4I40A

Crystal structure of staphylococcal inositol monophosphatase-1: 50mm licl inhibited complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 75
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i40A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i40A02
1FPGA 1FPBA 1FPFA 4HXVA 4AS5A 1RDYA 5DW8A 2Y5KA 1RDXA 1FBHA 3D1RA 4I3YA 4HE2A 1FBPA 1IMEA 4GX3A 1FRPA 1XI6A 1IMCA 1EYIA 1G0IA 2QVRA 4GWUA 5J16A 5ET6A 1LBZA 5F24A 2WEFA 2R8TA 2Q74A 3KBZA 2WBBA 1NV3A 1VDWA 2Y5LA 2CZKA 2BJIA 4PTKA 1D9QA 1FPIA 2P3VA 1EYKA 2FHYA 1LBWA 3IFCA 1FPEA 5EQ9A 5LDZA 1NV4A 1YZ0A 1CNQA 1LBYA 1NUYA 4GX4A 1YYZA 5EYHA 2FIEA 2FIXA 4IR8A 5ESYA 2VT5A 3T0JA 1BK4A 1SPIA 1FTAA 5EQ7A 3IFAA 5IZ3A 5EYGA 2QVVA 3FBPA 4G61A 1LEVA 4MJOA 5ET5A 2WBDA 4GX6A 1NV2A 5IZ1A 1FPJA 2JJKA 1DCUA 2OWZA 4H45A 1NUZA 3LUZA 2CZHA 1NV0A 3LV0A 1FBEA 1IMBA 1NUWA 1NI9A 1QGXA 2HHMA 1FPDA 4GWWA 1FBGA 1YXIA 1NUXA 5T3JA 2F3BA 1K9YA 1RDZA 1IMFA 3BIHA 1FSAA 1IMAA 2OX3A 3KC1A 5EQ8A 5I3SA 1AWBA 2DDKA 1G0HA 1NV1A 4FBPA 2QVUA 1NV6A 4HE0A 4I40A 1FBCA 1KA0A 5EQAA 1INPA 4KXPA 2Q8MA 4QXDA 5A5LA 1NV7A 3RPLB 4I3EA 4GWZA 5FBPA 5ET8A 1KZ8A 1FJ6A 4GWYA 2P3NA 1LBXA 3RYDA 1K9ZA 4GWXA 1Q9DA 4GWSA 1DBZA 1LBVA 1FBDA 1IMDA 1FPKA 3BIGA 3KC0A 4AS4A 1DK4A 4GBVA 3RPLA 3B8BA 2FVZA 5ET7A 1NV5A 1FPLA 3QMFA 2PCRA 4HE1A 2F3DA 5IZ3B 1JP4A 1EYJA 4H46A 1FBFA 3ROJA 4GBWA 1KA1A 2CZIA 2FBPA 2QFLA 2GQ1A 4N81A 3A29A 4O7IA 1FJ9A
chains in the Genus database with same CATH superfamily
1FPFA 4EQ7A 4F3SA 5AA1A 3VVFA 1RDXA 5LTCA 2KR0A 3JYRA 4G8NA 5FHNA 2OJTA 5CMCA 1D9VA 3CSGA 1NNFA 4EXKA 4R2FA 1NV3A 2BJIA 3QXMA 3R6UA 5K2YA 3H6UA 4KD5A 4QSCA 2I49A 4FIMA 4O3BA 3MSTA 2XWOA 3OOAA 4LUBA 4JVIA 4GVOA 1XVYA 5I2KB 4ZZEA 3DLNA 3VLVA 1MQIA 4RY1A 3MP1A 4ZE9A 5I56B 3H06B 4ZE8A 4G4PA 1FBGA 2XWVA 4N6DA 3UIFA 5I84A 3BIHA 1PB7A 4Q5TA 4R74A 2I3VA 4EUOA 2DWHA 3VLUA 2REGA 1MXXA 1Q1KA 5JTYA 3TUSA 1TWYA 1MH3A 4I9DA 5ITOA 4KCCA 4LQ2A 1QKBA 3IJOB 4YB7A 4L17A 4YAHX 1N7XA 4NF5A 3IOTA 5ISUA 1Y9UA 4IO7A 1A99A 1MQGA 2DQVA 4O7IA 4PGPA 1US5A 4AS5A 4XFEA 4BLAA 1JETA 4LN5A 3KOTA 3TYHA 4HE2A 4RXLA 4RYAA 3CFZA 3THIA 4G77A 2CMOA 3FUZA 1PBPA 3PGFA 2Q2AA 3W15C 4IY6A 2Y7KA 4ISUA 4PTKA 1MPBA 1EYKA 3SERA 1PB9A 2CEXA 5HM4B 1NL5A 3G3IA 3K02A 4N4UA 2DWJA 1JW1A 1P1NA 4H8JA 1MXWA 3MQ9A 4F22A 1IQ7A 1MH4A 1OIBA 1QUJA 4H65A 1DTGA 1DCUA 1MXYA 2ZYMA 3O2AA 2NUVA 1IMBA 4OA4A 2XX7A 2F7AA 3KOSA 1FQCA 4XIGQ 4ECFA 2ZYKA 3HFUA 2F3BA 1P1UA 5I2NB 1R9QA 4LZ8A 5I3SA 1FTLA 4NN3A 2B3FA 4FORA 2F6PA 4KQPA 4I40A 3N5LA 4KXPA 3C35A 1NV7A 5F1QA 5KZTA 3RYDA 1LAFE 2OWSA 3RT6B 3CG3A 1SQYA 2ONKE 3QUJA 4F19A 4NAPA 4X1DA 5CC2A 1MM6A 3G3JA 5A5XB 2F36A 1NV5A 4HE1A 4U4SA 4FJPA 1MPCA 1JVXA 3UN6A 3EQ1A 4KFQA 4U21A 3VV5A 3TAJA 4YKPA 2NXOA 1FPBA 1OVTA 5IM2A 4C1TA 1B6HA 5H8HA 4ZDMA 1FQEA 4P56A 3V89B 1JQFA 2PT2A 4Z7EA 4Q0CA 4AB6A 3IJXB 4NF8A 4IO5A 4GL8A 4N17A 2F35A 5H8NA 1PC3A 2VPOA 1B40A 1YYZA 1WVJA 3LBSA 1ZU0A 3N6UA 3VXBA 4JXIA 3PD9A 4YB5A 3FD3A 3FVKA 4XEQA 4XKQA 1LSTA 3KN7A 4MLVA 1M5EA 3Q26A 2OWZA 4QRZA 4O8MA 2R6GE 3H03A 2ONRA 4IO6A 4ZEDA 3CFXA 2V25A 1O63A 3TQLA 2VP1A 3SZPA 4N6KA 2DDKA 2VD3A 3B50A 2Q8MA 4POWA 2P3NA 1PBQA 3N26A 5A5XA 3OSRA 4FEBA 1LBVA 1FPKA 2XXXA 3FVNA 1D3KA 4H67A 3LSXA 2CZLA 1QUIA 3T9XB 4KHZE 2P0SA 1MXZA 2XXTA 4PBQA 5DT6A 4ELRA 4PFBA 2WKYA 3IAZA 3CIJA 4MNIA 4LZ5A 4NF4A 2OK2A 2YJPA 4I3YA 3HHFA 2DS9A 4NF8B 1IMEA 4MX6A 2XHDA 1Y3PA 3DELB 4ONYA 1EYIA 4OANA 1WDNA 5DTBA 4MCOA 3MVWA 2A5TA 1MY4A 1J1NA 4XTCQ 1LAHE 2R8TA 4ELOA 2Y5LA 2CZKA 3FASA 1LBWA 3U72A 1IUDA 3RPWA 2X26A 2Q8JA 5HPQA 1KWHA 2HCAA 3OEKA 1SPIA 1MQJA 4LQ5A 3FGSA 4PDHA 4NG7A 2QRYA 4ELPA 1OMPA 3R26A 4G61A 3ZKKA 1N3WA 1N76A 4MFIA 3FXQA 3SEXA 1NV0A 4QFNA 4DIGA 1XVXA 1B3LA 4OVQA 3OSQA 3K6UA 1IMFA 3MUQA 4X9TA 1AWBA 2Z8FA 1DPEA 4Q8RA 1H45A 2IEEA 5FTIA 4PAKA 2B3BA 5AA4A 2KQZA 4GWXA 1Q9DA 4R6HA 2HZKA 1M5CA 3EHTA 1OQHA 3BFUA 2I0BA 1JP4A 1HSLA 2ZYNA 3PMVA 5I59A 1R6ZA 1T0KA 2DVZA 3C36A 2DXYA 1FBHA 5EHSA 3U1OA 2DXRA 2XXVA 2QMWA 3D1RA 4UA8A 1SW5A 2OZZA 4NE4A 4IB2A 4N15A 4F1VA 3DP8A 3PMWA 1G0IA 2V84A 1B7UA 1SVXB 4EF2A 3Q29A 1US4A 4XKPA 3K6VA 1FPIA 2ZZXA 4YB6A 3IFCA 1SBPA 2OCUA 4OVPA 3CSBA 4IR8A 1FQBA 2VT5A 1TT1A 4KI0E 2XXYA 1BKAA 1JW4A 1YAEA 4MNCA 5DVIA 