4I40A

Crystal structure of staphylococcal inositol monophosphatase-1: 50mm licl inhibited complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 75
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i40A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i40A02
4HE2A 1FPDA 2PCRA 4H46A 2BJIA 1FPJA 5J16A 1XI6A 5F24A 1INPA 1EYKA 1YYZA 3IFCA 1YZ0A 3LUZA 4I3EA 1NI9A 1LBYA 1K9YA 5EQAA 1FTAA 2WBDA 4GX6A 1AWBA 1FBFA 1RDYA 2JJKA 4GX4A 5IZ3B 5ET5A 1EYIA 1YXIA 5A5LA 5IZ3A 5EYGA 3A29A 1FPKA 5IZ1A 1NV0A 1NUYA 1FPEA 2CZKA 5EYHA 4MJOA 1G0IA 1EYJA 1QGXA 5ET8A 4GX3A 2Y5KA 2F3BA 4O7IA 1IMDA 1FBEA 4G61A 1G0HA 2DDKA 1IMFA 1FJ6A 1FBPA 3KC0A 1DCUA 2GQ1A 1NUZA 1FPFA 1IMAA 1LBVA 3FBPA 1LEVA 1NV2A 4IR8A 5EQ9A 1NV5A 5LDZA 3RYDA 3BIGA 1DBZA 1NV3A 2FVZA 4GBWA 5EQ8A 2FHYA 5ESYA 2QVUA 2Q8MA 1CNQA 1FPGA 3QMFA 3ROJA 3IFAA 2CZIA 1SPIA 4I3YA 1FPBA 5I3SA 1RDXA 1FPIA 5ET7A 5EQ7A 1KZ8A 4GWYA 1DK4A 2P3NA 2QVVA 1LBZA 1LBXA 4GWZA 2QVRA 3LV0A 2FBPA 1JP4A 1KA1A 1KA0A 4GWUA 4I40A 1NV7A 3RPLB 2WBBA 2QFLA 1FJ9A 2WEFA 1NUWA 3RPLA 1Q9DA 4GWXA 4QXDA 1FBHA 2Y5LA 3B8BA 1FSAA 4KXPA 1IMEA 3KBZA 4HE1A 4AS5A 1IMCA 1FBGA 2CZHA 1NV6A 1D9QA 4AS4A 2F3DA 1FBCA 4GWSA 1NV4A 4FBPA 1NUXA 1NV1A 5T3JA 2R8TA 2VT5A 1FBDA 4HE0A 2Q74A 4GWWA 3KC1A 2FIEA 4PTKA 2HHMA 5FBPA 1IMBA 2P3VA 4HXVA 3BIHA 5ET6A 1VDWA 2OWZA 4N81A 5DW8A 2OX3A 2FIXA 3T0JA 1LBWA 1RDZA 1FRPA 3D1RA 4GBVA 1K9ZA 1BK4A 1FPLA 4H45A
chains in the Genus database with same CATH superfamily
1MPCA 3I3VA 4PAIA 2OK2A 3H7MA 4LZ8A 4PBHA 3NOHA 4C0RA 4NF4A 1Z7ME 4LQ2A 2O7IA 3HN0A 1Z7NE 5I57B 1TFDA 1G0IA 5FTHA 4IO2A 3CSBA 1FJ6A 4JDFA 3E3KA 4N17A 2GQ1A 3CFLA 4N4UA 1MXUA 1NV5A 2OCUA 4G2ZA 1FW0A 4FECA 3MSTA 2GHAA 3QMFA 1FPBA 1B3HA 3E79A 4N15A 1MPDA 4XEQA 2QVVA 3H06B 3VVDA 4I9DA 2H5YA 1D4NA 3O2AA 1NNTA 1MRPA 4DIGA 3PUZE 3RGYA 5DEXB 3SEYA 3C31A 3ZS6A 2B3BA 5K2YA 3FVGA 1IZ1A 1NFTA 3JZJA 3KSXA 1AH5A 5AA2D 2FIEA 1YTVA 4G77A 5KCJB 4XFEA 1ZBMA 4G8NA 1MY2A 2B3FA 1VDWA 4OWDA 5DW8A 3IOVA 3K1MA 1RDZA 5JTYA 1QJMA 4PCDA 2A5TB 1JW1A 4BDQA 3IJXB 2Q9TA 4R73A 4PAFA 5CC2A 