4I40A

Crystal structure of staphylococcal inositol monophosphatase-1: 50mm licl inhibited complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 75
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i40A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i40A02
2FIXA 1IMDA 2VT5A 5IZ3A 1LBZA 1DBZA 5ESYA 5J16A 1LBWA 1NV3A 4HE0A 1FPKA 1FBCA 1JP4A 1K9YA 1NV6A 4GWSA 2P3VA 1SPIA 5T3JA 2CZKA 5EQ7A 2FIEA 4GBVA 2R8TA 2FBPA 5FBPA 1NI9A 1NUZA 2OWZA 4I3YA 1FBEA 2Q74A 3QMFA 4GX4A 3LV0A 4GX6A 3IFCA 3B8BA 1RDXA 2WEFA 2FHYA 2WBBA 1FBGA 4IR8A 1FPBA 1FPDA 1KA1A 2F3BA 1LBVA 3RPLA 1FSAA 2QVVA 2F3DA 2HHMA 1IMBA 1VDWA 5I3SA 2QFLA 1EYJA 1KZ8A 3RYDA 4QXDA 4I40A 2Y5KA 2GQ1A 4HE1A 1FBFA 1IMEA 2QVRA 1FRPA 1KA0A 2PCRA 3LUZA 2BJIA 1DCUA 1YYZA 4FBPA 3BIHA 4AS4A 3KC1A 4O7IA 5LDZA 1QGXA 1Q9DA 3KC0A 3D1RA 1FJ9A 1D9QA 1AWBA 1FPGA 1FTAA 4I3EA 3T0JA 4KXPA 4MJOA 1XI6A 1FBDA 3FBPA 1IMFA 5EYGA 1K9ZA 4GWUA 3RPLB 1NUYA 1IMCA 1DK4A 4HE2A 2WBDA 4GX3A 1FBHA 1FJ6A 1NV2A 1NV4A 1FPIA 1CNQA 5ET6A 2DDKA 1G0IA 2Q8MA 1EYKA 4G61A 3KBZA 1NV1A 5ET5A 1NV5A 4GBWA 4GWZA 2OX3A 1LBXA 4GWXA 4H46A 1EYIA 1YXIA 4H45A 3ROJA 1NUXA 1NV7A 1NV0A 2FVZA 2Y5LA 1IMAA 1FBPA 1BK4A 5ET7A 4GWYA 3A29A 5EQ9A 1FPJA 1FPFA 2CZIA 1RDYA 1FPLA 1LEVA 5ET8A 3BIGA 5EQ8A 1LBYA 4PTKA 2P3NA 3IFAA 4N81A 5F24A 5IZ1A 1RDZA 1INPA 4AS5A 5IZ3B 5DW8A 1G0HA 1YZ0A 4GWWA 2CZHA 1NUWA 2JJKA 5EQAA 5EYHA 4HXVA 5A5LA 1FPEA 2QVUA
chains in the Genus database with same CATH superfamily
2I4CA 4MCOA 3JZJA 1JP4A 1MS7A 1K9YA 4POXA 1LGBC 4R74A 3QK6A 2OWZA 4DDDA 4EUOA 5TU0A 3OMBA 1MQGA 3UORA 5DEXB 3SEUA 2Z8DA 4TLMB 3RT8A 2BJJX 3OEMA 4N91A 1DMBA 4GL0A 2ONSA 3ECRA 3B6TA 4F3GA 1FSAA 3TMGA 4PDHA 3H6VA 1OMPA 5JK4A 4JXIA 1DPEA 1Q1KA 4R75A 2YPNA 3D1RA 4PFUA 1AWBA 3T0JA 3W9WA 2V93A 2CMOA 2UVGA 4JSDA 2HAUA 2GFEA 1M5DA 4NGUA 2QMWA 2XD3A 4H1XA 5A5XA 2HXWA 3PMVA 2Y7WA 4K3FA 1JQFA 5ET5A 2WX9A 4PC9A 5L9OA 2P2AA 5IGAA 4H46A 1DOTA 5FHMA 1H76A 3ROJA 3RN8A 5AA3A 1KWHA 4F1YA 3A29A 1SBPA 4U1OA 1SW5A 4DXBA 1R6ZA 2F5XA 1T0KA 2VOZA 3EHTA 1RDZA 4OEUA 2PBWA 3TCGA 5EHSA 1QUKA 4PGPA 4GXSB 1SW2A 1MM6A 1P1UA 5J16A 4F2OA 4PE3A 3B6QA 1WODA 5CRYA 2HXRA 1D9YA 1TXFA 4OFLA 2DYXA 4IY5A 2Q74A 3FASA 4NHBA 4RPNA 4JWYA 5AA1A 3S9EA 1B3FA 3FVOA 2WBBA 3HO7A 4N15A 4F22A 4U1ZA 1VFDA 2B3BA 1B3EA 1B46A 1MRPA 2Y7PA 3RPLA 3VV5A 3FD3A 4PFBA 2HHMA 3LSWA 4KHZE 4KR5A 3NOHA 3KBRA 4PF8A 2F35A 4G68A 3MZ1A 1JVYA 2F78A 1B6HA 4GIZA 1VFEA 4XKRA 2I0CA 3DP8A 3Q26A 4JVDA 2WBDA 4IO7A 2ZYNA 1MY2A 4EF1A 1XOCA 3MZBA 2XXTA 3WAEA 2WYKA 3IO4A 5HM4B 1EYIA 5IM2A 5I2KA 4H45A 1A99A 1B0LA 3FXBA 3V83A 2A5TA 2F7AA 1URGA 4JBZA 2OBGA 2FYIA 2KQZA 1EZPA 3KN7A 3TDJA 1JVXA 4WEPA 1Y1ZA 2F6GA 2FNCA 3USDA 4BDOA 1BLFA 2ONRA 3KSJA 5IKBA 5J1DA 3MW0A 3O9PA 5ELVA 2NWJA 5T3JA 4F3BA 4F1VA 5FBPA 2Y7RA 5KZTA 3VLUA 3JV9A 1JEVA 2DP8A 3Q29A 1MQIA 3SETA 2DE4A 2PFYA 3C35A 1PB8A 2AIXA 1MXVA 1VR5A 2QVVA 2F3DA 4ZE9A 3PUZE 5ISUA 2O1MA 1ZIUA 2IEEA 2GRVA 1S7YA 3RTWB 3FGSA 3FJGA 3G7WA 3PU5A 1A54A 4IY6A 1H3DA 2PVUA 3VLWA 5AA4B 1O7TA 1XI6A 3K6UA 2HZKA 1FTKA 1P1NA 3T9VA 4QSDA 1MY0A 3C9HA 4LVQA 5K2YA 4N6PA 1B7ZA 2XX7A 2RKMA 5H8NB 3M8UA 4G77A 4O7MA 4QF9A 3MVZA 4L17A 1FBPA 5I56A 2QS1A 2GH9A 1XS5A 3C31A 2XX8A 1IXHA 3K6WA 1FPLA 5EHMA 4ELRA 1USYH 3D4CA 5F7VA 3Q25A 1B05A 4GD5A 5EQAA 2VD3A 4HXVA 3IB1A 1UQWA 2FIXA 1B5IA 4OVTA 1BTJA 2WKYA 3T9HB 4GOTA 4PQJA 1NV6A 2AL4A 1OVBA 5EQ7A 2VGQA 1ZU0A 1YTVA 1FBEA 1B40A 1B9JA 3RUMA 4GL8A 4F39A 1LAFE 5H8HA 1RKMA 3OOAA 2PFZA 5H8QB 1M5FA 1B4ZA 1FPBA 1FPDA 3ZSFA 1OQHA 1NNTA 4UABA 1D3KA 3RYDA 4OVRA 1XC1A 2CZLA 2V3UA 3C4MA 2QL3A 2QVRA 3KJ7A 1KA0A 2O7UA 1A40A 4I3EA 4N4UA 1PC3A 3H6UA 3H4ZA 4N13A 2E0SA 2OWSA 5HBCA 4YKIA 3TPAA 3SDFA 4ESWA 1M5CA 5I2KB 3FVGA 4DI3D 1FQCA 3TFLA 3VDFA 1B32A 2H9BA 5FHNA 1NUXA 2V25A 4FATA 4NF0A 1JEUA 3PPOA 2D21A 2DXRA 2OJTA 2XA5A 3N6TA 4OA4A 3BIGA 5EQ8A 5KCJA 2Q9TA 2XXHA 5IZ1A 1N04A 4H8IA 5H8QA 4ZZEA 2B4LA 4N17A 2D3IA 2A5SA 1NNKA 2O69A 4GQOA 4U21A 2XXWA 3IOTA 4LUBA 4LQ5A 2ZZXA 1MQHA 2XXKA 3LBSA 2F8DA 3RTFB 2XWVA 4MNCA 5I2NB 3ZS6A 5CMMA 1H45A 2XXPA 1AIVA 2B4MA 3HSTA 2I49A 3IJXB 5I59A 5DYHA 3MUQA 1YCJA 3CSBA 4OANA 3GZGA 4ZE8A 3PV0E 5I59B 3SEWA 3LUZA 3UP9A 3SEVA 1MXWA 2DE3A 4N6DA 3HV1A 3B6WA 3DP6A 