3KJTA 3ZKLA 3D4GA 2QS1A 4GWOA 1FPJA 3IO4A 3KJ7A 4WEDA 3E78A 1NUWA 3EHUA 4QSEA 2I48A 1PB8A 4F3BA 5I2NA 2Z23A 3PV0E 4N8YA 1FBCA 1ZBMA 5ICQA 3LR1A 4DZ1A 4NF6B 3RQTA 3PUZE 1UTHA 4AS4A 4TQUQ 1DOTA 3TTNA 2RC8A 4M1VA 4OHNA 4Z0IA 4H46A 2WYKA 1VFDA 4KR5A 2FNCA 1AMFA 1ANFA 2H5YA 1XOCA 5KDTB 3A3CA 2Y5KA 4PP0A 2Q88A 4PFTA 1XHYA 2RC9A 5CI5A 2G93A 4MMPA 1IMCA 3MYUA 3GXAA 4NGUA 4GWUA 5L9OA 5ET6A 4OQOA 1P1WA 1ZKBA 2WEFA 1MDQA 1QJMA 1YTVA 1Y20A 3FXBA 1B46A 4KPTA 3H6WA 2P3VA 3KN3A 3E9XA 4TLLB 3SKPA 5EYHA 3FATA 4QFKA 1MQDA 4N13A 4MEVA 1B7HA 1MY0A 3IL1B 4PF8A 3ZS6A 1A7LA 3K1PA 2PFYA 1R9LA 2RC7A 4IO2A 4ELQA 4JWXA 3C34A 3MJNA 5CMKA 1OVBA 1FBEA 1Z7ME 1LFIA 1RDZA 4TOZA 2Z22A 1Y3NA 3TMGA 1SI1A 2Z8EA 4GXAA 5EQAA 4QXDA 2DE2A 3IB1A 4RJZA 3CI8A 3JZJA 3RY3A 1DPPA 3RT8A 1B5HA 2XX8A 3B8BA 1L5TA 3PPRA 2HPGA 4XKRA 1B0LA 1N0TA 4DCXA 3TFLA 3VVDA 1NNTA 2O84X 3K6XA 3S9MC 3ECRA 4HW8A 2PYYA 4DE8A 2Y7WA 3I3VA 3RTFB 4I1DA 3TELA 2VD2A 3O97A 1FRPA 4PBHA 1UIUA 5J16A 1M5BA 4YMAA 4YU0A 5TPAA 2Q74A 4RPNA 1RYXA 5F7VA 2V3UA 3MBPA 4NF5B 1B3HA 1B0HA 2LAOA 1NV4A 2H9BA 1NUYA 4GX4A 4F1UA 3EHSA 2XX9A 1S9TA 4YZZA 1QKAA 5EYGA 4E0WA 2RINA 2DWAA 2H25A 4R73A 4OZ9A 5TPAB 3V8XB 2QSXA 3RN8A 4OXVA 2JJKA 3EF7A 5BWJA 1B7ZA 1NUZA 2WYPA 2PFZA 2V93A 3PPNA 3HSTA 3E3KA 3IB2A 5I56A 1FPDA 2REJA 4NWDA 3UK4A 5FHMA 1JEUA 1LCTA 4FEDA 5CBSA 5DEXA 1BP5A 3OEMA 3PUWE 3O6GA 2HQ0A 5FBPA 1LBXA 1BTJA 1A55A 5I5PA 3BIGA 1UIVA 3G3HA 2XD3A 3KC0A 2R71A 4U22A 2DE4A 4N07A 2ZZVA 3QMFA 1KA1A 4PQJA 4GLIA 5DVJA 2PT1A 2ESNA 1IITA 3SEYA 4MHFA 3KBRA 4G68A 1FTJA 4C0RA 3PTYA 1I6BA 2QS2A 3MZBA 1Y1ZA 3RTWB 4XKNA 4H0WA 4R9FA 3O29A 1JEVA 1VDWA 2OPDA 3TKDA 1DSNA 4OVTA 1ATGA 5H8FB 4JBZA 4F2QA 3OXNA 2XXUA 3N6TA 3TQWA 4QFPA 1MPDA 2ALUA 2UVIA 3SDFA 3S9EA 3FBPA 1AH5A 1LEVA 1F9BA 4GD5A 4JVCA 4OFOA 1O64A 3IK6B 3MWBA 4OYVA 4H45A 2XXPA 4BDNA 1TXFA 5B70A 1B2HA 3LUYA 2OPEA 4OVSA 1LGBC 4LATA 2XD2A 4ZEFA 3KG2A 1AIVA 3CFLA 4HE0A 2I0CA 4PF6A 2ANJA 4LONB 1MY1A 5KCJB 3SEWA 2M8CA 3RPLB 4I3EA 1II5A 1URGA 2DYXA 4X8RA 2ZXTA 5ET8A 1B9JA 2AYSA 3UORA 3FV2A 4GF8A 4NF4B 1SI0A 3TCFA 5H8HB 4IGRA 1VSOA 4OEVA 2F7BA 3BBRA 2UYFA 1NH8A 1UTBB 4H5FA 2XXQA 2QFLA 2H98A 1HSJA 5EHMA 1N84A 3S9NC 5LOMA 4LA9A 3OO9A 4HXVA 1SW1A 3DM0A 1RDYA 5H8QA 3QYTA 1Y3QA 3C4MA 4U23A 1M5DA 4GX3A 2D21A 1XC1A 4RPOA 3PMXA 5K2XA 4QFLA 3G3FA 3FXRA 2I4BA 4MBPA 1I69A 3O9PA 3CHGA 3K1MA 4P8BA 3GLBA 5I57B 3IORA 1SYIA 1LFGA 3OO8A 2DOJA 3I6VA 3A09A 2FIXA 5ESYA 2MKZA 1POTA 4F2OA 1A8FA 3O6HA 3S4UA 1IXHA 1I6AA 3TDJA 3KGCA 4XF5A 4N91A 4JB7A 2ONSA 1P1OA 4NX1A 1B5JA 1R1NA 4MAGA 5H8SA 3WAEA 4H6DA 4OENA 2F34A 2ABHA 3H6TA 1NI9A 2HHMA 4GWWA 5JTYB 4O94A 2QPQA 4ESXA 5T3JA 2A5SA 3SESA 1HSEA 1IIWA 3EN3A 3AXFA 4PGNA 2H4IA 3TEPA 1INPA 3OENA 3FJ7A 2Y84A 4R75A 4YMBA 3DP6A 5B7DA 1Y1MA 2NOOA 4GWSA 1LFHA 2OLBA 2DE3A 1DK4A 2B65A 1P1QA 1QULA 1SDXA 3M8UA 3R7XA 2A5TB 4AB5A 1FTMA 2I58A 2QJEA 1B3GA 4YKKA 1FPGA 4NF0A 4P1LA 1MDP1 1Z7NE 1IZ1A 1POY1 3K1NA 2VPNA 3KZGA 3O66A 2B4LA 3W9VA 3VDFA 4G2ZA 2H99A 3HPIA 2HZLA 3FJGA 3C31A 5IGAA 4OMBA 1OQGA 3OD7A 4JWOA 3TCHA 1D4NA 1TFDA 5EQ9A 1LAGE 4JDFA 2ZNSA 3T0JA 1BK4A 3Q27A 3HV1A 3Q25A 1B4ZA 4OETA 4ZEBA 1LAXA 1H3DA 1XT8A 5BUUA 4AQ4A 4BDOA 4GX6A 1QW0A 3LUZA 4MLQA 4OESA 2F5XA 1DTZA 1QGXA 2V3QA 4QFOA 3K4UA 4F39A 3QAXA 4F3GA 3KC1A 2XXKA 4FBPA 3KN8A 4XXUA 2F78A 4ZZAA 3T1BA 4G8MA 2HFBA 5CMMA 3U94A 1VE4A 3MVXA 4LVQA 3GYYA 4NQ8A 4LP2B 2DP8A 4YKJA 2WX9A 5H8NB 1DBZA 4P0IA 1OLCA 3RNNA 4KYSA 3A3UA 5L9SA 3V83A 2PCRA 2DSFA 4K3FA 4P3LA 1FBFA 2Q89A 4P11A 2VOZA 4U1OA 1FTOA 1MY2A 2GHAA 3USDA 2F7CA 3TZAA 2V4CA 4G68C 4NTLA 2GFEA 3VXCA 4M4GA 2QS3A 1Q35A 4POXA 3ONMA 1UQWA 1H76A 4IO3A 3VFJA 4FATA 2VGQA 1A54A 2RF1A 4ZECA 4GL0A 3VE1B 2O68A 4OERA 2I3WA 3PU5A 3ILUB 2PBWA 3IFAA 4N6PA 3D4CA 3RLFE 4MJOA 3IO6A 1ZIUA 3CR9A 3ILTB 2G29A 1NV2A 3K6WA 2DVCA 3KEIA 2HXRA 3MZ9A 4GOTA 1TFAA 1YXIA 4R72A 5I57A 4WKMA 3CVGA 2OX3A 1IMAA 4PAFA 1CB6A 2QVUA 3PD8A 3IR1A 3S9LC 3QUFA 4BDLA 2AIXA 4DDDA 4UACA 2YPNA 2FYIA 2KLFA 3H3GA 5CMBA 1ZLQA 1JNFA 1EZPA 4G68B 5ET7A 3MC2A 5JK4A 1EYJA 1UTBA 2F97A 2NVUB 4RNSA 4GXSB 2FBPA 4PE3A 4HCWA 4N81A 4R6YA 4YKIA 3GBAA 3O28A 2O1MA 2XXIA 5CBRA 1LB8A 3KSJA 3VLWA 4OVJA 2OBGA 3V5AA 3T9HB 3H4ZA 2QVRA 4WEPA 3T9UA 1RYOA 