4I40A

Crystal structure of staphylococcal inositol monophosphatase-1: 50mm licl inhibited complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
b'KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 75
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i40A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i40A02
1EYJA 1FPIA 1NUXA 4GWYA 1FJ9A 2F3BA 1G0HA 4AS4A 1DBZA 4MJOA 3LV0A 2CZIA 1SPIA 1XI6A 5EQ8A 4QXDA 1RDYA 5FBPA 5J16A 5IZ3B 4HE2A 1FPLA 5EQAA 4AS5A 3B8BA 1NV6A 4N81A 3RYDA 1INPA 1D9QA 3FBPA 4HXVA 2Q8MA 1FBGA 2FBPA 2GQ1A 1FPBA 4I40A 1FPFA 5EQ9A 1FBHA 1FPEA 3BIHA 1IMEA 2CZKA 1CNQA 4H45A 1RDZA 1DCUA 1IMFA 2JJKA 1YYZA 2P3VA 3KC0A 3RPLA 1IMBA 1VDWA 4KXPA 2F3DA 1FTAA 2Y5LA 3KBZA 2QVVA 1FBCA 2FVZA 2DDKA 1NI9A 1FRPA 4GWSA 1RDXA 3QMFA 2HHMA 5LDZA 2Y5KA 1KA1A 2Q74A 1NV7A 1YXIA 1NUZA 3IFAA 2R8TA 1IMDA 2OX3A 4GWUA 2QVUA 5ESYA 1NUWA 4O7IA 2PCRA 4PTKA 3ROJA 1K9ZA 2WEFA 1FPGA 1DK4A 2QFLA 1KZ8A 2FIEA 4GX3A 2BJIA 1BK4A 2FIXA 1FBEA 3A29A 1FPDA 4HE0A 1LBXA 5EYGA 1YZ0A 1LBWA 4GWZA 4HE1A 1FBFA 1LBZA 5I3SA 2OWZA 1AWBA 1QGXA 2WBDA 3IFCA 4FBPA 5EYHA 1LBVA 5F24A 1LEVA 1FSAA 3BIGA 3RPLB 4I3EA 4GWXA 1IMCA 1FBDA 2P3NA 4I3YA 5ET7A 5DW8A 4GBVA 1NUYA 1NV1A 1NV4A 1EYKA 1IMAA 4GWWA 4GBWA 3T0JA 5IZ1A 1FBPA 2CZHA 1JP4A 2VT5A 1EYIA 3D1RA 4GX6A 1FPJA 1Q9DA 4H46A 5T3JA 1KA0A 5A5LA 5IZ3A 4G61A 1FPKA 5EQ7A 1LBYA 4IR8A 1NV0A 2QVRA 5ET5A 1NV5A 2WBBA 3LUZA 4GX4A 1FJ6A 3KC1A 5ET8A 1K9YA 1NV3A 1G0IA 5ET6A 1NV2A 2FHYA
chains in the Genus database with same CATH superfamily
1JW5A 4BLAA 1FJ9A 1JVYA 1QUJA 3T9XB 2CZIA 3U65A 1QJMA 4JBZA 5H8HB 3ZSFA 1B3HA 5J16A 4OMBA 3OMBA 4Q30B 1EZOA 5EQAA 5AE4A 4OANA 1JW1A 3OD7A 1S9TA 4GFRA 1GTKA 1WDNA 3M3FA 2NUVA 4OERA 4R2FA 3QYTA 1US5A 1A8EA 3EN3A 2QVVA 5IKBA 3FGSA 4X48A 4EQBA 1UTHA 4XIGQ 1QUKA 3H6WA 3WAFA 1B4ZA 4OWDA 3FXQA 3CSBA 2WEFA 4IGRA 3MP1A 1S50A 2H98A 4PF6A 4ELPA 3O6IA 2XXXA 1YZ0A 2DXRA 1LFGA 2Z8DA 4IO6A 3FVGA 2VGQA 4XEQA 4EUOA 4FATA 2RF1A 4YAHX 2VHAA 2P3NA 1ZLQA 2O7UA 4H8IA 4GBWA 3FASA 4EF2A 1H44A 4R6KA 1FQDA 1LBYA 1N0TA 4DDDA 3TTRA 1FQEA 2QRYA 4QFKA 1POTA 3PMXA 4QF9A 1OLCA 4JVCA 4TOZA 3PPPA 1IXIA 4QSCA 2XX8A 3ECRA 4PDHA 3Q25A 2IEEA 3IB1A 1MY1A 2PX1A 4AS5A 2RC8A 3CRBA 3U1OA 3FUZA 3QAXA 4OEVA 2V3QA 4I40A 1B0HA 1B7HA 3RQTA 2Y7IA 3G3IA 5BUUA 3BFTA 3CR9A 1MH3A 5ITOA 4X9TA 5AA4B 1LFHA 4KI0E 3C36A 5ICQA 2UVGA 1YXIA 3IB0A 4C0RA 1JNFA 2OWTA 1MXYA 3IOTA 2XWKA 2QVUA 2F97A 3TEPA 3I5OA 3RT8A 3E13X 3O66A 4N6DA 3OELA 1FPGA 4F1YA 1GR2A 4BDNA 3LSLA 3G7WA 4PF8A 3SERA 1I69A 1LBWA 5CMBA 2ZZVA 3EF7A 2I3VA 2WBDA 3OXNA 4O3CA 3H4ZA 1VFEA 2XXKA 2FYIA 3GBBA 4G68C 4N4UA 1OIBA 5CM6A 2WKYA 1OVTA 3W9VA 3VXBA 5IZ1A 1A40A 4DZ1A 3KJ7A 3I3VA 4UACA 3T96B 1MXUA 4GLIA 3HFUA 3EHUA 3AXFA 3FV1A 4ZEFA 1UIVA 3EHSA 2KQZA 3FVNA 2O84X 1FQBA 3HO7A 3UA8A 1FPLA 2F78A 2GRVA 5A5XB 3OSRA 3FBPA 2FBPA 1URDA 4M4GA 1FBHA 3BIHA 4LZ5A 3KOTA 1A54A 1RDZA 4PETA 5H8NB 3NOHA 1AMFA 4OESA 2XXVA 4GD5A 3VV5A 1B3LA 1SI1A 4OXVA 2V84A 4GWSA 5LDZA 1B1XA 3VLUA 4GRKA 4OA4A 1QVSA 4GQOA 4ZEDA 5I2NB 4OQOA 4RYAA 3ODBA 5CMKA 2H9BA 2QFLA 4I8CA 1N7WA 1FBEA 1FTJA 4P8BA 1SD3A 4HE1A 4QFPA 1FBFA 4ZEBA 3KFMA 2DWIA 2O68A 4P47A 4YU0A 1NH8A 3HV1A 4UA8A 4F22A 3SESA 5I84A 1NFTA 3SKPA 4I3EA 4GL0A 4OYVA 4P3LA 5DW8A 2O69A 2XXPA 4MH5A 3KBRA 1NV1A 4YKJA 1J1NA 2CMOA 4PGNA 1Y4CA 5I5PA 3TZAA 3HPIA 1Q9DA 4POXA 4F2OA 2B3BA 3A3UA 1LAFE 1FPKA 4F1UA 4P56A 4OVTA 4NN3A 2Z8EA 1FTKA 1B46A 5DTBA 3IAZA 1WODA 1SQYA 3N6TA 4IO3A 4KHZE 4NF6B 1FPIA 1D3KA 3CFXA 3M3KA 3KEIA 3RLFE 4OEUA 2O1MA 4QXDA 5I7IA 4KQPA 4TLMB 4RPOA 1VE4A 5IZ3B 2GH9A 4RNSA 2QPQA 2E1SA 4ISUA 2XXQA 2KR0A 2OLBA 3K6UA 1N84A 3K00A 1FPFA 5EQ9A 1YPNA 3KZGA 1B6HA 3S9LC 1IMFA 2DXYA 4KXPA 3PD8A 4F3SA 1ZJLA 4PFTA 2QS3A 1M5FA 4GXSB 1LCFA 3TCGA 3LR1A 1KA1A 4MCOA 4PFIA 2B65A 2XD3A 4PAIA 3VLVA 3CVGA 5BWJA 5JTYA 4OFOA 1K9ZA 1RYOA 3MC2A 1PB7A 4MF3A 4GF8A 4ND9A 3RTFB 1MQJA 3PMWA 1FPDA 4H8JA 5EYGA 5CMMA 1LBZA 3C4MA 2XX9A 4XKQA 3IFCA 1LBCA 1SVXB 3Q27A 1Q35A 5F24A 1MQGA 4YB5A 4P11A 1EZ9A 1RKMA 3B7DA 4GBVA 2OBGA 2D21A 1MM7A 5DYHA 1CB6A 1ELJA 5DVJA 1B05A 5T3JA 2QS1A 2RINA 4GXAA 3UP9A 2ABHA 1OLAA 1UTBA 1FTLA 1A7LA 1JETA 4R9GA 1IIWA 4QFNA 4AS4A 3MYUA 3CG1A 5AA4A 4N81A 4U1OA 4HXVA 2GQ1A 4YKPA 