4I40A

Crystal structure of staphylococcal inositol monophosphatase-1: 50mm licl inhibited complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 75
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i40A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i40A02
2QVVA 1FPBA 1FJ6A 4I3YA 4MJOA 1NUYA 5A5LA 1RDXA 4GX3A 4GX6A 2P3VA 3KC1A 5ESYA 3RPLA 1LBYA 2CZKA 4GWXA 1Q9DA 5EQAA 1LBXA 5IZ3B 1NV2A 5FBPA 4H46A 1FBEA 3ROJA 2WBDA 3BIHA 1EYIA 2P3NA 1NV0A 1FPFA 2BJIA 4GWYA 3IFCA 2WEFA 2Y5KA 1IMDA 3D1RA 5IZ1A 4AS4A 1AWBA 4HE0A 1FPLA 4GWSA 4G61A 4FBPA 4I3EA 1YXIA 1VDWA 2WBBA 1DBZA 1EYJA 5LDZA 2QVUA 1KA0A 1IMBA 1NUXA 2QVRA 2PCRA 4KXPA 1NI9A 4HE2A 1FJ9A 1K9YA 2JJKA 2F3BA 1NV1A 3RPLB 4AS5A 3IFAA 1KZ8A 2R8TA 1BK4A 2QFLA 2GQ1A 5I3SA 4H45A 1FPJA 4GBVA 5EQ8A 5EYGA 4N81A 4HXVA 3KC0A 1D9QA 1FBPA 2VT5A 1FRPA 4IR8A 5F24A 1DCUA 1FPIA 1NV7A 1LBWA 5ET6A 5T3JA 1NV4A 2OX3A 1IMEA 4GWUA 1KA1A 1INPA 2Q8MA 1FBDA 4QXDA 1FBHA 2DDKA 1IMCA 5EQ9A 2HHMA 1G0HA 2FIEA 1RDZA 1NUWA 3LV0A 1IMFA 1FPEA 1FPDA 3QMFA 2FHYA 3B8BA 3KBZA 1LEVA 1JP4A 3T0JA 1K9ZA 2FIXA 2FVZA 2CZIA 4PTKA 4GX4A 5ET8A 4GWZA 3RYDA 4I40A 1FBGA 1FBCA 5EQ7A 5IZ3A 1NV3A 1LBVA 1QGXA 5DW8A 1FPGA 5J16A 1FSAA 1IMAA 4GBWA 1CNQA 1FBFA 1LBZA 3LUZA 1EYKA 1YYZA 2F3DA 1G0IA 2FBPA 1XI6A 2Y5LA 4O7IA 3BIGA 1FPKA 1NUZA 4HE1A 1NV5A 4GWWA 1FTAA 2Q74A 2CZHA 1SPIA 1YZ0A 1RDYA 2OWZA 3FBPA 1DK4A 5ET7A 5ET5A 5EYHA 1NV6A 3A29A
chains in the Genus database with same CATH superfamily
2A5SA 5I84A 2XWIA 3N26A 4MH5A 4KI0E 5TP9B 4OVQA 3RPLA 1PB9A 2UVHA 5AA3A 1Q9DA 3UORA 2WX9A 1FBEA 4EF1A 3QSLA 1EYIA 4ELPA 3KZGA 1SQYA 1AMFA 4YB6A 2Y5KA 1IMDA 1VFDA 3D4GA 1FQCA 5B7DA 4NTLA 2XD2A 4N13A 4PDDA 4X04A 2PCRA 3ISPA 4WEDA 1DPEA 4JVDA 5EYFA 4XKQA 3TQWA 3FATA 3RPWA 1ZJLA 2Z8FA 4DCXA 3PTYA 2QS2A 1FQBA 1N3WA 1FTKA 1PEBA 1QULA 2RC7A 3JZJA 4PAFA 5KZTA 5KDTB 1WVJA 3QMFA 2QRYA 3FZVA 1MQHA 3RYDA 2CZIA 3P7IA 1MG1A 1B5IA 5EQ7A 4H67A 1KWHA 4XTCQ 2ABHA 4PF6A 1LBZA 2D5WA 1P1NA 1LLSA 4ZE9A 4YB7A 3VLWA 1MXUA 1D3KA 3EKIA 2ZMBA 3EF7A 3TQLA 3IB1A 1LAGE 1MY1A 3VLVA 1MRPA 3A29A 3WAFA 1ZMGA 4I9DA 2HEUA 1FJ6A 4MJOA 3RUMA 2UYEA 2XXPA 4GX6A 1I69A 3KC1A 3MBPA 1B05A 3ODBA 1RYXA 4IY5A 5K2XA 1ZU0A 1UTBA 2G29A 3TUSA 5H8FB 4NGUA 4NX1A 4NF8B 1OVTA 2I49A 4IGTA 1A55A 3H7MA 3MZ9A 4PGNA 2A5TA 4DIGA 1EZOA 4P0GA 4OVRA 3T9VA 3R26A 4KXPA 4G68C 3R6UA 2F3BA 1IXIA 1NV1A 4OHNA 1URSA 4DXCA 1TFDA 4AS5A 3S9MC 5AA4A 4DZ1A 1OVBA 3I5OA 3VE1B 3TCHA 1MPDA 4ZEBA 3QK6A 2XX8A 1MXVA 1N7WA 4N6DA 1IXCA 3KEIA 5IZZA 2DWHA 2OX3A 4E0XA 1LFGA 1SBPA 2NVUB 3WAEA 4AB5A 1GTKA 2O7IA 1PB8A 1EH3A 3KN8A 3B6TA 3H6WA 1PBPA 2F8DA 3C36A 1RYOA 3KFMA 2V3TA 4KQPA 1XVYA 4JSOA 4OXVA 4DE8A 1YPNA 3IB2A 5IAIA 1B3LA 5CBSA 5CMBA 3SZPA 3MVWA 4HE1A 3UP9A 3CG1A 2QJEA 2F97A 2REJA 3OSRA 4HS7A 5ITOA 4RYAA 3LR1A 1RDXA 2Z23A 3IB0A 1JW4A 3K6UA 1Y1MA 5I58B 2B4LA 3QAXA 5H8NA 3M3KA 2DE4A 4E0WA 4F1UA 2H5YA 4QFKA 1LCTA 3CIJA 3PPQA 3CVGA 3SKPA 2R9JA 3O2AA 1B52A 4NEDA 3HO7A 2B4MA 2OCUA 3FXQA 3TPAA 2HXWA 5DVJA 4BDOA 1FPJA 4FE8A 2I0BA 1ELJA 2OPEA 4OVSA 2O1LA 3L6GA 4F2OA 1DCUA 5ET6A 1MXZA 4EQ9A 1URDA 3V5AA 2HAVA 1UQWA 2ZYNA 4BDQA 2FIXA 4L17A 4ZEIA 1O64A 1TWYA 1FSAA 1XI6A 3CRBA 1AH5A 1MY2A 3IO4A 1MQDA 4LATA 1MXYA 3FBPA 1B3GA 2ZNUA 4NG7A 4MFIA 1FPBA 5BWJA 1D4NA 1XHYA 4LONB 4GX3A 4R9GA 4GWXA 3T1BA 1LBXA 1NV2A 4IO4A 2Z8EA 5I56B 2WBDA 3IOVA 4YKKA 3O9PA 1YAEA 4AS4A 1SW1A 4BDRA 1US4A 2XXIA 4KR5A 4EDPA 4P0IA 1NMUA 3TYHA 1VDWA 2WBBA 2V4CA 3V89B 4OETA 4PFRA 2XX9A 3W15C 4GLIA 1IEJA 1MS7A 5KDTA 3HFUA 3C31A 3ZSFA 4RPOA 3CSBA 2I48A 3RT6B 4H45A 2VD3A 3FXBA 5EYGA 2ZYOA 4NF4B 4JDFA 5HPQA 3G3IA 1FRPA 3PPRA 2KLFA 2HPGA 1KA1A 3ZKLA 4QXDA 1Y3NA 2M8CA 3UK4A 4WXJA 4PFIA 2XXKA 4RJZA 1RDZA 2VHAA 3KBZA 1LEVA 2I4BA 3T0JA 2Y7WA 2IA4A 2CMOA 4HCYA 4QHQA 1N7XA 5H8FA 2XA5A 3K2DA 4DI3D 2ONRA 3KOSA 4NF8A 1NUZA 2I6EA 5B70A 2Y7RA 3OEMA 2DS9A 3H6UA 3MYUA 2VOZA 4LA9A 5EYHA 3N6UA 3PGFA 4X1DA 5H8QB 3B6QA 3BKIB 5FTIA 3O6GA 2DP8A 4F3PA 4YB5A 2RC9A 2Y7PA 1A99A 2H98A 5IZ3B 4H46A 4C0RA 2G93A 3K4UA 3LUYA 2PFYA 4IO3A 3LSFB 1B3FA 1NKXA 4NWDA 1IXGA 1Y3PA 4BLAA 4Q0CA 4HE0A 2GFEA 1SYHA 3S9EA 4QBAA 2GHBA 1A7LA 4OYVA 1MY3A 1DTZA 1NNPA 4PC9A 1MPCA 3DELB 1B3EA 4ELOA 3PMVA 2O6AA 5I2NB 3K6XA 4FAJA 