2XA5A 2UVGA 1XS5A 1QUKA 2R9JA 3BFTA 5F24A 2Z8DA 4ZEIA 1GR2A 1FPEA 2OWTA 3OMBA 1CNQA 1LBYA 3RGYA 5I2KA 1SD3A 5EQ7A 1P99A 3IOUA 2QVVA 3O6IA 4BDQA 1ELJA 2UVJA 4ZEKA 3T66A 3TTRA 1FQDA 4JVDA 4EXLA 2Y7PA 4H8IA 1VFEA 1YPNA 4PFWA 5JEIA 4OVRA 4IY5A 4DCYA 1NUXA 4JSOA 4OWDA 4QBAA 5TU0A 2O7IA 4PC9A 3KSXA 3ISPA 5EQ8A 1S50A 1LLSA 5H8QB 2ZNUA 3PPOA 1SW2A 1GVCA 4O3CA 3B6TA 3M3LA 3PUYE 1MRPA 4R9GA 3G3KA 4P0GA 3FJMA 5FTHA 4ESWA 4DI4B 3FZVA 1IXIA 3K01A 1JW5A 3G7WA 3QSLA 5AA2A 1FPLA 3TPAA 3UA8A 3MVYA 4E0XA 1BIYA 2O69A 1AOVA 3FVOA 4DXCA 5ELVA 4BDRA 1FTKA 1YCJA 3T9VA 2ZMBA 1FJ9A 3RPLA 1N04A 2FA7A 3OO6A 1FW0A 3W9WA 4PCDA 5I7IA 4NHBA 2ZNTA 5L9MA 1FBPA 3T22A 1XI6A 2HXWA 4F18A 1MXUA 2Y7RA 2D5WA 3WAFA 1MY3A 4QF9A 2DWIA 3P7IA 4G8HA 3UGWA 4ZS9A 2QMXA 1GGGA 1NFTA 2UVHA 1NKXA 5KCJA 1B58A 1NNPA 3HO7A 2O51A 4X04A 5ET5A 5H8FA 1UTHB 1NMUA 4FAJA 3E79A 1Y4CA 1B5IA 2AL5A 3LV0A 1SYHA 3M3FA 4PDDA 5ITPA 3PPQA 3QK6A 4GFRA 4EF1A 2P2AA 3MZ1A 2E1SA 3K00A 2O6AA 3T96B 3CRBA 4KCDA 4IO4A 1JVYA 1B32A 4GWYA 5AE4A 2GRVA 5IZZA 4GBVA 3JV9A 4PFIA 1EH3A 3T93B 3S2VA 4F1YA 3TTMA 1MXVA 5CM6A 3A29A 2ZYOA 4R2BA 3IOVA 4HTGA 1PDAA 5FHOA 3QIMA 2ZZWA 3EPEA 3MVZA 5DW8A 3K2DA 4N8GA 3IB0A 1N7WA 2I4CA 4MH5A 3GZGA 4O3AA 2XWIA 4F29A 1USYH 4RK2A 4TLMB 4NF6A 1RKMA 1M5FA 3FXUA 1LBZA 2Q2CA 4X48A 3K0VA 1B1XA 3UP9A 2WBBA 4GIZA 3IX1A 2V3TA 2FHYA 5HBCA 3LC8A 5LDZA 1YZ0A 3RUMA 4H5GA 3PPPA 5DVFA 4RA1A 2E0SA 3SEVA 2I6EA 2IA4A 3H6VA 2XXRA 2WBDA 2RKMA 5I58B 4PFRA 1GV8A 5DYHA 5IZ1A 4WXJA 3HN0A 5KDTA 5AA4B 4F31B 4NMYA 4PFUA 1ZTYA 5J1DA 2Y7IA 2X7PA 3BKIB 4P47A 2PMSA 1K9YA 1B05A 1LCFA 4RK9A 1FSAA 4OEUA 1AL3A 1B3FA 1B51A 2BJJX 5AA2D 1G0HA 2XXHA 3HCQA 3MPKA 1KZ8A 2RCAA 3TTKA 1NH7A 1IMDA 4F3PA 2O1LA 3L6GA 2THIA 2GHBA 1B4HA 4DI3D 3Q28A 2QS4A 2YLNA 3C9HA 3FIRA 5IZ3B 3TCGA 1DMBA 1H44A 1FQFA 4I62A 1EU8A 4U2RA 5DEXB 3GBBA 2P1SA 1USYE 2RCBA 1MQHA 5M2VA 4H1XA 1VR5A 3U8QA 4HCYA 1EZ9A 4PFYA 2D3IA 1LBBA 4OFJA 2HEUA 1PEBA 3E13X 1ZJLA 4FECA 2W7YA 1D9QA 4PE5B 2X7QA 1FCKA 4FE8A 2HAVA 2FIEA 3CG1A 3PUXE 3U92A 4Q30B 3H7MA 1FTAA 5CRYA 3SEUA 2HAUA 3LSFB 1FQAA 2UXAA 4PAIA 4EDPA 3NOHA 3ZSFA 2PVUA 3TODA 2CZHA 1SW4A 5IKBA 3FVGA 1OLAA 4MIJA 4X1BA 3MW0A 1I6QA 2UYEA 4OFLA 4UABA 1ZMGA 3C32A 5AA2B 1LBCA 3LSLA 4PETA 4BDMA 3LSWA 5TP9B 1CE2A 3I5OA 1KA0A 3ODBA 4GQOA 1D9YA 4U1ZA 3KFMA 5A5LA 4O7MA 1A40A 1S7YA 1FJ6A 1B52A 3E4RA 3OO7A 4QHQA 4MNPA 4C1UA 3F11A 1N3XA 4IGTA 2L5VA 1LB9A 2F3DA 3SETA 3C33A 4GBWA 2CZIA 1IXCA 3EKIA 1B3EA 2Q9TA 2XXWA 3IOWA 3G3GA 4NEDA 4YICA 1MG1A 2QL3A 5L8DA 3N94A 4QSDA 3B7DA 1URDA 4LZ7A 3U65A 1H43A 2AL4A 1O7TA 3U93A 3MP6A 3VVEA 4GRKA 4KYDA 4KYEA 4MF3A 1GTKA 5I58A 3KBZA 3B6WA 4JWYA 3MP8A 2F8DA 4NWCA 5EYFA 1B1HA 1Y4TA 3FV1A 2NWJA 3MPLA 1QVSA 3MAMA 2B4MA 4R6KA 1NNKA 1MS7A 5IZ3A 1A8EA 3L6HA 1EZOA 4DXBA 4P1EA 1URSA 3DP4A 2VHAA 4DXUA 2O7UA 1BLFA 5TP9A 4U4XA 5IAIA 2GH9A 4DLDA 5AA3A 1NV1A 1NV6A 4OTEA 4GWZA 5I59B 2CEYA 1K9ZA 2F6GA 1FBDA 4P9KA 4ND9A 1MM7A 1WODA 3M3KA 2FVZA 3TTLA 4THIA 1IEJA 2XWKA 4JSDA 3ROJA 5ICTA 3OELA 2PX1A 2GQ1A 1IXGA 4EQBA 3PUVE 3B6QA 3HHGA 4I8CA 4HS7A 4EQ9A
chains in the Genus database with same CATH topology
4PGPA 1FPGA 4MHFA 4NF0A 2ZZWA 1FPBA 1FPFA 4HXVA 4AS5A 2DVZA 4P1LA 4YICA 4MNIA 1RDYA 5DW8A 4PCDA 4XFEA 2Y5KA 3PTYA 1RDXA 1FBHA 2V4CA 2KR0A 4LN5A 4N8GA 5I7IA 5LTCA 3D1RA 4I3YA 4HE2A 3U65A 4NHBA 1FBPA 1IMEA 4GX3A 2VPNA 2XWIA 4HCYA 4N15A 4MX6A 2B4LA 4F1VA 3W9VA 1FRPA 1XI6A 1IMCA 1EYIA 1G0IA 2QVRA 4MMPA 4OANA 4PBHA 3MYUA 2XA5A 4P56A 4F18A 4NGUA 4GWUA 4MCOA 5J16A 5ET6A 1LBZA 5F24A 2WEFA 2R8TA 2Q74A 3KBZA 2HZLA 2WBBA 5IM2A 1NV3A 1VDWA 2Y5LA 3FXBA 3CHGA 2CZKA 5IGAA 2BJIA 4P8BA 4PTKA 1D9QA 1FPIA 2P3VA 1EYKA 2ZZXA 5J1DA 2FHYA 1LBWA 2CEXA 4N17A 3IFCA 1FPEA 5EQ9A 5LDZA 1NV4A 4OVTA 1YZ0A 1CNQA 1LBYA 2VPOA 1NUYA 4GX4A 1YYZA 5EYHA 4N4UA 4F1UA 2FIEA 4OVPA 2FIXA 4IR8A 5ESYA 4X9TA 2VT5A 2MKZA 3MSTA 3T0JA 2XWOA 4YZZA 1BK4A 2B4MA 4MEVA 1SPIA 1FTAA 4MNCA 4JVIA 5EQ7A 3IFAA 5IZ3A 4NG7A 5EYGA 4PF8A 4PDHA 4XEQA 2QVVA 3FBPA 4XF5A 4G61A 4N91A 1LEVA 4MJOA 4X04A 5ET5A 2WBDA 4PAIA 4GX6A 4JVCA 4NX1A 4PFRA 1NV2A 3E79A 5IZ1A 1FPJA 2PFYA 4MAGA 2JJKA 3NOHA 1DCUA 2OWZA 4H45A 1NUZA 2WYPA 4JVDA 3LUZA 2CZHA 4O8MA 4P1EA 1NV0A 2HXRA 2F5XA 2PFZA 3E78A 