT5A 4QFKA 1B0HA 4QHQA 3OO8A 5B7DA 3LR1A 4N15A 5I84A 3B6QA 1LGBC 3MP1A 2QSXA 1VFDA 4FE8A 4JWYA 1SPIA 2DE2A 1P1NA 4PQJA 4PAKA 1R6ZA 5IM2A 5EQAA 1TFDA 4U22A 4ZZAA 4NF4A 3PMVA 2E0SA 1YTVA 4OTEA 3VVEA 5CM6A 3OD7A 1JNFA 3FUZA 2RCAA 4GX6A 4NN3A 3FXUA 4KXPA 4F1UA 2B3FA 4OQOA 4U21A 5ET6A 4Q8RA 1R9LA 2Y7RA 3OSRA 3JZJA 5FHOA 5I57A 3O6HA 2HPGA 1JVXA 1SW5A 4U2RA 3TQWA 3CVGA 4GBVA 3MVZA 4MJOA 1IQ7A 4KD5A 2QRYA 3AXFA 1B3LA 1XHYA 1FPBA 4EXLA 3N6TA 5TP9B 4NEDA 1EH3A 3KN8A 2XXQA 4HE1A 2Q2CA 4OMBA 3N5LA 1HSLA 1D9QA 3CG3A 3ILTB 2XXXA 4NF4B 4E0XA 1A54A 4IO6A 2O69A 2V3UA 2QVUA 2I0CA 4NX1A 3G3JA 3V89B 1FQDA 4LUBA 4YAHX 4LONB 4Q0CA 2CEXA 2BJIA 5H8QA 2AIXA 4R73A 4GX4A 1S50A 3K2DA 1ATGA 2XHDA 4JVIA 1ELJA 5DEXA 3DP8A 3O29A 5I57B 3PGFA 4DXCA 2DE3A 1VR5A 2X26A 4ELRA 3USDA 2UYFA 1UIVA 2XXWA 5M2VA 4G8NA 1FBCA 1FBEA 4HW8A 4F29A 1OMPA 2DSFA 4FAJA 4YU0A 3TTKA 1IXIA 1NNTA 4WXJA 2RC9A 4MFIA 2V3QA 2HAVA 2Q8MA 4OVSA 4QSDA 1FTMA 4AQ4A 1B3FA 4DCYA 3MZBA 4RPOA 2ESNA 2P1SA 3I6VA 3CIJA 3S9LC 1DPEA 3RNNA 4XKNA 1I69A 2XX8A 1YYZA 1DPPA 5DEXB 2ZNTA 4ISUA 2Y7PA 1FPKA 4OA4A 2F35A 1MQIA 4P8BA 1FCKA 3K0VA 3GBBA 1OIBA 3RYDA 3FIRA 4ZDMA 3HO7A 4NAPA 5EQ7A 1XS5A 1ANFA 3G3HA 4EDPA 2HXWA 2GHBA 4QSEA 3WAFA 4N81A 1LAGE 4GWZA 2XXUA 4QSCA 2DWJA 1D4NA 3T9XB 1IUDA 3H6VA 2FA7A 3IB0A 4GFRA 4ZECA 3PTYA 4PGNA 1UTBA 4GLIA 2XWOA 1IIWA 2XXVA 3HHGA 5ITPA 5K2YA 3KJTA 3CFZA 2DVZA 2QVVA 1LEVA 2GRVA 3A3CA 2WYKA 3OO7A 4P3LA 4KYDA 2Q89A 1FQAA 1KZ8A 4P47A 2Q2AA 5I58A 1P99A 2VPNA 3RPWA 1MXVA 2OWZA 1A99A 1FW0A 3QUFA 4AB6A 1I6AA 1QGXA 3KGCA 4E0WA 3LBSA 2XXIA 1PC3A 4ZS9A 4OERA 1NH8A 3PPQA 1A8FA 4HCWA 5I5PA 4Z0IA 4MLQA 3OO6A 1PBQA 5T3JA 2QS1A 4BDOA 3K6VA 3TUSA 4JBZA 1SVXB 1DCUA 3RPLB 2KQZA 2F3DA 3BIGA 4MEVA 3O28A 5FBPA 4H8JA 1MXYA 4R2FA 4OHNA 3NOHA 2QJEA 2VD2A 4O3AA 2PT1A 4PP0A 2Z8EA 3H7MA 1XVXA 5I3SA 1MRPA 4NHBA 4GL8A 1LB8A 4LATA 4LN5A 2F6PA 3K6WA 1H44A 1MDQA 1YAEA 4HCYA 3V5AA 1NV7A 3MVXA 4XF5A 3LSWA 3U8QA 2VPOA 1MPCA 3T1BA 2DXRA 4G8MA 4C1TA 1NL5A 3VLUA 3N6UA 4X1BA 4DZ1A 1XI6A 2DQVA 2QMXA 2DVCA 3IOTA 4ONYA 3U94A 1GVCA 4ZEKA 1K9ZA 4O3CA 3E79A 4QXDA 2GQ1A 5J16A 3U72A 3SEWA 4MCOA 3MP6A 3UA8A 2X7PA 3QUJA 5DT6A 4GD5A 3RUMA 1DSNA 3SEVA 1FQFA 1LBCA 3KJ7A 4PFWA 3IOWA 2PBWA 1SD3A 4UA8A 1JQFA 2X7QA 2P2AA 4F1YA 1TT1A 2ZNSA 3VXCA 4NF6A 4X48A 1XT8A 2Z8FA 3MSTA 3RQTA 1YPNA 2NVUB 2F7CA 4PFTA 2FVZA 5I56A 1PB9A 2AYSA 1H45A 4HTGA 1DK4A 4ESWA 4KCCA 2LAOA 3C31A 3OENA 2JJKA 4RK2A 5ET8A 3VVFA 4XEQA 1M5FA 2V4CA 3SESA 1B3GA 2ZMBA 2XWVA 3FJ7A 2I4BA 1VFEA 3MUQA 4R6YA 1YZ0A 1MH4A 1PDAA 1YXIA 3K02A 4ZE9A 1NNFA 3TZAA 3OEKA 2ALUA 4F19A 4NF6B 1BIYA 1B6HA 1NH7A 2NUVA 3FVOA 4NF0A 4LZ5A 1ZIUA 5I59B 1EZOA 4F3SA 4DXBA 2OZZA 5I56B 4MF3A 1GTKA 4I9DA 3EKIA 5EHMA 3KG2A 4RK9A 1IMFA 4FIMA 1N3XA 1JW1A 2B4LA 3Q28A 2XXYA 3SETA 3FV1A 3HHFA 3MW0A 3B6WA 4F3GA 3MVWA 4MIJA 4KHZE 3FASA 3O6GA 1Y20A 2ZZWA 5DVJA 1FBGA 1NV0A 3MZ1A 4TQUQ 1T0KA 3S9EA 3OO9A 1AMFA 1SW4A 4DI4B 5A5LA 3ZKKA 3TCHA 5BUUA 4U23A 1JW5A 2G93A 3KN7A 1VDWA 3D4CA 1NI9A 2I48A 4PETA 4WEPA 1Y1ZA 4LQ2A 1SYIA 3EHTA 4OESA 3IFAA 2VGQA 5L9MA 4YKPA 4GWSA 4DXUA 4IY6A 2QVRA 4OETA 4PDHA 2FIXA 1UIUA 3PU5A 3B8BA 3DP4A 4OEUA 3WAEA 4G2ZA 4P0IA 4GF8A 1P1WA 2XWKA 4R2BA 1F9BA 3PPNA 4PAIA 2I6EA 3MQ9A 1N04A 1DBZA 4U1OA 3TODA 2OK2A 1FBDA 3MPKA 3FVNA 3U92A 3H06B 2HCAA 4U4XA 2VD3A 2NOOA 4PTKA 1S9TA 2Y5LA 3OMBA 2QS3A 3HPIA 1OQHA 2ONRA 2Q74A 5HBCA 3PUYE 2XX7A 3F11A 1RDXA 5ET5A 2O7IA 2DS9A 4X8RA 1FTLA 3OXNA 3PUVE 4EQ7A 2PYYA 1A40A 3B7DA 4JSOA 3UP9A 2R8TA 4BDRA 3H6UA 1EYKA 3O97A 3N94A 1TXFA 1IXHA 3V8XB 1LLSA 1Z7ME 4JVDA 3TCGA 3S9NC 1QUKA 2ZXTA 4TLMB 2B3BA 1MY1A 4MMPA 4GWOA 4NMYA 3TMGA 2Y5KA 5EQ9A 1H3DA 4P1EA 3CSBA 2O1LA 4O8MA 1LCTA 1FPLA 2VOZA 5ESYA 2FNCA 2KLFA 3BFUA 3FVKA 3IOVA 2FYIA 3CFXA 4HE0A 4HXVA 3TQLA 1NUWA 3OELA 5ICQA 1H76A 3CRBA 2QFLA 3DP6A 3BKIB 4KQPA 2QMWA 4HE2A 1EU8A 1JW4A 4LA9A 4O7IA 3PD8A 4KFQA 