1R9QA 4OESA 3VXBA 4N81A 1HSJA 1QW0A 1FW0A 3H03A 1Y20A 4GFRA 3OO6A 1JEUA 3SEUA 4XXUA 1IMEA 2NUVA 4N07A 3OMBA 2ONKE 4OFLA 4Z7EA 1IMFA 4N17A 1USYH 4U23A 4JB7A 3E3KA 5AA2D 1WDNA 2I4CA 4H0WA 4GXAA 3Q27A 5I58A 3VFJA 3ILTB 3LUZA 3B50A 4LQ5A 3TAJA 4LVQA 5ELVA 3O6IA 4TQUQ 4U22A 5L9SA 1N76A 1WODA 1SPIA 3KOTA 5L9OA 1MY4A 2F78A 2H9BA 4U21A 2UVJA 1CB6A 4UA8A 3O66A 1XT8A 3S2VA 3KSJA 1HSEA 2DE2A 4ISUA 1FPFA 3H6VA 2F7BA 4XFEA 2GH9A 3KN3A 2PFZA 4X1BA 3ILUB 3CFXA 1II5A 3O6HA 4ELQA 4ZS9A 5FHMA 1NNTA 4G77A 3H06B 3HHFA 3K01A 4IO5A 2Y7KA 1N04A 1QKBA 1ATGA 1NH7A 3S9NC 4PDHA 3PD9A 4U1OA 3IL1B 4ZZAA 1NL5A 1QKAA 4YAHX 1CE2A 2HAUA 3ONMA 4R6YA 2R71A 4F31B 4LUBA 4ZDMA 4NE4A 1G0HA 1P1QA 2DWIA 3BFUA 1LAXA 1Z7NE 4XKRA 1DOTA 4R2FA 3HHGA 3OELA 4N8YA 1NV3A 5I56A 1LBCA 1CNQA 3G3HA 3ECRA 2Y5LA 4R73A 4O7IA 2NWJA 1I6QA 3EHTA 4QFOA 1QVSA 2PVUA 2RINA 4PFTA 5KCJB 4RK9A 1QUKA 2QMWA 3MUQA 4F39A 1VFEA 1PB7A 4GQOA 1JETA 1LBYA 4LZ8A 4YKIA 3BBRA 3C33A 3A3UA 4IO7A 3PPOA 4GWYA 3SEWA 1MXXA 3D1RA 3RTFB 4G4PA 3OD7A 4NF4A 1VR5A 1B40A 3RTWB 3HN0A 4KYDA 4ESXA 2I58A 2ZYKA 4OWDA 4FECA 3T93B 3G3JA 3FASA 4OENA 4Q8RA 2AIXA 1MDP1 4YKPA 4KD5A 1GGGA 2DVCA 5F24A 1NV7A 3FJGA 2CEYA 4U4XA 2PX1A 5ITPA 1JEVA 4MLVA 3U93A 1NH8A 5DYHA 5H8QA 4P3LA 3LV0A 4KYEA 2DQVA 3MW0A 4DXBA 2FVZA 4GX4A 4FEDA 4IY6A 1FTLA 5IZ3A 1QGXA 2THIA 2YJPA 2F3DA 2DSFA 1QJMA 4H65A 2X7QA 2O51A 2CZHA 2QS3A 4KCDA 4HW8A 4F3GA 3CR9A 2B3BA 1JVXA 4I3YA 3TCFA 5LOMA 4PGPA 3U1OA 2DOJA 4NQ8A 3T9UA 5EQAA 2I3VA 2HQ0A 3OSQA 4GD5A 3TCGA 5I2NA 2BJIA 1B5HA 2FNCA 4GIZA 4ZEFA 3C35A 4MBPA 3K1PA 4PFUA 1SI0A 2XXHA 2QSXA 1DBZA 2O69A 3E9XA 2XXWA 4KFQA 1A40A 1MDQA 1IMBA 1LAFE 2JJKA 4MIJA 4MEVA 3O28A 4JXIA 3G3GA 3OXNA 1R1NA 4C1UA 2XD3A 4XIGQ 5JTYB 4GF8A 4HTGA 2H25A 4GBVA 1DTGA 4P11A 5ISUA 2UYFA 5CI5A 3H4ZA 3E13X 1J1NA 3IK6B 1Y4TA 1UIVA 2GRVA 3U72A 1M5DA 3QXMA 4MNCA 2F6GA 3SEVA 1GVCA 2HHMA 1LSTA 3JYRA 1B32A 1FPDA 3W9VA 3CI8A 1IITA 4DCYA 1POY1 2O68A 4PBQA 4OANA 4X48A 2F7CA 4I40A 1R9LA 2P2AA 2P1SA 3FUZA 2HCAA 2L5VA 3MQ9A 4YU0A 4PAKA 4TLLB 3VV5A 4ELRA 5H8SA 2UVIA 1B0HA 3OENA 4Z0IA 4OEUA 4YKJA 5HM4B 1Y1ZA 1BLFA 4PE5B 4G8MA 4EQBA 1OMPA 4IGRA 3QUFA 1P1UA 2F34A 4PE3A 5EHMA 5L8DA 5DT6A 2XXTA 5BUUA 1AL3A 4H5GA 3VVFA 2HXRA 2D21A 2I3WA 4FBPA 2RKMA 1SW2A 3MPLA 3MVZA 2DWJA 4IO2A 5LDZA 4FIMA 4TOZA 3O97A 3E79A 4FJPA 3HCQA 1EZPA 2XWOA 1LB8A 4EQ7A 3EHUA 3IOUA 4FORA 3OO7A 4G8NA 2V93A 1TFAA 5IM2A 5I7IA 4F1VA 3PPNA 2CZLA 2UXAA 3IR1A 4OVJA 5KCJA 3LSLA 4K3FA 2W7YA 3N5LA 3F11A 1FBHA 1IZ1A 3QIMA 4AB6A 5EQ9A 2X26A 3V83A 2FYIA 2OLBA 3TTLA 1JP4A 2Q2AA 2PT2A 1K9ZA 3K1MA 1USYE 3PUWE 2Z22A 4Q5TA 5J16A 1FPGA 1DMBA 1FTMA 4YMBA 2OZZA 3VVEA 1EYKA 2DXRA 1LB9A 3C32A 4OFOA 3K0VA 5LTCA 1NV5A 3DLNA 3LBSA 3NOHA 1FTAA 1Y4CA 2KR0A 2WKYA 1EZ9A 4H6DA 3KBRA 4RPNA 4PAIA 1NUYA 1QUIA 4GXSB 3IX1A 2H99A 3TTNA 2X7PA 5JEIA 1M5FA 3DM0A 4JWOA 2P3NA 3T96B 4I8CA 2AYSA 2O7UA 2Z8DA 1H76A 4JWXA 1MM6A 4P1EA 1FPLA 2XXUA 4I3EA 4QFPA 1LBBA 1MQGA 2H4IA 1D9YA 3PMWA 4XF5A 1ZTYA 4OVPA 4MNIA 3G7WA 3I3VA 3FV2A 3D4CA 4DI4B 3QUJA 4RNSA 3SERA 1KZ8A 2IEEA 3M3LA 3FGSA 5I3SA 4NF6B 3PV0E 4PFBA 2XXQA 1QUJA 1T0KA 4UACA 3TEPA 3IJXB 3FJ7A 3LC8A 1VE4A 4N4UA 1PC3A 1OLCA 5H8HA 1N0TA 3MVYA 4THIA 4RY1A 4NF5B 3IO6A 3KGCA 4PBHA 3TKDA 3IOWA 3S9LC 5CMCA 1US5A 5DW8A 4QFNA 3EHSA 1XC1A 1YYZA 2ZNSA 1UIUA 3BIGA 4OTEA 4N91A 3MP6A 4R72A 4QRZA 1N84A 1SW4A 4NF0A 1B1XA 4G2ZA 3DP6A 5FHNA 1N3XA 2ZNTA 2FA7A 2Y7IA 2P3VA 1B3HA 2XXXA 3QYTA 5JTYA 4PQJA 5I2KB 4IB2A 3TTKA 2MKZA 3IFCA 5IZ1A 3MC2A 4X9TA 3IOTA 4GWSA 4G61A 3C34A 3V8XB 2I0CA 1EYJA 5HBCA 1M5EA 4OQOA 4F18A 2V3UA 4MX6A 3TTRA 2QMXA 2F5XA 3PUZE 1P1WA 4H8JA 1AOVA 3HV1A 3UN6A 4KHZE 1H44A 4N6PA 1D9VA 1BK4A 3KJ7A 2GQ1A 5ICQA 3K02A 4JBZA 1F9BA 3TELA 4DLDA 1P1OA 3CG3A 4G8HA 1XVXA 4NMYA 3LSWA 4BDLA 2DDKA 1IMCA 1JW5A 1B1HA 5I5PA 1NUWA 2DWAA 4NHBA 3M8UA 4AQ4A 4OFJA 2NOOA 3K00A 4GBWA 1IXHA 1B4HA 4LZ5A 1DSNA 1UTHA 3S4UA 5JK4A 1O7TA 1B7HA 1FPKA 3AXFA 3VXCA 1LAHE 4GWWA 1A8FA 2Q74A 3BFTA 4I62A 4EF2A 4O94A 3SEYA 1RDYA 1DK4A 5ET7A 2HZKA 4F3SA 4N8GA 4H8IA 3PMXA 5TPAB 3UIFA 3HSTA 5FBPA 1BIYA 1MH4A 3B7DA 3PU5A 3TODA 3CFZA 1MH3A 3DP8A 4P56A 1B9JA 4WKMA 3THIA 3K1NA 4U1ZA 5FHOA 4GL0A 3SDFA 3FVKA 1KA0A 4ND9A 1SI1A 1NI9A 5ICTA 2KQZA 