1EYKA 3LUZA 2V25A 2D5WA 3KG2A 4G8HA 5EQAA 4RK9A 3M3FA 2WBDA 3OSRA 2AIXA 5ET5A 1FPKA 4GX3A 1IMDA 3IO4A 2XXTA 5IM2A 1DCUA 3GBAA 2XXRA 4OVPA 2F97A 4GF8A 4H8IA 1ZMGA 4GVOA 3TELA 5BWJA 3S9EA 2PT2A 3HHGA 4KR5A 3BFTA 2REJA 2RCBA 4QRZA 5JEIA 1PBQA 1SPIA 2P0SA 1FQDA 1A8FA 4EQ7A 1FPIA 4BDRA 1JEUA 4OA4A 1BTJA 2QVRA 2Q89A 4EF2A 4GWUA 1GVCA 2XWOA 1FJ9A 2F6GA 2LAOA 4DXUA 3N6TA 3EQ1A 4EQ9A 4F29A 2OZZA 4PE5B 2A5SA 3S9MC 1II5A 4IB2A 5EHMA 5L9OA 4M4GA 2RC7A 1FBDA 1URDA 3PMXA 4R2FA 4YKJA 4IGTA 2Q8JA 3OEMA 2B65A 3B7DA 1ZIUA 1NNFA 3FXRA 3ISPA 3IO6A 2NVUB 3U8QA 1M5EA 1Y4CA 5FTIA 2VP1A 4OVQA 3OD7A 2PVUA 3K00A 4IO5A 1YPNA 2Z8EA 4MMPA 1FQEA 4FEBA 3KJ7A 1B5HA 2OWTA 3QUJA 3IL1B 1LFIA 3KGCA 2AL5A 2Y5KA 2F3BA 3KOSA 3O66A 1QUKA 2M8CA 2YLNA 3T22A 2XWKA 5LDZA 4K3FA 4PBQA 1FTJA 1RKMA 4LATA 1DBZA 3LR1A 3AXFA 2Q8MA 4RNSA 2DWHA 4MAGA 5I58A 5I3SA 1XOCA 3KJTA 2I4BA 1KZ8A 4ZEDA 2HXWA 4ZEKA 1B3EA 1UTHB 4OERA 4POXA 3PMWA 5DVFA 3QK6A 1N3XA 1TT1A 1NV1A 5T3JA 3U92A 3G7WA 3RNNA 5AA4B 1R1NA 3VFJA 1JVXA 3IAZA 3TTRA 4JWXA 5CMBA 1OLAA 3U72A 1T0KA 2O51A 4OHNA 4X8RA 2AYSA 1JW4A 2XXWA 4KCCA 5B70A 2MKZA 1IITA 4I62A 3MVXA 4H45A 3LSFB 2P1SA 3KOTA 2PFYA 2E0SA 5J1DA 2XX9A 3Q28A 1SYIA 5H8QB 5CM6A 2DOJA 1YYZA 4I3EA 2PMSA 1Y1ZA 4JB7A 1ZU0A 2L5VA 5ET8A 3KBRA 1DTGA 2XXHA 4R74A 3TCHA 2DSFA 4ELOA 1NV2A 3LSWA 4HS7A 1ZTYA 3VVEA 5ESYA 1OVBA 1FPGA 1MQIA 4F19A 3GYYA 1OMPA 4GWYA 4F31B 2Q2CA 4P0IA 3Q27A 1XHYA 4F3SA 3H4ZA 1NV7A 2WBBA 2O1MA 4JVDA 1FCKA 2F35A 4QXDA 4BDLA 2H99A 1FSAA 4YAHX 2I0BA 2D3IA 1IMCA 1FBGA 4ELQA 4QF9A 4G68B 3BKIB 4P1EA 3IOTA 1MM6A 4HE0A 5I59B 2THIA 1B1XA 5L8DA 4AB6A 1FQBA 1BIYA 2FA7A 4EXKA 4NF8B 1PDAA 4NN3A 1AIVA 4MNPA 2V3QA 3HCQA 5ITOA 3QYTA 4P11A 4HE2A 1FPDA 3VVFA 4OZ9A 4Q30B 5J16A 3N94A 1R6ZA 3KFMA 3K01A 1PC3A 3DP6A 5CRYA 1QVSA 1K9YA 3IJOB 3V8XB 1JW5A 2JJKA 1VSOA 4JBZA 1A40A 3A29A 1P1NA 4O7IA 1B52A 3TCGA 4U1ZA 2Q88A 2ZZVA 4XKQA 2HZKA 1MY0A 3MVYA 1JNFA 1FQFA 1FPFA 4WXJA 3CG3A 1RYXA 2DE3A 4YMAA 4XXUA 5I56B 1OIBA 1TXFA 5EQ8A 2XXVA 1DMBA 3T93B 3KN3A 1NKXA 3C35A 1M5FA 2X7QA 2UVGA 1A7LA 1F9BA 5HBCA 