4P11A 1AWBA 3Q27A 1JP4A 2H4IA 2KR0A 3HFUA 2D3IA 1FPJA 4DIGA 2W7YA 4RA1A 1ZJLA 3TFLA 4OVTA 1N7XA 1B46A 1LAFE 5H8NA 4GX3A 4OVRA 5A5XA 3G7WA 4BDLA 4UACA 1B1HA 1FJ9A 2XXHA 1FPFA 1MPDA 3OEMA 1Y3NA 1ZTYA 3KC0A 2O1MA 4OEVA 1QJMA 4OFJA 2R9JA 4ZZEA 1M5EA 1KA0A 2WKYA 3RTWB 3VE1B 3K01A 1NV2A 1CE2A 1SW1A 1MXUA 2ZYOA 5DYHA 4FBPA 3C35A 1FPEA 2FIEA 3FXQA 5BWJA 5FTIA 1RYXA 3CSGA 4N91A 2OJTA 4JXIA 3KC1A 4PFRA 5H8QB 3H6TA 3CR9A 3ECRA 1VE4A 4MBPA 4YKKA 3E13X 4IO2A 3VLVA 5EYGA 1IXCA 4F39A 1MY4A 5I2KA 5H8NB 5A5XB 4NWCA 3FGSA 3UORA 3QMFA 3R6UA 4X9TA 2G29A 3MYUA 4RY1A 4H67A 3A09A 3EHUA 1GV8A 4ELQA 3MVYA 1LB9A 1US4A 1SQYA 3TDJA 4H1XA 1USYH 3IO4A 1IXGA 1NV4A 5AA2A 4DE8A 4F31B 1BK4A 3D1RA 2ABHA 1IMAA 3H3GA 4PF6A 5I2KB 3S9MC 4P9KA 5DW8A 2RKMA 2REJA 5JK4A 2IEEA 2ZNUA 2ANJA 2QS2A 5IAIA 1BTJA 3DM0A 1MG1A 4H0WA 5AA1A 4ZE8A 4QRZA 1Y9UA 2XD2A 2L5VA 5H8FA 2PFYA 4BLAA 4N17A 4HS7A 3U93A 4ESXA 4PFUA 2WYPA 1FRPA 5H8HA 2F6GA 5KDTA 1MQHA 4RPNA 3SDFA 3SEYA 3M3FA 1B52A 3T66A 4L17A 4F3PA 1UTBB 3MJNA 1YCJA 5TU0A 4EXKA 1NV3A 3K1MA 1FBPA 2F8DA 5J1DA 4ND9A 4LQ5A 5L9OA 2UVHA 3TELA 2I4CA 1FPIA 4I3EA 4R74A 4DLDA 1UQWA 4NQ8A 2ZYKA 4PGPA 4ZEDA 1PBPA 5IGAA 1MH3A 4ZEIA 5I58B 2Z8DA 3G3IA 2V84A 3FXRA 5H8FB 3IFCA 2WBDA 1FSAA 2RC8A 2WX9A 2UYEA 1LSTA 2F5XA 3ZSFA 3QAXA 3THIA 1M5BA 1MQGA 1Q1KA 2YLNA 2AL4A 3P7IA 4PE5B 2A5SA 5ELVA 3HN0A 1H43A 3K4UA 4FATA 2CZHA 4IR8A 2F7BA 3IOUA 1ZKBA 4BDNA 2DWIA 1MY0A 2QPQA 2THIA 4OVJA 2HAUA 4Q30B 4G8HA 2UVJA 1POY1 4XIGQ 3H4ZA 2UXAA 4RXLA 3FVGA 1CB6A 1Y4TA 4PF8A 1IITA 3KBRA 3E78A 2Z22A 4OANA 4OVQA 1LBVA 3QSLA 2HQ0A 3TTMA 1LBXA 2F3BA 1NUZA 4YICA 1MPBA 1B1XA 3KOSA 4O3BA 1FQBA 1B4ZA 3CHGA 1M5CA 5B70A 4IGTA 3IAZA 1IMBA 4N13A 2CZKA 3C4MA 2DDKA 1DTGA 2YJPA 1VSOA 5I2NA 3DLNA 5LOMA 1GGGA 1EZPA 2F97A 1B0LA 1DTZA 1SBPA 4YMAA 1D9VA 1JETA 3IO6A 3HCQA 3C34A 4G68A 3GXAA 5AA4A 5EYHA 3KOTA 3PV0E 4XKQA 3TKDA 1RDZA 1B5IA 2OPDA 5JEIA 3H6WA 1IMCA 3A29A 4O7MA 3RLFE 4TOZA 1AOVA 3PPPA 4N8YA 1ZLQA 5F1QA 5JTYA 5K2XA 3PMWA 2ZYNA 1URSA 1MS7A 3KSXA 4JDFA 2F34A 4LZ8A 3TAJA 2I3VA 2P3NA 4MH5A 3EPEA 5IKBA 1OVTA 3TTRA 3ROJA 2Q8JA 1FTAA 1OLAA 2F78A 4AB5A 2REGA 4PBQA 2MKZA 3EF7A 4O94A 4AS5A 2O7UA 3O2AA 4C1UA 1URDA 5TPAA 4I3YA 1B7ZA 4I1DA 4GRKA 4GVOA 1NMUA 4R75A 2QS4A 1CNQA 1IMEA 4F18A 4EUOA 4POXA 5CI5A 5AE4A 4ZEFA 2RINA 5JTYB 2ZYMA 1TWYA 2P0SA 4H5GA 1L5TA 4JVCA 2OWSA 4P1LA 5EQ8A 1NV5A 4K3FA 4DI3D 4MNCA 3O9PA 3RGYA 1LFHA 1XC1A 4FJPA 2OBGA 2OCUA 3LSXA 3FD3A 5L8DA 5H8SA 1B2HA 3D4GA 1PB8A 2R71A 1SDXA 2DWAA 3CG1A 5CC2A 1RKMA 5TPAB 3T93B 4OYVA 3VV5A 4MNIA 2Y7WA 1EYIA 4NTLA 5CMMA 4PFIA 2XWIA 3R26A 1BKAA 5IZ1A 3N26A 2H98A 4OWDA 4IB2A 4GXSB 2I49A 3C33A 3I3VA 2F7AA 1MY3A 2HEUA 3MZ9A 5CBRA 1NV1A 1B7UA 2GHAA 3GBAA 5I7IA 1A55A 4EF1A 5AA3A 3IJOB 3U65A 2HZLA 3MC2A 2XXTA 4I8CA 4R72A 3T96B 5L9SA 2VHAA 1URGA 3UIFA 3VFJA 3U1OA 3EQ1A 1B05A 1KA1A 4MLVA 4I40A 3O66A 5DTBA 2RC7A 3L6HA 1Y3PA 3ONMA 4QFNA 4GBWA 4KR5A 1USYE 2A5TA 2I58A 3T0JA 4NGUA 1B40A 4WKMA 4F2QA 1RYOA 3PPOA 3B50A 3FXBA 3HV1A 2FBPA 1QKAA 5LTCA 5TP9A 1LBYA 5EYFA 1MDP1 3S2VA 4XFEA 1MQJA 3K1PA 3JV9A 3LSLA 1LAXA 5KZTA 3T9VA 2OPEA 4XKPA 3PD9A 3CFLA 4GL0A 2HFBA 2Z23A 4DDDA 5FHMA 1AH5A 1P1UA 3C9HA 3MWBA 2HZKA 1O7TA 3ILUB 5CRYA 5KCJA 4KYEA 2NXOA 3ZS6A 5CMBA 2CZIA 3H03A 2A5TB 5HPQA 3KEIA 2CZLA 3BBRA 4PCDA 2XA5A 1Q9DA 3W9WA 4ELPA 2XXRA 3M8UA 3RT6B 1OQGA 4OFLA 2GH9A 1D9YA 4YKIA 2I0BA 2ZZVA 1D3KA 4N07A 3T9UA 3BIHA 4P56A 1QUJA 2OWTA 4YB7A 4OFOA 4FEDA 1Y3QA 4QFPA 2O51A 3FJMA 5CBSA 2O68A 4JSDA 1QKBA 1FQCA 4C0RA 4JWXA 4IO4A 4EQ9A 3JYRA 3UGWA 4MNPA 1B58A 1OLCA 1JVYA 4YKJA 3K1NA 1WVJA 4PBHA 5KCJB 4Z7EA 4THIA 3SKPA 5F24A 1EZ9A 4PC9A 3FZVA 4KPTA 4M1VA 4P0GA 4N6PA 3SEXA 3ZKLA 2DXYA 3GYYA 2ONKE 3VXBA 5FTHA 3TEPA 1TFAA 3TPAA 4NF8A 2O6AA 4F3BA 1FBHA 4U4SA 3C32A 4YB6A 3A3UA 1B9JA 2XXPA 1LFGA 4H46A 4FECA 4MHFA 1JEVA 4ELOA 3PMXA 4ECFA 3PUZE 4GQOA 3RT8A 3HSTA 