1Y3NA 1IXHA 3PU5A 4R6YA 4PDDA 2OPDA 1P1WA 3USDA 4EF1A 4H5GA 2DWHA 2PVUA 1B5HA 4QRZA 1R6ZA 2RCAA 3MVYA 1PEBA 3DP8A 2ALUA 5ESYA 2RCBA 2HAVA 3K1NA 3S9NC 4LZ8A 4XTCQ 3RY3A 2DE2A 3MP6A 1B58A 2F36A 2NXOA 2A5TB 5I3SA 3OO8A 4KYSA 1DPPA 1USYH 5AA2D 3C32A 1QKAA 1XHYA 3D4GA 1FSAA 1XS5A 2P2AA 4YKKA 1IXGA 1EYIA 5DVFA 1FPJA 1MDQA 3LC8A 1KA0A 3K01A 3IOWA 4DXBA 5I58B 4N07A 5A5XA 1R9LA 4RY1A 1HSJA 4G8MA 3LUZA 4ONYA 1CE2A 4N91A 5ET6A 1A55A 2Q88A 1EYJA 2KLFA 5H8NA 3QUFA 1NL5A 3ZKKA 1NNFA 5FBPA 2Y7WA 4H6DA 1B4HA 3FXBA 3G3GA 3U93A 5I2NA 1FPBA 3BKIB 3CHGA 4NWDA 2Q2CA 3F11A 3B6QA 3GXAA 4BDLA 3V83A 2O1LA 2P3VA 3KC0A 2ESNA 4C1UA 1JEUA 5CBSA 2F7CA 4POWA 3FZVA 4U4SA 2F35A 2QJEA 1P1NA 2HHMA 2V25A 4ZZAA 2QSXA 2F7AA 4PE5B 5K2YA 2PYYA 2UVHA 2R8TA 2Q9TA 3IL1B 4FJPA 3H6TA 4FAJA 2I4BA 1MY4A 5JK4A 4HS7A 1M5DA 3B50A 1JQFA 5ICTA 3JYRA 4NF4B 1URGA 4PFUA 3E78A 4NF8B 1L5TA 2OZZA 4NF6A 1MXVA 4BDQA 4ESWA 2I48A 1NUYA 4LQ2A 1FTMA 2YLNA 4JSOA 3GBAA 5IZ3A 1OQHA 3MPLA 4NEDA 4DCYA 4LN5A 2WBBA 2Q8JA 3O6HA 4N17A 3S2VA 4O7MA 1DPEA 4M1VA 1LFIA 4KPTA 3PTYA 5JTYB 3TFLA 4F39A 4OENA 1JEVA 4PBHA 4G4PA 2GFEA 3Q26A 2Y84A 2I3WA 4PBQA 4K3FA 4OVJA 2CZKA 3TQWA 1MPCA 4JWYA 4N8GA 2I4CA 2WYPA 2LAOA 3U92A 1BKAA 1YCJA 2Z23A 4F1VA 1RDXA 1P1QA 3K2DA 2AIXA 1UTBB 1N3XA 3K02A 5F1QA 4F18A 1DTZA 3M3LA 4PFBA 1ZKBA 4GWUA 1NUWA 4NF5A 3K0VA 2ONRA 2H5YA 1DK4A 4N15A 2DVCA 4RXLA 4XKPA 1MXZA 2YJPA 2P1SA 2O6AA 3SETA 5CI5A 3RTWB 3DLNA 1TT1A 4IGTA 4ELQA 1MPBA 3FD3A 4R9FA 1URSA 4Q8RA 1Y4TA 1LBVA 5ITPA 3BFUA 3IO6A 3TPAA 4DI3D 1UIUA 1IMAA 5I57B 4DI4B 1GV8A 5AA1A 3MUQA 4F31B 2RKMA 3FJGA 3SEUA 4AB5A 4G68A 3IJOB 1B32A 1IQ7A 1SYHA 2THIA 4GL8A 4ZZEA 4YMBA 5L9SA 4U22A 2AL5A 5DVIA 3OO6A 1SW5A 3JV9A 2PBWA 3HCQA 1MRPA 3QIMA 3ISPA 2GHBA 1ZBMA 4TLLB 2Q89A 4PCDA 4DE8A 4FECA 4R74A 1F9BA 3H03A 2HXRA 4YB7A 1N7XA 4FEDA 4I1DA 1CNQA 4L17A 2ZYMA 3H6VA 4PFYA 1JVXA 1R1NA 3H3GA 4JDFA 3VVFA 4IY6A 2VP1A 4EXKA 2HXWA 3W9WA 3IORA 4EQ7A 1NNTA 5FHMA 4NAPA 1II5A 4XKRA 3G3FA 3E79A 3O29A 2A5TA 3I6VA 1XOCA 1NV7A 1LB9A 3MAMA 3U8QA 3TCFA 1EU8A 3QK6A 3V8XB 4NHBA 3ONMA 3Q29A 2UVIA 2XXWA 2H4IA 5JEIA 5DT6A 2A5SA 1IUDA 3MWBA 5I2KB 1US4A 2MKZA 2OPEA 4KFQA 1BK4A 4DLDA 3T93B 4WEPA 1Z7NE 1DSNA 2PT1A 2ZZXA 5I58A 5IM2A 1QGXA 3EKIA 2DYXA 3RPWA 3VVDA 1O63A 4JXIA 3H6UA 5CBRA 5IGAA 4G77A 2CEYA 1B5JA 4H65A 1P99A 1NV4A 2ONSA 4OVRA 4R72A 4BDRA 1FBPA 1A8FA 4ESXA 4G61A 1B7UA 1XVXA 1NV0A 5TP9B 3FXUA 3OEMA 1B40A 2IA4A 4YKIA 1ANFA 4GOTA 1LBBA 4MIJA 2X26A 5EQ8A 1B7ZA 4NMYA 1TXFA 2RC7A 5KCJB 3O28A 4HE2A 1OVBA 4OVPA 4KD5A 4LATA 2X7PA 3RGYA 3JZJA 3MVXA 3OO7A 3TUSA 3VE1B 3IB2A 1NKXA 4RJZA 2DWJA 2Y5LA 3KBZA 1LCTA 5H8QB 3TTMA 1M5CA 1LAXA 4OHNA 3CI8A 4NF4A 1OQGA 4GVOA 3RN8A 3HSTA 3PPOA 4PAFA 2XWIA 2ZYOA 3ZS6A 3IR1A 1LSTA 2DE3A 4NF8A 4PTKA 3T66A 3H7MA 3FIRA 2FIEA 4GX3A 4G8HA 4F3GA 3C33A 2H25A 3KG2A 5B7DA 3D4CA 1LGBC 1FQAA 5L9MA 5B70A 1LEVA 4ZE9A 2DS9A 2CEXA 1Y1ZA 3C31A 4YMAA 3MPKA 1B3GA 3DP6A 2NVUB 3QXMA 1JP4A 3K6XA 4GX6A 5AA3A 4PP0A 1USYE 4OFJA 1NMUA 3K4UA 2ZYNA 2ZNTA 1MY0A 4QFOA 2XWOA 2Z8FA 3DM0A 1NV3A 2QS4A 3V5AA 2AYSA 3FVKA 4NF5B 2FHYA 1BTJA 3C35A 3PUYE 2F6GA 1SBPA 1Y9UA 4NWCA 3LSXA 4F3BA 1YTVA 1IITA 1B2HA 4MNPA 1NNKA 1D4NA 4X04A 1POY1 1Y3QA 2WYKA 4DXUA 2PFZA 2V3TA 1EH3A 4AQ4A 4ZEKA 5I59B 1SYIA 2DE4A 1TFAA 4FORA 3FJMA 1TWYA 1N04A 4O3BA 4P9KA 3N5LA 4IO2A 5TPAA 4THIA 1FCKA 1NI9A 2XXIA 3EQ1A 4PE3A 4MAGA 4G68B 3CSGA 2Q74A 4Q0CA 1NUZA 3B6WA 2OCUA 3LSFB 1PB8A 2ZXTA 1NNPA 1Y1MA 4IB2A 2XX7A 2XD2A 4OTEA 4QBAA 5HM4B 5I57A 1H43A 3LUYA 4R2BA 2ONKE 4NF0A 4O3AA 4PC9A 2OWZA 4NG7A 5EYHA 1ATGA 4RPNA 2REGA 2Y7PA 1LB8A 4GWXA 3E3KA 3PUWE 3GYYA 5EHMA 4EDPA 1YAEA 2QMWA 3DELB 3EHTA 1MY3A 4Z7EA 1XC1A 4ELRA 4LONB 2FA7A 4IO5A 4BDMA 4NGUA 2UXAA 4MLQA 3MJNA 1Y20A 2PMSA 1ZIUA 4WEDA 3CFLA 3L6HA 4OFLA 5CRYA 3THIA 1B3EA 1G0HA 1DBZA 4LVQA 2V3UA 3N94A 5H8FA 3B8BA 2HPGA 3U72A 4IO4A 1FBGA 2QMXA 3CFZA 1FPEA 4TQUQ 4XFEA 3T9UA 3RPLA 3T1BA 4QSDA 2NWJA 5I2KA 1B3FA 4OVSA 4DIGA 4PFWA 3MZ1A 4NX1A 4KYEA 1IMDA 2ZZWA 2OX3A 2PFYA 5J1DA 1VFDA 4O7IA 1MPDA 2PCRA 3DP4A 5L8DA 4NE4A 2UYFA 4X8RA 3KJTA 2BJIA 4JB7A 1T0KA 3TTNA 3PPRA 4MBPA 4GWZA 4MNCA 1MQDA 2DVZA 1AWBA 4F3PA 4PFRA 5TP9A 1AOVA 3PV0E 3E4RA 3L6GA 1MG1A 3C9HA 5F7VA 3G3HA 2VD2A 4OVQA 