4I1DA 5I59B 3RN8A 4ECFA 2Q89A 4MLQA 2GHAA 4R6HA 5TU0A 4OERA 4NAPA 2XWVA 4OZ9A 1D9QA 3GXAA 1H3DA 4PETA 1FPIA 3E4RA 3FVOA 5IKBA 3UA8A 3MVXA 4PP0A 3TZAA 4TLMB 4G68B 4H5FA 3Q25A 4R2BA 1Y9UA 1TXFA 3L6HA 2XHDA 2DE3A 1L5TA 3RY3A 2ZZVA 1FBFA 2Q9TA 2XXVA 3EN3A 3FVNA 2QS1A 3TFLA 2PYYA 4O3CA 1HSLA 1I6AA 1MM7A 4POXA 4R9FA 5I57B 4KPTA 2OWZA 4EXLA 3MP8A 3B6WA 2OWSA 3RT8A 1NUXA 5FTHA 3MP1A 3U94A 2B3FA 4OA4A 5CMKA 1LCFA 1MQIA 2ZZXA 5ESYA 4EXKA 1B0LA 1MY0A 3DP4A 4P1LA 4PF8A 3N94A 1B5JA 1VSOA 4JSDA 3C4MA 4NN3A 3ROJA 3JV9A 3BIHA 4GOTA 1NV0A 4ZZEA 2F6PA 1TT1A 4MNPA 4NF6A 2WEFA 4EUOA 3TDJA 4MF3A 1B7UA 1O63A 5H8HB 5EHSA 4QSDA 2YPNA 1JW1A 3CFLA 4ZEKA 1MQJA 3MPKA 1OQHA 3Q26A 3PUYE 1DPPA 2V25A 1ZIUA 5CBRA 4NF5A 1FCKA 1ZLQA 5DEXB 5J1DA 1B6HA 3SESA 3Q28A 3RNNA 3PPPA 3FV1A 3IAZA 2OK2A 2V84A 5EQ8A 3K6VA 1PDAA 5AA2A 2RCBA 3CSGA 3Q29A 1NV4A 2AL5A 4POWA 5A5XA 3GLBA 3G3KA 4M4GA 2B65A 4GRKA 3OO9A 2FIEA 3PUVE 1LGBC 3H6TA 4N15A 3FXUA 4RK2A 4PTKA 2OPDA 2V3QA 2OBGA 1JQFA 2F36A 2ONSA 4Q30B 5I2KA 1G0IA 3MZBA 2OJTA 1SYIA 3FVGA 2LAOA 4O3BA 1YZ0A 1EU8A 1IQ7A 1B46A 3PUXE 3RLFE 2ZYMA 4YICA 1NV6A 1SD3A 1POTA 2QVVA 2PMSA 2VPOA 5AA1A 3TTMA 3EQ1A 2CZKA 1NNKA 1FTOA 4OEVA 4JVCA 3W9WA 3U8QA 4PCDA 2QL3A 2F35A 5F7VA 4OMBA 3KG2A 2O84X 4P8BA 3RGYA 1FQAA 3O29A 4MAGA 1PBQA 2QVUA 4GVOA 3LSXA 2XXRA 2QVRA 2E1SA 2ANJA 3OEKA 1K9YA 1ZBMA 3RPLB 1I6BA 4O8MA 1UTHB 4FATA 1Y3QA 5TP9A 1MXWA 4GL8A 3T22A 1B58A 1ZKBA 3I6VA 4KCCA 4HXVA 3H3GA 4O3AA 1B2HA 3A09A 1OLAA 3PD8A 4U4SA 1IUDA 4C1TA 1SW5A 4ZECA 3A3CA 3GZGA 3FXRA 3FJMA 4LN5A 3RQTA 1FBDA 3SETA 1YCJA 1FPEA 2RC8A 4MMPA 4F29A 5M2VA 5TPAA 2RF1A 4FEBA 4MCOA 4GWZA 1GR2A 4NWCA 1FBCA 4BDMA 1LBVA 2QPQA 1XS5A 4JWYA 4QF9A 4ZE8A 4F22A 2FBPA 1H43A 4RA1A 1Q35A 2F7AA 2XXYA 2DVZA 3HPIA 5L9MA 3MWBA 3G3FA 2O1MA 4QSCA 1BKAA 2R6GE 3GYYA 1GV8A 1Q1KA 5I59A 3ZKKA 4YMAA 3OO8A 4U2RA 4QSEA 2VD2A 3KN7A 4XKPA 4YZZA 5K2YA 2RCAA 4ESWA 3C9HA 1Z7ME 3OOAA 3TMGA 2Y84A 1R6ZA 2UVGA 1A54A 1JVYA 3MZ1A 4G68A 2DXYA 5CMMA 2HFBA 3M3FA 3IFAA 3IJOB 4OVTA 1OQGA 2WYPA 1UTBB 3GBAA 3USDA 4ONYA 2NXOA 3MSTA 4DXUA 1BTJA 4UABA 2D3IA 4X8RA 1B51A 2QS4A 5T3JA 5I57A 2A5TB 1S9TA 1YTVA 1INPA 3SEXA 5CRYA 2ZZWA 2VP1A 1FTJA 5DVFA 1XOCA 2FHYA 3B8BA 1ANFA 1M5CA 3K6WA 4WEPA 5ET8A 4F3BA 4XKNA 1JNFA 5AA4B 1IMAA 3VDFA 1B7ZA 4GWOA 1FQEA 1A8EA 5CC2A 4HCWA 2ZXTA 3VLUA 4QFLA 2PBWA 4JVIA 4F2QA 4O7MA 3ZS6A 5ET5A 5DTBA 4BDNA 2P0SA 1B4ZA 2VPNA 1M5BA 4KYSA 5A5LA 1NNFA 2VGQA 5DEXA 4M1VA 1LFHA 1FQFA 2HZLA 5AA2B 4RXLA 3T9HB 1S50A 4PFYA 4H1XA 2CEXA 3U92A 2ESNA 5A5XB 3E78A 3GBBA 1AWBA 3FD3A 2OWTA 3CHGA 1YXIA 4P47A 4F1YA 1S7YA 4ZEDA 4IO6A 1FQDA 4PFWA 1IIWA 2XWKA 4MHFA 4LZ7A 2PT1A 3MAMA 1URGA 3IORA 4HE2A 1FJ9A 4R74A 1OIBA 1H45A 1RKMA 2XX7A 3KJTA 3UGWA 2R8TA 3N6TA 4LP2B 4N6KA 2QFLA 4LQ2A 1NFTA 3KC0A 3MJNA 5H8NB 1FBPA 2BJJX 2VT5A 4IR8A 1LFIA 1LBWA 3R7XA 1SDXA 4GWUA 3KSXA 1BP5A 2Q8MA 3FIRA 2DYXA 3T66A 5CM6A 5F1QA 2Q8JA 5AE4A 1MPBA 1FBGA 2Q2CA 5IGAA 4P9KA 3EPEA 1P99A 2AL4A 1SVXB 2ALUA 2REGA 4XEQA 2E0SA 4DDDA 1AIVA 4F19A 3T9XB 4R75A 2Q88A 3U65A 3VVDA 2YLNA 4R6KA 5DVIA 2WYKA
chains in the Genus database with same CATH topology
2XWIA 4OA4A 2ZZXA 5ESYA 4OVQA 3RPLA 4P1LA 4PF8A 1Q9DA 5IZ3B 4H46A 2WX9A 4NN3A 1FBEA 3ROJA 2PFYA 3BIHA 1EYIA 1NV0A 4PE3A 4MNPA 2WEFA 2Y5KA 1IMDA 2HXRA 4HE0A 4FBPA 4QBAA 5LDZA 4PDDA 3E79A 4X04A 4PC9A 2PCRA 3ISPA 4JVDA 2XWOA 5J1DA 5EQ8A 4N81A 5IM2A 3PTYA 5I7IA 4F1VA 1NV4A 1IMEA 1FBHA 5EQ9A 2FIEA 4PAFA 1IMFA 4N17A 3QMFA 4N15A 1JP4A 1K9ZA 3RYDA 4PTKA 2CZIA 2V3QA 5EQ7A 5J16A 1FPGA 4PF6A 1LBZA 3LUZA 1EYKA 1G0IA 3B50A 5LTCA 1NV5A 3NOHA 1FTAA 2KR0A 1SPIA 3EKIA 1YZ0A 4YICA 1NV6A 3A29A 2QVVA 1FJ6A 2VPOA 4MJOA 4PAIA 1NUYA 4GX6A 3KC1A 2CZKA 2DE2A 4JVCA 3W9WA 2P3NA 1FPFA 4NGUA 4NX1A 4PCDA 4P8BA 4P1EA 4XFEA 1FPLA 4I3EA 2PFZA 4PGNA 4MAGA 4OVRA 2QVUA 4XF5A 2QVRA 4KXPA 4OVPA 4MNIA 1K9YA 2F3BA 4DI4B 1NV1A 3RPLB 4O8MA 4AS5A 1KZ8A 5I3SA 4PDHA 4HXVA 4PFBA 4N6DA 5IZZA 2OX3A 4LN5A 4N4UA 1FBDA 1G0HA 1FPEA 4MMPA 4PBHA 4MCOA 4GWZA 1FBCA 4N8YA 1NV3A 1LBVA 5DW8A 2QPQA 1CNQA 1YYZA 2FBPA 2Y5LA 4O7IA 3BIGA 3SZPA 4N91A 4HE1A 2DVZA 4NF0A 3GYYA 1RDXA 2P3VA 1LBYA 4YZZA 2B4LA 2MKZA 4GWYA 3IFCA 3D1RA 5IZ1A 4X9TA 2DE4A 4F1UA 4GWSA 4G61A 1EYJA 4F18A 