2NWJA 3Q25A 4M4GA 2RCBA 4KI0E 1O63A 1BP5A 1M5DA 3IORA 4RYAA 1QULA 3V83A 4KCDA 5ET7A 4H45A 2PVUA 1FPGA 3SZPA 4IO3A 4N4UA 1XOCA 4GXAA 5LDZA 1N76A 5CMCA 4IY5A 1SI0A 4F22A 1RDYA 2E1SA 3KBZA 2DP8A 2M8CA 1AL3A 1MM7A 2HHMA 5DVIA 2CMOA 1XVYA 1J1NA 5IZZA 4GOTA 4NF8B 3Q26A 3FATA 1LBZA 3LSFB 4DCXA 4OZ9A 1POTA 1N84A 2V25A 4GWUA 5ITOA 3EN3A 3QYTA 2PMSA 1S7YA 4N6KA 4RNSA 1I6QA 1IMDA 4LZ7A 3IJXB 1II5A 1FPDA 3BFTA 3M3KA 1NFTA 2DWHA 4PAFA 1QVSA 1ZBMA 4IO5A 3Q29A 2V3TA 4X04A 3IK6B 1N7WA 2PX1A 3K6UA 1NV6A 4H5FA 1NUXA 1LBWA 4QFOA 3RPLA 4FEBA 3KFMA 4Q5TA 5FHNA 1G0HA 2PT2A 4N8GA 2VP1A 5AA2B 1B51A 1P1OA 1HSEA 3QK6A 3I5OA 1NNKA 4PE3A 3DELB 4F2OA 4X1DA 4UABA 3TYHA 2O84X 4G77A 2UVIA 1QW0A 5EHSA 3QXMA 5IZ3A 1DOTA 2DYXA 1Y1MA 3L6GA 4OXVA 4YZZA 5ISUA 3RTFB 4F1VA 4IGRA 3LUYA 3GLBA 3LC8A 2WBBA 1A8EA 4H65A 4QFLA 4NWDA 4KYSA 1G0IA 1SI1A 3FV2A 3IX1A 1MXWA 4LVQA 2ZZXA 3VLWA 5H8HB 1PEBA 2CEYA 4GWXA 1UTHA 1B4HA 5KDTB 3S4UA 2HXRA 4BDQA 4JWOA 1LBBA 2UVGA 1NUYA 4FORA 3KSJA 4EQBA 4OENA 5F7VA 4GIZA 1K9YA 1R9QA
chains in the Genus database with same CATH topology
5IZ3B 4I3YA 4O8MA 3RYDA 4NAPA 5EQ7A 1CNQA 1IMEA 1FPLA 4F18A 5ESYA 4N81A 4GWZA 4OVPA 4HE0A 4HXVA 4AS4A 1NUWA 4JVCA 4P1LA 5EQ8A 3PTYA 1NV5A 4DI3D 4MNCA 4PGNA 4G61A 2QFLA 2XWOA 4HE2A 4O7IA 2DVZA 2QVVA 1AWBA 1LEVA 1JP4A 2WYKA 2KR0A 3HFUA 4P3LA 1FPJA 2DE4A 4GWWA 2Q9TA 4OVTA 1KZ8A 4P47A 4MNIA 4GX3A 4OVRA 1EYIA 4PFIA 2XWIA 2VPNA 1FJ9A 1FPFA 5IZ1A 3KC0A 2OWZA 4PDDA 3LV0A 3FBPA 1KA0A 1NV1A 5I7IA 1QGXA 3U65A 2HZLA 1NV2A 4FBPA 4HCWA 5I5PA 1FPEA 2FIEA 5T3JA 4NG7A 1KA1A 2FHYA 4I40A 4N91A 1FBFA 2P3VA 3KC1A 1DCUA 2PCRA 4PFRA 3RPLB 4GBWA 1EYJA 2KQZA 2F3DA 3BIGA 5EYGA 4MEVA 3T0JA 5FBPA 2OX3A 3NOHA 4NGUA 3B50A 3FXBA 2FBPA 5LTCA 5I3SA 1LBYA 4NHBA 2B4MA 3QMFA 4XFEA 4X9TA 4GWYA 3MYUA 4LN5A 4HCYA 1NV7A 4XF5A 4MX6A 2VPOA 3T1BA 1XI6A 2HZKA 1K9ZA 1NV4A 1INPA 3E79A 4QXDA 2PFZA 1BK4A 3D1RA 2GQ1A 1IMAA 5J16A 2CZIA 3LUZA 4MCOA 4PF6A 4P9KA 5DW8A 4N6DA 4PCDA 2XA5A 1Q9DA 2WEFA 5JK4A 3W9WA 3ISPA 2ZZVA 4MAGA 3BIHA 4P56A 2L5VA 2PFYA 4N17A 3MSTA 2WYPA 2FVZA 1FRPA 4MNPA 4PBHA 1DK4A 2JJKA 5F24A 1NV3A 5ET8A 1FBPA 4QBAA 4XEQA 4PC9A 4M1VA 2V4CA 5J1DA 3W9VA 1FJ6A 4PFBA 2XWVA 3GYYA 2XXKA 1FPIA 1YZ0A 4I3EA 1YXIA 1FBHA 4NQ8A 2VT5A 4PGPA 5IGAA 4N15A 4H46A 4F19A 3IFCA 2WBDA 1FSAA 4MHFA 2WX9A 4NF0A 2F5XA 1SPIA 2DE2A 4PAKA 3EKIA 5ET7A 1IMFA 4H45A 5IM2A 5EQAA 1FPGA 2B4LA 3SZPA 4N4UA 2CZHA 4IR8A 5CM6A 5LDZA 4GX6A 1RDYA 4MIJA 4NN3A 2ZZWA 1FBGA 4KXPA 4F1UA 3KBZA 2QPQA 1NV0A 2HHMA 5ET6A 5IZZA 4DI4B 1LBZA 2HPGA 5A5LA 4GBVA 4PF8A 4MJOA 4GWUA 3E78A 4OANA 4OVQA 1FPBA 1VDWA 4N6KA 1IMDA 1LBVA 1NI9A 4PETA 1LBXA 2F3BA 4HE1A 1FPDA 1NUZA 3IFAA 4YICA 4PAFA 4GWSA 1D9QA 2QVRA 4PDHA 2FIXA 3CHGA 4X04A 2QVUA 4NX1A 1NV6A 1IMBA 1NUXA 3B8BA 1LBWA 2CEXA 2BJIA 2CZKA 2DDKA 3RPLA 4GX4A 1G0HA 4N8GA 2XWKA 4JVIA 4PAIA 2DE3A 1DBZA 4PE3A 1FBDA 4UABA 5EYHA 5IZ3A 1FBCA 1FBEA 4PTKA 1RDZA 2Y5LA 4YZZA 2Q74A 2V3QA 4F1VA 1IMCA 3A29A 4O7MA 2WBBA 2Q8MA 1RDXA 4OVSA 5ET5A 4N8YA 4X8RA 1G0IA 2R8TA 2ZZXA 1EYKA 2CEYA 4GWXA 2P3NA 1YYZA 2HXRA 4JVDA 1NUYA 3ROJA 1FPKA 4OA4A 1FTAA 4MMPA 4PBQA 2MKZA 4P8BA 4O94A 4AS5A 2Y5KA 5EQ9A 1K9YA 4P1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ3 B;  3RPL B;  4I3Y A;  4GBW A;  1EYJ A;  1LBX A;  3RYD A;  2F3B A;  4HE1 A;  2F3D A;  1FPD A;  3BIG A;  1DK4 A;  1NUZ A;  3IFA A;  5EYG A;  3T0J A;  5FBP A;  2JJK A;  2OX3 A;  5EQ7 A;  4GWS A;  5F24 A;  1D9Q A;  2QVR A;  1CNQ A;  1IME A;  1FPL A;  1NV3 A;  2FIX A;  5ET8 A;  1FBP A;  5ESY A;  2QVU A;  2FBP A;  4N81 A;  1NV6 A;  4GWZ A;  1FJ6 A;  5I3S A;  1IMB A;  1NUX A;  3B8B A;  1LBY A;  1LBW A;  2BJI A;  3QMF A;  2CZK A;  4HE0 A;  4HXV A;  2DDK A;  3RPL A;  4AS4 A;  1NUW A;  4GX4 A;  1FPI A;  1YZ0 A;  4I3E A;  1G0H A;  1YXI A;  4GWY A;  5EQ8 A;  1FBH A;  1NV5 A;  2VT5 A;  4G61 A;  2QFL A;  1NV7 A;  1DBZ A;  4H46 