3D1RA 5TU0A 5KCJA 3Q28A 5EQ7A 3TKDA 4IR8A 4O8MA 4RA1A 3O2AA 1G0IA 1NV2A 2O7IA 2I6EA 1FTOA 1VR5A 1B52A 5LOMA 1IXCA 1QUIA 4KYDA 4LQ5A 1SW2A 4C1TA 4KCDA 5H8QA 4ELOA 5AA2A 3MVZA 3RYDA 1B5IA 2Q8MA 2BJJX 3TELA 4HCYA 1I6QA 2AL4A 4WXJA 2REJA 4MX6A 3UGWA 5ELVA 3LSWA 3RNNA 4LZ7A 4FIMA 1P1UA 3GZGA 5FTIA 2B4MA 1FRPA 2O51A 3PGFA 3S4UA 1IEJA 3KN3A 1XT8A 1H76A 2R6GE 4JVIA 4P1EA 1H45A 5KDTB 4N13A 3PD9A 3A09A 4EXLA 3MSTA 4OZ9A 3ILUB 2VD3A 2FIXA 1PBQA 4G8NA 2XHDA 4QSEA 4IY5A 4U23A 3KSJA 4YICA 4X1BA 2RC9A 2R71A 4FBPA 4XXUA 3PMVA 1IMCA 1FBDA 5TPAB 1MDP1 3VVEA 1EYKA 4GWWA 1P1OA 3HHGA 4U1ZA 3TQLA 3GLBA 3LBSA 2G29A 2F6PA 1QKBA 3R6UA 3HHFA 3KC1A 5I59A 1FQCA 5DEXB 1DTGA 3SZPA 1M5EA 2DQVA 1IZ1A 2B4LA 3PUVE 1SPIA 1XI6A 3OSQA 1MY2A 1NV6A 3S9MC 3PUXE 2VOZA 2VPNA 3KN8A 4Q5TA 1MQIA 5I56B 1IMEA 5CMCA 4H45A 5FHNA 3IJXB 3KOSA 4O94A 3HN0A 3G3KA 4F2QA 1QW0A 1VDWA 1LAHE 4H0WA 3ZKLA 2HQ0A 3TYHA 2FVZA 2DDKA 3N6UA 4N8YA 2FNCA 2XXRA 1JW4A 1PC3A 4ECFA 1AIVA 1NH7A 1DOTA 3MP8A 4MHFA 2I0CA 3SEVA 2I58A 3O97A 2DWAA 1ZU0A 3FXRA 1PDAA 2GHAA 3IX1A 3S9EA 1TFDA 5H8FB 4ZEIA 4ZS9A 3A29A 4PQJA 1LBXA 2V4CA 1BLFA 2F34A 1RYXA 2HAUA 1EZPA 2WX9A 2D5WA 3VLWA 1B51A 3TODA 4EQ9A 3BIGA 4P0IA 3RPLB 3UN6A 4I3YA 1D9VA 2R9JA 3RT6B 1FW0A 1KWHA 4H46A 5A5LA 3RUMA 3QSLA 3T9VA 1LAGE 2XXTA 4DXCA 3CG3A 3T9HB 1NV5A 1SW4A 1PBPA 4GX4A 4FEBA 1BP5A 4MLVA 2F8DA 4GWYA 4HCWA 5FTHA 1BIYA 4KR5A 4PAKA 3SEXA 1RDYA 4JVDA 3TCHA 3FATA 4LUBA 3OENA 1INPA 1GGGA 1MXXA 3QUJA 4JWOA 4U21A 1Y3PA 4I62A 4FE8A 3K1PA 4XF5A 2Y7KA 1R9QA 2D3IA 1MM6A 2W7YA 1YYZA 2F3DA 4JSDA 3M8UA 4U2RA 1MS7A 4QFLA 4I9DA 2E0SA 4RK9A 1B0LA 3KN7A 3E9XA 1WVJA 3IFAA 2XWVA 3BBRA 1QULA 3OEKA 5LTCA 3B6TA 4E0XA 1B1HA 2QL3A 3C34A 4WKMA 1B9JA 3O9PA 5H8HA 4KCCA 1UTHB 5AA2B 4LA9A 3KSXA 3UK4A 4R73A 4F19A 5EYFA 1GVCA 2M8CA 1M5BA 3MQ9A 2Y7RA 3CIJA 4BDOA 4X1DA 1AH5A 3TTKA 3W15C 2OWSA 1LLSA 5H8SA 1N3WA 2VPOA 2QVRA 5ET5A 4RK2A 1FJ6A 1Z7ME 3N26A 3SEWA 5HBCA 4UABA 1MQHA 1NUXA 1O7TA 3EPEA 1O64A 4G2ZA 4MJOA 3LV0A 4N6PA 2G93A 4ZECA 2ZNUA 1XVYA 4R6HA 2XA5A 1I6AA 2UVJA 2XXUA 2DP8A 2HFBA 4XKNA 1SI0A 1DCUA 1IMBA 3OO9A 3R7XA 5KDTA 2B3FA 3P7IA 3ILTB 3V89B 4PGPA 1HSLA 1FBCA 2HZKA 4F29A 2Y5KA 1SDXA 2X7QA 2DSFA 3FVOA 3IOUA 3A3CA 1UQWA 3H06B 5K2XA 4R75A 2QS2A 1ZMGA 2ZMBA 4Z0IA 4OETA 3ROJA 4N6KA 2Z22A 4ZE8A 4H5FA 1KZ8A 1MXWA 2YPNA 1AL3A 5HPQA 1DMBA 1FQFA 3U94A 2NOOA 2HEUA 2OJTA 5CC2A 2V93A 4P0GA 1I6BA 2P0SA 3PPNA 5IAIA 2OK2A 5DEXA 4E0WA 2CZLA 3O6GA 3T0JA 3VFJA 5EHSA 2VT5A 1A99A 3K6VA 2HCAA 2F5XA 3SDFA 3VDFA 3IO4A 3WAEA 3MBPA 3TDJA 3KGCA 4U4XA 3PUZE 1K9YA 2I0BA 1HSEA 4ZDMA 5I56A 1OMPA 3PPQA 3TMGA 4JWXA 2F3BA 2L5VA 3TAJA 1ZTYA 1VSOA 2ZNSA 2PT2A 4AB6A 1D9QA 1Q1KA 1S7YA 2ZYKA 4DCXA 4HW8A 3UORA 2UYEA 3G3JA 2I49A 4H67A 3IOVA 2JJKA 1MH4A 3MZBA 1FTAA 3SEYA 4MEVA 4MFIA 3IK6B 1N76A 3QMFA 4NTLA 3TTLA 3K1MA 3K6WA 3OOAA 5IZZA 2XXHA 5L9OA 4GIZA 5M2VA 4YB6A 4GWOA 2DOJA 3MZ9A 4NQ8A 3MW0A 2ANJA 4HE0A 3MVWA 1PB9A 4P1LA 4MMPA 5FHOA 3T22A 3FJ7A 3VXCA 2H99A 4HTGA 4IO7A 4QHQA 4YZZA 5KZTA 5ET7A 2HZLA 3UIFA 4H1XA 4LP2B 1SW1A 2F7BA 3FV2A 2CZHA 2XXYA 2Q2AA 5ISUA 3R26A 1H3DA 5ET8A 4MNIA 1D9YA
chains in the Genus database with same CATH topology
3SZPA 1FJ9A 4AS4A 2B4LA 4MIJA 2CZIA 1SPIA 1XI6A 5EQ8A 3MYUA 3U65A 5J16A 4HE2A 4OVPA 5EQAA 1NV6A 4N81A 4HXVA 4OANA 2GQ1A 2VPNA 1IMEA 4PDDA 4H45A 4O94A 1VDWA 2Y5LA 3KBZA 2QVVA 2FVZA 2DDKA 4N8YA 4PAFA 2XWIA 4MHFA 5ESYA 2DE3A 4PTKA 2WEFA 4PF6A 2FIEA 4GX3A 2DE2A 3A29A 1LBXA 2V4CA 1YZ0A 5I3SA 2WX9A 4XEQA 1LEVA 1FSAA 3BIGA 2CEXA 3RPLB 2P3NA 4I3YA 4GBWA 1JP4A 1EYIA 4GX6A 1FPJA 4H46A 1KA0A 5A5LA 1LBYA 1NV5A 3LUZA 4GX4A 2XWOA 1NV3A 4N91A 5ET6A 2FHYA 1EYJA 4JVCA 4GWYA 4HCWA 4PAKA 1RDYA 5FBPA 4MNPA 4PDHA 4JVDA 4AS5A 3FXBA 4X04A 1INPA 2WYKA 2PFZA 1FPBA 2V3QA 4I40A 3CHGA 4XF5A 2DE4A 1YYZA 2P3VA 3KC0A 4P9KA 2F3DA 4X9TA 1NI9A 2HHMA 4PE3A 4MAGA 2Q74A 1YXIA 1NUZA 3IFAA 2XWVA 2R8TA 2Q9TA 2XWKA 5LTCA 2QVUA 5JK4A 4N6DA 1FPGA 3B50A 4QBAA 4PF8A 1LBWA 4NF0A 2ZZVA 4PC9A 2OWZA 4F19A 4NG7A 2WBDA 3E78A 5EYHA 4GWXA 2XXKA 4N4UA 5CM6A 3GYYA 3W9VA 1NUYA 5IZ1A 5IZ3A 2VPOA 2QVRA 4NGUA 4LN5A 5ET5A 2WBBA 4N17A 1FJ6A 4O7MA 3HFUA 4M1VA 3PTYA 4UABA 1NUXA 1G0HA 1DBZA 4MJOA 4PBHA 3LV0A 2KQZA 1FPLA 2XA5A 3B8BA 2HPGA 3FBPA 