2X7QA 2OZZA 2QSXA 1NUYA 3RGYA 1IXCA 4ELPA 4KPTA 3K2DA 3N5LA 2Q8MA 2XXRA 4Q5TA 3RY3A 1UTBA 4MHFA 2Z23A 5ITPA 4UACA 1PDAA 4YMAA 1HSEA 3SKPA 1JETA 2QS3A 4NG7A 3U94A 1B7UA 1B4HA 3FXUA 4G8NA 3K0VA 4N81A 3U65A 1OLAA 1MPCA 3PPQA 3TYHA 1YZ0A 1B0HA 1SD3A 3EPEA 1IMDA 1M5BA 2P1SA 1DBZA 4XIGQ 3I3VA 5DVJA 4QFKA 4GWSA 5I7IA 1R9LA 4GBVA 4I1DA 2OK2A 3GLBA 4LQ2A 4YZZA 3UN6A 1Y9UA 2HZLA 2RCAA 1URDA 1US4A 2M8CA 3U1OA 2X7PA 3VVEA 4XKNA 4F31B 3K4UA 4KD5A 3S2VA 1A7LA 2XXVA 4OQOA 3M3LA 2DVCA 5I3SA 3MVWA 3PD9A 4OHNA 4R6YA 1B2HA 2DXYA 4ZEFA 1AL3A 4O8MA 3GBAA 3KOTA 4AS4A 1LB8A 2F7BA 4HS7A 3G3IA 2NUVA 3FV2A 1MDP1 1OLCA 2HQ0A 2Y7IA 1DK4A 3CFXA 5ET6A 2DDKA 4O3CA 3R7XA 3O66A 3K6XA 4KCDA 4ZEDA 1NV5A 1LBBA 1A8FA 4DXCA 3FVNA 3BBRA 2XWKA 4IO6A 4FORA 5CBSA 4R2BA 1BK4A 2ONKE 1JW4A 1FPJA 3A3CA 3KG2A 4ND9A 1LEVA 4FJPA 3TZAA 1LLSA 4DZ1A 3KZGA 4FEDA 5DW8A 1G0HA 2ZNUA 3DM0A 2CZHA 1NMUA 3OENA 3B7DA 4PAKA 1TT1A 2O1LA 4Q0CA 3ZKLA 4MNPA 2B65A 4NEDA 4HE0A 5TP9A 2I3WA 3DELB 3ILUB 1N84A 3BFUA 2E1SA 4H67A 4E0WA 4GRKA 1NI9A 3O6HA 4ZEIA 4JVCA 3CIJA 4GX6A 3IFCA 1B5JA 5AA4A 4JSOA 1LCTA 4OVPA 1F9BA 4QSCA 4F29A 4IB2A 2XHDA 3TTKA 2PYYA 1ELJA 3TTRA 4WKMA 1P99A 3FIRA 4EQ7A 1LFIA 4OFJA 2PCRA 4PE5B 1YYZA 1AH5A 4C1TA 2H99A 2DS9A 5H8SA 1JW5A 2RCBA 1FTAA 4X04A 2F34A 2F36A 1B1HA 1FBDA 1IMFA 5KDTA 4FE8A 1VSOA 1L5TA 1IUDA 4JDFA 1NV4A 4R73A 3PPRA 3OSQA 3IR1A 4GBWA 3HFUA 1QKAA 1GR2A 1OIBA 3V89B 1B3LA 4ONYA 1IITA 3MQ9A 1XVXA 2ZNSA 2RC7A 3IL1B 4X1DA 3EN3A 4IO3A 1RDYA 3IFAA 4NF5A 2ZZVA 3UIFA 3RPWA 4H8JA 5AA2A 5LTCA 2VT5A 4OENA 3PUXE 5ESYA 3OD7A 4BDNA 3G3JA 4LATA 4PAIA 3K02A 1NNPA 4GLIA 3TQLA 2I48A 1P1WA 4MBPA 3I6VA 3B8BA 2THIA 3QIMA 2FHYA 3HPIA 1Y3PA 1FBGA 1BP5A 3CG1A 4Z7EA 1MM7A 2R9JA 3EF7A 1I6BA 1LAXA 2DWAA 5IZZA 3S9MC 3UGWA 5DTBA 1NFTA 5JTYA 4RYAA 1QKBA 2Y5KA 1NH8A 4GVOA 3E9XA 3MYUA 4QFNA 3RT6B 4HE1A 3IORA 1DCUA 3BIHA 4NF8B 3ILTB 5JTYB 3HHGA 2QRYA 3PMXA 4U2RA 1DPPA 1UIVA 4P1EA 1NV2A 2QS4A 3CVGA 4C0RA 2UVHA 1EYKA 3MPLA 1MQJA 1QJMA 1NV1A 2DE2A 4KFQA 2R6GE 3R6UA 4R6KA 1NV0A 3GYYA 3IOWA 3M3FA 1Y3NA 4P47A 1ZLQA 4P1LA 3CRBA 1BIYA 1I6QA 2L5VA 4O3BA 3GXAA 1FTMA 3ZKKA 3HCQA 2P3NA 5AA2B 5F24A 4AS5A 3FV1A 4ZEBA 2Q2AA 1FQDA 2HPGA 3MP1A 4IO2A 4TOZA 5IZ3A 4FIMA 2UYEA 4O94A 2OCUA 5K2XA 4GX4A 4H5GA 2WEFA 2O68A 3OXNA 4XEQA 2H4IA 4ESXA 4F3SA 1KA1A 1LBVA 4YB5A 3T66A 4JWOA 5CMCA 5CMKA 1PBQA 2OLBA 3VLVA 4I40A 4I9DA 3IAZA 1LFGA 4Q8RA 1MQDA 1IZ1A 1N0TA 5LDZA 3W9VA 3K01A 4G68C 4PFIA 4IO5A 3VFJA 1LFHA 4N8YA 1RYXA 1S50A 3LSFB 4NF4A 2XWIA 3P7IA 2Z8FA 1FBHA 4YKPA 4MNIA 2PT1A 1B52A 4PDDA 1FTLA 1VE4A 2HEUA 3O29A 2FA7A 4EQBA 1QUIA 4NWCA 3MPKA 4NF6A 2XXUA 3ODBA 3K1NA 5KCJB 2PT2A 3K1MA 3GBBA 1LBCA 3MJNA 3SERA 3TCHA 4P8BA 3O6GA 4G8HA 1FPFA 5IAIA 2GHAA 1ZKBA 2LAOA 4PFYA 3EKIA 4R2FA 4PTKA 1Q35A 3S9NC 3KN8A 3KEIA 4G8MA 4FEBA 4GWWA 2ABHA 4LA9A 1FPEA 4X1BA 3T1BA 1OQGA 3ISPA 2I6EA 4LZ5A 4MFIA 1FPKA 1ZBMA 5CC2A 3PUYE 4MAGA 5H8FB 3S4UA 3T9XB 3VVDA 1QULA 4ZDMA 1Y3QA 3C33A 5AA2D 4MEVA 4PBQA 5F1QA 4KCCA 3EHUA 4QHQA 4BDRA 3TELA 1OVTA 1SW4A 4G2ZA 4Z0IA 1YAEA 2F3BA 2B3FA 2RC8A 1EZ9A 4U22A 3G3FA 3VVFA 3RLFE 2X26A 4X8RA 2O51A 4ZEKA 1Z7ME 2Q88A 1UTHA 3RNNA 3TUSA 5EYFA 4N07A 4ELQA 3QXMA 1MH3A 4M1VA 4OYVA 4KXPA 4NN3A 5I58B 3A09A 1ZMGA 1QUJA 3QYTA 2Y7KA 2ZXTA 3H03A 1N7WA 2AL5A 3Q27A 1B51A 4DI4B 1SQYA 1POY1 4P56A 4QSEA 3E79A 3VXBA 4H6DA 3A3UA 3B50A 1SW1A 4NWDA 4H5FA 4P9KA 4EXLA 2DOJA 2VPNA 1MXUA 5TP9B 4H0WA 5TPAB 1I6AA 1INPA 1N76A 4DXUA 3S9LC 3OO6A 5I2NA 3O2AA 1B1XA 1SYIA 1FQFA 1POTA 4HCYA 2UYFA 1MDQA 1O63A 3T22A 2I0BA 3PMWA 3CHGA 4IGRA 3MSTA 2RINA 1FTJA 4NQ8A 3PPPA 2PMSA 3LR1A 4OZ9A 4JWXA 2F6PA 3FVKA 4HW8A 5I57A 4NAPA 2ANJA 1GVCA 3PPNA 3G3KA 3FZVA 4LP2B 1IMBA 5I57B 2CEXA 3N94A 1FBFA 1II5A 3I5OA 4M4GA 3UK4A 4KYEA 2HFBA 4I8CA 4DIGA 1FJ9A 2PX1A 4X9TA 1UTBB 3L6GA 3QSLA 3K6VA 1A55A 4OETA 3IK6B 3N6UA 1GV8A 3CR9A 3MWBA 1CNQA 4OVQA 2I58A 1G0IA 1MPDA 3C34A 1J1NA 5L9SA 1LCFA 5JEIA 3KBZA 2HCAA 2ALUA 3VE1B 4XKQA 2ESNA 1DSNA 2GHBA 5ITOA 1Y1MA 5FHOA 2DWJA 3CSGA 4TQUQ 4RK9A 4GWYA 5EQ9A 2F7CA 4WXJA 2QPQA 2H5YA 2CZIA 3IB2A 3MZ9A 4LN5A 3L6HA 1FTOA 5H8HB 1SYHA 1EZOA 2JJKA 5DVFA 1XVYA 2QVUA 1FQEA 1LBZA 1SI1A 1PBPA 1NV3A 3KOSA 3PUWE 4EQ9A 4KYDA 4DE8A 2R8TA 3MP6A 3SESA 3U8QA 