A;  4HE2 A;  3IFC A;  2WBD A;  1FSA A;  1FBD A;  4O7I A;  2QVV A;  1XI6 A;  1AWB A;  1LEV A;  5EYH A;  1JP4 A;  5IZ3 A;  1FBC A;  1K9Z A;  1FBE A;  1NV4 A;  4PTK A;  1INP A;  1SPI A;  1RDZ A;  4QXD A;  2Y5L A;  1FPJ A;  1BK4 A;  4GWW A;  5ET7 A;  1IMF A;  3D1R A;  4H45 A;  1KZ8 A;  2GQ1 A;  1IMA A;  5J16 A;  5EQA A;  1FPG A;  2CZI A;  2Q74 A;  4GX3 A;  3LUZ A;  2CZH A;  1EYI A;  1IMC A;  4IR8 A;  3A29 A;  5LDZ A;  2WBB A;  2Q8M A;  1RDX A;  5DW8 A;  4GX6 A;  1FJ9 A;  1RDY A;  1FPF A;  5ET5 A;  5IZ1 A;  1FBG A;  4KXP A;  3KC0 A;  1Q9D A;  3KBZ A;  2OWZ A;  1G0I A;  1NV0 A;  2WEF A;  2HHM A;  5ET6 A;  3LV0 A;  3FBP A;  1KA0 A;  2R8T A;  1NV1 A;  1EYK A;  1QGX A;  4GWX A;  2P3N A;  1YYZ A;  1LBZ A;  3BIH A;  1NV2 A;  5A5L A;  1NUY A;  3ROJ A;  4FBP A;  1FPK A;  1FPE A;  4GBV A;  2FIE A;  4MJO A;  4GWU A;  1FTA A;  5T3J A;  1KA1 A;  2FHY A;  4I40 A;  1FPB A;  1VDW A;  2PCR A;  1IMD A;  1FBF A;  2P3V A;  2Y5K A;  5EQ9 A;  1K9Y A;  1DCU A;  3KC1 A;  2FVZ A;  1LBV A;  1FRP A;  4AS5 A;  1NI9 A; 
#chains in the Genus database with same CATH topology
 5IZ3 B;  1B3H A;  1N3W A;  3MP8 A;  1OVB A;  4NF5 A;  1GR2 A;  1MM6 A;  1Q35 A;  1DMB A;  2XD3 A;  3MAM A;  2H99 A;  4LP2 B;  3PUX E;  4POW A;  1IZ1 A;  4OVP A;  1HSJ A;  4AS4 A;  3SER A;  1Z7N E;  1B32 A;  1B5J A;  1NNP A;  2GFE A;  1WDN A;  4G61 A;  3PPR A;  4R9G A;  1UTH B;  3RN8 A;  1A7L A;  3QIM A;  1LFI A;  4NE4 A;  4TLL B;  2IA4 A;  3IL1 B;  3CI8 A;  4XKR A;  4EF2 A;  4H6D A;  1FQE A;  1FTO A;  2DE4 A;  1N0T A;  4GWW A;  3M3L A;  2Q9T A;  2Y84 A;  4NF5 B;  4R9F A;  2V93 A;  2R6G E;  3VVD A;  5DVF A;  5ICT A;  3OOA A;  1LCF A;  4JB7 A;  5I59 A;  3T9H B;  4IO7 A;  3IR1 A;  4PDD A;  4RJZ A;  3E3K A;  3TTL A;  3LV0 A;  2ONS A;  2YPN A;  3FBP A;  1MQD A;  1SYH A;  3C36 A;  2Y7K A;  2Y7I A;  3RY3 A;  4YB5 A;  3W15 C;  3OSQ A;  4NG7 A;  2DOJ A;  1BLF A;  4R6K A;  2FHY A;  4XTC Q;  2BJJ X;  1FBF A;  2P3V A;  2I3W A;  2PCR A;  3O6I A;  1FTJ A;  1EYJ A;  5I2N B;  3IB2 A;  5CMK A;  3UN6 A;  1I6B A;  2OX3 A;  2H25 A;  3MPL A;  2XX9 A;  2B4M A;  4G68 B;  1IEJ A;  5AA4 B;  4GWY A;  3KZG A;  4R6H A;  1NKX A;  1FTK A;  4MX6 A;  2QL3 A;  3E4R A;  1P1Q A;  3GZG A;  3FJG A;  1ZU0 A;  2H5Y A;  3KN3 A;  2OLB A;  3T22 A;  1MXZ A;  2Q88 A;  1INP A;  3IB1 A;  2PFZ A;  3K6X A;  1SW2 A;  5HM4 B;  3VDF A;  1ZMG A;  1MXX A;  3LUZ A;  1PB7 A;  2RF1 A;  4XXU A;  4N6D A;  4H8I A;  4PFY A;  3MBP A;  1O64 A;  4ZEB A;  1AIV A;  2WEF A;  3ISP A;  1B3E A;  4MAG A;  4WED A;  1Y4C A;  3R7X A;  3UK4 A;  2F36 A;  3TCF A;  2D21 A;  2D5W A;  3EHS A;  4G4P A;  5AA2 D;  4YMB A;  3SEU A;  3G3F A;  4G68 C;  3PUW E;  1B5H A;  1R1N A;  3TTN A;  2H9B A;  4U1Z A;  3E9X A;  4BDM A;  3K00 A;  3ODB A;  4QBA A;  1WOD A;  3B6T A;  1QUI A;  1MY2 A;  3G3G A;  4QF9 A;  1FJ6 A;  4PFB A;  3W9V A;  3G3K A;  1JEU A;  1KWH A;  2XXK A;  1B7H A;  2AL5 A;  2B65 A;  4I62 A;  1US5 A;  1LAH E;  2VT5 A;  4QFK A;  1B0H A;  4QHQ A;  3OO8 A;  5B7D A;  3LR1 A;  4N15 A;  5I84 A;  3B6Q A;  1LGB C;  3MP1 A;  2QSX A;  1VFD A;  4FE8 A;  4JWY A;  1SPI A;  2DE2 A;  1P1N A;  4PQJ A;  4PAK A;  1R6Z A;  5IM2 A;  5EQA A;  1TFD A;  4U22 A;  4ZZA A;  4NF4 A;  3PMV A;  2E0S A;  1YTV A;  4OTE A;  3VVE A;  5CM6 A;  3OD7 A;  1JNF A;  3FUZ A;  2RCA A;  4GX6 A;  4NN3 A;  3FXU A;  4KXP A;  4F1U A;  2B3F A;  4OQO A;  4U21 A;  5ET6 A;  4Q8R A;  1R9L A;  2Y7R A;  3OSR A;  3JZJ A;  5FHO A;  5I57 A;  3O6H A;  2HPG A;  1JVX A;  1SW5 A;  4U2R A;  3TQW A;  3CVG A;  4GBV A;  3MVZ A;  4MJO A;  1IQ7 A;  4KD5 A;  2QRY A;  3AXF A;  1B3L A;  1XHY A;  1FPB A;  4EXL A;  3N6T A;  5TP9 B;  4NED A;  1EH3 A;  3KN8 A;  2XXQ A;  4HE1 A;  2Q2C A;  4OMB A;  3N5L A;  1HSL A;  1D9Q A;  3CG3 A;  3ILT B;  2XXX A;  4NF4 B;  4E0X A;  1A54 A;  4IO6 A;  2O69 A;  2V3U A;  2QVU A;  2I0C A;  4NX1 