4PBQA 1FBGA 2FBPA 1FBHA 1FPEA 3BIHA 4XFEA 2CZKA 1RDZA 4PETA 1DCUA 3NOHA 4N8GA 3RPLA 1IMBA 3T1BA 2WYPA 4PGPA 1FBCA 4F1VA 4GWSA 4OVSA 1RDXA 5LDZA 2HZKA 2Y5KA 4OA4A 4F18A 4NX1A 4PFBA 1IMDA 2ZZWA 2OX3A 4GWUA 2PFYA 5J1DA 1NUWA 4O7IA 2PCRA 3ROJA 4N6KA 1DK4A 4N15A 2QFLA 4X8RA 1KZ8A 2BJIA 1FBEA 4P8BA 4GWZA 4HE1A 1FBFA 4MNCA 2DVZA 1AWBA 4P47A 4PFRA 1LBVA 4I3EA 4P3LA 5DW8A 4DI3D 1NV1A 4PGNA 3T0JA 1IMAA 5I5PA 4OVQA 2VT5A 3D1RA 4DI4B 1Q9DA 1FPKA 5EQ7A 2F5XA 4F1UA 4P56A 4IR8A 4OVTA 4O8MA 4NN3A 1K9YA 1G0IA 1NV2A 1FPIA 2F3BA 4QXDA 3ISPA 2L5VA 5I7IA 4PCDA 5IZ3B 2QPQA 3RYDA 2KR0A 1D9QA 2Q8MA 2HXRA 4HCYA 1FPFA 5EQ9A 1CNQA 4MX6A 1IMFA 2JJKA 4KXPA 1FTAA 3W9WA 4MEVA 2B4MA 1FRPA 4NAPA 3QMFA 3E79A 1KA1A 4MCOA 4PFIA 1NV7A 5IZZA 4NHBA 4JVIA 4PAIA 4P1EA 1K9ZA 4NQ8A 2MKZA 3MSTA 1BK4A 2FIXA 1FPDA 4HE0A 5EYGA 4P1LA 1LBZA 4MMPA 4YICA 2ZZXA 5IM2A 1QGXA 3IFCA 3EKIA 4FBPA 5F24A 4YZZA 1IMCA 1FBDA 5IGAA 2CEYA 5ET7A 4GBVA 2HZLA 1NV4A 1EYKA 4GWWA 4OVRA 1FBPA 2CZHA 5T3JA 4G61A 1NV0A 5ET8A 3KC1A 4MNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYJ A;  1FPI A;  1NUX A;  4GWY A;  1FJ9 A;  2F3B A;  1G0H A;  4AS4 A;  1DBZ A;  4MJO A;  3LV0 A;  2CZI A;  1SPI A;  1XI6 A;  5EQ8 A;  4QXD A;  1RDY A;  5FBP A;  5J16 A;  5IZ3 B;  4HE2 A;  1FPL A;  5EQA A;  4AS5 A;  3B8B A;  1NV6 A;  4N81 A;  3RYD A;  1INP A;  1D9Q A;  3FBP A;  4HXV A;  2Q8M A;  1FBG A;  2FBP A;  2GQ1 A;  1FPB A;  4I40 A;  1FPF A;  5EQ9 A;  1FBH A;  1FPE A;  3BIH A;  1IME A;  2CZK A;  1CNQ A;  4H45 A;  1RDZ A;  1DCU A;  1IMF A;  2JJK A;  1YYZ A;  2P3V A;  3KC0 A;  3RPL A;  1IMB A;  1VDW A;  4KXP A;  2F3D A;  1FTA A;  2Y5L A;  3KBZ A;  2QVV A;  1FBC A;  2FVZ A;  2DDK A;  1NI9 A;  1FRP A;  4GWS A;  1RDX A;  3QMF A;  2HHM A;  5LDZ A;  2Y5K A;  1KA1 A;  2Q74 A;  1NV7 A;  1YXI A;  1NUZ A;  3IFA A;  2R8T A;  1IMD A;  2OX3 A;  4GWU A;  2QVU A;  5ESY A;  1NUW A;  4O7I A;  2PCR A;  4PTK A;  3ROJ A;  1K9Z A;  2WEF A;  1FPG A;  1DK4 A;  2QFL A;  1KZ8 A;  2FIE A;  4GX3 A;  2BJI A;  1BK4 A;  2FIX A;  1FBE A;  3A29 A;  1FPD A;  4HE0 A;  1LBX A;  5EYG A;  1YZ0 A;  1LBW A;  4GWZ A;  4HE1 A;  1FBF A;  1LBZ A;  5I3S A;  2OWZ A;  1AWB A;  1QGX A;  2WBD A;  3IFC A;  4FBP A;  5EYH A;  1LBV A;  5F24 A;  1LEV A;  1FSA A;  3BIG A;  3RPL B;  4I3E A;  4GWX A;  1IMC A;  1FBD A;  2P3N A;  4I3Y A;  5ET7 A;  5DW8 A;  4GBV A;  1NUY A;  1NV1 A;  1NV4 A;  1EYK A;  1IMA A;  4GWW A;  4GBW A;  3T0J A;  5IZ1 A;  1FBP A;  2CZH A;  1JP4 A;  2VT5 A;  1EYI A;  3D1R A;  4GX6 A;  1FPJ A;  1Q9D A;  4H46 A;  5T3J A;  1KA0 A;  5A5L A;  5IZ3 A;  4G61 A;  1FPK A;  5EQ7 A;  1LBY A;  4IR8 A;  1NV0 A;  2QVR A;  5ET5 A;  1NV5 A;  2WBB A;  3LUZ A;  4GX4 A;  1FJ6 A;  3KC1 A;  5ET8 A;  1K9Y A;  1NV3 A;  1G0I A;  5ET6 A;  1NV2 A;  2FHY A; 
#chains in the Genus database with same CATH topology
 1JW5 A;  4BLA A;  1FJ9 A;  1JVY A;  1QUJ A;  3T9X B;  2CZI A;  3U65 A;  1QJM A;  4JBZ A;  5H8H B;  3ZSF A;  1B3H A;  5J16 A;  4OMB A;  3OMB A;  4Q30 B;  1EZO A;  5EQA A;  5AE4 A;  4OAN A;  1JW1 A;  3OD7 A;  1S9T A;  4GFR A;  1GTK A;  1WDN A;  3M3F A;  2NUV A;  4OER A;  4R2F A;  3QYT A;  1US5 A;  1A8E A;  3EN3 A;  2QVV A;  5IKB A;  3FGS A;  4X48 A;  4EQB A;  1UTH A;  4XIG Q;  1QUK A;  3H6W A;  3WAF A;  1B4Z A;  4OWD A;  3FXQ A;  3CSB A;  2WEF A;  4IGR A;  3MP1 A;  1S50 A;  2H98 A;  4PF6 A;  4ELP A;  3O6I A;  2XXX A;  1YZ0 A;  2DXR A;  1LFG A;  2Z8D A;  4IO6 A;  3FVG A;  2VGQ A;  4XEQ A;  4EUO A;  4FAT A;  2RF1 A;  4YAH X;  2VHA A;  2P3N A;  1ZLQ A;  2O7U A;  4H8I A;  4GBW A;  3FAS A;  4EF2 A;  1H44 A;  4R6K A;  1FQD A;  1LBY A;  1N0T A;  4DDD A;  3TTR A;  1FQE A;  2QRY A;  4QFK A;  1POT A;  3PMX A;  4QF9 A;  1OLC A;  4JVC A;  4TOZ A;  3PPP A;  1IXI A;  4QSC A;  2XX8 A;  3ECR A;  4PDH A;  3Q25 A;  2IEE A;  3IB1 A;  1MY1 A;  2PX1 A;  4AS5 A;  2RC8 A;  3CRB A;  3U1O A;  3FUZ A;  3QAX A;  4OEV A;  2V3Q A;  4I40 A;  1B0H A;  1B7H A;  3RQT A;  2Y7I A;  3G3I A;  5BUU A;  3BFT A;  3CR9 A;  1MH3 A;  5ITO A;  4X9T A;  5AA4 B;  1LFH A;  4KI0 E;  3C36 A;  5ICQ A;  2UVG A;  1YXI A;  3IB0 A;  4C0R A;  1JNF A;  2OWT A;  1MXY A;  3IOT A;  2XWK A;  2QVU A;  2F97 A;  3TEP A;  3I5O A;  3RT8 A;  3E13 