4MX6A 2F5XA 2B4MA 3IFAA 4OVTA 2WYPA 1BK4A 2GQ1A 1FPJA 3MSTA 4OVSA 4UABA 5F24A 1DCUA 1NV7A 4X8RA 5ET6A 5T3JA 2CEYA 1INPA 2DDKA 1IMCA 2ZZWA 4P3LA 5I5PA 1NUWA 3LV0A 2FHYA 3B8BA 4NHBA 2FIXA 2FVZA 5ET8A 4GX4A 5IZ3A 1QGXA 1FSAA 1IMAA 4GBWA 2F3DA 5JK4A 1XI6A 4HCWA 1FPKA 4GWWA 4JVIA 2Q74A 2CZHA 4O94A 4O7MA 1RDYA 3FBPA 1DK4A 5ET7A 2HZKA 5ET5A 4N8GA 4NG7A 1FPBA 2VPNA 4I3YA 4PGPA 5A5LA 4GX3A 4NQ8A 4GWXA 5EQAA 4M1VA 3T1BA 1LBXA 2HZLA 1NV2A 5FBPA 2WBDA 2BJIA 2CEXA 4AS4A 3E78A 1AWBA 3CHGA 4P56A 1YXIA 4P47A 1VDWA 2WBBA 1DBZA 2V4CA 4PFRA 2XWKA 1KA0A 1IMBA 4MHFA 1NI9A 4HE2A 3HFUA 1FJ9A 2JJKA 4MIJA 4MEVA 2KQZA 2R8TA 4N6KA 2QFLA 4NAPA 4H45A 4GBVA 2XWVA 3FXBA 5EYGA 3KC0A 1D9QA 1FBPA 2VT5A 1FRPA 4IR8A 4PETA 1FPIA 1LBWA 4GWUA 2HPGA 1KA1A 2Q8MA 4QXDA 5CM6A 4MNCA 2HHMA 4PFIA 2XXKA 1RDZA 1FPDA 3W9VA 3KBZA 1LEVA 3T0JA 4OANA 4PBQA 4I40A 2DE3A 1FBGA 4HCYA 5IGAA 2ZZVA 4P9KA 2L5VA 1FBFA 2Q9TA 4PAKA 2XA5A 4DI3D 4XEQA 1NUZA 4F19A 3MYUA 2OWZA 3U65A 5EYHA 1NUXA 2WYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVV A;  1FPB A;  1FJ6 A;  4I3Y A;  4MJO A;  1NUY A;  5A5L A;  1RDX A;  4GX3 A;  4GX6 A;  2P3V A;  3KC1 A;  5ESY A;  3RPL A;  1LBY A;  2CZK A;  4GWX A;  1Q9D A;  5EQA A;  1LBX A;  5IZ3 B;  1NV2 A;  5FBP A;  4H46 A;  1FBE A;  3ROJ A;  2WBD A;  3BIH A;  1EYI A;  2P3N A;  1NV0 A;  1FPF A;  2BJI A;  4GWY A;  3IFC A;  2WEF A;  2Y5K A;  1IMD A;  3D1R A;  5IZ1 A;  4AS4 A;  1AWB A;  4HE0 A;  1FPL A;  4GWS A;  4G61 A;  4FBP A;  4I3E A;  1YXI A;  1VDW A;  2WBB A;  1DBZ A;  1EYJ A;  5LDZ A;  2QVU A;  1KA0 A;  1IMB A;  1NUX A;  2QVR A;  2PCR A;  4KXP A;  1NI9 A;  4HE2 A;  1FJ9 A;  1K9Y A;  2JJK A;  2F3B A;  1NV1 A;  3RPL B;  4AS5 A;  3IFA A;  1KZ8 A;  2R8T A;  1BK4 A;  2QFL A;  2GQ1 A;  5I3S A;  4H45 A;  1FPJ A;  4GBV A;  5EQ8 A;  5EYG A;  4N81 A;  4HXV A;  3KC0 A;  1D9Q A;  1FBP A;  2VT5 A;  1FRP A;  4IR8 A;  5F24 A;  1DCU A;  1FPI A;  1NV7 A;  1LBW A;  5ET6 A;  5T3J A;  1NV4 A;  2OX3 A;  1IME A;  4GWU A;  1KA1 A;  1INP A;  2Q8M A;  1FBD A;  4QXD A;  1FBH A;  2DDK A;  1IMC A;  5EQ9 A;  2HHM A;  1G0H A;  2FIE A;  1RDZ A;  1NUW A;  3LV0 A;  1IMF A;  1FPE A;  1FPD A;  3QMF A;  2FHY A;  3B8B A;  3KBZ A;  1LEV A;  1JP4 A;  3T0J A;  1K9Z A;  2FIX A;  2FVZ A;  2CZI A;  4PTK A;  4GX4 A;  5ET8 A;  4GWZ A;  3RYD A;  4I40 A;  1FBG A;  1FBC A;  5EQ7 A;  5IZ3 A;  1NV3 A;  1LBV A;  1QGX A;  5DW8 A;  1FPG A;  5J16 A;  1FSA A;  1IMA A;  4GBW A;  1CNQ A;  1FBF A;  1LBZ A;  3LUZ A;  1EYK A;  1YYZ A;  2F3D A;  1G0I A;  2FBP A;  1XI6 A;  2Y5L A;  4O7I A;  3BIG A;  1FPK A;  1NUZ A;  4HE1 A;  1NV5 A;  4GWW A;  1FTA A;  2Q74 A;  2CZH A;  1SPI A;  1YZ0 A;  1RDY A;  2OWZ A;  3FBP A;  1DK4 A;  5ET7 A;  5ET5 A;  5EYH A;  1NV6 A;  3A29 A; 
#chains in the Genus database with same CATH topology
 2A5S A;  5I84 A;  2XWI A;  3N26 A;  4MH5 A;  4KI0 E;  5TP9 B;  4OVQ A;  3RPL A;  1PB9 A;  2UVH A;  5AA3 A;  1Q9D A;  3UOR A;  2WX9 A;  1FBE A;  4EF1 A;  3QSL A;  1EYI A;  4ELP A;  3KZG A;  1SQY A;  1AMF A;  4YB6 A;  2Y5K A;  1IMD A;  1VFD A;  3D4G A;  1FQC A;  5B7D A;  4NTL A;  2XD2 A;  4N13 A;  4PDD A;  4X04 A;  2PCR A;  3ISP A;  4WED A;  1DPE A;  4JVD A;  5EYF A;  4XKQ A;  3TQW A;  3FAT A;  3RPW A;  1ZJL A;  2Z8F A;  4DCX A;  3PTY A;  2QS2 A;  1FQB A;  1N3W A;  1FTK A;  1PEB A;  1QUL A;  2RC7 A;  3JZJ A;  4PAF A;  5KZT A;  5KDT B;  1WVJ A;  3QMF A;  2QRY A;  3FZV A;  1MQH A;  3RYD A;  2CZI A;  3P7I A;  1MG1 A;  1B5I A;  5EQ7 A;  4H67 A;  1KWH A;  4XTC Q;  2ABH A;  4PF6 A;  1LBZ A;  2D5W A;  1P1N A;  1LLS A;  4ZE9 A;  4YB7 A;  3VLW A;  1MXU A;  1D3K A;  3EKI A;  2ZMB A;  3EF7 A;  3TQL A;  3IB1 A;  1LAG E;  1MY1 A;  3VLV A;  1MRP A;  3A29 A;  3WAF A;  1ZMG A;  4I9D A;  2HEU A;  1FJ6 A;  4MJO A;  3RUM A;  2UYE A;  2XXP A;  4GX6 A;  1I69 A;  3KC1 A;  3MBP A;  1B05 A;  3ODB A;  1RYX A;  4IY5 A;  5K2X A;  1ZU0 A;  1UTB A;  2G29 A;  3TUS A;  5H8F B;  4NGU A;  4NX1 A;  4NF8 B;  1OVT A;  2I49 A;  4IGT A;  1A55 A;  3H7M A;  3MZ9 A;  4PGN A;  2A5T A;  4DIG A;  1EZO A;  4P0G A;  4OVR A;  3T9V A;  3R26 A;  4KXP A;  4G68 C;  3R6U A;  2F3B A;  1IXI A;  1NV1 A;  4OHN A;  1URS A;  4DXC A;  1TFD A;  4AS5 A;  3S9M C;  5AA4 