A;  3G3J A;  3V89 B;  1FQD A;  4LUB A;  4YAH X;  4LON B;  4Q0C A;  2CEX A;  2BJI A;  5H8Q A;  2AIX A;  4R73 A;  4GX4 A;  1S50 A;  3K2D A;  1ATG A;  2XHD A;  4JVI A;  1ELJ A;  5DEX A;  3DP8 A;  3O29 A;  5I57 B;  3PGF A;  4DXC A;  2DE3 A;  1VR5 A;  2X26 A;  4ELR A;  3USD A;  2UYF A;  1UIV A;  2XXW A;  5M2V A;  4G8N A;  1FBC A;  1FBE A;  4HW8 A;  4F29 A;  1OMP A;  2DSF A;  4FAJ A;  4YU0 A;  3TTK A;  1IXI A;  1NNT A;  4WXJ A;  2RC9 A;  4MFI A;  2V3Q A;  2HAV A;  2Q8M A;  4OVS A;  4QSD A;  1FTM A;  4AQ4 A;  1B3F A;  4DCY A;  3MZB A;  4RPO A;  2ESN A;  2P1S A;  3I6V A;  3CIJ A;  3S9L C;  1DPE A;  3RNN A;  4XKN A;  1I69 A;  2XX8 A;  1YYZ A;  1DPP A;  5DEX B;  2ZNT A;  4ISU A;  2Y7P A;  1FPK A;  4OA4 A;  2F35 A;  1MQI A;  4P8B A;  1FCK A;  3K0V A;  3GBB A;  1OIB A;  3RYD A;  3FIR A;  4ZDM A;  3HO7 A;  4NAP A;  5EQ7 A;  1XS5 A;  1ANF A;  3G3H A;  4EDP A;  2HXW A;  2GHB A;  4QSE A;  3WAF A;  4N81 A;  1LAG E;  4GWZ A;  2XXU A;  4QSC A;  2DWJ A;  1D4N A;  3T9X B;  1IUD A;  3H6V A;  2FA7 A;  3IB0 A;  4GFR A;  4ZEC A;  3PTY A;  4PGN A;  1UTB A;  4GLI A;  2XWO A;  1IIW A;  2XXV A;  3HHG A;  5ITP A;  5K2Y A;  3KJT A;  3CFZ A;  2DVZ A;  2QVV A;  1LEV A;  2GRV A;  3A3C A;  2WYK A;  3OO7 A;  4P3L A;  4KYD A;  2Q89 A;  1FQA A;  1KZ8 A;  4P47 A;  2Q2A A;  5I58 A;  1P99 A;  2VPN A;  3RPW A;  1MXV A;  2OWZ A;  1A99 A;  1FW0 A;  3QUF A;  4AB6 A;  1I6A A;  1QGX A;  3KGC A;  4E0W A;  3LBS A;  2XXI A;  1PC3 A;  4ZS9 A;  4OER A;  1NH8 A;  3PPQ A;  1A8F A;  4HCW A;  5I5P A;  4Z0I A;  4MLQ A;  3OO6 A;  1PBQ A;  5T3J A;  2QS1 A;  4BDO A;  3K6V A;  3TUS A;  4JBZ A;  1SVX B;  1DCU A;  3RPL B;  2KQZ A;  2F3D A;  3BIG A;  4MEV A;  3O28 A;  5FBP A;  4H8J A;  1MXY A;  4R2F A;  4OHN A;  3NOH A;  2QJE A;  2VD2 A;  4O3A A;  2PT1 A;  4PP0 A;  2Z8E A;  3H7M A;  1XVX A;  5I3S A;  1MRP A;  4NHB A;  4GL8 A;  1LB8 A;  4LAT A;  4LN5 A;  2F6P A;  3K6W A;  1H44 A;  1MDQ A;  1YAE A;  4HCY A;  3V5A A;  1NV7 A;  3MVX A;  4XF5 A;  3LSW A;  3U8Q A;  2VPO A;  1MPC A;  3T1B A;  2DXR A;  4G8M A;  4C1T A;  1NL5 A;  3VLU A;  3N6U A;  4X1B A;  4DZ1 A;  1XI6 A;  2DQV A;  2QMX A;  2DVC A;  3IOT A;  4ONY A;  3U94 A;  1GVC A;  4ZEK A;  1K9Z A;  4O3C A;  3E79 A;  4QXD A;  2GQ1 A;  5J16 A;  3U72 A;  3SEW A;  4MCO A;  3MP6 A;  3UA8 A;  2X7P A;  3QUJ A;  5DT6 A;  4GD5 A;  3RUM A;  1DSN A;  3SEV A;  1FQF A;  1LBC A;  3KJ7 A;  4PFW A;  3IOW A;  2PBW A;  1SD3 A;  4UA8 A;  1JQF A;  2X7Q A;  2P2A A;  4F1Y A;  1TT1 A;  2ZNS A;  3VXC A;  4NF6 A;  4X48 A;  1XT8 A;  2Z8F A;  3MST A;  3RQT A;  1YPN A;  2NVU B;  2F7C A;  4PFT A;  2FVZ A;  5I56 A;  1PB9 A;  2AYS A;  1H45 A;  4HTG A;  1DK4 A;  4ESW A;  4KCC A;  2LAO A;  3C31 A;  3OEN A;  2JJK A;  4RK2 A;  5ET8 A;  3VVF A;  4XEQ A;  1M5F A;  2V4C A;  3SES A;  1B3G A;  2ZMB A;  2XWV A;  3FJ7 A;  2I4B A;  1VFE A;  3MUQ A;  4R6Y A;  1YZ0 A;  1MH4 A;  1PDA A;  1YXI A;  3K02 A;  4ZE9 A;  1NNF A;  3TZA A;  3OEK A;  2ALU A;  4F19 A;  4NF6 B;  1BIY A;  1B6H A;  1NH7 A;  2NUV A;  3FVO A;  4NF0 A;  4LZ5 A;  1ZIU A;  5I59 B;  1EZO A;  4F3S A;  4DXB A;  2OZZ A;  5I56 B;  4MF3 A;  1GTK A;  4I9D A;  3EKI A;  5EHM A;  3KG2 A;  4RK9 A;  1IMF A;  4FIM A;  1N3X A;  1JW1 A;  2B4L A;  3Q28 A;  2XXY A;  3SET A;  3FV1 A;  3HHF A;  3MW0 A;  3B6W A;  4F3G A;  3MVW A;  4MIJ A;  4KHZ E;  3FAS A;  3O6G A;  1Y20 A;  2ZZW A;  5DVJ A;  1FBG A;  1NV0 A;  3MZ1 A;  4TQU Q;  1T0K A;  3S9E A;  3OO9 A;  1AMF A;  1SW4 A;  4DI4 B;  5A5L A;  3ZKK A;  3TCH A;  5BUU A;  4U23 A;  1JW5 A;  2G93 A;  3KN7 A;  1VDW A;  3D4C A;  1NI9 A;  2I48 A;  4PET A;  4WEP A;  1Y1Z A;  4LQ2 A;  1SYI A;  3EHT A;  4OES A;  3IFA A;  2VGQ A;  5L9M A;  4YKP A;  4GWS A;  4DXU A;  4IY6 A;  2QVR A;  4OET A;  4PDH A;  2FIX A;  1UIU A;  3PU5 A;  3B8B A;  3DP4 A;  4OEU A;  3WAE A;  4G2Z A;  4P0I A;  4GF8 A;  1P1W