3K00A 3FJMA 4E0XA 3M3KA 1XHYA 2UVIA 2UXAA 2WYPA 4NE4A 4QBAA 1GGGA 5L9MA 2VD2A 2XXIA 2KR0A 1VDWA 4WEDA 1B3HA 1FQAA 3KN3A 3IO6A 2W7YA 4AB6A 3MVYA 3KGCA 1R9QA 2GQ1A 4MMPA 5H8NA 3TQWA 3CG3A 4OVJA 4JVIA 4OVSA 4FBPA 3KC1A 4JB7A 4KQPA 4AQ4A 5CI5A 3TTLA 3HHFA 1D4NA 4KI0E 3PTYA 2DSFA 1LSTA 3O28A 3THIA 3FBPA 1QW0A 4OEVA 4GWUA 4BDQA 2MKZA 5BWJA 5I5PA 2D5WA 1GTKA 1LBXA 1SVXB 1LAGE 3OSRA 2HAVA 3Q28A 1N3XA 2XWOA 3C32A 2Q2CA 3E78A 4F3PA 5ICTA 4NF6B 3MBPA 4F1UA 1FW0A 1UTHB 3T9UA 2V3QA 3U92A 5A5LA 3MC2A 3FXQA 2Q8JA 4C1UA 1FCKA 4XF5A 1MY1A 4MIJA 4R72A 3SEYA 3TTNA 5B70A 2P3VA 1SPIA 2CZKA 5DT6A 3K1PA 2FIEA 1AMFA 2XX9A 1HSJA 1Y4TA 1JW1A 1NUZA 2I4BA 1HSLA 4HCWA 4OERA 3G3GA 4U4XA 1NKXA 1N3WA 1MH4A 4I62A 5M2VA 4DCYA 1IQ7A 2OWTA 3H7MA 2VP1A 3EQ1A 4MF3A 1O64A 1SDXA 1P1QA 1PB7A 1EYJA 4QXDA 5AE4A 1BKAA 1TWYA 1B3GA 2XXQA 3FUZA 1ANFA 2XXYA 1DTZA 4U4SA 2REJA 4RXLA 4DCXA 4N8GA 4THIA 1MY3A 4RK2A 3F11A 5TPAA 4MJOA 2ZYMA 4YICA 3V5AA 4HE2A 1FPIA 2H98A 4ZECA 4GWZA 3MVXA 2OX3A 4YB7A 1YXIA 3TKDA 1AOVA 3VXCA 3V8XB 4X48A 3OO7A 2Y5LA 3KFMA 4YKKA 4PFTA 3U93A 5DVIA 2Z22A 2F97A 4AB5A 1IEJA 2OPEA 1M5EA 4RY1A 4PFRA 1PEBA 4KYSA 2R71A 1FQBA 1N7XA 4G68B 2P0SA 2O84X 3H06B 3BFTA 4N6KA 1Y4CA 1MXZA 3O97A 2NXOA 3RQTA 3FJ7A 4NX1A 2AYSA 4MLVA 3IX1A 4FAJA 3IOUA 3R26A 3CI8A 4NF8A 5I56B 3LSXA 1PB9A 1B5HA 1Y20A 2QS2A 2RF1A 2XD2A 4FECA 1RYOA 4R9GA 5CM6A 5I58A 2ZYOA 5H8FA 1ZJLA 2DQVA 3H3GA 5LOMA 1IXIA 1TFAA 2QJEA 4O7IA 1QGXA 1Q9DA 3IJOB 4YAHX 2G29A 2DWIA 4PETA 3OO9A 2XXXA 4QFOA 5CMBA 4MH5A 3PUVE 3RPLB 5B7DA 4GX3A 1FJ6A 1USYE 2ZMBA 1A8EA 3OELA 4RNSA 1MY4A 2KLFA 3BKIB 3ONMA 4RA1A 3IB0A 2UVJA 5BUUA 3CFLA 4UA8A 4P0IA 2Y84A 3EHSA 4MLQA 1S9TA 1YPNA 2VPOA 4NF4B 3JYRA 5ET8A 4PP0A 1LBYA 1JNFA 2H25A 4PAFA 3H6WA 3T96B 1XT8A 3AXFA 2YJPA 5EYHA 1NUWA 2OPDA 4EDPA 4XKPA 4BDMA 3OEKA 4PCDA 4TLLB 2QMXA 4Q30B 3DP4A 5ICQA 1WVJA 2FBPA 4I3YA 3QUFA 1LAHE 4PF6A 4RJZA 3QMFA 3TEPA 3LV0A 5HPQA 1RDXA 1NL5A 5FTIA 3N26A 3LUYA 4HTGA 1NH7A 3E3KA 4QFPA 2V4CA 3UA8A 4GFRA 4U23A 2I3VA 4P11A 3QAXA 4IO4A 1H44A 4IGTA 1KZ8A 3TODA 3KSXA 3FATA 3PGFA 3PD8A 1IMEA 4BLAA 1FRPA 2Z8EA 1WDNA 4ZZAA 2ZYKA 1D9QA 1R1NA 1CB6A 1TFDA 2RC9A 4H65A 4GXAA 5A5XB 5EYGA 3WAFA 5I84A 1K9ZA 3FXRA 2IA4A 1IMCA 4R6HA 3TTMA 1MXXA 2Q89A 4OESA 4G61A 1IXGA 5DEXA 2DVZA 4NMYA 2G93A 3QUJA 4NTLA 4PBHA 1US5A 1SI0A 3TAJA 4F18A 3SEXA 2ZNTA 5L8DA 1NV7A 3C36A 4ISUA 5ET7A 3IOVA 1MG1A 4RPOA 4ECFA 3KJTA 3DLNA 4G4PA 3SZPA 1ATGA 2A5TB 4LZ7A 4OMBA 3E4RA 4F19A 1B7HA 4OXVA 1LBWA 1FBCA 4YKJA 4OFOA 2NOOA 4O3AA 3T93B 4BDLA 1DTGA 3O6IA 1NNFA 4LONB 4LZ8A 4DLDA 4PFWA 1UIUA 4YB6A 2VHAA 5CBRA 1CE2A 1EU8A 1B58A 1Z7NE 2REGA 5FTHA 4IR8A 4XTCQ 4ZS9A 2O6AA 4GF8A 2YLNA 2QFLA 3MP8A 4GWOA 4P3LA 4QRZA 4YMBA 4EF2A 4EXKA 3MAMA 3LSLA 1QVSA 2BJIA 3G3HA 4R9FA 4POWA 3KC0A 1LB9A 4F2QA 1FPGA 4NF5B 2V84A 1I69A 2O7IA 3U72A 3CFZA 1D9VA 1MPBA 1P1OA 4P0GA 2DWHA 3LC8A 3W15C 1EH3A 2V3TA 4OTEA 4PGNA 4GWXA 4OWDA 4QFLA 1IIWA 2FVZA 4MX6A 4YU0A 4XXUA 1IMAA 3HN0A 2ZZWA 4ELOA 1MXYA 3H6TA 5KDTB 3TCFA 1ZTYA 2NVUB 3OO8A 1URSA 1H43A 5IZ3B 2CEYA 4XFEA 3D4GA 3E13X
chains in the Genus database with same CATH topology
5LTCA 2FIXA 1IMDA 2VT5A 5IZ3A 4MNPA 1LBZA 3T1BA 1DBZA 3ISPA 4OVTA 5ESYA 5J16A 4MCOA 4XF5A 1LBWA 1NV3A 4HE0A 1FPKA 4MIJA 4N6KA 1FBCA 1JP4A 4HCYA 4O94A 4PCDA 1K9YA 1NV6A 4PE3A 4GWSA 4MAGA 2P3VA 1SPIA 5T3JA 5I7IA 4NX1A 2CZKA 2ZZXA 2XXKA 2HXRA 5EQ7A 4F1VA 4PAIA 2FIEA 4GBVA 2R8TA 2XWVA 3CHGA 2FBPA 5FBPA 4PAKA 1NI9A 1NUZA 2OWZA 4I3YA 1FBEA 4MNCA 4JVCA 4PF6A 2Q74A 4YZZA 3QMFA 4NHBA 4GX4A 4HCWA 3MSTA 3LV0A 4GX6A 4MEVA 3IFCA 3B8BA 1RDXA 2WEFA 2HZLA 4NQ8A 4PBQA 4XEQA 2B4MA 2FHYA 2DE4A 2WBBA 4OVPA 1FBGA 2WYPA 4N15A 2PFYA 4IR8A 2PFZA 2V4CA 4N91A 4QBAA 1FPBA 1FPDA 1KA1A 4NAPA 2F3BA 1LBVA 3RPLA 1FSAA 2QVVA 2F3DA 4PFBA 5IZZA 4PDHA 2HHMA 1IMBA 1VDWA 5I3SA 2KR0A 4UABA 2QFLA 5CM6A 4OANA 1EYJA 1KZ8A 4X8RA 2CEXA 3RYDA 4QXDA 4OVRA 4P3LA 3NOHA 4I40A 2Y5KA 3MYUA 4PF8A 2GQ1A 4MMPA 4HE1A 1FBFA 5JK4A 1IMEA 2QVRA 4O8MA 1FRPA 1KA0A 2PCRA 3LUZA 4JVIA 4OVSA 2BJIA 1DCUA 1YYZA 4FBPA 3BIHA 4AS4A 3KC1A 4O7IA 5LDZA 1QGXA 1Q9DA 3KC0A 2DE3A 4N8GA 4N6DA 4PFIA 3D1RA 3W9VA 1FJ9A 4M1VA 1D9QA 1AWBA 3PTYA 4X9TA 1FPGA 1FTAA 4I3EA 3T0JA 4KXPA 4NN3A 4PETA 