A;  4DZ1 A;  1OVB A;  3I5O A;  3VE1 B;  3TCH A;  1MPD A;  4ZEB A;  3QK6 A;  2XX8 A;  1MXV A;  1N7W A;  4N6D A;  1IXC A;  3KEI A;  5IZZ A;  2DWH A;  2OX3 A;  4E0X A;  1LFG A;  1SBP A;  2NVU B;  3WAE A;  4AB5 A;  1GTK A;  2O7I A;  1PB8 A;  1EH3 A;  3KN8 A;  3B6T A;  3H6W A;  1PBP A;  2F8D A;  3C36 A;  1RYO A;  3KFM A;  2V3T A;  4KQP A;  1XVY A;  4JSO A;  4OXV A;  4DE8 A;  1YPN A;  3IB2 A;  5IAI A;  1B3L A;  5CBS A;  5CMB A;  3SZP A;  3MVW A;  4HE1 A;  3UP9 A;  3CG1 A;  2QJE A;  2F97 A;  2REJ A;  3OSR A;  4HS7 A;  5ITO A;  4RYA A;  3LR1 A;  1RDX A;  2Z23 A;  3IB0 A;  1JW4 A;  3K6U A;  1Y1M A;  5I58 B;  2B4L A;  3QAX A;  5H8N A;  3M3K A;  2DE4 A;  4E0W A;  4F1U A;  2H5Y A;  4QFK A;  1LCT A;  3CIJ A;  3PPQ A;  3CVG A;  3SKP A;  2R9J A;  3O2A A;  1B52 A;  4NED A;  3HO7 A;  2B4M A;  2OCU A;  3FXQ A;  3TPA A;  2HXW A;  5DVJ A;  4BDO A;  1FPJ A;  4FE8 A;  2I0B A;  1ELJ A;  2OPE A;  4OVS A;  2O1L A;  3L6G A;  4F2O A;  1DCU A;  5ET6 A;  1MXZ A;  4EQ9 A;  1URD A;  3V5A A;  2HAV A;  1UQW A;  2ZYN A;  4BDQ A;  2FIX A;  4L17 A;  4ZEI A;  1O64 A;  1TWY A;  1FSA A;  1XI6 A;  3CRB A;  1AH5 A;  1MY2 A;  3IO4 A;  1MQD A;  4LAT A;  1MXY A;  3FBP A;  1B3G A;  2ZNU A;  4NG7 A;  4MFI A;  1FPB A;  5BWJ A;  1D4N A;  1XHY A;  4LON B;  4GX3 A;  4R9G A;  4GWX A;  3T1B A;  1LBX A;  1NV2 A;  4IO4 A;  2Z8E A;  5I56 B;  2WBD A;  3IOV A;  4YKK A;  3O9P A;  1YAE A;  4AS4 A;  1SW1 A;  4BDR A;  1US4 A;  2XXI A;  4KR5 A;  4EDP A;  4P0I A;  1NMU A;  3TYH A;  1VDW A;  2WBB A;  2V4C A;  3V89 B;  4OET A;  4PFR A;  2XX9 A;  3W15 C;  4GLI A;  1IEJ A;  1MS7 A;  5KDT A;  3HFU A;  3C31 A;  3ZSF A;  4RPO A;  3CSB A;  2I48 A;  3RT6 B;  4H45 A;  2VD3 A;  3FXB A;  5EYG A;  2ZYO A;  4NF4 B;  4JDF A;  5HPQ A;  3G3I A;  1FRP A;  3PPR A;  2KLF A;  2HPG A;  1KA1 A;  3ZKL A;  4QXD A;  1Y3N A;  2M8C A;  3UK4 A;  4WXJ A;  4PFI A;  2XXK A;  4RJZ A;  1RDZ A;  2VHA A;  3KBZ A;  1LEV A;  2I4B A;  3T0J A;  2Y7W A;  2IA4 A;  2CMO A;  4HCY A;  4QHQ A;  1N7X A;  5H8F A;  2XA5 A;  3K2D A;  4DI3 D;  2ONR A;  3KOS A;  4NF8 A;  1NUZ A;  2I6E A;  5B70 A;  2Y7R A;  3OEM A;  2DS9 A;  3H6U A;  3MYU A;  2VOZ A;  4LA9 A;  5EYH A;  3N6U A;  3PGF A;  4X1D A;  5H8Q B;  3B6Q A;  3BKI B;  5FTI A;  3O6G A;  2DP8 A;  4F3P A;  4YB5 A;  2RC9 A;  2Y7P A;  1A99 A;  2H98 A;  5IZ3 B;  4H46 A;  4C0R A;  2G93 A;  3K4U A;  3LUY A;  2PFY A;  4IO3 A;  3LSF B;  1B3F A;  1NKX A;  4NWD A;  1IXG A;  1Y3P A;  4BLA A;  4Q0C A;  4HE0 A;  2GFE A;  1SYH A;  3S9E A;  4QBA A;  2GHB A;  1A7L A;  4OYV A;  1MY3 A;  1DTZ A;  1NNP A;  4PC9 A;  1MPC A;  3DEL B;  1B3E A;  4ELO A;  3PMV A;  2O6A A;  5I2N B;  3K6X A;  4FAJ A;  1R9Q A;  4OES A;  3VXB A;  4N81 A;  1HSJ A;  1QW0 A;  1FW0 A;  3H03 A;  1Y20 A;  4GFR A;  3OO6 A;  1JEU A;  3SEU A;  4XXU A;  1IME A;  2NUV A;  4N07 A;  3OMB A;  2ONK E;  4OFL A;  4Z7E A;  1IMF A;  4N17 A;  1USY H;  4U23 A;  4JB7 A;  3E3K A;  5AA2 D;  1WDN A;  2I4C A;  4H0W A;  4GXA A;  3Q27 A;  5I58 A;  3VFJ A;  3ILT B;  3LUZ A;  3B50 A;  4LQ5 A;  3TAJ A;  4LVQ A;  5ELV A;  3O6I A;  4TQU Q;  4U22 A;  5L9S A;  1N76 A;  1WOD A;  1SPI A;  3KOT A;  5L9O A;  1MY4 A;  2F78 A;  2H9B A;  4U21 A;  2UVJ A;  1CB6 A;  4UA8 A;  3O66 A;  1XT8 A;  3S2V A;  3KSJ A;  1HSE A;  2DE2 A;  4ISU A;  1FPF A;  3H6V A;  2F7B A;  4XFE A;  2GH9 A;  3KN3 A;  2PFZ A;  4X1B A;  3ILU B;  3CFX A;  1II5 A;  3O6H A;  4ELQ A;  4ZS9 A;  5FHM A;  1NNT A;  4G77 A;  3H06 B;  3HHF A;  3K01 A;  4IO5 A;  2Y7K A;  1N04 A;  1QKB A;  1ATG A;  1NH7 A;  3S9N C;  4PDH A;  3PD9 A;  4U1O A;  3IL1 B;  4ZZA A;  1NL5 A;  1QKA A;  4YAH X;  1CE2 A;  2HAU A;  3ONM A;  4R6Y A;  2R71 A;  4F31 B;  4LUB A;  4ZDM A;  4NE4 A;  1G0H A;  1P1Q A;  2DWI A;  3BFU A;  1LAX A;  1Z7N E;  4XKR A;  1DOT A;  4R2F A;  3HHG A;  3OEL A;  4N8Y A;  1NV3 A;  5I56 A;  1LBC A;  1CNQ A;  3G3H A;  3ECR A;  2Y5L A;  4R73 A;  4O7I A;  2NWJ A;  1I6Q A;  3EHT A;  4QFO A;  1QVS A;  2PVU A;  2RIN A;  4PFT A;  5KCJ B;  4RK9 A;  1QUK A;  2QMW A;  3MUQ A;  4F39 A;  1VFE A;  1PB7 A;  4GQO A;  1JET A;  1LBY A;  4LZ8 A;  4YKI A;  3BBR A;  3C33 A;  3A3U A;  4IO7 A;  3PPO A;  4GWY A;  3SEW A;  1MXX A;  3D1R A;  3RTF B;  4G4P A;  3OD7 A;  4NF4 A;  1VR5 A;  1B40 A;  3RTW B;  3HN0 A;  4KYD A;  4ESX A;  2I58 A;  2ZYK A;  4OWD A;  4FEC A;  3T93 B;  3G3J A;  3FAS A;  4OEN A;  4Q8R A;  2AIX A;  1MDP 1;  4YKP A;  4KD5 A;  1GGG A;  2DVC A;  5F24 A;  1NV7 A;  3FJG A;  2CEY A;  4U4X A;  2PX1 A;  5ITP A;  1JEV A;  4MLV A;  3U93 A;  1NH8 A;  5DYH A;  5H8Q A;  4P3L A;  3LV0 A;  4KYE A;  2DQV A;  3MW0 A;  4DXB A;  2FVZ A;  4GX4 A;  4FED A;  4IY6 A;  1FTL A;  5IZ3 A;  1QGX A;  2THI A;  2YJP A;  2F3D A;  2DSF A;  1QJM A;  4H65 A;  2X7Q A;  2O51 A;  2CZH A;  2QS3 A;  4KCD A;  4HW8 A;  4F3G A;  3CR9 A;  2B3B A;  1JVX A;  4I3Y A;  3TCF A;  5LOM A;  4PGP A;  3U1O A;  2DOJ A;  4NQ8 A;  3T9U A;  5EQA A;  2I3V A;  2HQ0 A;  3OSQ A;  4GD5 A;  3TCG A;  5I2N A;  2BJI A;  1B5H A;  2FNC A;  4GIZ A;  4ZEF A;  3C35 A;  4MBP A;  3K1P A;  4PFU A;  1SI0 A;  2XXH A;  2QSX A;  1DBZ A;  2O69 A;  3E9X A;  2XXW A;  4KFQ A;  1A40 A;  1MDQ A;  1IMB A;  1LAF E;  2JJK A;  4MIJ A;  4MEV A;  3O28 A;  4JXI A;  3G3G A;  3OXN A;  1R1N A;  4C1U A;  2XD3 A;  4XIG Q;  5JTY B;  4GF8 A;  4HTG A;  2H25 A;  4GBV A;  1DTG A;  4P11 A;  5ISU A;  2UYF A;  5CI5 A;  3H4Z A;  3E13 X;  1J1N A;  3IK6 B;  1Y4T A;  1UIV A;  2GRV A;  3U72 A;  1M5D A;  3QXM A;  4MNC A;  2F6G A;  3SEV A;  1GVC A;  2HHM A;  1LST A;  3JYR A;  1B32 A;  1FPD A;  3W9V A;  3CI8 A;  1IIT A;  4DCY A;  1POY 1;  2O68 A;  4PBQ A;  4OAN A;  4X48 A;  2F7C A;  4I40 A;  1R9L A;  2P2A A;  2P1S A;  3FUZ A;  2HCA A;  2L5V A;  3MQ9 A;  4YU0 A;  4PAK A;  4TLL B;  3VV5 A;  4ELR A;  5H8S A;  2UVI A;  1B0H A;  3OEN A;  4Z0I A;  4OEU A;  4YKJ A;  5HM4 B;  1Y1Z A;  1BLF A;  4PE5 B;  4G8M A;  4EQB A;  1OMP A;  4IGR A;  3QUF A;  1P1U A;  2F34 A;  4PE3 A;  5EHM A;  5L8D A;  5DT6 A;  2XXT A;  5BUU A;  1AL3 A;  4H5G A;  3VVF A;  2HXR A;  2D21 A;  2I3W A;  4FBP A;  2RKM A;  1SW2 A;  3MPL A;  3MVZ A;  2DWJ A;  4IO2 A;  5LDZ A;  4FIM A;  4TOZ A;  3O97 A;  3E79 A;  4FJP A;  3HCQ A;  1EZP A;  2XWO A;  1LB8 A;  4EQ7 A;  3EHU A;  3IOU A;  4FOR A;  3OO7 A;  4G8N A;  2V93 A;  1TFA A;  5IM2 A;  5I7I A;  4F1V A;  3PPN A;  2CZL A;  2UXA A;  3IR1 A;  4OVJ A;  5KCJ A;  3LSL A;  4K3F A;  2W7Y A;  3N5L A;  3F11 A;  1FBH A;  1IZ1 A;  3QIM A;  4AB6 A;  5EQ9 A;  2X26 A;  3V83 A;  2FYI A;  2OLB A;  3TTL A;  1JP4 A;  2Q2A A;  2PT2 A;  1K9Z A;  3K1M A;  1USY E;  3PUW E;  2Z22 A;  4Q5T A;  5J16 A;  1FPG A;  1DMB A;  1FTM A;  4YMB A;  2OZZ A;  3VVE A;  1EYK A;  2DXR A;  1LB9 A;  3C32 A;  4OFO A;  3K0V A;  5LTC A;  1NV5 A;  3DLN A;  3LBS A;  3NOH A;  1FTA A;  1Y4C A;  2KR0 A;  2WKY A;  1EZ9 A;  4H6D A;  3KBR A;  4RPN A;  4PAI A;  1NUY A;  1QUI A;  4GXS B;  3IX1 A;  2H99 A;  3TTN A;  2X7P A;  5JEI A;  1M5F A;  3DM0 A;  4JWO A;  2P3N A;  3T96 B;  4I8C A;  2AYS A;  2O7U A;  2Z8D A;  1H76 A;  4JWX A;  1MM6 A;  4P1E A;  1FPL A;  2XXU A;  4I3E A;  4QFP A;  1LBB A;  1MQG A;  2H4I A;  1D9Y A;  3PMW A;  4XF5 A;  1ZTY A;  4OVP A;  4MNI A;  3G7W A;  3I3V A;  3FV2 A;  3D4C A;  4DI4 B;  3QUJ A;  4RNS A;  3SER A;  1KZ8 A;  2IEE A;  3M3L A;  3FGS A;  5I3S A;  4NF6 B;  3PV0 E;  4PFB A;  2XXQ A;  1QUJ A;  1T0K A;  4UAC A;  3TEP A;  3IJX B;  3FJ7 A;  3LC8 A;  1VE4 A;  4N4U A;  1PC3 A;  1OLC A;  5H8H A;  1N0T A;  3MVY A;  4THI A;  4RY1 A;  4NF5 B;  3IO6 A;  3KGC A;  4PBH A;  3TKD A;  3IOW A;  3S9L C;  5CMC A;  1US5 A;  5DW8 A;  4QFN A;  3EHS A;  1XC1 A;  1YYZ A;  2ZNS A;  1UIU A;  3BIG A;  4OTE A;  4N91 A;  3MP6 A;  4R72 A;  4QRZ A;  1N84 A;  1SW4 A;  4NF0 A;  1B1X A;  4G2Z A;  3DP6 A;  5FHN A;  1N3X A;  2ZNT A;  2FA7 A;  2Y7I A;  2P3V A;  1B3H A;  2XXX A;  3QYT A;  5JTY A;  4PQJ A;  5I2K B;  4IB2 A;  3TTK A;  2MKZ A;  3IFC A;  5IZ1 A;  3MC2 A;  4X9T A;  3IOT A;  4GWS A;  4G61 A;  3C34 A;  3V8X B;  2I0C A;  1EYJ A;  5HBC A;  1M5E A;  4OQO A;  4F18 A;  2V3U A;  4MX6 A;  3TTR A;  2QMX A;  2F5X A;  3PUZ E;  1P1W A;  4H8J A;  1AOV A;  3HV1 A;  3UN6 A;  4KHZ E;  1H44 A;  4N6P A;  1D9V A;  1BK4 A;  3KJ7 A;  2GQ1 A;  5ICQ A;  3K02 A;  4JBZ A;  1F9B A;  3TEL A;  4DLD A;  1P1O A;  3CG3 A;  4G8H A;  1XVX A;  4NMY A;  3LSW A;  4BDL A;  2DDK A;  1IMC A;  1JW5 A;  1B1H A;  5I5P A;  1NUW A;  2DWA A;  4NHB A;  3M8U