3LV0A 4MIJA 1FBEA 1IMBA 4OA4A 4PDDA 1NUWA 1NI9A 1QGXA 2HHMA 1FPDA 4GWWA 1FBGA 1YXIA 2XWVA 1NUXA 2V3QA 4N6DA 2QPQA 4O94A 4OVQA 4P47A 4OVSA 4QBAA 4UABA 5T3JA 3HFUA 2F3BA 1K9YA 1RDZA 4PC9A 1IMFA 3BIHA 3ISPA 1FSAA 1IMAA 2OX3A 3KC1A 5EQ8A 5I3SA 4NN3A 4N6KA 1AWBA 2DDKA 1G0HA 2XXKA 4PETA 4PAFA 3SZPA 1NV1A 4FBPA 2QVUA 1NV6A 4HE0A 4I40A 3T1BA 4PGNA 3B50A 4N8YA 4PF6A 1FBCA 1KA0A 5EQAA 1INPA 4KXPA 2Q8MA 4OVRA 4QXDA 5A5LA 1NV7A 3RPLB 2DE2A 4I3EA 3GYYA 4GWZA 4O7MA 5FBPA 4NQ8A 4PAKA 5ET8A 1KZ8A 1FJ6A 4GWYA 2P3NA 1LBXA 4X8RA 3RYDA 2CEYA 1K9ZA 2KQZA 4GWXA 1Q9DA 2WX9A 4GWSA 1DBZA 5I5PA 1LBVA 1FBDA 1IMDA 2HZKA 4P9KA 1FPKA 3BIGA 4F19A 4MNPA 3KC0A 4NAPA 4AS4A 2DE3A 4DI4B 5IZZA 1DK4A 4GBVA 2DE4A 3RPLA 4DI3D 4PFIA 3B8BA 2L5VA 2FVZA 2ZZVA 5ET7A 1NV5A 1FPLA 3QMFA 2PCRA 4HE1A 2F3DA 2HPGA 5IZ3B 1JP4A 2XWKA 4M1VA 1EYJA 5JK4A 4P3LA 4H46A 1FBFA 2WYKA 3ROJA 4GBWA 4PBQA 1KA1A 2CZIA 2FBPA 3EKIA 2QFLA 4PE3A 3W9WA 4HCWA 5CM6A 2Q9TA 2GQ1A 4N81A 3A29A 4PFBA 4O7IA 1FJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPG A;  1FPB A;  1FPF A;  4HXV A;  4AS5 A;  1RDY A;  5DW8 A;  2Y5K A;  1RDX A;  1FBH A;  3D1R A;  4I3Y A;  4HE2 A;  1FBP A;  1IME A;  4GX3 A;  1FRP A;  1XI6 A;  1IMC A;  1EYI A;  1G0I A;  2QVR A;  4GWU A;  5J16 A;  5ET6 A;  1LBZ A;  5F24 A;  2WEF A;  2R8T A;  2Q74 A;  3KBZ A;  2WBB A;  1NV3 A;  1VDW A;  2Y5L A;  2CZK A;  2BJI A;  4PTK A;  1D9Q A;  1FPI A;  2P3V A;  1EYK A;  2FHY A;  1LBW A;  3IFC A;  1FPE A;  5EQ9 A;  5LDZ A;  1NV4 A;  1YZ0 A;  1CNQ A;  1LBY A;  1NUY A;  4GX4 A;  1YYZ A;  5EYH A;  2FIE A;  2FIX A;  4IR8 A;  5ESY A;  2VT5 A;  3T0J A;  1BK4 A;  1SPI A;  1FTA A;  5EQ7 A;  3IFA A;  5IZ3 A;  5EYG A;  2QVV A;  3FBP A;  4G61 A;  1LEV A;  4MJO A;  5ET5 A;  2WBD A;  4GX6 A;  1NV2 A;  5IZ1 A;  1FPJ A;  2JJK A;  1DCU A;  2OWZ A;  4H45 A;  1NUZ A;  3LUZ A;  2CZH A;  1NV0 A;  3LV0 A;  1FBE A;  1IMB A;  1NUW A;  1NI9 A;  1QGX A;  2HHM A;  1FPD A;  4GWW A;  1FBG A;  1YXI A;  1NUX A;  5T3J A;  2F3B A;  1K9Y A;  1RDZ A;  1IMF A;  3BIH A;  1FSA A;  1IMA A;  2OX3 A;  3KC1 A;  5EQ8 A;  5I3S A;  1AWB A;  2DDK A;  1G0H A;  1NV1 A;  4FBP A;  2QVU A;  1NV6 A;  4HE0 A;  4I40 A;  1FBC A;  1KA0 A;  5EQA A;  1INP A;  4KXP A;  2Q8M A;  4QXD A;  5A5L A;  1NV7 A;  3RPL B;  4I3E A;  4GWZ A;  5FBP A;  5ET8 A;  1KZ8 A;  1FJ6 A;  4GWY A;  2P3N A;  1LBX A;  3RYD A;  1K9Z A;  4GWX A;  1Q9D A;  4GWS A;  1DBZ A;  1LBV A;  1FBD A;  1IMD A;  1FPK A;  3BIG A;  3KC0 A;  4AS4 A;  1DK4 A;  4GBV A;  3RPL A;  3B8B A;  2FVZ A;  5ET7 A;  1NV5 A;  1FPL A;  3QMF A;  2PCR A;  4HE1 A;  2F3D A;  5IZ3 B;  1JP4 A;  1EYJ A;  4H46 A;  1FBF A;  3ROJ A;  4GBW A;  1KA1 A;  2CZI A;  2FBP A;  2QFL A;  2GQ1 A;  4N81 A;  3A29 A;  4O7I A;  1FJ9 A; 
#chains in the Genus database with same CATH topology
 1FPF A;  4EQ7 A;  4F3S A;  5AA1 A;  3VVF A;  1RDX A;  5LTC A;  2KR0 A;  3JYR A;  4G8N A;  5FHN A;  2OJT A;  5CMC A;  1D9V A;  3CSG A;  1NNF A;  4EXK A;  4R2F A;  1NV3 A;  2BJI A;  3QXM A;  3R6U A;  5K2Y A;  3H6U A;  4KD5 A;  4QSC A;  2I49 A;  4FIM A;  4O3B A;  3MST A;  2XWO A;  3OOA A;  4LUB A;  4JVI A;  4GVO A;  1XVY A;  5I2K B;  4ZZE A;  3DLN A;  3VLV A;  1MQI A;  4RY1 A;  3MP1 A;  4ZE9 A;  5I56 B;  3H06 B;  4ZE8 A;  4G4P A;  1FBG A;  2XWV A;  4N6D A;  3UIF A;  5I84 A;  3BIH A;  1PB7 A;  4Q5T A;  4R74 A;  2I3V A;  4EUO A;  2DWH A;  3VLU A;  2REG A;  1MXX A;  1Q1K A;  5JTY A;  3TUS A;  1TWY A;  1MH3 A;  4I9D A;  5ITO A;  4KCC A;  4LQ2 A;  1QKB A;  3IJO B;  4YB7 A;  4L17 A;  4YAH X;  1N7X A;  4NF5 A;  3IOT A;  5ISU A;  1Y9U A;  4IO7 A;  1A99 A;  1MQG A;  2DQV A;  4O7I A;  4PGP A;  1US5 A;  4AS5 A;  4XFE A;  4BLA A;  1JET A;  4LN5 A;  3KOT A;  3TYH A;  4HE2 A;  4RXL A;  4RYA A;  3CFZ A;  3THI A;  4G77 A;  2CMO A;  3FUZ A;  1PBP A;  3PGF A;  2Q2A A;  3W15 C;  4IY6 A;  2Y7K A;  4ISU A;  4PTK A;  1MPB A;  1EYK A;  3SER A;  1PB9 A;  2CEX A;  5HM4 B;  1NL5 A;  3G3I A;  3K02 A;  4N4U A;  2DWJ A;  1JW1 A;  1P1N A;  4H8J A;  1MXW A;  3MQ9 A;  4F22 A;  1IQ7 A;  1MH4 A;  1OIB A;  1QUJ A;  4H65 A;  1DTG A;  1DCU A;  1MXY A;  2ZYM A;  3O2A A;  2NUV A;  1IMB A;  4OA4 A;  2XX7 A;  2F7A A;  3KOS A;  1FQC A;  4XIG Q;  4ECF