4X04A 4N4UA 3W9WA 4MJOA 4N8YA 1XI6A 1FBDA 3FBPA 1IMFA 2HZKA 5EYGA 4YICA 1K9ZA 4GWUA 3RPLB 1NUYA 1IMCA 1DK4A 4HE2A 2XWIA 4NGUA 4JVDA 2WBDA 4GX3A 1FBHA 1FJ6A 1NV2A 4P1EA 1NV4A 1FPIA 1CNQA 5ET6A 2DDKA 4OVQA 4DI4B 1G0IA 2MKZA 2Q8MA 1EYKA 4MNIA 5I5PA 4G61A 4P56A 2DVZA 4DI3D 4MHFA 4PDDA 3KBZA 4PBHA 1NV1A 5ET5A 2DE2A 1NV5A 2WX9A 2WYKA 4GBWA 4GWZA 3E79A 2OX3A 3HFUA 4PC9A 4PGNA 5IGAA 1LBXA 4GWXA 4H46A 1EYIA 1YXIA 4O7MA 4H45A 5IM2A 4F18A 3ROJA 1NUXA 3FXBA 1NV7A 1NV0A 2FVZA 3GYYA 4MX6A 2XWKA 2Y5LA 3B50A 4NG7A 1IMAA 1FBPA 4NF0A 4P47A 4P8BA 1BK4A 5ET7A 2XWOA 4GWYA 3A29A 5EQ9A 4P1LA 3E78A 1FPJA 4P9KA 2QPQA 2ZZWA 1FPFA 2XA5A 2KQZA 2L5VA 2CZIA 2VPOA 2VPNA 1RDYA 3EKIA 4LN5A 2F5XA 4OA4A 1FPLA 1LEVA 5ET8A 3BIGA 5EQ8A 1LBYA 4PTKA 2Q9TA 2P3NA 3IFAA 3SZPA 4PAFA 4N81A 5F24A 5IZ1A 1RDZA 2ZZVA 1INPA 3U65A 4AS5A 5IZ3B 4F1UA 2CEYA 5DW8A 1G0HA 1YZ0A 4PFRA 4PGPA 4GWWA 2CZHA 1NUWA 2JJKA 5EQAA 5EYHA 2B4LA 2V3QA 4HXVA 5A5LA 4XFEA 1FPEA 4N17A 5J1DA 2HPGA 4F19A 2QVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIX A;  1IMD A;  2VT5 A;  5IZ3 A;  1LBZ A;  1DBZ A;  5ESY A;  5J16 A;  1LBW A;  1NV3 A;  4HE0 A;  1FPK A;  1FBC A;  1JP4 A;  1K9Y A;  1NV6 A;  4GWS A;  2P3V A;  1SPI A;  5T3J A;  2CZK A;  5EQ7 A;  2FIE A;  4GBV A;  2R8T A;  2FBP A;  5FBP A;  1NI9 A;  1NUZ A;  2OWZ A;  4I3Y A;  1FBE A;  2Q74 A;  3QMF A;  4GX4 A;  3LV0 A;  4GX6 A;  3IFC A;  3B8B A;  1RDX A;  2WEF A;  2FHY A;  2WBB A;  1FBG A;  4IR8 A;  1FPB A;  1FPD A;  1KA1 A;  2F3B A;  1LBV A;  3RPL A;  1FSA A;  2QVV A;  2F3D A;  2HHM A;  1IMB A;  1VDW A;  5I3S A;  2QFL A;  1EYJ A;  1KZ8 A;  3RYD A;  4QXD A;  4I40 A;  2Y5K A;  2GQ1 A;  4HE1 A;  1FBF A;  1IME A;  2QVR A;  1FRP A;  1KA0 A;  2PCR A;  3LUZ A;  2BJI A;  1DCU A;  1YYZ A;  4FBP A;  3BIH A;  4AS4 A;  3KC1 A;  4O7I A;  5LDZ A;  1QGX A;  1Q9D A;  3KC0 A;  3D1R A;  1FJ9 A;  1D9Q A;  1AWB A;  1FPG A;  1FTA A;  4I3E A;  3T0J A;  4KXP A;  4MJO A;  1XI6 A;  1FBD A;  3FBP A;  1IMF A;  5EYG A;  1K9Z A;  4GWU A;  3RPL B;  1NUY A;  1IMC A;  1DK4 A;  4HE2 A;  2WBD A;  4GX3 A;  1FBH A;  1FJ6 A;  1NV2 A;  1NV4 A;  1FPI A;  1CNQ A;  5ET6 A;  2DDK A;  1G0I A;  2Q8M A;  1EYK A;  4G61 A;  3KBZ A;  1NV1 A;  5ET5 A;  1NV5 A;  4GBW A;  4GWZ A;  2OX3 A;  1LBX A;  4GWX A;  4H46 A;  1EYI A;  1YXI A;  4H45 A;  3ROJ A;  1NUX A;  1NV7 A;  1NV0 A;  2FVZ A;  2Y5L A;  1IMA A;  1FBP A;  1BK4 A;  5ET7 A;  4GWY A;  3A29 A;  5EQ9 A;  1FPJ A;  1FPF A;  2CZI A;  1RDY A;  1FPL A;  1LEV A;  5ET8 A;  3BIG A;  5EQ8 A;  1LBY A;  4PTK A;  2P3N A;  3IFA A;  4N81 A;  5F24 A;  5IZ1 A;  1RDZ A;  1INP A;  4AS5 A;  5IZ3 B;  5DW8 A;  1G0H A;  1YZ0 A;  4GWW A;  2CZH A;  1NUW A;  2JJK A;  5EQA A;  5EYH A;  4HXV A;  5A5L A;  1FPE A;  2QVU A; 
#chains in the Genus database with same CATH topology
 2I4C A;  4MCO A;  3JZJ A;  1JP4 A;  1MS7 A;  1K9Y A;  4POX A;  1LGB C;  4R74 A;  3QK6 A;  2OWZ A;  4DDD A;  4EUO A;  5TU0 A;  3OMB A;  1MQG A;  3UOR A;  5DEX B;  3SEU A;  2Z8D A;  4TLM B;  3RT8 A;  2BJJ X;  3OEM A;  4N91 A;  1DMB A;  4GL0 A;  2ONS A;  3ECR A;  3B6T A;  4F3G A;  1FSA A;  3TMG A;  4PDH A;  3H6V A;  1OMP A;  5JK4 A;  4JXI A;  1DPE A;  1Q1K A;  4R75 A;  2YPN A;  3D1R A;  4PFU A;  1AWB A;  3T0J A;  3W9W A;  2V93 A;  2CMO A;  2UVG A;  4JSD A;  2HAU A;  2GFE A;  1M5D A;  4NGU A;  2QMW A;  2XD3 A;  4H1X A;  5A5X A;  2HXW A;  3PMV A;  2Y7W A;  4K3F A;  1JQF A;  5ET5 A;  2WX9 A;  4PC9 A;  5L9O A;  2P2A A;  5IGA A;  4H46 A;  1DOT A;  5FHM A;  1H76 A;  3ROJ A;  3RN8 A;  5AA3 A;  1KWH A;  4F1Y A;  3A29 A;  1SBP A;  4U1O A;  1SW5 A;  4DXB A;  1R6Z A;  2F5X A;  1T0K A;  2VOZ A;  3EHT A;  1RDZ A;  4OEU A;  2PBW A;  3TCG A;  5EHS A;  1QUK A;  4PGP A;  4GXS B;  1SW2 A;  1MM6 A;  1P1U A;  5J16 A;  4F2O A;  4PE3 A;  3B6Q A;  1WOD A;  5CRY A;  2HXR A;  1D9Y A;  1TXF A;  4OFL A;  2DYX A;  4IY5 A;  2Q74 A;  3FAS A;  4NHB A;  4RPN A;  4JWY A;  5AA1 A;  3S9E A;  1B3F A;  3FVO A;  2WBB A;  3HO7 A;  4N15 A;  4F22 A;  4U1Z A;  1VFD A;  2B3B A;  1B3E A;  1B46 A;  1MRP A;  2Y7P A;  3RPL A;  3VV5 A;  3FD3 A;  4PFB A;  2HHM A;  3LSW A;  4KHZ E;  4KR5 A;  3NOH A;  3KBR A;  4PF8 A;  2F35 A;  4G68 A;  3MZ1 A;  1JVY A;  2F78 