X;  3O66 A;  4N6D A;  3OEL A;  1FPG A;  4F1Y A;  1GR2 A;  4BDN A;  3LSL A;  3G7W A;  4PF8 A;  3SER A;  1I69 A;  1LBW A;  5CMB A;  2ZZV A;  3EF7 A;  2I3V A;  2WBD A;  3OXN A;  4O3C A;  3H4Z A;  1VFE A;  2XXK A;  2FYI A;  3GBB A;  4G68 C;  4N4U A;  1OIB A;  5CM6 A;  2WKY A;  1OVT A;  3W9V A;  3VXB A;  5IZ1 A;  1A40 A;  4DZ1 A;  3KJ7 A;  3I3V A;  4UAC A;  3T96 B;  1MXU A;  4GLI A;  3HFU A;  3EHU A;  3AXF A;  3FV1 A;  4ZEF A;  1UIV A;  3EHS A;  2KQZ A;  3FVN A;  2O84 X;  1FQB A;  3HO7 A;  3UA8 A;  1FPL A;  2F78 A;  2GRV A;  5A5X B;  3OSR A;  3FBP A;  2FBP A;  1URD A;  4M4G A;  1FBH A;  3BIH A;  4LZ5 A;  3KOT A;  1A54 A;  1RDZ A;  4PET A;  5H8N B;  3NOH A;  1AMF A;  4OES A;  2XXV A;  4GD5 A;  3VV5 A;  1B3L A;  1SI1 A;  4OXV A;  2V84 A;  4GWS A;  5LDZ A;  1B1X A;  3VLU A;  4GRK A;  4OA4 A;  1QVS A;  4GQO A;  4ZED A;  5I2N B;  4OQO A;  4RYA A;  3ODB A;  5CMK A;  2H9B A;  2QFL A;  4I8C A;  1N7W A;  1FBE A;  1FTJ A;  4P8B A;  1SD3 A;  4HE1 A;  4QFP A;  1FBF A;  4ZEB A;  3KFM A;  2DWI A;  2O68 A;  4P47 A;  4YU0 A;  1NH8 A;  3HV1 A;  4UA8 A;  4F22 A;  3SES A;  5I84 A;  1NFT A;  3SKP A;  4I3E A;  4GL0 A;  4OYV A;  4P3L A;  5DW8 A;  2O69 A;  2XXP A;  4MH5 A;  3KBR A;  1NV1 A;  4YKJ A;  1J1N A;  2CMO A;  4PGN A;  1Y4C A;  5I5P A;  3TZA A;  3HPI A;  1Q9D A;  4POX A;  4F2O A;  2B3B A;  3A3U A;  1LAF E;  1FPK A;  4F1U A;  4P56 A;  4OVT A;  4NN3 A;  2Z8E A;  1FTK A;  1B46 A;  5DTB A;  3IAZ A;  1WOD A;  1SQY A;  3N6T A;  4IO3 A;  4KHZ E;  4NF6 B;  1FPI A;  1D3K A;  3CFX A;  3M3K A;  3KEI A;  3RLF E;  4OEU A;  2O1M A;  4QXD A;  5I7I A;  4KQP A;  4TLM B;  4RPO A;  1VE4 A;  5IZ3 B;  2GH9 A;  4RNS A;  2QPQ A;  2E1S A;  4ISU A;  2XXQ A;  2KR0 A;  2OLB A;  3K6U A;  1N84 A;  3K00 A;  1FPF A;  5EQ9 A;  1YPN A;  3KZG A;  1B6H A;  3S9L C;  1IMF A;  2DXY A;  4KXP A;  3PD8 A;  4F3S A;  1ZJL A;  4PFT A;  2QS3 A;  1M5F A;  4GXS B;  1LCF A;  3TCG A;  3LR1 A;  1KA1 A;  4MCO A;  4PFI A;  2B65 A;  2XD3 A;  4PAI A;  3VLV A;  3CVG A;  5BWJ A;  5JTY A;  4OFO A;  1K9Z A;  1RYO A;  3MC2 A;  1PB7 A;  4MF3 A;  4GF8 A;  4ND9 A;  3RTF B;  1MQJ A;  3PMW A;  1FPD A;  4H8J A;  5EYG A;  5CMM A;  1LBZ A;  3C4M A;  2XX9 A;  4XKQ A;  3IFC A;  1LBC A;  1SVX B;  3Q27 A;  1Q35 A;  5F24 A;  1MQG A;  4YB5 A;  4P11 A;  1EZ9 A;  1RKM A;  3B7D A;  4GBV A;  2OBG A;  2D21 A;  1MM7 A;  5DYH A;  1CB6 A;  1ELJ A;  5DVJ A;  1B05 A;  5T3J A;  2QS1 A;  2RIN A;  4GXA A;  3UP9 A;  2ABH A;  1OLA A;  1UTB A;  1FTL A;  1A7L A;  1JET A;  4R9G A;  1IIW A;  4QFN A;  4AS4 A;  3MYU A;  3CG1 A;  5AA4 A;  4N81 A;  4U1O A;  4HXV A;  2GQ1 A;  4YKP A;  1Y3N A;  1IXH A;  3PU5 A;  4R6Y A;  4PDD A;  2OPD A;  1P1W A;  3USD A;  4EF1 A;  4H5G A;  2DWH A;  2PVU A;  1B5H A;  4QRZ A;  1R6Z A;  2RCA A;  3MVY A;  1PEB A;  3DP8 A;  2ALU A;  5ESY A;  2RCB A;  2HAV A;  3K1N A;  3S9N C;  4LZ8 A;  4XTC Q;  3RY3 A;  2DE2 A;  3MP6 A;  1B58 A;  2F36 A;  2NXO A;  2A5T B;  5I3S A;  3OO8 A;  4KYS A;  1DPP A;  1USY H;  5AA2 D;  3C32 A;  1QKA A;  1XHY A;  3D4G A;  1FSA A;  1XS5 A;  2P2A A;  4YKK A;  1IXG A;  1EYI A;  5DVF A;  1FPJ A;  1MDQ A;  3LC8 A;  1KA0 A;  3K01 A;  3IOW A;  4DXB A;  5I58 B;  4N07 A;  5A5X A;  1R9L A;  4RY1 A;  1HSJ A;  4G8M A;  3LUZ A;  4ONY A;  1CE2 A;  4N91 A;  5ET6 A;  1A55 A;  2Q88 A;  1EYJ A;  2KLF A;  5H8N A;  3QUF A;  1NL5 A;  3ZKK A;  1NNF A;  5FBP A;  2Y7W A;  4H6D A;  1B4H A;  3FXB A;  3G3G A;  3U93 A;  5I2N A;  1FPB A;  3BKI B;  3CHG A;  4NWD A;  2Q2C A;  3F11 A;  3B6Q A;  3GXA A;  4BDL A;  3V83 A;  2O1L A;  2P3V A;  3KC0 A;  2ESN A;  4C1U A;  1JEU A;  5CBS A;  2F7C A;  4POW A;  3FZV A;  4U4S A;  2F35 A;  2QJE A;  1P1N A;  2HHM A;  2V25 A;  4ZZA A;  2QSX A;  2F7A A;  4PE5 B;  5K2Y A;  2PYY A;  2UVH A;  2R8T A;  2Q9T A;  3IL1 B;  4FJP A;  3H6T A;  4FAJ A;  2I4B A;  1MY4 A;  5JK4 A;  4HS7 A;  1M5D A;  3B50 A;  1JQF A;  5ICT A;  3JYR A;  4NF4 B;  1URG A;  4PFU A;  3E78 A;  4NF8 B;  1L5T A;  2OZZ A;  4NF6 A;  1MXV A;  4BDQ A;  4ESW A;  2I48 A;  1NUY A;  4LQ2 A;  1FTM A;  2YLN A;  4JSO A;  3GBA A;  5IZ3 A;  1OQH A;  3MPL A;  4NED A;  4DCY A;  4LN5 A;  2WBB A;  2Q8J A;  3O6H A;  4N17 A;  3S2V A;  4O7M A;  1DPE A;  