A;  2XWK A;  4R2B A;  1F9B A;  3PPN A;  4PAI A;  2I6E A;  3MQ9 A;  1N04 A;  1DBZ A;  4U1O A;  3TOD A;  2OK2 A;  1FBD A;  3MPK A;  3FVN A;  3U92 A;  3H06 B;  2HCA A;  4U4X A;  2VD3 A;  2NOO A;  4PTK A;  1S9T A;  2Y5L A;  3OMB A;  2QS3 A;  3HPI A;  1OQH A;  2ONR A;  2Q74 A;  5HBC A;  3PUY E;  2XX7 A;  3F11 A;  1RDX A;  5ET5 A;  2O7I A;  2DS9 A;  4X8R A;  1FTL A;  3OXN A;  3PUV E;  4EQ7 A;  2PYY A;  1A40 A;  3B7D A;  4JSO A;  3UP9 A;  2R8T A;  4BDR A;  3H6U A;  1EYK A;  3O97 A;  3N94 A;  1TXF A;  1IXH A;  3V8X B;  1LLS A;  1Z7M E;  4JVD A;  3TCG A;  3S9N C;  1QUK A;  2ZXT A;  4TLM B;  2B3B A;  1MY1 A;  4MMP A;  4GWO A;  4NMY A;  3TMG A;  2Y5K A;  5EQ9 A;  1H3D A;  4P1E A;  3CSB A;  2O1L A;  4O8M A;  1LCT A;  1FPL A;  2VOZ A;  5ESY A;  2FNC A;  2KLF A;  3BFU A;  3FVK A;  3IOV A;  2FYI A;  3CFX A;  4HE0 A;  4HXV A;  3TQL A;  1NUW A;  3OEL A;  5ICQ A;  1H76 A;  3CRB A;  2QFL A;  3DP6 A;  3BKI B;  4KQP A;  2QMW A;  4HE2 A;  1EU8 A;  1JW4 A;  4LA9 A;  4O7I A;  3PD8 A;  4KFQ A;  4P11 A;  1AWB A;  3Q27 A;  1JP4 A;  2H4I A;  2KR0 A;  3HFU A;  2D3I A;  1FPJ A;  4DIG A;  2W7Y A;  4RA1 A;  1ZJL A;  3TFL A;  4OVT A;  1N7X A;  1B46 A;  1LAF E;  5H8N A;  4GX3 A;  4OVR A;  5A5X A;  3G7W A;  4BDL A;  4UAC A;  1B1H A;  1FJ9 A;  2XXH A;  1FPF A;  1MPD A;  3OEM A;  1Y3N A;  1ZTY A;  3KC0 A;  2O1M A;  4OEV A;  1QJM A;  4OFJ A;  2R9J A;  4ZZE A;  1M5E A;  1KA0 A;  2WKY A;  3RTW B;  3VE1 B;  3K01 A;  1NV2 A;  1CE2 A;  1SW1 A;  1MXU A;  2ZYO A;  5DYH A;  4FBP A;  3C35 A;  1FPE A;  2FIE A;  3FXQ A;  5BWJ A;  5FTI A;  1RYX A;  3CSG A;  4N91 A;  2OJT A;  4JXI A;  3KC1 A;  4PFR A;  5H8Q B;  3H6T A;  3CR9 A;  3ECR A;  1VE4 A;  4MBP A;  4YKK A;  3E13 X;  4IO2 A;  3VLV A;  5EYG A;  1IXC A;  4F39 A;  1MY4 A;  5I2K A;  5H8N B;  5A5X B;  4NWC A;  3FGS A;  3UOR A;  3QMF A;  3R6U A;  4X9T A;  2G29 A;  3MYU A;  4RY1 A;  4H67 A;  3A09 A;  3EHU A;  1GV8 A;  4ELQ A;  3MVY A;  1LB9 A;  1US4 A;  1SQY A;  3TDJ A;  4H1X A;  1USY H;  3IO4 A;  1IXG A;  1NV4 A;  5AA2 A;  4DE8 A;  4F31 B;  1BK4 A;  3D1R A;  2ABH A;  1IMA A;  3H3G A;  4PF6 A;  5I2K B;  3S9M C;  4P9K A;  5DW8 A;  2RKM A;  2REJ A;  5JK4 A;  2IEE A;  2ZNU A;  2ANJ A;  2QS2 A;  5IAI A;  1BTJ A;  3DM0 A;  1MG1 A;  4H0W A;  5AA1 A;  4ZE8 A;  4QRZ A;  1Y9U A;  2XD2 A;  2L5V A;  5H8F A;  2PFY A;  4BLA A;  4N17 A;  4HS7 A;  3U93 A;  4ESX A;  4PFU A;  2WYP A;  1FRP A;  5H8H A;  2F6G A;  5KDT A;  1MQH A;  4RPN A;  3SDF A;  3SEY A;  3M3F A;  1B52 A;  3T66 A;  4L17 A;  4F3P A;  1UTB B;  3MJN A;  1YCJ A;  5TU0 A;  4EXK A;  1NV3 A;  3K1M A;  1FBP A;  2F8D A;  5J1D A;  4ND9 A;  4LQ5 A;  5L9O A;  2UVH A;  3TEL A;  2I4C A;  1FPI A;  4I3E A;  4R74 A;  4DLD A;  1UQW A;  4NQ8 A;  2ZYK A;  4PGP A;  4ZED A;  1PBP A;  5IGA A;  1MH3 A;  4ZEI A;  5I58 B;  2Z8D A;  3G3I A;  2V84 A;  3FXR A;  5H8F B;  3IFC A;  2WBD A;  1FSA A;  2RC8 A;  2WX9 A;  2UYE A;  1LST A;  2F5X A;  3ZSF A;  3QAX A;  3THI A;  1M5B A;  1MQG A;  1Q1K A;  2YLN A;  2AL4 A;  3P7I A;  4PE5 B;  2A5S A;  5ELV A;  3HN0 A;  1H43 A;  3K4U A;  4FAT A;  2CZH A;  4IR8 A;  2F7B A;  3IOU A;  1ZKB A;  4BDN A;  2DWI A;  1MY0 A;  2QPQ A;  2THI A;  4OVJ A;  2HAU A;  4Q30 B;  4G8H A;  2UVJ A;  1POY 1;  4XIG Q;  3H4Z A;  2UXA A;  4RXL A;  3FVG A;  1CB6 A;  1Y4T A;  4PF8 A;  1IIT A;  3KBR A;  3E78 A;  2Z22 A;  4OAN A;  4OVQ A;  1LBV A;  3QSL A;  2HQ0 A;  3TTM A;  1LBX A;  2F3B A;  1NUZ A;  4YIC A;  1MPB A;  1B1X A;  3KOS A;  4O3B A;  1FQB A;  1B4Z A;  3CHG A;  1M5C A;  5B70 A;  4IGT A;  3IAZ A;  1IMB A;  4N13 A;  2CZK A;  3C4M A;  2DDK A;  1DTG A;  2YJP A;  1VSO A;  5I2N A;  3DLN A;  5LOM A;  1GGG A;  1EZP A;  2F97 A;  1B0L A;  1DTZ A;  1SBP A;  4YMA A;  1D9V A;  1JET A;  3IO6 A;  3HCQ A;  3C34 A;  4G68 A;  3GXA A;  5AA4 A;  5EYH A;  3KOT A;  3PV0 E;  4XKQ A;  3TKD A;  1RDZ A;  1B5I A;  2OPD A;  5JEI A;  3H6W A;  1IMC A;  3A29 A;  4O7M A;  3RLF E;  4TOZ A;  1AOV A;  3PPP A;  4N8Y A;  1ZLQ A;  5F1Q A;  5JTY A;  5K2X A;  3PMW A;  2ZYN A;  1URS A;  1MS7 A;  3KSX A;  4JDF A;  2F34 A;  4LZ8 A;  3TAJ A;  2I3V A;  2P3N A;  4MH5 A;  3EPE A;  5IKB A;  1OVT A;  3TTR A;  3ROJ A;  2Q8J A;  1FTA A;  1OLA A;  2F78 A;  4AB5 A;  2REG A;  4PBQ A;  2MKZ A;  3EF7 A;  4O94 A;  4AS5 A;  2O7U A;  3O2A A;  4C1U A;  1URD A;  5TPA A;  4I3Y A;  1B7Z A;  4I1D A;  4GRK A;  4GVO A;  1NMU A;  4R75 A;  2QS4 A;  1CNQ A;  1IME A;  4F18 A;  4EUO A;  4POX A;  5CI5 A;  5AE4 A;  4ZEF A;  2RIN A;  5JTY B;  2ZYM A;  1TWY A;  2P0S A;  4H5G A;  1L5T A;  4JVC A;  2OWS A;  4P1L A;  5EQ8 A;  1NV5 A;  4K3F A;  4DI3 D;  4MNC A;  3O9P A;  3RGY A;  1LFH A;  1XC1 A;  4FJP A;  2OBG A;  2OCU A;  3LSX A;  3FD3 A;  5L8D A;  5H8S A;  1B2H A;  3D4G A;  1PB8 A;  2R71 A;  1SDX A;  2DWA A;  3CG1 A;  5CC2 A;  1RKM A;  5TPA B;  3T93 B;  4OYV A;  3VV5 A;  4MNI A;  2Y7W A;  1EYI A;  4NTL A;  5CMM A;  4PFI A;  2XWI A;  3R26 A;  1BKA A;  5IZ1 A;  3N26 A;  2H98 A;  4OWD A;  4IB2 A;  4GXS B;  2I49 A;  3C33 A;  3I3V A;  2F7A A;  1MY3 A;  2HEU A;  3MZ9 A;  5CBR A;  1NV1 A;  1B7U A;  2GHA A;  3GBA A;  5I7I A;  1A55 A;  4EF1 A;  5AA3 A;  3IJO B;  3U65 A;  2HZL A;  3MC2 A;  2XXT A;  4I8C A;  4R72 A;  3T96 B;  5L9S A;  2VHA A;  1URG A;  3UIF A;  3VFJ A;  3U1O A;  3EQ1 A;  1B05 A;  1KA1 A;  4MLV A;  4I40 A;  3O66 A;  5DTB A;  2RC7 A;  3L6H A;  1Y3P A;  3ONM A;  4QFN A;  4GBW A;  4KR5 A;  1USY E;  2A5T A;  2I58 A;  3T0J A;  4NGU A;  1B40 A;  4WKM A;  4F2Q A;  1RYO A;  3PPO A;  3B50 A;  3FXB A;  3HV1 A;  2FBP A;  1QKA A;  5LTC A;  5TP9 A;  1LBY A;  5EYF A;  1MDP 1;  3S2V A;  4XFE A;  1MQJ A;  3K1P A;  3JV9 A;  3LSL A;  1LAX A;  5KZT A;  3T9V A;  2OPE A;  4XKP A;  3PD9 A;  3CFL A;  4GL0 A;  2HFB A;  2Z23 A;  4DDD A;  5FHM A;  1AH5 A;  1P1U A;  3C9H A;  3MWB A;  2HZK A;  1O7T A;  3ILU B;  5CRY A;  5KCJ A;  4KYE A;  2NXO A;  3ZS6 A;  5CMB A;  2CZI A;  3H03 A;  2A5T B;  5HPQ A;  3KEI A;  2CZL A;  3BBR A;  4PCD A;  2XA5 A;  1Q9D A;  3W9W A;  4ELP A;  2XXR A;  3M8U A;  3RT6 B;  1OQG A;  4OFL A;  2GH9 A;  1D9Y A;  4YKI A;  2I0B A;  2ZZV A;  1D3K A;  4N07 A;  3T9U A;  3BIH A;  4P56 A;  1QUJ A;  2OWT A;  4YB7 A;  4OFO A;  4FED A;  1Y3Q A;  4QFP A;  2O51 A;  3FJM A;  5CBS A;  2O68 A;  4JSD A;  1QKB A;  1FQC A;  4C0R A;  4JWX A;  4IO4 A;  4EQ9 A;  3JYR A;  3UGW A;  4MNP A;  1B58 A;  1OLC A;  1JVY A;  4YKJ A;  3K1N A;  1WVJ A;  4PBH A;  5KCJ B;  4Z7E A;  4THI A;  3SKP A;  5F24 A;  1EZ9 A;  4PC9 A;  3FZV A;  4KPT A;  4M1V A;  4P0G A;  4N6P A;  3SEX A;  3ZKL A;  2DXY A;  3GYY A;  2ONK E;  3VXB A;  5FTH A;  3TEP A;  1TFA A;  3TPA A;  4NF8 A;  2O6A A;  4F3B A;  1FBH A;  4U4S A;  3C32 A;  4YB6 A;  3A3U A;  1B9J A;  2XXP A;  1LFG A;  4H46 A;  4FEC A;  4MHF A;  1JEV A;  4ELO A;  3PMX A;  4ECF A;  3PUZ E;  4GQO A;  3RT8 A;  3HST A;  2NWJ A;  3Q25 A;  4M4G A;  2RCB A;  4KI0 E;  1O63 A;  1BP5 A;  1M5D A;  3IOR A;  4RYA A;  1QUL A;  3V83 A;  4KCD A;  5ET7 A;  4H45 A;  2PVU A;  1FPG A;  3SZP A;  4IO3 A;  4N4U A;  1XOC A;  4GXA A;  5LDZ A;  1N76 A;  5CMC A;  4IY5 A;  1SI0 A;  4F22 A;  1RDY A;  2E1S A;  3KBZ A;  2DP8 A;  2M8C A;  1AL3 A;  1MM7 A;  2HHM A;  5DVI A;  2CMO A;  1XVY A;  1J1N A;  5IZZ A;  4GOT A;  4NF8 B;  3Q26 A;  3FAT A;  1LBZ A;  3LSF B;  4DCX A;  4OZ9 A;  1POT A;  1N84 A;  2V25 A;  4GWU A;  5ITO A;  3EN3 A;  3QYT A;  2PMS A;  1S7Y A;  4N6K A;  4RNS A;  1I6Q A;  1IMD A;  4LZ7 A;  3IJX B;  1II5 A;  1FPD A;  3BFT A;  3M3K A;  1NFT A;  2DWH A;  4PAF A;  1QVS A;  1ZBM A;  4IO5 A;  3Q29 A;  2V3T A;  4X04 A;  3IK6 B;  1N7W A;  2PX1 A;  3K6U A;  1NV6 A;  4H5F A;  1NUX A;  1LBW A;  4QFO A;  3RPL A;  4FEB A;  3KFM A;  4Q5T A;  5FHN A;  1G0H A;  2PT2 A;  4N8G A;  2VP1 A;  5AA2 