A;  1B6H A;  4GIZ A;  1VFE A;  4XKR A;  2I0C A;  3DP8 A;  3Q26 A;  4JVD A;  2WBD A;  4IO7 A;  2ZYN A;  1MY2 A;  4EF1 A;  1XOC A;  3MZB A;  2XXT A;  3WAE A;  2WYK A;  3IO4 A;  5HM4 B;  1EYI A;  5IM2 A;  5I2K A;  4H45 A;  1A99 A;  1B0L A;  3FXB A;  3V83 A;  2A5T A;  2F7A A;  1URG A;  4JBZ A;  2OBG A;  2FYI A;  2KQZ A;  1EZP A;  3KN7 A;  3TDJ A;  1JVX A;  4WEP A;  1Y1Z A;  2F6G A;  2FNC A;  3USD A;  4BDO A;  1BLF A;  2ONR A;  3KSJ A;  5IKB A;  5J1D A;  3MW0 A;  3O9P A;  5ELV A;  2NWJ A;  5T3J A;  4F3B A;  4F1V A;  5FBP A;  2Y7R A;  5KZT A;  3VLU A;  3JV9 A;  1JEV A;  2DP8 A;  3Q29 A;  1MQI A;  3SET A;  2DE4 A;  2PFY A;  3C35 A;  1PB8 A;  2AIX A;  1MXV A;  1VR5 A;  2QVV A;  2F3D A;  4ZE9 A;  3PUZ E;  5ISU A;  2O1M A;  1ZIU A;  2IEE A;  2GRV A;  1S7Y A;  3RTW B;  3FGS A;  3FJG A;  3G7W A;  3PU5 A;  1A54 A;  4IY6 A;  1H3D A;  2PVU A;  3VLW A;  5AA4 B;  1O7T A;  1XI6 A;  3K6U A;  2HZK A;  1FTK A;  1P1N A;  3T9V A;  4QSD A;  1MY0 A;  3C9H A;  4LVQ A;  5K2Y A;  4N6P A;  1B7Z A;  2XX7 A;  2RKM A;  5H8N B;  3M8U A;  4G77 A;  4O7M A;  4QF9 A;  3MVZ A;  4L17 A;  1FBP A;  5I56 A;  2QS1 A;  2GH9 A;  1XS5 A;  3C31 A;  2XX8 A;  1IXH A;  3K6W A;  1FPL A;  5EHM A;  4ELR A;  1USY H;  3D4C A;  5F7V A;  3Q25 A;  1B05 A;  4GD5 A;  5EQA A;  2VD3 A;  4HXV A;  3IB1 A;  1UQW A;  2FIX A;  1B5I A;  4OVT A;  1BTJ A;  2WKY A;  3T9H B;  4GOT A;  4PQJ A;  1NV6 A;  2AL4 A;  1OVB A;  5EQ7 A;  2VGQ A;  1ZU0 A;  1YTV A;  1FBE A;  1B40 A;  1B9J A;  3RUM A;  4GL8 A;  4F39 A;  1LAF E;  5H8H A;  1RKM A;  3OOA A;  2PFZ A;  5H8Q B;  1M5F A;  1B4Z A;  1FPB A;  1FPD A;  3ZSF A;  1OQH A;  1NNT A;  4UAB A;  1D3K A;  3RYD A;  4OVR A;  1XC1 A;  2CZL A;  2V3U A;  3C4M A;  2QL3 A;  2QVR A;  3KJ7 A;  1KA0 A;  2O7U A;  1A40 A;  4I3E A;  4N4U A;  1PC3 A;  3H6U A;  3H4Z A;  4N13 A;  2E0S A;  2OWS A;  5HBC A;  4YKI A;  3TPA A;  3SDF A;  4ESW A;  1M5C A;  5I2K B;  3FVG A;  4DI3 D;  1FQC A;  3TFL A;  3VDF A;  1B32 A;  2H9B A;  5FHN A;  1NUX A;  2V25 A;  4FAT A;  4NF0 A;  1JEU A;  3PPO A;  2D21 A;  2DXR A;  2OJT A;  2XA5 A;  3N6T A;  4OA4 A;  3BIG A;  5EQ8 A;  5KCJ A;  2Q9T A;  2XXH A;  5IZ1 A;  1N04 A;  4H8I A;  5H8Q A;  4ZZE A;  2B4L A;  4N17 A;  2D3I A;  2A5S A;  1NNK A;  2O69 A;  4GQO A;  4U21 A;  2XXW A;  3IOT A;  4LUB A;  4LQ5 A;  2ZZX A;  1MQH A;  2XXK A;  3LBS A;  2F8D A;  3RTF B;  2XWV A;  4MNC A;  5I2N B;  3ZS6 A;  5CMM A;  1H45 A;  2XXP A;  1AIV A;  2B4M A;  3HST A;  2I49 A;  3IJX B;  5I59 A;  5DYH A;  3MUQ A;  1YCJ A;  3CSB A;  4OAN A;  3GZG A;  4ZE8 A;  3PV0 E;  5I59 B;  3SEW A;  3LUZ A;  3UP9 A;  3SEV A;  1MXW A;  2DE3 A;  4N6D A;  3HV1 A;  3B6W A;  3DP6 A;  2X7Q A;  2OZZ A;  2QSX A;  1NUY A;  3RGY A;  1IXC A;  4ELP A;  4KPT A;  3K2D A;  3N5L A;  2Q8M A;  2XXR A;  4Q5T A;  3RY3 A;  1UTB A;  4MHF A;  2Z23 A;  5ITP A;  4UAC A;  1PDA A;  4YMA A;  1HSE A;  3SKP A;  1JET A;  2QS3 A;  4NG7 A;  3U94 A;  1B7U A;  1B4H A;  3FXU A;  4G8N A;  3K0V A;  4N81 A;  3U65 A;  1OLA A;  1MPC A;  3PPQ A;  3TYH A;  1YZ0 A;  1B0H A;  1SD3 A;  3EPE A;  1IMD A;  1M5B A;  2P1S A;  1DBZ A;  4XIG Q;  3I3V A;  5DVJ A;  4QFK A;  4GWS A;  5I7I A;  1R9L A;  4GBV A;  4I1D A;  2OK2 A;  3GLB A;  4LQ2 A;  4YZZ A;  3UN6 A;  1Y9U A;  2HZL A;  2RCA A;  1URD A;  1US4 A;  2M8C A;  3U1O A;  2X7P A;  3VVE A;  4XKN A;  4F31 B;  3K4U A;  4KD5 A;  3S2V A;  1A7L A;  2XXV A;  4OQO A;  3M3L A;  2DVC A;  5I3S A;  3MVW A;  3PD9 A;  4OHN A;  4R6Y A;  1B2H A;  2DXY A;  4ZEF A;  1AL3 A;  4O8M A;  3GBA A;  3KOT A;  4AS4 A;  1LB8 A;  2F7B A;  4HS7 A;  3G3I A;  2NUV A;  3FV2 A;  1MDP 1;  1OLC A;  2HQ0 A;  2Y7I A;  1DK4 A;  3CFX A;  5ET6 A;  2DDK A;  4O3C A;  3R7X A;  3O66 A;  3K6X A;  4KCD A;  4ZED A;  1NV5 A;  1LBB A;  1A8F A;  4DXC A;  3FVN A;  3BBR A;  2XWK A;  4IO6 A;  4FOR A;  5CBS A;  4R2B A;  1BK4 A;  2ONK E;  1JW4 A;  1FPJ A;  3A3C A;  3KG2 A;  4ND9 A;  1LEV A;  4FJP A;  3TZA A;  1LLS A;  4DZ1 A;  3KZG A;  4FED A;  5DW8 A;  1G0H A;  2ZNU A;  3DM0 A;  2CZH A;  1NMU A;  3OEN A;  3B7D A;  4PAK A;  1TT1 A;  2O1L A;  4Q0C A;  3ZKL A;  4MNP A;  2B65 A;  4NED A;  4HE0 A;  5TP9 A;  2I3W A;  3DEL B;  3ILU B;  1N84 A;  3BFU A;  2E1S