A;  2ZYK A;  3HFU A;  2F3B A;  1P1U A;  5I2N B;  1R9Q A;  4LZ8 A;  5I3S A;  1FTL A;  4NN3 A;  2B3F A;  4FOR A;  2F6P A;  4KQP A;  4I40 A;  3N5L A;  4KXP A;  3C35 A;  1NV7 A;  5F1Q A;  5KZT A;  3RYD A;  1LAF E;  2OWS A;  3RT6 B;  3CG3 A;  1SQY A;  2ONK E;  3QUJ A;  4F19 A;  4NAP A;  4X1D A;  5CC2 A;  1MM6 A;  3G3J A;  5A5X B;  2F36 A;  1NV5 A;  4HE1 A;  4U4S A;  4FJP A;  1MPC A;  1JVX A;  3UN6 A;  3EQ1 A;  4KFQ A;  4U21 A;  3VV5 A;  3TAJ A;  4YKP A;  2NXO A;  1FPB A;  1OVT A;  5IM2 A;  4C1T A;  1B6H A;  5H8H A;  4ZDM A;  1FQE A;  4P56 A;  3V89 B;  1JQF A;  2PT2 A;  4Z7E A;  4Q0C A;  4AB6 A;  3IJX B;  4NF8 A;  4IO5 A;  4GL8 A;  4N17 A;  2F35 A;  5H8N A;  1PC3 A;  2VPO A;  1B40 A;  1YYZ A;  1WVJ A;  3LBS A;  1ZU0 A;  3N6U A;  3VXB A;  4JXI A;  3PD9 A;  4YB5 A;  3FD3 A;  3FVK A;  4XEQ A;  4XKQ A;  1LST A;  3KN7 A;  4MLV A;  1M5E A;  3Q26 A;  2OWZ A;  4QRZ A;  4O8M A;  2R6G E;  3H03 A;  2ONR A;  4IO6 A;  4ZED A;  3CFX A;  2V25 A;  1O63 A;  3TQL A;  2VP1 A;  3SZP A;  4N6K A;  2DDK A;  2VD3 A;  3B50 A;  2Q8M A;  4POW A;  2P3N A;  1PBQ A;  3N26 A;  5A5X A;  3OSR A;  4FEB A;  1LBV A;  1FPK A;  2XXX A;  3FVN A;  1D3K A;  4H67 A;  3LSX A;  2CZL A;  1QUI A;  3T9X B;  4KHZ E;  2P0S A;  1MXZ A;  2XXT A;  4PBQ A;  5DT6 A;  4ELR A;  4PFB A;  2WKY A;  3IAZ A;  3CIJ A;  4MNI A;  4LZ5 A;  4NF4 A;  2OK2 A;  2YJP A;  4I3Y A;  3HHF A;  2DS9 A;  4NF8 B;  1IME A;  4MX6 A;  2XHD A;  1Y3P A;  3DEL B;  4ONY A;  1EYI A;  4OAN A;  1WDN A;  5DTB A;  4MCO A;  3MVW A;  2A5T A;  1MY4 A;  1J1N A;  4XTC Q;  1LAH E;  2R8T A;  4ELO A;  2Y5L A;  2CZK A;  3FAS A;  1LBW A;  3U72 A;  1IUD A;  3RPW A;  2X26 A;  2Q8J A;  5HPQ A;  1KWH A;  2HCA A;  3OEK A;  1SPI A;  1MQJ A;  4LQ5 A;  3FGS A;  4PDH A;  4NG7 A;  2QRY A;  4ELP A;  1OMP A;  3R26 A;  4G61 A;  3ZKK A;  1N3W A;  1N76 A;  4MFI A;  3FXQ A;  3SEX A;  1NV0 A;  4QFN A;  4DIG A;  1XVX A;  1B3L A;  4OVQ A;  3OSQ A;  3K6U A;  1IMF A;  3MUQ A;  4X9T A;  1AWB A;  2Z8F A;  1DPE A;  4Q8R A;  1H45 A;  2IEE A;  5FTI A;  4PAK A;  2B3B A;  5AA4 A;  2KQZ A;  4GWX A;  1Q9D A;  4R6H A;  2HZK A;  1M5C A;  3EHT A;  1OQH A;  3BFU A;  2I0B A;  1JP4 A;  1HSL A;  2ZYN A;  3PMV A;  5I59 A;  1R6Z A;  1T0K A;  2DVZ A;  3C36 A;  2DXY A;  1FBH A;  5EHS A;  3U1O A;  2DXR A;  2XXV A;  2QMW A;  3D1R A;  4UA8 A;  1SW5 A;  2OZZ A;  4NE4 A;  4IB2 A;  4N15 A;  4F1V A;  3DP8 A;  3PMW A;  1G0I A;  2V84 A;  1B7U A;  1SVX B;  4EF2 A;  3Q29 A;  1US4 A;  4XKP A;  3K6V A;  1FPI A;  2ZZX A;  4YB6 A;  3IFC A;  1SBP A;  2OCU A;  4OVP A;  3CSB A;  4IR8 A;  1FQB A;  2VT5 A;  1TT1 A;  4KI0 E;  2XXY A;  1BKA A;  1JW4 A;  1YAE A;  4MNC A;  5DVI A;  3KJT A;  3ZKL A;  3D4G A;  2QS1 A;  4GWO A;  1FPJ A;  3IO4 A;  3KJ7 A;  4WED A;  3E78 A;  1NUW A;  3EHU A;  4QSE A;  2I48 A;  1PB8 A;  4F3B A;  5I2N A;  2Z23 A;  3PV0 E;  4N8Y A;  1FBC A;  1ZBM A;  5ICQ A;  3LR1 A;  4DZ1 A;  4NF6 B;  3RQT A;  3PUZ E;  1UTH A;  4AS4 A;  4TQU Q;  1DOT A;  3TTN A;  2RC8 A;  4M1V A;  4OHN A;  4Z0I A;  4H46 A;  2WYK A;  1VFD A;  4KR5 A;  2FNC A;  1AMF A;  1ANF A;  2H5Y A;  1XOC A;  5KDT B;  3A3C A;  2Y5K A;  4PP0 A;  2Q88 A;  4PFT A;  1XHY A;  2RC9 A;  5CI5 A;  2G93 A;  4MMP A;  1IMC A;  3MYU A;  3GXA A;  4NGU A;  4GWU A;  5L9O A;  5ET6 A;  4OQO A;  1P1W A;  1ZKB A;  2WEF A;  1MDQ A;  1QJM A;  1YTV A;  1Y20 A;  3FXB A;  1B46 A;  4KPT A;  3H6W A;  2P3V A;  3KN3 A;  3E9X A;  4TLL B;  3SKP A;  5EYH A;  3FAT A;  4QFK A;  1MQD A;  4N13 A;  4MEV A;  1B7H A;  1MY0 A;  3IL1 B;  4PF8 A;  3ZS6 A;  1A7L A;  3K1P A;  2PFY A;  1R9L A;  2RC7 A;  4IO2 A;  4ELQ A;  4JWX A;  3C34 A;  3MJN A;  5CMK A;  1OVB A;  1FBE A;  1Z7M E;  1LFI A;  1RDZ A;  4TOZ A;  2Z22 A;  1Y3N A;  3TMG A;  1SI1 A;  2Z8E A;  4GXA A;  5EQA A;  4QXD A;  2DE2 A;  3IB1 A;  4RJZ A;  3CI8 A;  3JZJ A;  3RY3 A;  1DPP A;  3RT8 A;  1B5H A;  2XX8 A;  3B8B A;  1L5T A;  3PPR A;  2HPG A;  4XKR A;  1B0L A;  1N0T A;  4DCX A;  3TFL A;  3VVD A;  1NNT A;  2O84 X;  3K6X A;  3S9M C;  3ECR A;  4HW8 A;  2PYY A;  4DE8 A;  2Y7W A;  3I3V A;  3RTF B;  4I1D A;  3TEL A;  2VD2 A;  3O97 A;  1FRP A;  4PBH A;  1UIU A;  5J16 A;  1M5B A;  4YMA A;  4YU0 A;  5TPA A;  2Q74 