A;  4AQ4 A;  4OFJ A;  2NOO A;  3K00 A;  4GBW A;  1IXH A;  1B4H A;  4LZ5 A;  1DSN A;  1UTH A;  3S4U A;  5JK4 A;  1O7T A;  1B7H A;  1FPK A;  3AXF A;  3VXC A;  1LAH E;  4GWW A;  1A8F A;  2Q74 A;  3BFT A;  4I62 A;  4EF2 A;  4O94 A;  3SEY A;  1RDY A;  1DK4 A;  5ET7 A;  2HZK A;  4F3S A;  4N8G A;  4H8I A;  3PMX A;  5TPA B;  3UIF A;  3HST A;  5FBP A;  1BIY A;  1MH4 A;  3B7D A;  3PU5 A;  3TOD A;  3CFZ A;  1MH3 A;  3DP8 A;  4P56 A;  1B9J A;  4WKM A;  3THI A;  3K1N A;  4U1Z A;  5FHO A;  4GL0 A;  3SDF A;  3FVK A;  1KA0 A;  4ND9 A;  1SI1 A;  1NI9 A;  5ICT A;  2KQZ A;  4I1D A;  5I59 B;  3RN8 A;  4ECF A;  2Q89 A;  4MLQ A;  2GHA A;  4R6H A;  5TU0 A;  4OER A;  4NAP A;  2XWV A;  4OZ9 A;  1D9Q A;  3GXA A;  1H3D A;  4PET A;  1FPI A;  3E4R A;  3FVO A;  5IKB A;  3UA8 A;  3MVX A;  4PP0 A;  3TZA A;  4TLM B;  4G68 B;  4H5F A;  3Q25 A;  4R2B A;  1Y9U A;  1TXF A;  3L6H A;  2XHD A;  2DE3 A;  1L5T A;  3RY3 A;  2ZZV A;  1FBF A;  2Q9T A;  2XXV A;  3EN3 A;  3FVN A;  2QS1 A;  3TFL A;  2PYY A;  4O3C A;  1HSL A;  1I6A A;  1MM7 A;  4POX A;  4R9F A;  5I57 B;  4KPT A;  2OWZ A;  4EXL A;  3MP8 A;  3B6W A;  2OWS A;  3RT8 A;  1NUX A;  5FTH A;  3MP1 A;  3U94 A;  2B3F A;  4OA4 A;  5CMK A;  1LCF A;  1MQI A;  2ZZX A;  5ESY A;  4EXK A;  1B0L A;  1MY0 A;  3DP4 A;  4P1L A;  4PF8 A;  3N94 A;  1B5J A;  1VSO A;  4JSD A;  3C4M A;  4NN3 A;  3ROJ A;  3JV9 A;  3BIH A;  4GOT A;  1NV0 A;  4ZZE A;  2F6P A;  1TT1 A;  4MNP A;  4NF6 A;  2WEF A;  4EUO A;  3TDJ A;  4MF3 A;  1B7U A;  1O63 A;  5H8H B;  5EHS A;  4QSD A;  2YPN A;  1JW1 A;  3CFL A;  4ZEK A;  1MQJ A;  3MPK A;  1OQH A;  3Q26 A;  3PUY E;  1DPP A;  2V25 A;  1ZIU A;  5CBR A;  4NF5 A;  1FCK A;  1ZLQ A;  5DEX B;  5J1D A;  1B6H A;  3SES A;  3Q28 A;  3RNN A;  3PPP A;  3FV1 A;  3IAZ A;  2OK2 A;  2V84 A;  5EQ8 A;  3K6V A;  1PDA A;  5AA2 A;  2RCB A;  3CSG A;  3Q29 A;  1NV4 A;  2AL5 A;  4POW A;  5A5X A;  3GLB A;  3G3K A;  4M4G A;  2B65 A;  4GRK A;  3OO9 A;  2FIE A;  3PUV E;  1LGB C;  3H6T A;  4N15 A;  3FXU A;  4RK2 A;  4PTK A;  2OPD A;  2V3Q A;  2OBG A;  1JQF A;  2F36 A;  2ONS A;  4Q30 B;  5I2K A;  1G0I A;  3MZB A;  2OJT A;  1SYI A;  3FVG A;  2LAO A;  4O3B A;  1YZ0 A;  1EU8 A;  1IQ7 A;  1B46 A;  3PUX E;  3RLF E;  2ZYM A;  4YIC A;  1NV6 A;  1SD3 A;  1POT A;  2QVV A;  2PMS A;  2VPO A;  5AA1 A;  3TTM A;  3EQ1 A;  2CZK A;  1NNK A;  1FTO A;  4OEV A;  4JVC A;  3W9W A;  3U8Q A;  4PCD A;  2QL3 A;  2F35 A;  5F7V A;  4OMB A;  3KG2 A;  2O84 X;  4P8B A;  3RGY A;  1FQA A;  3O29 A;  4MAG A;  1PBQ A;  2QVU A;  4GVO A;  3LSX A;  2XXR A;  2QVR A;  2E1S A;  2ANJ A;  3OEK A;  1K9Y A;  1ZBM A;  3RPL B;  1I6B A;  4O8M A;  1UTH B;  4FAT A;  1Y3Q A;  5TP9 A;  1MXW A;  4GL8 A;  3T22 A;  1B58 A;  1ZKB A;  3I6V A;  4KCC A;  4HXV A;  3H3G A;  4O3A A;  1B2H A;  3A09 A;  1OLA A;  3PD8 A;  4U4S A;  1IUD A;  4C1T A;  1SW5 A;  4ZEC A;  3A3C A;  3GZG A;  3FXR A;  3FJM A;  4LN5 A;  3RQT A;  1FBD A;  3SET A;  1YCJ A;  1FPE A;  2RC8 A;  4MMP A;  4F29 A;  5M2V A;  5TPA A;  2RF1 A;  4FEB A;  4MCO A;  4GWZ A;  1GR2 A;  4NWC A;  1FBC A;  4BDM A;  1LBV A;  2QPQ A;  1XS5 A;  4JWY A;  4QF9 A;  4ZE8 A;  4F22 A;  2FBP A;  1H43 A;  4RA1 A;  1Q35 A;  2F7A A;  2XXY A;  2DVZ A;  3HPI A;  5L9M A;  3MWB A;  3G3F A;  2O1M A;  4QSC A;  1BKA A;  2R6G E;  3GYY A;  1GV8 A;  1Q1K A;  5I59 A;  3ZKK A;  4YMA A;  3OO8 A;  4U2R A;  4QSE A;  2VD2 A;  3KN7 A;  4XKP A;  4YZZ A;  5K2Y A;  2RCA A;  4ESW A;  3C9H A;  1Z7M E;  3OOA A;  3TMG A;  2Y84 A;  1R6Z A;  2UVG A;  1A54 A;  1JVY A;  3MZ1 A;  4G68 A;  2DXY A;  5CMM A;  2HFB A;  3M3F A;  3IFA A;  3IJO B;  4OVT A;  1OQG A;  2WYP A;  1UTB B;  3GBA A;  3USD A;  4ONY A;  2NXO A;  3MST A;  4DXU A;  1BTJ A;  4UAB A;  2D3I A;  4X8R A;  1B51 A;  2QS4 A;  5T3J A;  5I57 A;  2A5T B;  1S9T A;  1YTV A;  1INP A;  3SEX A;  5CRY A;  2ZZW A;  2VP1 A;  1FTJ A;  5DVF A;  1XOC A;  2FHY A;  3B8B A;  1ANF A;  1M5C A;  3K6W A;  4WEP A;  5ET8 A;  4F3B A;  4XKN A;  1JNF A;  5AA4 B;  1IMA A;  3VDF A;  1B7Z A;  4GWO A;  1FQE A;  1A8E A;  5CC2 A;  4HCW A;  2ZXT A;  3VLU A;  4QFL A;  2PBW A;  4JVI A;  4F2Q A;  4O7M A;  3ZS6 A;  5ET5 A;  5DTB A;  4BDN A;  2P0S A;  1B4Z A;  2VPN A;  1M5B