A;  4H67 A;  4E0W A;  4GRK A;  1NI9 A;  3O6H A;  4ZEI A;  4JVC A;  3CIJ A;  4GX6 A;  3IFC A;  1B5J A;  5AA4 A;  4JSO A;  1LCT A;  4OVP A;  1F9B A;  4QSC A;  4F29 A;  4IB2 A;  2XHD A;  3TTK A;  2PYY A;  1ELJ A;  3TTR A;  4WKM A;  1P99 A;  3FIR A;  4EQ7 A;  1LFI A;  4OFJ A;  2PCR A;  4PE5 B;  1YYZ A;  1AH5 A;  4C1T A;  2H99 A;  2DS9 A;  5H8S A;  1JW5 A;  2RCB A;  1FTA A;  4X04 A;  2F34 A;  2F36 A;  1B1H A;  1FBD A;  1IMF A;  5KDT A;  4FE8 A;  1VSO A;  1L5T A;  1IUD A;  4JDF A;  1NV4 A;  4R73 A;  3PPR A;  3OSQ A;  3IR1 A;  4GBW A;  3HFU A;  1QKA A;  1GR2 A;  1OIB A;  3V89 B;  1B3L A;  4ONY A;  1IIT A;  3MQ9 A;  1XVX A;  2ZNS A;  2RC7 A;  3IL1 B;  4X1D A;  3EN3 A;  4IO3 A;  1RDY A;  3IFA A;  4NF5 A;  2ZZV A;  3UIF A;  3RPW A;  4H8J A;  5AA2 A;  5LTC A;  2VT5 A;  4OEN A;  3PUX E;  5ESY A;  3OD7 A;  4BDN A;  3G3J A;  4LAT A;  4PAI A;  3K02 A;  1NNP A;  4GLI A;  3TQL A;  2I48 A;  1P1W A;  4MBP A;  3I6V A;  3B8B A;  2THI A;  3QIM A;  2FHY A;  3HPI A;  1Y3P A;  1FBG A;  1BP5 A;  3CG1 A;  4Z7E A;  1MM7 A;  2R9J A;  3EF7 A;  1I6B A;  1LAX A;  2DWA A;  5IZZ A;  3S9M C;  3UGW A;  5DTB A;  1NFT A;  5JTY A;  4RYA A;  1QKB A;  2Y5K A;  1NH8 A;  4GVO A;  3E9X A;  3MYU A;  4QFN A;  3RT6 B;  4HE1 A;  3IOR A;  1DCU A;  3BIH A;  4NF8 B;  3ILT B;  5JTY B;  3HHG A;  2QRY A;  3PMX A;  4U2R A;  1DPP A;  1UIV A;  4P1E A;  1NV2 A;  2QS4 A;  3CVG A;  4C0R A;  2UVH A;  1EYK A;  3MPL A;  1MQJ A;  1QJM A;  1NV1 A;  2DE2 A;  4KFQ A;  2R6G E;  3R6U A;  4R6K A;  1NV0 A;  3GYY A;  3IOW A;  3M3F A;  1Y3N A;  4P47 A;  1ZLQ A;  4P1L A;  3CRB A;  1BIY A;  1I6Q A;  2L5V A;  4O3B A;  3GXA A;  1FTM A;  3ZKK A;  3HCQ A;  2P3N A;  5AA2 B;  5F24 A;  4AS5 A;  3FV1 A;  4ZEB A;  2Q2A A;  1FQD A;  2HPG A;  3MP1 A;  4IO2 A;  4TOZ A;  5IZ3 A;  4FIM A;  2UYE A;  4O94 A;  2OCU A;  5K2X A;  4GX4 A;  4H5G A;  2WEF A;  2O68 A;  3OXN A;  4XEQ A;  2H4I A;  4ESX A;  4F3S A;  1KA1 A;  1LBV A;  4YB5 A;  3T66 A;  4JWO A;  5CMC A;  5CMK A;  1PBQ A;  2OLB A;  3VLV A;  4I40 A;  4I9D A;  3IAZ A;  1LFG A;  4Q8R A;  1MQD A;  1IZ1 A;  1N0T A;  5LDZ A;  3W9V A;  3K01 A;  4G68 C;  4PFI A;  4IO5 A;  3VFJ A;  1LFH A;  4N8Y A;  1RYX A;  1S50 A;  3LSF B;  4NF4 A;  2XWI A;  3P7I A;  2Z8F A;  1FBH A;  4YKP A;  4MNI A;  2PT1 A;  1B52 A;  4PDD A;  1FTL A;  1VE4 A;  2HEU A;  3O29 A;  2FA7 A;  4EQB A;  1QUI A;  4NWC A;  3MPK A;  4NF6 A;  2XXU A;  3ODB A;  3K1N A;  5KCJ B;  2PT2 A;  3K1M A;  3GBB A;  1LBC A;  3MJN A;  3SER A;  3TCH A;  4P8B A;  3O6G A;  4G8H A;  1FPF A;  5IAI A;  2GHA A;  1ZKB A;  2LAO A;  4PFY A;  3EKI A;  4R2F A;  4PTK A;  1Q35 A;  3S9N C;  3KN8 A;  3KEI A;  4G8M A;  4FEB A;  4GWW A;  2ABH A;  4LA9 A;  1FPE A;  4X1B A;  3T1B A;  1OQG A;  3ISP A;  2I6E A;  4LZ5 A;  4MFI A;  1FPK A;  1ZBM A;  5CC2 A;  3PUY E;  4MAG A;  5H8F B;  3S4U A;  3T9X B;  3VVD A;  1QUL A;  4ZDM A;  1Y3Q A;  3C33 A;  5AA2 D;  4MEV A;  4PBQ A;  5F1Q A;  4KCC A;  3EHU A;  4QHQ A;  4BDR A;  3TEL A;  1OVT A;  1SW4 A;  4G2Z A;  4Z0I A;  1YAE A;  2F3B A;  2B3F A;  2RC8 A;  1EZ9 A;  4U22 A;  3G3F A;  3VVF A;  3RLF E;  2X26 A;  4X8R A;  2O51 A;  4ZEK A;  1Z7M E;  2Q88 A;  1UTH A;  3RNN A;  3TUS A;  5EYF A;  4N07 A;  4ELQ A;  3QXM A;  1MH3 A;  4M1V A;  4OYV A;  4KXP A;  4NN3 A;  5I58 B;  3A09 A;  1ZMG A;  1QUJ A;  3QYT A;  2Y7K A;  2ZXT A;  3H03 A;  1N7W A;  2AL5 A;  3Q27 A;  1B51 A;  4DI4 B;  1SQY A;  1POY 1;  4P56 A;  4QSE A;  3E79 A;  3VXB A;  4H6D A;  3A3U A;  3B50 A;  1SW1 A;  4NWD A;  4H5F A;  4P9K A;  4EXL A;  2DOJ A;  2VPN A;  1MXU A;  5TP9 B;  4H0W A;  5TPA B;  1I6A A;  1INP A;  1N76 A;  4DXU A;  3S9L C;  3OO6 A;  5I2N A;  3O2A A;  1B1X A;  1SYI A;  1FQF A;  1POT A;  4HCY A;  2UYF A;  1MDQ A;  1O63 A;  3T22 A;  2I0B A;  3PMW A;  3CHG A;  4IGR A;  3MST A;  2RIN A;  1FTJ A;  4NQ8 A;  3PPP A;  2PMS A;  3LR1 A;  4OZ9 A;  4JWX A;  2F6P A;  3FVK A;  4HW8 A;  5I57 A;  4NAP A;  2ANJ A;  1GVC A;  3PPN A;  3G3K A;  3FZV A;  4LP2 B;  1IMB A;  5I57 B;  2CEX A;  3N94 A;  1FBF A;  1II5 A;  3I5O A;  4M4G A;  3UK4 A;  4KYE A;  2HFB A;  4I8C A;  4DIG A;  1FJ9 A;  2PX1 A;  4X9T A;  1UTB B;  3L6G A;  3QSL A;  3K6V A;  1A55 A;  4OET A;  3IK6 