4M1V A;  1LFI A;  4KPT A;  3PTY A;  5JTY B;  3TFL A;  4F39 A;  4OEN A;  1JEV A;  4PBH A;  4G4P A;  2GFE A;  3Q26 A;  2Y84 A;  2I3W A;  4PBQ A;  4K3F A;  4OVJ A;  2CZK A;  3TQW A;  1MPC A;  4JWY A;  4N8G A;  2I4C A;  2WYP A;  2LAO A;  3U92 A;  1BKA A;  1YCJ A;  2Z23 A;  4F1V A;  1RDX A;  1P1Q A;  3K2D A;  2AIX A;  1UTB B;  1N3X A;  3K02 A;  5F1Q A;  4F18 A;  1DTZ A;  3M3L A;  4PFB A;  1ZKB A;  4GWU A;  1NUW A;  4NF5 A;  3K0V A;  2ONR A;  2H5Y A;  1DK4 A;  4N15 A;  2DVC A;  4RXL A;  4XKP A;  1MXZ A;  2YJP A;  2P1S A;  2O6A A;  3SET A;  5CI5 A;  3RTW B;  3DLN A;  1TT1 A;  4IGT A;  4ELQ A;  1MPB A;  3FD3 A;  4R9F A;  1URS A;  4Q8R A;  1Y4T A;  1LBV A;  5ITP A;  3BFU A;  3IO6 A;  3TPA A;  4DI3 D;  1UIU A;  1IMA A;  5I57 B;  4DI4 B;  1GV8 A;  5AA1 A;  3MUQ A;  4F31 B;  2RKM A;  3FJG A;  3SEU A;  4AB5 A;  4G68 A;  3IJO B;  1B32 A;  1IQ7 A;  1SYH A;  2THI A;  4GL8 A;  4ZZE A;  4YMB A;  5L9S A;  4U22 A;  2AL5 A;  5DVI A;  3OO6 A;  1SW5 A;  3JV9 A;  2PBW A;  3HCQ A;  1MRP A;  3QIM A;  3ISP A;  2GHB A;  1ZBM A;  4TLL B;  2Q89 A;  4PCD A;  4DE8 A;  4FEC A;  4R74 A;  1F9B A;  3H03 A;  2HXR A;  4YB7 A;  1N7X A;  4FED A;  4I1D A;  1CNQ A;  4L17 A;  2ZYM A;  3H6V A;  4PFY A;  1JVX A;  1R1N A;  3H3G A;  4JDF A;  3VVF A;  4IY6 A;  2VP1 A;  4EXK A;  2HXW A;  3W9W A;  3IOR A;  4EQ7 A;  1NNT A;  5FHM A;  4NAP A;  1II5 A;  4XKR A;  3G3F A;  3E79 A;  3O29 A;  2A5T A;  3I6V A;  1XOC A;  1NV7 A;  1LB9 A;  3MAM A;  3U8Q A;  3TCF A;  1EU8 A;  3QK6 A;  3V8X B;  4NHB A;  3ONM A;  3Q29 A;  2UVI A;  2XXW A;  2H4I A;  5JEI A;  5DT6 A;  2A5S A;  1IUD A;  3MWB A;  5I2K B;  1US4 A;  2MKZ A;  2OPE A;  4KFQ A;  1BK4 A;  4DLD A;  3T93 B;  4WEP A;  1Z7N E;  1DSN A;  2PT1 A;  2ZZX A;  5I58 A;  5IM2 A;  1QGX A;  3EKI A;  2DYX A;  3RPW A;  3VVD A;  1O63 A;  4JXI A;  3H6U A;  5CBR A;  5IGA A;  4G77 A;  2CEY A;  1B5J A;  4H65 A;  1P99 A;  1NV4 A;  2ONS A;  4OVR A;  4R72 A;  4BDR A;  1FBP A;  1A8F A;  4ESX A;  4G61 A;  1B7U A;  1XVX A;  1NV0 A;  5TP9 B;  3FXU A;  3OEM A;  1B40 A;  2IA4 A;  4YKI A;  1ANF A;  4GOT A;  1LBB A;  4MIJ A;  2X26 A;  5EQ8 A;  1B7Z A;  4NMY A;  1TXF A;  2RC7 A;  5KCJ B;  3O28 A;  4HE2 A;  1OVB A;  4OVP A;  4KD5 A;  4LAT A;  2X7P A;  3RGY A;  3JZJ A;  3MVX A;  3OO7 A;  3TUS A;  3VE1 B;  3IB2 A;  1NKX A;  4RJZ A;  2DWJ A;  2Y5L A;  3KBZ A;  1LCT A;  5H8Q B;  3TTM A;  1M5C A;  1LAX A;  4OHN A;  3CI8 A;  4NF4 A;  1OQG A;  4GVO A;  3RN8 A;  3HST A;  3PPO A;  4PAF A;  2XWI A;  2ZYO A;  3ZS6 A;  3IR1 A;  1LST A;  2DE3 A;  4NF8 A;  4PTK A;  3T66 A;  3H7M A;  3FIR A;  2FIE A;  4GX3 A;  4G8H A;  4F3G A;  3C33 A;  2H25 A;  3KG2 A;  5B7D A;  3D4C A;  1LGB C;  1FQA A;  5L9M A;  5B70 A;  1LEV A;  4ZE9 A;  2DS9 A;  2CEX A;  1Y1Z A;  3C31 A;  4YMA A;  3MPK A;  1B3G A;  3DP6 A;  2NVU B;  3QXM A;  1JP4 A;  3K6X A;  4GX6 A;  5AA3 A;  4PP0 A;  1USY E;  4OFJ A;  1NMU A;  3K4U A;  2ZYN A;  2ZNT A;  1MY0 A;  4QFO A;  2XWO A;  2Z8F A;  3DM0 A;  1NV3 A;  2QS4 A;  3V5A A;  2AYS A;  3FVK A;  4NF5 B;  2FHY A;  1BTJ A;  3C35 A;  3PUY E;  2F6G A;  1SBP A;  1Y9U A;  4NWC A;  3LSX A;  4F3B A;  1YTV A;  1IIT A;  1B2H A;  4MNP A;  1NNK A;  1D4N A;  4X04 A;  1POY 1;  1Y3Q A;  2WYK A;  4DXU A;  2PFZ A;  2V3T A;  1EH3 A;  4AQ4 A;  4ZEK A;  5I59 B;  1SYI A;  2DE4 A;  1TFA A;  4FOR A;  3FJM A;  1TWY A;  1N04 A;  4O3B A;  4P9K A;  3N5L A;  4IO2 A;  5TPA A;  4THI A;  1FCK A;  1NI9 A;  2XXI A;  3EQ1 A;  4PE3 A;  4MAG A;  4G68 B;  3CSG A;  2Q74 A;  4Q0C A;  1NUZ A;  3B6W A;  2OCU A;  3LSF B;  1PB8 A;  2ZXT A;  1NNP A;  1Y1M A;  4IB2 A;  2XX7 A;  2XD2 A;  4OTE A;  4QBA A;  5HM4 B;  5I57 A;  1H43 A;  3LUY A;  4R2B A;  2ONK E;  4NF0 A;  4O3A A;  4PC9 A;  2OWZ A;  4NG7 A;  5EYH A;  1ATG A;  4RPN A;  2REG A;  2Y7P A;  1LB8 A;  4GWX A;  3E3K A;  3PUW E;  3GYY A;  5EHM A;  4EDP A;  1YAE A;  2QMW A;  3DEL B;  3EHT A;  1MY3 A;  4Z7E A;  1XC1 A;  4ELR A;  4LON B;  2FA7 A;  4IO5 A;  4BDM A;  4NGU A;  2UXA A;  4MLQ A;  3MJN A;  1Y20 A;  2PMS A;  1ZIU A;  4WED A;  3CFL A;  3L6H A;  4OFL A;  5CRY A;  3THI A;  1B3E A;  1G0H A;  1DBZ A;  4LVQ A;  2V3U A;  3N94 A;  5H8F A;  3B8B A;  2HPG A;  3U72 A;  4IO4 A;  1FBG A;  