A;  4KYS A;  5A5L A;  1NNF A;  2VGQ A;  5DEX A;  4M1V A;  1LFH A;  1FQF A;  2HZL A;  5AA2 B;  4RXL A;  3T9H B;  1S50 A;  4PFY A;  4H1X A;  2CEX A;  3U92 A;  2ESN A;  5A5X B;  3E78 A;  3GBB A;  1AWB A;  3FD3 A;  2OWT A;  3CHG A;  1YXI A;  4P47 A;  4F1Y A;  1S7Y A;  4ZED A;  4IO6 A;  1FQD A;  4PFW A;  1IIW A;  2XWK A;  4MHF A;  4LZ7 A;  2PT1 A;  3MAM A;  1URG A;  3IOR A;  4HE2 A;  1FJ9 A;  4R74 A;  1OIB A;  1H45 A;  1RKM A;  2XX7 A;  3KJT A;  3UGW A;  2R8T A;  3N6T A;  4LP2 B;  4N6K A;  2QFL A;  4LQ2 A;  1NFT A;  3KC0 A;  3MJN A;  5H8N B;  1FBP A;  2BJJ X;  2VT5 A;  4IR8 A;  1LFI A;  1LBW A;  3R7X A;  1SDX A;  4GWU A;  3KSX A;  1BP5 A;  2Q8M A;  3FIR A;  2DYX A;  3T66 A;  5CM6 A;  5F1Q A;  2Q8J A;  5AE4 A;  1MPB A;  1FBG A;  2Q2C A;  5IGA A;  4P9K A;  3EPE A;  1P99 A;  2AL4 A;  1SVX B;  2ALU A;  2REG A;  4XEQ A;  2E0S A;  4DDD A;  1AIV A;  4F19 A;  3T9X B;  4R75 A;  2Q88 A;  3U65 A;  3VVD A;  2YLN A;  4R6K A;  5DVI A;  2WYK A; 
#chains in the Genus database with same CATH homology
 2XWI A;  4OA4 A;  2ZZX A;  5ESY A;  4OVQ A;  3RPL A;  4P1L A;  4PF8 A;  1Q9D A;  5IZ3 B;  4H46 A;  2WX9 A;  4NN3 A;  1FBE A;  3ROJ A;  2PFY A;  3BIH A;  1EYI A;  1NV0 A;  4PE3 A;  4MNP A;  2WEF A;  2Y5K A;  1IMD A;  2HXR A;  4HE0 A;  4FBP A;  4QBA A;  5LDZ A;  4PDD A;  3E79 A;  4X04 A;  4PC9 A;  2PCR A;  3ISP A;  4JVD A;  2XWO A;  5J1D A;  5EQ8 A;  4N81 A;  5IM2 A;  3PTY A;  5I7I A;  4F1V A;  1NV4 A;  1IME A;  1FBH A;  5EQ9 A;  2FIE A;  4PAF A;  1IMF A;  4N17 A;  3QMF A;  4N15 A;  1JP4 A;  1K9Z A;  3RYD A;  4PTK A;  2CZI A;  2V3Q A;  5EQ7 A;  5J16 A;  1FPG A;  4PF6 A;  1LBZ A;  3LUZ A;  1EYK A;  1G0I A;  3B50 A;  5LTC A;  1NV5 A;  3NOH A;  1FTA A;  2KR0 A;  1SPI A;  3EKI A;  1YZ0 A;  4YIC A;  1NV6 A;  3A29 A;  2QVV A;  1FJ6 A;  2VPO A;  4MJO A;  4PAI A;  1NUY A;  4GX6 A;  3KC1 A;  2CZK A;  2DE2 A;  4JVC A;  3W9W A;  2P3N A;  1FPF A;  4NGU A;  4NX1 A;  4PCD A;  4P8B A;  4P1E A;  4XFE A;  1FPL A;  4I3E A;  2PFZ A;  4PGN A;  4MAG A;  4OVR A;  2QVU A;  4XF5 A;  2QVR A;  4KXP A;  4OVP A;  4MNI A;  1K9Y A;  2F3B A;  4DI4 B;  1NV1 A;  3RPL B;  4O8M A;  4AS5 A;  1KZ8 A;  5I3S A;  4PDH A;  4HXV A;  4PFB A;  4N6D A;  5IZZ A;  2OX3 A;  4LN5 A;  4N4U A;  1FBD A;  1G0H A;  1FPE A;  4MMP A;  4PBH A;  4MCO A;  4GWZ A;  1FBC A;  4N8Y A;  1NV3 A;  1LBV A;  5DW8 A;  2QPQ A;  1CNQ A;  1YYZ A;  2FBP A;  2Y5L A;  4O7I A;  3BIG A;  3SZP A;  4N91 A;  4HE1 A;  2DVZ A;  4NF0 A;  3GYY A;  1RDX A;  2P3V A;  1LBY A;  4YZZ A;  2B4L A;  2MKZ A;  4GWY A;  3IFC A;  3D1R A;  5IZ1 A;  4X9T A;  2DE4 A;  4F1U A;  4GWS A;  4G61 A;  1EYJ A;  4F18 A;  4MX6 A;  2F5X A;  2B4M A;  3IFA A;  4OVT A;  2WYP A;  1BK4 A;  2GQ1 A;  1FPJ A;  3MST A;  4OVS A;  4UAB A;  5F24 A;  1DCU A;  1NV7 A;  4X8R A;  5ET6 A;  5T3J A;  2CEY A;  1INP A;  2DDK A;  1IMC A;  2ZZW A;  4P3L A;  5I5P A;  1NUW A;  3LV0 A;  2FHY A;  3B8B A;  4NHB A;  2FIX A;  2FVZ A;  5ET8 A;  4GX4 A;  5IZ3 A;  1QGX A;  1FSA A;  1IMA A;  4GBW A;  2F3D A;  5JK4 A;  1XI6 A;  4HCW A;  1FPK A;  4GWW A;  4JVI A;  2Q74 A;  2CZH A;  4O94 A;  4O7M A;  1RDY A;  3FBP A;  1DK4 A;  5ET7 A;  2HZK A;  5ET5 A;  4N8G A;  4NG7 A;  1FPB A;  2VPN A;  4I3Y A;  4PGP A;  5A5L A;  4GX3 A;  4NQ8 A;  4GWX A;  5EQA A;  4M1V A;  3T1B A;  1LBX A;  2HZL A;  1NV2 A;  5FBP A;  2WBD A;  2BJI A;  2CEX A;  4AS4 A;  3E78 A;  1AWB A;  3CHG A;  4P56 A;  1YXI A;  4P47 A;  1VDW A;  2WBB A;  1DBZ A;  2V4C A;  4PFR A;  2XWK A;  1KA0 A;  1IMB A;  4MHF A;  1NI9 A;  4HE2 A;  3HFU A;  1FJ9 A;  2JJK A;  4MIJ A;  4MEV A;  2KQZ A;  2R8T A;  4N6K A;  2QFL A;  4NAP A;  4H45 A;  4GBV A;  2XWV A;  3FXB A;  5EYG A;  3KC0 A;  1D9Q A;  1FBP A;  2VT5 A;  1FRP A;  4IR8 A;  4PET A;  1FPI A;  1LBW A;  4GWU A;  2HPG A;  1KA1 A;  2Q8M A;  4QXD A;  5CM6 A;  4MNC A;  2HHM A;  4PFI A;  2XXK A;  1RDZ A;  1FPD A;  3W9V A;  3KBZ A;  1LEV A;  3T0J A;  4OAN A;  4PBQ A;  4I40 A;  2DE3 A;  1FBG A;  4HCY A;  5IGA A;  2ZZV A;  4P9K A;  2L5V A;  1FBF A;  2Q9T A;  4PAK A;  2XA5 A;  4DI3 D;  4XEQ A;  1NUZ A;  4F19 A;  3MYU A;  2OWZ A;  3U65 A;  5EYH A;  1NUX A;  2WYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...