B;  1B51 A;  1P1O A;  1HSE A;  3QK6 A;  3I5O A;  1NNK A;  4PE3 A;  3DEL B;  4F2O A;  4X1D A;  4UAB A;  3TYH A;  2O84 X;  4G77 A;  2UVI A;  1QW0 A;  5EHS A;  3QXM A;  5IZ3 A;  1DOT A;  2DYX A;  1Y1M A;  3L6G A;  4OXV A;  4YZZ A;  5ISU A;  3RTF B;  4F1V A;  4IGR A;  3LUY A;  3GLB A;  3LC8 A;  2WBB A;  1A8E A;  4H65 A;  4QFL A;  4NWD A;  4KYS A;  1G0I A;  1SI1 A;  3FV2 A;  3IX1 A;  1MXW A;  4LVQ A;  2ZZX A;  3VLW A;  5H8H B;  1PEB A;  2CEY A;  4GWX A;  1UTH A;  1B4H A;  5KDT B;  3S4U A;  2HXR A;  4BDQ A;  4JWO A;  1LBB A;  2UVG A;  1NUY A;  4FOR A;  3KSJ A;  4EQB A;  4OEN A;  5F7V A;  4GIZ A;  1K9Y A;  1R9Q A; 
#chains in the Genus database with same CATH homology
 5IZ3 B;  4I3Y A;  4O8M A;  3RYD A;  4NAP A;  5EQ7 A;  1CNQ A;  1IME A;  1FPL A;  4F18 A;  5ESY A;  4N81 A;  4GWZ A;  4OVP A;  4HE0 A;  4HXV A;  4AS4 A;  1NUW A;  4JVC A;  4P1L A;  5EQ8 A;  3PTY A;  1NV5 A;  4DI3 D;  4MNC A;  4PGN A;  4G61 A;  2QFL A;  2XWO A;  4HE2 A;  4O7I A;  2DVZ A;  2QVV A;  1AWB A;  1LEV A;  1JP4 A;  2WYK A;  2KR0 A;  3HFU A;  4P3L A;  1FPJ A;  2DE4 A;  4GWW A;  2Q9T A;  4OVT A;  1KZ8 A;  4P47 A;  4MNI A;  4GX3 A;  4OVR A;  1EYI A;  4PFI A;  2XWI A;  2VPN A;  1FJ9 A;  1FPF A;  5IZ1 A;  3KC0 A;  2OWZ A;  4PDD A;  3LV0 A;  3FBP A;  1KA0 A;  1NV1 A;  5I7I A;  1QGX A;  3U65 A;  2HZL A;  1NV2 A;  4FBP A;  4HCW A;  5I5P A;  1FPE A;  2FIE A;  5T3J A;  4NG7 A;  1KA1 A;  2FHY A;  4I40 A;  4N91 A;  1FBF A;  2P3V A;  3KC1 A;  1DCU A;  2PCR A;  4PFR A;  3RPL B;  4GBW A;  1EYJ A;  2KQZ A;  2F3D A;  3BIG A;  5EYG A;  4MEV A;  3T0J A;  5FBP A;  2OX3 A;  3NOH A;  4NGU A;  3B50 A;  3FXB A;  2FBP A;  5LTC A;  5I3S A;  1LBY A;  4NHB A;  2B4M A;  3QMF A;  4XFE A;  4X9T A;  4GWY A;  3MYU A;  4LN5 A;  4HCY A;  1NV7 A;  4XF5 A;  4MX6 A;  2VPO A;  3T1B A;  1XI6 A;  2HZK A;  1K9Z A;  1NV4 A;  1INP A;  3E79 A;  4QXD A;  2PFZ A;  1BK4 A;  3D1R A;  2GQ1 A;  1IMA A;  5J16 A;  2CZI A;  3LUZ A;  4MCO A;  4PF6 A;  4P9K A;  5DW8 A;  4N6D A;  4PCD A;  2XA5 A;  1Q9D A;  2WEF A;  5JK4 A;  3W9W A;  3ISP A;  2ZZV A;  4MAG A;  3BIH A;  4P56 A;  2L5V A;  2PFY A;  4N17 A;  3MST A;  2WYP A;  2FVZ A;  1FRP A;  4MNP A;  4PBH A;  1DK4 A;  2JJK A;  5F24 A;  1NV3 A;  5ET8 A;  1FBP A;  4QBA A;  4XEQ A;  4PC9 A;  4M1V A;  2V4C A;  5J1D A;  3W9V A;  1FJ6 A;  4PFB A;  2XWV A;  3GYY A;  2XXK A;  1FPI A;  1YZ0 A;  4I3E A;  1YXI A;  1FBH A;  4NQ8 A;  2VT5 A;  4PGP A;  5IGA A;  4N15 A;  4H46 A;  4F19 A;  3IFC A;  2WBD A;  1FSA A;  4MHF A;  2WX9 A;  4NF0 A;  2F5X A;  1SPI A;  2DE2 A;  4PAK A;  3EKI A;  5ET7 A;  1IMF A;  4H45 A;  5IM2 A;  5EQA A;  1FPG A;  2B4L A;  3SZP A;  4N4U A;  2CZH A;  4IR8 A;  5CM6 A;  5LDZ A;  4GX6 A;  1RDY A;  4MIJ A;  4NN3 A;  2ZZW A;  1FBG A;  4KXP A;  4F1U A;  3KBZ A;  2QPQ A;  1NV0 A;  2HHM A;  5ET6 A;  5IZZ A;  4DI4 B;  1LBZ A;  2HPG A;  5A5L A;  4GBV A;  4PF8 A;  4MJO A;  4GWU A;  3E78 A;  4OAN A;  4OVQ A;  1FPB A;  1VDW A;  4N6K A;  1IMD A;  1LBV A;  1NI9 A;  4PET A;  1LBX A;  2F3B A;  4HE1 A;  1FPD A;  1NUZ A;  3IFA A;  4YIC A;  4PAF A;  4GWS A;  1D9Q A;  2QVR A;  4PDH A;  2FIX A;  3CHG A;  4X04 A;  2QVU A;  4NX1 A;  1NV6 A;  1IMB A;  1NUX A;  3B8B A;  1LBW A;  2CEX A;  2BJI A;  2CZK A;  2DDK A;  3RPL A;  4GX4 A;  1G0H A;  4N8G A;  2XWK A;  4JVI A;  4PAI A;  2DE3 A;  1DBZ A;  4PE3 A;  1FBD A;  4UAB A;  5EYH A;  5IZ3 A;  1FBC A;  1FBE A;  4PTK A;  1RDZ A;  2Y5L A;  4YZZ A;  2Q74 A;  2V3Q A;  4F1V A;  1IMC A;  3A29 A;  4O7M A;  2WBB A;  2Q8M A;  1RDX A;  4OVS A;  5ET5 A;  4N8Y A;  4X8R A;  1G0I A;  2R8T A;  2ZZX A;  1EYK A;  2CEY A;  4GWX A;  2P3N A;  1YYZ A;  2HXR A;  4JVD A;  1NUY A;  3ROJ A;  1FPK A;  4OA4 A;  1FTA A;  4MMP A;  4PBQ A;  2MKZ A;  4P8B A;  4O94 A;  4AS5 A;  2Y5K A;  5EQ9 A;  1K9Y A;  4P1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...