B;  3N6U A;  1GV8 A;  3CR9 A;  3MWB A;  1CNQ A;  4OVQ A;  2I58 A;  1G0I A;  1MPD A;  3C34 A;  1J1N A;  5L9S A;  1LCF A;  5JEI A;  3KBZ A;  2HCA A;  2ALU A;  3VE1 B;  4XKQ A;  2ESN A;  1DSN A;  2GHB A;  5ITO A;  1Y1M A;  5FHO A;  2DWJ A;  3CSG A;  4TQU Q;  4RK9 A;  4GWY A;  5EQ9 A;  2F7C A;  4WXJ A;  2QPQ A;  2H5Y A;  2CZI A;  3IB2 A;  3MZ9 A;  4LN5 A;  3L6H A;  1FTO A;  5H8H B;  1SYH A;  1EZO A;  2JJK A;  5DVF A;  1XVY A;  2QVU A;  1FQE A;  1LBZ A;  1SI1 A;  1PBP A;  1NV3 A;  3KOS A;  3PUW E;  4EQ9 A;  4KYD A;  4DE8 A;  2R8T A;  3MP6 A;  3SES A;  3U8Q A;  3K00 A;  3FJM A;  4E0X A;  3M3K A;  1XHY A;  2UVI A;  2UXA A;  2WYP A;  4NE4 A;  4QBA A;  1GGG A;  5L9M A;  2VD2 A;  2XXI A;  2KR0 A;  1VDW A;  4WED A;  1B3H A;  1FQA A;  3KN3 A;  3IO6 A;  2W7Y A;  4AB6 A;  3MVY A;  3KGC A;  1R9Q A;  2GQ1 A;  4MMP A;  5H8N A;  3TQW A;  3CG3 A;  4OVJ A;  4JVI A;  4OVS A;  4FBP A;  3KC1 A;  4JB7 A;  4KQP A;  4AQ4 A;  5CI5 A;  3TTL A;  3HHF A;  1D4N A;  4KI0 E;  3PTY A;  2DSF A;  1LST A;  3O28 A;  3THI A;  3FBP A;  1QW0 A;  4OEV A;  4GWU A;  4BDQ A;  2MKZ A;  5BWJ A;  5I5P A;  2D5W A;  1GTK A;  1LBX A;  1SVX B;  1LAG E;  3OSR A;  2HAV A;  3Q28 A;  1N3X A;  2XWO A;  3C32 A;  2Q2C A;  3E78 A;  4F3P A;  5ICT A;  4NF6 B;  3MBP A;  4F1U A;  1FW0 A;  1UTH B;  3T9U A;  2V3Q A;  3U92 A;  5A5L A;  3MC2 A;  3FXQ A;  2Q8J A;  4C1U A;  1FCK A;  4XF5 A;  1MY1 A;  4MIJ A;  4R72 A;  3SEY A;  3TTN A;  5B70 A;  2P3V A;  1SPI A;  2CZK A;  5DT6 A;  3K1P A;  2FIE A;  1AMF A;  2XX9 A;  1HSJ A;  1Y4T A;  1JW1 A;  1NUZ A;  2I4B A;  1HSL A;  4HCW A;  4OER A;  3G3G A;  4U4X A;  1NKX A;  1N3W A;  1MH4 A;  4I62 A;  5M2V A;  4DCY A;  1IQ7 A;  2OWT A;  3H7M A;  2VP1 A;  3EQ1 A;  4MF3 A;  1O64 A;  1SDX A;  1P1Q A;  1PB7 A;  1EYJ A;  4QXD A;  5AE4 A;  1BKA A;  1TWY A;  1B3G A;  2XXQ A;  3FUZ A;  1ANF A;  2XXY A;  1DTZ A;  4U4S A;  2REJ A;  4RXL A;  4DCX A;  4N8G A;  4THI A;  1MY3 A;  4RK2 A;  3F11 A;  5TPA A;  4MJO A;  2ZYM A;  4YIC A;  3V5A A;  4HE2 A;  1FPI A;  2H98 A;  4ZEC A;  4GWZ A;  3MVX A;  2OX3 A;  4YB7 A;  1YXI A;  3TKD A;  1AOV A;  3VXC A;  3V8X B;  4X48 A;  3OO7 A;  2Y5L A;  3KFM A;  4YKK A;  4PFT A;  3U93 A;  5DVI A;  2Z22 A;  2F97 A;  4AB5 A;  1IEJ A;  2OPE A;  1M5E A;  4RY1 A;  4PFR A;  1PEB A;  4KYS A;  2R71 A;  1FQB A;  1N7X A;  4G68 B;  2P0S A;  2O84 X;  3H06 B;  3BFT A;  4N6K A;  1Y4C A;  1MXZ A;  3O97 A;  2NXO A;  3RQT A;  3FJ7 A;  4NX1 A;  2AYS A;  4MLV A;  3IX1 A;  4FAJ A;  3IOU A;  3R26 A;  3CI8 A;  4NF8 A;  5I56 B;  3LSX A;  1PB9 A;  1B5H A;  1Y20 A;  2QS2 A;  2RF1 A;  2XD2 A;  4FEC A;  1RYO A;  4R9G A;  5CM6 A;  5I58 A;  2ZYO A;  5H8F A;  1ZJL A;  2DQV A;  3H3G A;  5LOM A;  1IXI A;  1TFA A;  2QJE A;  4O7I A;  1QGX A;  1Q9D A;  3IJO B;  4YAH X;  2G29 A;  2DWI A;  4PET A;  3OO9 A;  2XXX A;  4QFO A;  5CMB A;  4MH5 A;  3PUV E;  3RPL B;  5B7D A;  4GX3 A;  1FJ6 A;  1USY E;  2ZMB A;  1A8E A;  3OEL A;  4RNS A;  1MY4 A;  2KLF A;  3BKI B;  3ONM A;  4RA1 A;  3IB0 A;  2UVJ A;  5BUU A;  3CFL A;  4UA8 A;  4P0I A;  2Y84 A;  3EHS A;  4MLQ A;  1S9T A;  1YPN A;  2VPO A;  4NF4 B;  3JYR A;  5ET8 A;  4PP0 A;  1LBY A;  1JNF A;  2H25 A;  4PAF A;  3H6W A;  3T96 B;  1XT8 A;  3AXF A;  2YJP A;  5EYH A;  1NUW A;  2OPD A;  4EDP A;  4XKP A;  4BDM A;  3OEK A;  4PCD A;  4TLL B;  2QMX A;  4Q30 B;  3DP4 A;  5ICQ A;  1WVJ A;  2FBP A;  4I3Y A;  3QUF A;  1LAH E;  4PF6 A;  4RJZ A;  3QMF A;  3TEP A;  3LV0 A;  5HPQ A;  1RDX A;  1NL5 A;  5FTI A;  3N26 A;  3LUY A;  4HTG A;  1NH7 A;  3E3K A;  4QFP A;  2V4C A;  3UA8 A;  4GFR A;  4U23 A;  2I3V A;  4P11 A;  3QAX A;  4IO4 A;  1H44 A;  4IGT A;  1KZ8 A;  3TOD A;  3KSX A;  3FAT A;  3PGF A;  3PD8 A;  1IME A;  4BLA A;  1FRP A;  2Z8E A;  1WDN A;  4ZZA A;  2ZYK A;  1D9Q A;  1R1N A;  1CB6 A;  1TFD A;  2RC9 A;  4H65 A;  4GXA A;  5A5X B;  5EYG A;  3WAF A;  5I84 A;  1K9Z A;  3FXR A;  2IA4 A;  1IMC A;  4R6H A;  3TTM A;  1MXX A;  2Q89 A;  4OES A;  4G61 A;  1IXG A;  5DEX A;  2DVZ A;  4NMY A;  2G93 A;  3QUJ A;  4NTL A;  4PBH A;  1US5 A;  1SI0 A;  3TAJ A;  4F18 A;  3SEX A;  2ZNT A;  5L8D A;  1NV7 A;  3C36 A;  4ISU A;  5ET7 A;  3IOV A;  1MG1 A;  4RPO A;  4ECF A;  3KJT