A;  4RPN A;  1RYX A;  5F7V A;  2V3U A;  3MBP A;  4NF5 B;  1B3H A;  1B0H A;  2LAO A;  1NV4 A;  2H9B A;  1NUY A;  4GX4 A;  4F1U A;  3EHS A;  2XX9 A;  1S9T A;  4YZZ A;  1QKA A;  5EYG A;  4E0W A;  2RIN A;  2DWA A;  2H25 A;  4R73 A;  4OZ9 A;  5TPA B;  3V8X B;  2QSX A;  3RN8 A;  4OXV A;  2JJK A;  3EF7 A;  5BWJ A;  1B7Z A;  1NUZ A;  2WYP A;  2PFZ A;  2V93 A;  3PPN A;  3HST A;  3E3K A;  3IB2 A;  5I56 A;  1FPD A;  2REJ A;  4NWD A;  3UK4 A;  5FHM A;  1JEU A;  1LCT A;  4FED A;  5CBS A;  5DEX A;  1BP5 A;  3OEM A;  3PUW E;  3O6G A;  2HQ0 A;  5FBP A;  1LBX A;  1BTJ A;  1A55 A;  5I5P A;  3BIG A;  1UIV A;  3G3H A;  2XD3 A;  3KC0 A;  2R71 A;  4U22 A;  2DE4 A;  4N07 A;  2ZZV A;  3QMF A;  1KA1 A;  4PQJ A;  4GLI A;  5DVJ A;  2PT1 A;  2ESN A;  1IIT A;  3SEY A;  4MHF A;  3KBR A;  4G68 A;  1FTJ A;  4C0R A;  3PTY A;  1I6B A;  2QS2 A;  3MZB A;  1Y1Z A;  3RTW B;  4XKN A;  4H0W A;  4R9F A;  3O29 A;  1JEV A;  1VDW A;  2OPD A;  3TKD A;  1DSN A;  4OVT A;  1ATG A;  5H8F B;  4JBZ A;  4F2Q A;  3OXN A;  2XXU A;  3N6T A;  3TQW A;  4QFP A;  1MPD A;  2ALU A;  2UVI A;  3SDF A;  3S9E A;  3FBP A;  1AH5 A;  1LEV A;  1F9B A;  4GD5 A;  4JVC A;  4OFO A;  1O64 A;  3IK6 B;  3MWB A;  4OYV A;  4H45 A;  2XXP A;  4BDN A;  1TXF A;  5B70 A;  1B2H A;  3LUY A;  2OPE A;  4OVS A;  1LGB C;  4LAT A;  2XD2 A;  4ZEF A;  3KG2 A;  1AIV A;  3CFL A;  4HE0 A;  2I0C A;  4PF6 A;  2ANJ A;  4LON B;  1MY1 A;  5KCJ B;  3SEW A;  2M8C A;  3RPL B;  4I3E A;  1II5 A;  1URG A;  2DYX A;  4X8R A;  2ZXT A;  5ET8 A;  1B9J A;  2AYS A;  3UOR A;  3FV2 A;  4GF8 A;  4NF4 B;  1SI0 A;  3TCF A;  5H8H B;  4IGR A;  1VSO A;  4OEV A;  2F7B A;  3BBR A;  2UYF A;  1NH8 A;  1UTB B;  4H5F A;  2XXQ A;  2QFL A;  2H98 A;  1HSJ A;  5EHM A;  1N84 A;  3S9N C;  5LOM A;  4LA9 A;  3OO9 A;  4HXV A;  1SW1 A;  3DM0 A;  1RDY A;  5H8Q A;  3QYT A;  1Y3Q A;  3C4M A;  4U23 A;  1M5D A;  4GX3 A;  2D21 A;  1XC1 A;  4RPO A;  3PMX A;  5K2X A;  4QFL A;  3G3F A;  3FXR A;  2I4B A;  4MBP A;  1I69 A;  3O9P A;  3CHG A;  3K1M A;  4P8B A;  3GLB A;  5I57 B;  3IOR A;  1SYI A;  1LFG A;  3OO8 A;  2DOJ A;  3I6V A;  3A09 A;  2FIX A;  5ESY A;  2MKZ A;  1POT A;  4F2O A;  1A8F A;  3O6H A;  3S4U A;  1IXH A;  1I6A A;  3TDJ A;  3KGC A;  4XF5 A;  4N91 A;  4JB7 A;  2ONS A;  1P1O A;  4NX1 A;  1B5J A;  1R1N A;  4MAG A;  5H8S A;  3WAE A;  4H6D A;  4OEN A;  2F34 A;  2ABH A;  3H6T A;  1NI9 A;  2HHM A;  4GWW A;  5JTY B;  4O94 A;  2QPQ A;  4ESX A;  5T3J A;  2A5S A;  3SES A;  1HSE A;  1IIW A;  3EN3 A;  3AXF A;  4PGN A;  2H4I A;  3TEP A;  1INP A;  3OEN A;  3FJ7 A;  2Y84 A;  4R75 A;  4YMB A;  3DP6 A;  5B7D A;  1Y1M A;  2NOO A;  4GWS A;  1LFH A;  2OLB A;  2DE3 A;  1DK4 A;  2B65 A;  1P1Q A;  1QUL A;  1SDX A;  3M8U A;  3R7X A;  2A5T B;  4AB5 A;  1FTM A;  2I58 A;  2QJE A;  1B3G A;  4YKK A;  1FPG A;  4NF0 A;  4P1L A;  1MDP 1;  1Z7N E;  1IZ1 A;  1POY 1;  3K1N A;  2VPN A;  3KZG A;  3O66 A;  2B4L A;  3W9V A;  3VDF A;  4G2Z A;  2H99 A;  3HPI A;  2HZL A;  3FJG A;  3C31 A;  5IGA A;  4OMB A;  1OQG A;  3OD7 A;  4JWO A;  3TCH A;  1D4N A;  1TFD A;  5EQ9 A;  1LAG E;  4JDF A;  2ZNS A;  3T0J A;  1BK4 A;  3Q27 A;  3HV1 A;  3Q25 A;  1B4Z A;  4OET A;  4ZEB A;  1LAX A;  1H3D A;  1XT8 A;  5BUU A;  4AQ4 A;  4BDO A;  4GX6 A;  1QW0 A;  3LUZ A;  4MLQ A;  4OES A;  2F5X A;  1DTZ A;  1QGX A;  2V3Q A;  4QFO A;  3K4U A;  4F39 A;  3QAX A;  4F3G A;  3KC1 A;  2XXK A;  4FBP A;  3KN8 A;  4XXU A;  2F78 A;  4ZZA A;  3T1B A;  4G8M A;  2HFB A;  5CMM A;  3U94 A;  1VE4 A;  3MVX A;  4LVQ A;  3GYY A;  4NQ8 A;  4LP2 B;  2DP8 A;  4YKJ A;  2WX9 A;  5H8N B;  1DBZ A;  4P0I A;  1OLC A;  3RNN A;  4KYS A;  3A3U A;  5L9S A;  3V83 A;  2PCR A;  2DSF A;  4K3F A;  4P3L A;  1FBF A;  2Q89 A;  4P11 A;  2VOZ A;  4U1O A;  1FTO A;  1MY2 A;  2GHA A;  3USD A;  2F7C A;  3TZA A;  2V4C A;  4G68 C;  4NTL A;  2GFE A;  3VXC A;  4M4G A;  2QS3 A;  1Q35 A;  4POX A;  3ONM A;  1UQW A;  1H76 A;  4IO3 A;  3VFJ A;  4FAT A;  2VGQ A;  1A54 A;  2RF1 A;  4ZEC A;  4GL0 A;  3VE1 B;  2O68 A;  4OER A;  2I3W A;  3PU5 A;  3ILU B;  2PBW A;  3IFA A;  4N6P A;  3D4C A;  3RLF E;  4MJO A;  3IO6 A;  1ZIU A;  3CR9 A;  3ILT B;  2G29 A;  1NV2 A;  3K6W A;  2DVC A;  3KEI A;  2HXR