2QMX A;  3CFZ A;  1FPE A;  4TQU Q;  4XFE A;  3T9U A;  3RPL A;  3T1B A;  4QSD A;  2NWJ A;  5I2K A;  1B3F A;  4OVS A;  4DIG A;  4PFW A;  3MZ1 A;  4NX1 A;  4KYE A;  1IMD A;  2ZZW A;  2OX3 A;  2PFY A;  5J1D A;  1VFD A;  4O7I A;  1MPD A;  2PCR A;  3DP4 A;  5L8D A;  4NE4 A;  2UYF A;  4X8R A;  3KJT A;  2BJI A;  4JB7 A;  1T0K A;  3TTN A;  3PPR A;  4MBP A;  4GWZ A;  4MNC A;  1MQD A;  2DVZ A;  1AWB A;  4F3P A;  4PFR A;  5TP9 A;  1AOV A;  3PV0 E;  3E4R A;  3L6G A;  1MG1 A;  3C9H A;  5F7V A;  3G3H A;  2VD2 A;  4OVQ A;  3D1R A;  5TU0 A;  5KCJ A;  3Q28 A;  5EQ7 A;  3TKD A;  4IR8 A;  4O8M A;  4RA1 A;  3O2A A;  1G0I A;  1NV2 A;  2O7I A;  2I6E A;  1FTO A;  1VR5 A;  1B52 A;  5LOM A;  1IXC A;  1QUI A;  4KYD A;  4LQ5 A;  1SW2 A;  4C1T A;  4KCD A;  5H8Q A;  4ELO A;  5AA2 A;  3MVZ A;  3RYD A;  1B5I A;  2Q8M A;  2BJJ X;  3TEL A;  4HCY A;  1I6Q A;  2AL4 A;  4WXJ A;  2REJ A;  4MX6 A;  3UGW A;  5ELV A;  3LSW A;  3RNN A;  4LZ7 A;  4FIM A;  1P1U A;  3GZG A;  5FTI A;  2B4M A;  1FRP A;  2O51 A;  3PGF A;  3S4U A;  1IEJ A;  3KN3 A;  1XT8 A;  1H76 A;  2R6G E;  4JVI A;  4P1E A;  1H45 A;  5KDT B;  4N13 A;  3PD9 A;  3A09 A;  4EXL A;  3MST A;  4OZ9 A;  3ILU B;  2VD3 A;  2FIX A;  1PBQ A;  4G8N A;  2XHD A;  4QSE A;  4IY5 A;  4U23 A;  3KSJ A;  4YIC A;  4X1B A;  2RC9 A;  2R71 A;  4FBP A;  4XXU A;  3PMV A;  1IMC A;  1FBD A;  5TPA B;  1MDP 1;  3VVE A;  1EYK A;  4GWW A;  1P1O A;  3HHG A;  4U1Z A;  3TQL A;  3GLB A;  3LBS A;  2G29 A;  2F6P A;  1QKB A;  3R6U A;  3HHF A;  3KC1 A;  5I59 A;  1FQC A;  5DEX B;  1DTG A;  3SZP A;  1M5E A;  2DQV A;  1IZ1 A;  2B4L A;  3PUV E;  1SPI A;  1XI6 A;  3OSQ A;  1MY2 A;  1NV6 A;  3S9M C;  3PUX E;  2VOZ A;  2VPN A;  3KN8 A;  4Q5T A;  1MQI A;  5I56 B;  1IME A;  5CMC A;  4H45 A;  5FHN A;  3IJX B;  3KOS A;  4O94 A;  3HN0 A;  3G3K A;  4F2Q A;  1QW0 A;  1VDW A;  1LAH E;  4H0W A;  3ZKL A;  2HQ0 A;  3TYH A;  2FVZ A;  2DDK A;  3N6U A;  4N8Y A;  2FNC A;  2XXR A;  1JW4 A;  1PC3 A;  4ECF A;  1AIV A;  1NH7 A;  1DOT A;  3MP8 A;  4MHF A;  2I0C A;  3SEV A;  2I58 A;  3O97 A;  2DWA A;  1ZU0 A;  3FXR A;  1PDA A;  2GHA A;  3IX1 A;  3S9E A;  1TFD A;  5H8F B;  4ZEI A;  4ZS9 A;  3A29 A;  4PQJ A;  1LBX A;  2V4C A;  1BLF A;  2F34 A;  1RYX A;  2HAU A;  1EZP A;  2WX9 A;  2D5W A;  3VLW A;  1B51 A;  3TOD A;  4EQ9 A;  3BIG A;  4P0I A;  3RPL B;  3UN6 A;  4I3Y A;  1D9V A;  2R9J A;  3RT6 B;  1FW0 A;  1KWH A;  4H46 A;  5A5L A;  3RUM A;  3QSL A;  3T9V A;  1LAG E;  2XXT A;  4DXC A;  3CG3 A;  3T9H B;  1NV5 A;  1SW4 A;  1PBP A;  4GX4 A;  4FEB A;  1BP5 A;  4MLV A;  2F8D A;  4GWY A;  4HCW A;  5FTH A;  1BIY A;  4KR5 A;  4PAK A;  3SEX A;  1RDY A;  4JVD A;  3TCH A;  3FAT A;  4LUB A;  3OEN A;  1INP A;  1GGG A;  1MXX A;  3QUJ A;  4JWO A;  4U21 A;  1Y3P A;  4I62 A;  4FE8 A;  3K1P A;  4XF5 A;  2Y7K A;  1R9Q A;  2D3I A;  1MM6 A;  2W7Y A;  1YYZ A;  2F3D A;  4JSD A;  3M8U A;  4U2R A;  1MS7 A;  4QFL A;  4I9D A;  2E0S A;  4RK9 A;  1B0L A;  3KN7 A;  3E9X A;  1WVJ A;  3IFA A;  2XWV A;  3BBR A;  1QUL A;  3OEK A;  5LTC A;  3B6T A;  4E0X A;  1B1H A;  2QL3 A;  3C34 A;  4WKM A;  1B9J A;  3O9P A;  5H8H A;  4KCC A;  1UTH B;  5AA2 B;  4LA9 A;  3KSX A;  3UK4 A;  4R73 A;  4F19 A;  5EYF A;  1GVC A;  2M8C A;  1M5B A;  3MQ9 A;  2Y7R A;  3CIJ A;  4BDO A;  4X1D A;  1AH5 A;  3TTK A;  3W15 C;  2OWS A;  1LLS A;  5H8S A;  1N3W A;  2VPO A;  2QVR A;  5ET5 A;  4RK2 A;  1FJ6 A;  1Z7M E;  3N26 A;  3SEW A;  5HBC A;  4UAB A;  1MQH A;  1NUX A;  1O7T A;  3EPE A;  1O64 A;  4G2Z A;  4MJO A;  3LV0 A;  4N6P A;  2G93 A;  4ZEC A;  2ZNU A;  1XVY A;  4R6H A;  2XA5 A;  1I6A A;  2UVJ A;  2XXU A;  2DP8 A;  2HFB A;  4XKN A;  1SI0 A;  1DCU A;  1IMB A;  3OO9 A;  3R7X A;  5KDT A;  2B3F A;  3P7I A;  3ILT B;  3V89 B;  4PGP A;  1HSL A;  1FBC A;  2HZK A;  4F29 A;  2Y5K A;  1SDX A;  2X7Q A;  2DSF A;  3FVO A;  3IOU A;  3A3C A;  1UQW A;  3H06 B;  5K2X A;  4R75 A;  2QS2 A;  1ZMG A;  2ZMB A;  4Z0I A;  4OET A;  3ROJ A;  4N6K A;  2Z22 A;  4ZE8 A;  4H5F A;  1KZ8 A;  1MXW A;  2YPN A;  1AL3 A;  5HPQ A;  1DMB A;  1FQF A;  3U94 A;  2NOO A;  2HEU A;  2OJT A;  5CC2 A;  2V93 A;  4P0G A;  1I6B A;  2P0S A;  3PPN A;  5IAI A;  2OK2 A;  5DEX A;  4E0W A;  2CZL A;  3O6G A;  