A;  3DLN A;  4G4P A;  3SZP A;  1ATG A;  2A5T B;  4LZ7 A;  4OMB A;  3E4R A;  4F19 A;  1B7H A;  4OXV A;  1LBW A;  1FBC A;  4YKJ A;  4OFO A;  2NOO A;  4O3A A;  3T93 B;  4BDL A;  1DTG A;  3O6I A;  1NNF A;  4LON B;  4LZ8 A;  4DLD A;  4PFW A;  1UIU A;  4YB6 A;  2VHA A;  5CBR A;  1CE2 A;  1EU8 A;  1B58 A;  1Z7N E;  2REG A;  5FTH A;  4IR8 A;  4XTC Q;  4ZS9 A;  2O6A A;  4GF8 A;  2YLN A;  2QFL A;  3MP8 A;  4GWO A;  4P3L A;  4QRZ A;  4YMB A;  4EF2 A;  4EXK A;  3MAM A;  3LSL A;  1QVS A;  2BJI A;  3G3H A;  4R9F A;  4POW A;  3KC0 A;  1LB9 A;  4F2Q A;  1FPG A;  4NF5 B;  2V84 A;  1I69 A;  2O7I A;  3U72 A;  3CFZ A;  1D9V A;  1MPB A;  1P1O A;  4P0G A;  2DWH A;  3LC8 A;  3W15 C;  1EH3 A;  2V3T A;  4OTE A;  4PGN A;  4GWX A;  4OWD A;  4QFL A;  1IIW A;  2FVZ A;  4MX6 A;  4YU0 A;  4XXU A;  1IMA A;  3HN0 A;  2ZZW A;  4ELO A;  1MXY A;  3H6T A;  5KDT B;  3TCF A;  1ZTY A;  2NVU B;  3OO8 A;  1URS A;  1H43 A;  5IZ3 B;  2CEY A;  4XFE A;  3D4G A;  3E13 X; 
#chains in the Genus database with same CATH homology
 5LTC A;  2FIX A;  1IMD A;  2VT5 A;  5IZ3 A;  4MNP A;  1LBZ A;  3T1B A;  1DBZ A;  3ISP A;  4OVT A;  5ESY A;  5J16 A;  4MCO A;  4XF5 A;  1LBW A;  1NV3 A;  4HE0 A;  1FPK A;  4MIJ A;  4N6K A;  1FBC A;  1JP4 A;  4HCY A;  4O94 A;  4PCD A;  1K9Y A;  1NV6 A;  4PE3 A;  4GWS A;  4MAG A;  2P3V A;  1SPI A;  5T3J A;  5I7I A;  4NX1 A;  2CZK A;  2ZZX A;  2XXK A;  2HXR A;  5EQ7 A;  4F1V A;  4PAI A;  2FIE A;  4GBV A;  2R8T A;  2XWV A;  3CHG A;  2FBP A;  5FBP A;  4PAK A;  1NI9 A;  1NUZ A;  2OWZ A;  4I3Y A;  1FBE A;  4MNC A;  4JVC A;  4PF6 A;  2Q74 A;  4YZZ A;  3QMF A;  4NHB A;  4GX4 A;  4HCW A;  3MST A;  3LV0 A;  4GX6 A;  4MEV A;  3IFC A;  3B8B A;  1RDX A;  2WEF A;  2HZL A;  4NQ8 A;  4PBQ A;  4XEQ A;  2B4M A;  2FHY A;  2DE4 A;  2WBB A;  4OVP A;  1FBG A;  2WYP A;  4N15 A;  2PFY A;  4IR8 A;  2PFZ A;  2V4C A;  4N91 A;  4QBA A;  1FPB A;  1FPD A;  1KA1 A;  4NAP A;  2F3B A;  1LBV A;  3RPL A;  1FSA A;  2QVV A;  2F3D A;  4PFB A;  5IZZ A;  4PDH A;  2HHM A;  1IMB A;  1VDW A;  5I3S A;  2KR0 A;  4UAB A;  2QFL A;  5CM6 A;  4OAN A;  1EYJ A;  1KZ8 A;  4X8R A;  2CEX A;  3RYD A;  4QXD A;  4OVR A;  4P3L A;  3NOH A;  4I40 A;  2Y5K A;  3MYU A;  4PF8 A;  2GQ1 A;  4MMP A;  4HE1 A;  1FBF A;  5JK4 A;  1IME A;  2QVR A;  4O8M A;  1FRP A;  1KA0 A;  2PCR A;  3LUZ A;  4JVI A;  4OVS A;  2BJI A;  1DCU A;  1YYZ A;  4FBP A;  3BIH A;  4AS4 A;  3KC1 A;  4O7I A;  5LDZ A;  1QGX A;  1Q9D A;  3KC0 A;  2DE3 A;  4N8G A;  4N6D A;  4PFI A;  3D1R A;  3W9V A;  1FJ9 A;  4M1V A;  1D9Q A;  1AWB A;  3PTY A;  4X9T A;  1FPG A;  1FTA A;  4I3E A;  3T0J A;  4KXP A;  4NN3 A;  4PET A;  4X04 A;  4N4U A;  3W9W A;  4MJO A;  4N8Y A;  1XI6 A;  1FBD A;  3FBP A;  1IMF A;  2HZK A;  5EYG A;  4YIC A;  1K9Z A;  4GWU A;  3RPL B;  1NUY A;  1IMC A;  1DK4 A;  4HE2 A;  2XWI A;  4NGU A;  4JVD A;  2WBD A;  4GX3 A;  1FBH A;  1FJ6 A;  1NV2 A;  4P1E A;  1NV4 A;  1FPI A;  1CNQ A;  5ET6 A;  2DDK A;  4OVQ A;  4DI4 B;  1G0I A;  2MKZ A;  2Q8M A;  1EYK A;  4MNI A;  5I5P A;  4G61 A;  4P56 A;  2DVZ A;  4DI3 D;  4MHF A;  4PDD A;  3KBZ A;  4PBH A;  1NV1 A;  5ET5 A;  2DE2 A;  1NV5 A;  2WX9 A;  2WYK A;  4GBW A;  4GWZ A;  3E79 A;  2OX3 A;  3HFU A;  4PC9 A;  4PGN A;  5IGA A;  1LBX A;  4GWX A;  4H46 A;  1EYI A;  1YXI A;  4O7M A;  4H45 A;  5IM2 A;  4F18 A;  3ROJ A;  1NUX A;  3FXB A;  1NV7 A;  1NV0 A;  2FVZ A;  3GYY A;  4MX6 A;  2XWK A;  2Y5L A;  3B50 A;  4NG7 A;  1IMA A;  1FBP A;  4NF0 A;  4P47 A;  4P8B A;  1BK4 A;  5ET7 A;  2XWO A;  4GWY A;  3A29 A;  5EQ9 A;  4P1L A;  3E78 A;  1FPJ A;  4P9K A;  2QPQ A;  2ZZW A;  1FPF A;  2XA5 A;  2KQZ A;  2L5V A;  2CZI A;  2VPO A;  2VPN A;  1RDY A;  3EKI A;  4LN5 A;  2F5X A;  4OA4 A;  1FPL A;  1LEV A;  5ET8 A;  3BIG A;  5EQ8 A;  1LBY A;  4PTK A;  2Q9T A;  2P3N A;  3IFA A;  3SZP A;  4PAF A;  4N81 A;  5F24 A;  5IZ1 A;  1RDZ A;  2ZZV A;  1INP A;  3U65 A;  4AS5 A;  5IZ3 B;  4F1U A;  2CEY A;  5DW8 A;  1G0H A;  1YZ0 A;  4PFR A;  4PGP A;  4GWW A;  2CZH A;  1NUW A;  2JJK A;  5EQA A;  5EYH A;  2B4L A;  2V3Q A;  4HXV A;  5A5L A;  4XFE A;  1FPE A;  4N17 A;  5J1D A;  2HPG A;  4F19 A;  2QVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...