A;  3MZ9 A;  4GOT A;  1TFA A;  1YXI A;  4R72 A;  5I57 A;  4WKM A;  3CVG A;  2OX3 A;  1IMA A;  4PAF A;  1CB6 A;  2QVU A;  3PD8 A;  3IR1 A;  3S9L C;  3QUF A;  4BDL A;  2AIX A;  4DDD A;  4UAC A;  2YPN A;  2FYI A;  2KLF A;  3H3G A;  5CMB A;  1ZLQ A;  1JNF A;  1EZP A;  4G68 B;  5ET7 A;  3MC2 A;  5JK4 A;  1EYJ A;  1UTB A;  2F97 A;  2NVU B;  4RNS A;  4GXS B;  2FBP A;  4PE3 A;  4HCW A;  4N81 A;  4R6Y A;  4YKI A;  3GBA A;  3O28 A;  2O1M A;  2XXI A;  5CBR A;  1LB8 A;  3KSJ A;  3VLW A;  4OVJ A;  2OBG A;  3V5A A;  3T9H B;  3H4Z A;  2QVR A;  4WEP A;  3T9U A;  1RYO A;  2XA5 A;  2UVG A;  1XS5 A;  1QUK A;  2R9J A;  3BFT A;  5F24 A;  2Z8D A;  4ZEI A;  1GR2 A;  1FPE A;  2OWT A;  3OMB A;  1CNQ A;  1LBY A;  3RGY A;  5I2K A;  1SD3 A;  5EQ7 A;  1P99 A;  3IOU A;  2QVV A;  3O6I A;  4BDQ A;  1ELJ A;  2UVJ A;  4ZEK A;  3T66 A;  3TTR A;  1FQD A;  4JVD A;  4EXL A;  2Y7P A;  4H8I A;  1VFE A;  1YPN A;  4PFW A;  5JEI A;  4OVR A;  4IY5 A;  4DCY A;  1NUX A;  4JSO A;  4OWD A;  4QBA A;  5TU0 A;  2O7I A;  4PC9 A;  3KSX A;  3ISP A;  5EQ8 A;  1S50 A;  1LLS A;  5H8Q B;  2ZNU A;  3PPO A;  1SW2 A;  1GVC A;  4O3C A;  3B6T A;  3M3L A;  3PUY E;  1MRP A;  4R9G A;  3G3K A;  4P0G A;  3FJM A;  5FTH A;  4ESW A;  4DI4 B;  3FZV A;  1IXI A;  3K01 A;  1JW5 A;  3G7W A;  3QSL A;  5AA2 A;  1FPL A;  3TPA A;  3UA8 A;  3MVY A;  4E0X A;  1BIY A;  2O69 A;  1AOV A;  3FVO A;  4DXC A;  5ELV A;  4BDR A;  1FTK A;  1YCJ A;  3T9V A;  2ZMB A;  1FJ9 A;  3RPL A;  1N04 A;  2FA7 A;  3OO6 A;  1FW0 A;  3W9W A;  4PCD A;  5I7I A;  4NHB A;  2ZNT A;  5L9M A;  1FBP A;  3T22 A;  1XI6 A;  2HXW A;  4F18 A;  1MXU A;  2Y7R A;  2D5W A;  3WAF A;  1MY3 A;  4QF9 A;  2DWI A;  3P7I A;  4G8H A;  3UGW A;  4ZS9 A;  2QMX A;  1GGG A;  1NFT A;  2UVH A;  1NKX A;  5KCJ A;  1B58 A;  1NNP A;  3HO7 A;  2O51 A;  4X04 A;  5ET5 A;  5H8F A;  1UTH B;  1NMU A;  4FAJ A;  3E79 A;  1Y4C A;  1B5I A;  2AL5 A;  3LV0 A;  1SYH A;  3M3F A;  4PDD A;  5ITP A;  3PPQ A;  3QK6 A;  4GFR A;  4EF1 A;  2P2A A;  3MZ1 A;  2E1S A;  3K00 A;  2O6A A;  3T96 B;  3CRB A;  4KCD A;  4IO4 A;  1JVY A;  1B32 A;  4GWY A;  5AE4 A;  2GRV A;  5IZZ A;  4GBV A;  3JV9 A;  4PFI A;  1EH3 A;  3T93 B;  3S2V A;  4F1Y A;  3TTM A;  1MXV A;  5CM6 A;  3A29 A;  2ZYO A;  4R2B A;  3IOV A;  4HTG A;  1PDA A;  5FHO A;  3QIM A;  2ZZW A;  3EPE A;  3MVZ A;  5DW8 A;  3K2D A;  4N8G A;  3IB0 A;  1N7W A;  2I4C A;  4MH5 A;  3GZG A;  4O3A A;  2XWI A;  4F29 A;  1USY H;  4RK2 A;  4TLM B;  4NF6 A;  1RKM A;  1M5F A;  3FXU A;  1LBZ A;  2Q2C A;  4X48 A;  3K0V A;  1B1X A;  3UP9 A;  2WBB A;  4GIZ A;  3IX1 A;  2V3T A;  2FHY A;  5HBC A;  3LC8 A;  5LDZ A;  1YZ0 A;  3RUM A;  4H5G A;  3PPP A;  5DVF A;  4RA1 A;  2E0S A;  3SEV A;  2I6E A;  2IA4 A;  3H6V A;  2XXR A;  2WBD A;  2RKM A;  5I58 B;  4PFR A;  1GV8 A;  5DYH A;  5IZ1 A;  4WXJ A;  3HN0 A;  5KDT A;  5AA4 B;  4F31 B;  4NMY A;  4PFU A;  1ZTY A;  5J1D A;  2Y7I A;  2X7P A;  3BKI B;  4P47 A;  2PMS A;  1K9Y A;  1B05 A;  1LCF A;  4RK9 A;  1FSA A;  4OEU A;  1AL3 A;  1B3F A;  1B51 A;  2BJJ X;  5AA2 D;  1G0H A;  2XXH A;  3HCQ A;  3MPK A;  1KZ8 A;  2RCA A;  3TTK A;  1NH7 A;  1IMD A;  4F3P A;  2O1L A;  3L6G A;  2THI A;  2GHB A;  1B4H A;  4DI3 D;  3Q28 A;  2QS4 A;  2YLN A;  3C9H A;  3FIR A;  5IZ3 B;  3TCG A;  1DMB A;  1H44 A;  1FQF A;  4I62 A;  1EU8 A;  4U2R A;  5DEX B;  3GBB A;  2P1S A;  1USY E;  2RCB A;  1MQH A;  5M2V A;  4H1X A;  1VR5 A;  3U8Q A;  4HCY A;  1EZ9 A;  4PFY A;  2D3I A;  1LBB A;  4OFJ A;  2HEU A;  1PEB A;  3E13 X;  1ZJL A;  4FEC A;  2W7Y A;  1D9Q A;  4PE5 B;  2X7Q A;  1FCK A;  4FE8 A;  2HAV A;  2FIE A;  3CG1 A;  3PUX E;  3U92 A;  4Q30 B;  3H7M A;  1FTA A;  5CRY A;  3SEU A;  2HAU A;  3LSF B;  1FQA A;  2UXA A;  4PAI A;  4EDP A;  3NOH A;  3ZSF A;  2PVU A;  3TOD A;  2CZH A;  1SW4 A;  5IKB A;  3FVG A;  1OLA A;  4MIJ A;  4X1B A;  3MW0 A;  1I6Q A;  2UYE A;  4OFL A;  4UAB A;  1ZMG A;  3C32 A;  5AA2 B;  1LBC A;  3LSL A;  4PET A;  4BDM A;  3LSW A;  5TP9 B;  1CE2 A;  3I5O A;  1KA0 A;  3ODB A;  4GQO A;  1D9Y A;  4U1Z A;  3KFM A;  5A5L A;  4O7M A;  1A40 A;  1S7Y A;  1FJ6 A;  1B52 A;  3E4R A;  3OO7 A;  4QHQ A;  4MNP A;  4C1U A;  3F11 A;  1N3X A;  4IGT A;  2L5V A;  1LB9 