3T0J A;  3VFJ A;  5EHS A;  2VT5 A;  1A99 A;  3K6V A;  2HCA A;  2F5X A;  3SDF A;  3VDF A;  3IO4 A;  3WAE A;  3MBP A;  3TDJ A;  3KGC A;  4U4X A;  3PUZ E;  1K9Y A;  2I0B A;  1HSE A;  4ZDM A;  5I56 A;  1OMP A;  3PPQ A;  3TMG A;  4JWX A;  2F3B A;  2L5V A;  3TAJ A;  1ZTY A;  1VSO A;  2ZNS A;  2PT2 A;  4AB6 A;  1D9Q A;  1Q1K A;  1S7Y A;  2ZYK A;  4DCX A;  4HW8 A;  3UOR A;  2UYE A;  3G3J A;  2I49 A;  4H67 A;  3IOV A;  2JJK A;  1MH4 A;  3MZB A;  1FTA A;  3SEY A;  4MEV A;  4MFI A;  3IK6 B;  1N76 A;  3QMF A;  4NTL A;  3TTL A;  3K1M A;  3K6W A;  3OOA A;  5IZZ A;  2XXH A;  5L9O A;  4GIZ A;  5M2V A;  4YB6 A;  4GWO A;  2DOJ A;  3MZ9 A;  4NQ8 A;  3MW0 A;  2ANJ A;  4HE0 A;  3MVW A;  1PB9 A;  4P1L A;  4MMP A;  5FHO A;  3T22 A;  3FJ7 A;  3VXC A;  2H99 A;  4HTG A;  4IO7 A;  4QHQ A;  4YZZ A;  5KZT A;  5ET7 A;  2HZL A;  3UIF A;  4H1X A;  4LP2 B;  1SW1 A;  2F7B A;  3FV2 A;  2CZH A;  2XXY A;  2Q2A A;  5ISU A;  3R26 A;  1H3D A;  5ET8 A;  4MNI A;  1D9Y A; 
#chains in the Genus database with same CATH homology
 3SZP A;  1FJ9 A;  4AS4 A;  2B4L A;  4MIJ A;  2CZI A;  1SPI A;  1XI6 A;  5EQ8 A;  3MYU A;  3U65 A;  5J16 A;  4HE2 A;  4OVP A;  5EQA A;  1NV6 A;  4N81 A;  4HXV A;  4OAN A;  2GQ1 A;  2VPN A;  1IME A;  4PDD A;  4H45 A;  4O94 A;  1VDW A;  2Y5L A;  3KBZ A;  2QVV A;  2FVZ A;  2DDK A;  4N8Y A;  4PAF A;  2XWI A;  4MHF A;  5ESY A;  2DE3 A;  4PTK A;  2WEF A;  4PF6 A;  2FIE A;  4GX3 A;  2DE2 A;  3A29 A;  1LBX A;  2V4C A;  1YZ0 A;  5I3S A;  2WX9 A;  4XEQ A;  1LEV A;  1FSA A;  3BIG A;  2CEX A;  3RPL B;  2P3N A;  4I3Y A;  4GBW A;  1JP4 A;  1EYI A;  4GX6 A;  1FPJ A;  4H46 A;  1KA0 A;  5A5L A;  1LBY A;  1NV5 A;  3LUZ A;  4GX4 A;  2XWO A;  1NV3 A;  4N91 A;  5ET6 A;  2FHY A;  1EYJ A;  4JVC A;  4GWY A;  4HCW A;  4PAK A;  1RDY A;  5FBP A;  4MNP A;  4PDH A;  4JVD A;  4AS5 A;  3FXB A;  4X04 A;  1INP A;  2WYK A;  2PFZ A;  1FPB A;  2V3Q A;  4I40 A;  3CHG A;  4XF5 A;  2DE4 A;  1YYZ A;  2P3V A;  3KC0 A;  4P9K A;  2F3D A;  4X9T A;  1NI9 A;  2HHM A;  4PE3 A;  4MAG A;  2Q74 A;  1YXI A;  1NUZ A;  3IFA A;  2XWV A;  2R8T A;  2Q9T A;  2XWK A;  5LTC A;  2QVU A;  5JK4 A;  4N6D A;  1FPG A;  3B50 A;  4QBA A;  4PF8 A;  1LBW A;  4NF0 A;  2ZZV A;  4PC9 A;  2OWZ A;  4F19 A;  4NG7 A;  2WBD A;  3E78 A;  5EYH A;  4GWX A;  2XXK A;  4N4U A;  5CM6 A;  3GYY A;  3W9V A;  1NUY A;  5IZ1 A;  5IZ3 A;  2VPO A;  2QVR A;  4NGU A;  4LN5 A;  5ET5 A;  2WBB A;  4N17 A;  1FJ6 A;  4O7M A;  3HFU A;  4M1V A;  3PTY A;  4UAB A;  1NUX A;  1G0H A;  1DBZ A;  4MJO A;  4PBH A;  3LV0 A;  2KQZ A;  1FPL A;  2XA5 A;  3B8B A;  2HPG A;  3FBP A;  4PBQ A;  1FBG A;  2FBP A;  1FBH A;  1FPE A;  3BIH A;  4XFE A;  2CZK A;  1RDZ A;  4PET A;  1DCU A;  3NOH A;  4N8G A;  3RPL A;  1IMB A;  3T1B A;  2WYP A;  4PGP A;  1FBC A;  4F1V A;  4GWS A;  4OVS A;  1RDX A;  5LDZ A;  2HZK A;  2Y5K A;  4OA4 A;  4F18 A;  4NX1 A;  4PFB A;  1IMD A;  2ZZW A;  2OX3 A;  4GWU A;  2PFY A;  5J1D A;  1NUW A;  4O7I A;  2PCR A;  3ROJ A;  4N6K A;  1DK4 A;  4N15 A;  2QFL A;  4X8R A;  1KZ8 A;  2BJI A;  1FBE A;  4P8B A;  4GWZ A;  4HE1 A;  1FBF A;  4MNC A;  2DVZ A;  1AWB A;  4P47 A;  4PFR A;  1LBV A;  4I3E A;  4P3L A;  5DW8 A;  4DI3 D;  1NV1 A;  4PGN A;  3T0J A;  1IMA A;  5I5P A;  4OVQ A;  2VT5 A;  3D1R A;  4DI4 B;  1Q9D A;  1FPK A;  5EQ7 A;  2F5X A;  4F1U A;  4P56 A;  4IR8 A;  4OVT A;  4O8M A;  4NN3 A;  1K9Y A;  1G0I A;  1NV2 A;  1FPI A;  2F3B A;  4QXD A;  3ISP A;  2L5V A;  5I7I A;  4PCD A;  5IZ3 B;  2QPQ A;  3RYD A;  2KR0 A;  1D9Q A;  2Q8M A;  2HXR A;  4HCY A;  1FPF A;  5EQ9 A;  1CNQ A;  4MX6 A;  1IMF A;  2JJK A;  4KXP A;  1FTA A;  3W9W A;  4MEV A;  2B4M A;  1FRP A;  4NAP A;  3QMF A;  3E79 A;  1KA1 A;  4MCO A;  4PFI A;  1NV7 A;  5IZZ A;  4NHB A;  4JVI A;  4PAI A;  4P1E A;  1K9Z A;  4NQ8 A;  2MKZ A;  3MST A;  1BK4 A;  2FIX A;  1FPD A;  4HE0 A;  5EYG A;  4P1L A;  1LBZ A;  4MMP A;  4YIC A;  2ZZX A;  5IM2 A;  1QGX A;  3IFC A;  3EKI A;  4FBP A;  5F24 A;  4YZZ A;  1IMC A;  1FBD A;  5IGA A;  2CEY A;  5ET7 A;  4GBV A;  2HZL A;  1NV4 A;  1EYK A;  4GWW A;  4OVR A;  1FBP A;  2CZH A;  5T3J A;  4G61 A;  1NV0 A;  5ET8 A;  3KC1 A;  4MNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...