A;  2F3D A;  3SET A;  3C33 A;  4GBW A;  2CZI A;  1IXC A;  3EKI A;  1B3E A;  2Q9T A;  2XXW A;  3IOW A;  3G3G A;  4NED A;  4YIC A;  1MG1 A;  2QL3 A;  5L8D A;  3N94 A;  4QSD A;  3B7D A;  1URD A;  4LZ7 A;  3U65 A;  1H43 A;  2AL4 A;  1O7T A;  3U93 A;  3MP6 A;  3VVE A;  4GRK A;  4KYD A;  4KYE A;  4MF3 A;  1GTK A;  5I58 A;  3KBZ A;  3B6W A;  4JWY A;  3MP8 A;  2F8D A;  4NWC A;  5EYF A;  1B1H A;  1Y4T A;  3FV1 A;  2NWJ A;  3MPL A;  1QVS A;  3MAM A;  2B4M A;  4R6K A;  1NNK A;  1MS7 A;  5IZ3 A;  1A8E A;  3L6H A;  1EZO A;  4DXB A;  4P1E A;  1URS A;  3DP4 A;  2VHA A;  4DXU A;  2O7U A;  1BLF A;  5TP9 A;  4U4X A;  5IAI A;  2GH9 A;  4DLD A;  5AA3 A;  1NV1 A;  1NV6 A;  4OTE A;  4GWZ A;  5I59 B;  2CEY A;  1K9Z A;  2F6G A;  1FBD A;  4P9K A;  4ND9 A;  1MM7 A;  1WOD A;  3M3K A;  2FVZ A;  3TTL A;  4THI A;  1IEJ A;  2XWK A;  4JSD A;  3ROJ A;  5ICT A;  3OEL A;  2PX1 A;  2GQ1 A;  1IXG A;  4EQB A;  3PUV E;  3B6Q A;  3HHG A;  4I8C A;  4HS7 A;  4EQ9 A; 
#chains in the Genus database with same CATH homology
 4PGP A;  1FPG A;  4MHF A;  4NF0 A;  2ZZW A;  1FPB A;  1FPF A;  4HXV A;  4AS5 A;  2DVZ A;  4P1L A;  4YIC A;  4MNI A;  1RDY A;  5DW8 A;  4PCD A;  4XFE A;  2Y5K A;  3PTY A;  1RDX A;  1FBH A;  2V4C A;  2KR0 A;  4LN5 A;  4N8G A;  5I7I A;  5LTC A;  3D1R A;  4I3Y A;  4HE2 A;  3U65 A;  4NHB A;  1FBP A;  1IME A;  4GX3 A;  2VPN A;  2XWI A;  4HCY A;  4N15 A;  4MX6 A;  2B4L A;  4F1V A;  3W9V A;  1FRP A;  1XI6 A;  1IMC A;  1EYI A;  1G0I A;  2QVR A;  4MMP A;  4OAN A;  4PBH A;  3MYU A;  2XA5 A;  4P56 A;  4F18 A;  4NGU A;  4GWU A;  4MCO A;  5J16 A;  5ET6 A;  1LBZ A;  5F24 A;  2WEF A;  2R8T A;  2Q74 A;  3KBZ A;  2HZL A;  2WBB A;  5IM2 A;  1NV3 A;  1VDW A;  2Y5L A;  3FXB A;  3CHG A;  2CZK A;  5IGA A;  2BJI A;  4P8B A;  4PTK A;  1D9Q A;  1FPI A;  2P3V A;  1EYK A;  2ZZX A;  5J1D A;  2FHY A;  1LBW A;  2CEX A;  4N17 A;  3IFC A;  1FPE A;  5EQ9 A;  5LDZ A;  1NV4 A;  4OVT A;  1YZ0 A;  1CNQ A;  1LBY A;  2VPO A;  1NUY A;  4GX4 A;  1YYZ A;  5EYH A;  4N4U A;  4F1U A;  2FIE A;  4OVP A;  2FIX A;  4IR8 A;  5ESY A;  4X9T A;  2VT5 A;  2MKZ A;  3MST A;  3T0J A;  2XWO A;  4YZZ A;  1BK4 A;  2B4M A;  4MEV A;  1SPI A;  1FTA A;  4MNC A;  4JVI A;  5EQ7 A;  3IFA A;  5IZ3 A;  4NG7 A;  5EYG A;  4PF8 A;  4PDH A;  4XEQ A;  2QVV A;  3FBP A;  4XF5 A;  4G61 A;  4N91 A;  1LEV A;  4MJO A;  4X04 A;  5ET5 A;  2WBD A;  4PAI A;  4GX6 A;  4JVC A;  4NX1 A;  4PFR A;  1NV2 A;  3E79 A;  5IZ1 A;  1FPJ A;  2PFY A;  4MAG A;  2JJK A;  3NOH A;  1DCU A;  2OWZ A;  4H45 A;  1NUZ A;  2WYP A;  4JVD A;  3LUZ A;  2CZH A;  4O8M A;  4P1E A;  1NV0 A;  2HXR A;  2F5X A;  2PFZ A;  3E78 A;  3LV0 A;  4MIJ A;  1FBE A;  1IMB A;  4OA4 A;  4PDD A;  1NUW A;  1NI9 A;  1QGX A;  2HHM A;  1FPD A;  4GWW A;  1FBG A;  1YXI A;  2XWV A;  1NUX A;  2V3Q A;  4N6D A;  2QPQ A;  4O94 A;  4OVQ A;  4P47 A;  4OVS A;  4QBA A;  4UAB A;  5T3J A;  3HFU A;  2F3B A;  1K9Y A;  1RDZ A;  4PC9 A;  1IMF A;  3BIH A;  3ISP A;  1FSA A;  1IMA A;  2OX3 A;  3KC1 A;  5EQ8 A;  5I3S A;  4NN3 A;  4N6K A;  1AWB A;  2DDK A;  1G0H A;  2XXK A;  4PET A;  4PAF A;  3SZP A;  1NV1 A;  4FBP A;  2QVU A;  1NV6 A;  4HE0 A;  4I40 A;  3T1B A;  4PGN A;  3B50 A;  4N8Y A;  4PF6 A;  1FBC A;  1KA0 A;  5EQA A;  1INP A;  4KXP A;  2Q8M A;  4OVR A;  4QXD A;  5A5L A;  1NV7 A;  3RPL B;  2DE2 A;  4I3E A;  3GYY A;  4GWZ A;  4O7M A;  5FBP A;  4NQ8 A;  4PAK A;  5ET8 A;  1KZ8 A;  1FJ6 A;  4GWY A;  2P3N A;  1LBX A;  4X8R A;  3RYD A;  2CEY A;  1K9Z A;  2KQZ A;  4GWX A;  1Q9D A;  2WX9 A;  4GWS A;  1DBZ A;  5I5P A;  1LBV A;  1FBD A;  1IMD A;  2HZK A;  4P9K A;  1FPK A;  3BIG A;  4F19 A;  4MNP A;  3KC0 A;  4NAP A;  4AS4 A;  2DE3 A;  4DI4 B;  5IZZ A;  1DK4 A;  4GBV A;  2DE4 A;  3RPL A;  4DI3 D;  4PFI A;  3B8B A;  2L5V A;  2FVZ A;  2ZZV A;  5ET7 A;  1NV5 A;  1FPL A;  3QMF A;  2PCR A;  4HE1 A;  2F3D A;  2HPG A;  5IZ3 B;  1JP4 A;  2XWK A;  4M1V A;  1EYJ A;  5JK4 A;  4P3L A;  4H46 A;  1FBF A;  2WYK A;  3ROJ A;  4GBW A;  4PBQ A;  1KA1 A;  2CZI A;  2FBP A;  3EKI A;  2QFL A;  4PE3 A;  3W9W A;  4HCW A;  5CM6 A;  2Q9T A;  2GQ1 A;  4N81 A;  3A29 A;  4PFB A;  4O7I A;  1FJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...