1DK4A 3VLWA 1B6HA 5F7VA 4GXAA 1B51A 1EZPA 4F2QA 3FV1A 4E0WA 3RPLA 4F3PA 1H43A 3EHSA 1R9LA 3DP4A 4F1VA 4EUOA 1QUIA 3U93A 4NWCA 4EQBA 4F22A 3MPKA 4NF6A 1UTBB 1SBPA 3L6HA 1LFGA 3MYUA 4TQUQ 2CZLA 2XXPA 3IB0A 1B05A 2DYXA 3OOAA 3RTFB 5KZTA 3HFUA 2OBGA 1Y20A 1XT8A 2XD2A 4RXLA 1B5JA 3IOWA 1RYOA 3OEKA 5TPAB 4IO4A 5TP9A 4BDOA 3IFCA 4LZ5A 4OVTA 3BFUA 3U1OA 2ANJA 2ZMBA 5IZ3B 2ZZWA 1IUDA 1FBEA 3PPQA 4BDNA 1SQYA 3TTLA 1MH4A 1B0LA 5EQ9A 1ANFA 3RPWA 3MWBA 5DT6A 2DE4A 1DOTA 2V3UA 5H8NA 1VFEA 4TLMB 3PUWE 2IEEA 4ISUA 2CZIA 5EHSA 3Q26A 4DI4B 2OLBA 4R2BA 2HXRA 3QIMA 3MPLA 3V83A 3OMBA 2F7CA 1MQDA 3TZAA 4MF3A 1QW0A 3QUFA 4RA1A 1SI1A 1JP4A 3DP8A 2F36A 3IK6B 1GGGA 2WEFA 1NUWA 3D4GA 4H1XA 1MY3A 4U4XA 4KYDA 4QSEA 1IMEA 4O94A 4R6HA 2F3DA 4GWSA 4P9KA 1NV4A 3K0VA 4PETA 2VT5A 4POWA 2O1LA 3PUXE 3A3UA 4F18A 4LA9A 3SESA 5I2KB 1IXCA 5ET6A 5ICTA 1OVTA 4LZ7A 3CIJA 1NH7A 2FIXA 3UGWA 4GL0A 4H67A 3KN7A 1N3WA 3N5LA 1URGA 4H46A 1EZ9A 3E13X 2ZZXA 2KR0A 3S4UA 4X9TA 4NX1A 1DSNA 4R75A 2PX1A 4WEDA 4F2OA 2W7YA 5H8SA 5AA3A 4F3BA 1POTA 4RYAA 1NUYA 2B4MA 1LB8A 1PB7A 2DDKA 1ZJLA 4F3GA 3KC0A 4FORA 1IMAA 3FJMA 5KDTB 2ZXTA 3CVGA 3I6VA 3MUQA 4M1VA 2F6PA 3PGFA 1LBCA 3O6IA 2Z22A 3U65A 1P1UA 1US4A 2UVJA 2Y7KA 3T96B 4HW8A 4N8YA 1KA0A 1I6BA 1SD3A 1DPEA 3MVZA 4XIGQ 5H8FB 4NF8A 2HPGA 4X04A 4GWXA 4L17A 1FBHA 1IXGA 3TTNA 3MVWA 3LBSA 3TFLA 4OVSA 2DVCA 4OQOA 2Q74A 1VE4A 4NTLA 3CRBA 4H6DA 2HHMA 1FTKA 2ZNUA 3VLUA 3GBBA 1LFHA 1Q1KA 5I2NB 4P8BA 2OX3A 3IB2A 3MP1A 4YICA 4RJZA 4MLQA 4H8JA 2QS3A 2AL4A 4HTGA 2I3VA 1S9TA 1TFAA 3C36A 2PT1A 1LBYA 2Y7WA 5ELVA 1H44A 4YKPA 1US5A 4IO7A 5M2VA 4R72A 4IO3A 1D9VA 5A5LA 1YXIA 2V93A 5IZ1A 5DVJA 3RLFE 3THIA 3SERA 1MQGA 4HCWA 1YAEA 4JVIA 4OENA 3RY3A 1B2HA 1LBVA 3TEPA 3FXBA 4Z0IA 3C9HA 3QSLA 2E1SA 4OYVA 4GL8A 2QSXA 4RK2A 1ZKBA 2RC8A 4ZECA 1MM7A 4LUBA 3H3GA 3V5AA 1H3DA 5EQ7A 3JV9A 2H4IA 4KI0E 3T9UA 5CBRA 4LQ5A 3LV0A 3C4MA 3FZVA 1DTZA 3TYHA 2QFLA 4DCYA 1B3FA 2Q2AA 5A5XB 3SEXA 1SDXA 4C1TA 4UABA 3ILTB 4KXPA 5AA2B 4ECFA 1MDQA 4GIZA 4P0GA 2QMXA 1FTMA 1PEBA 2ESNA 4I8CA 1BP5A 3HHFA 4PFIA 4HXVA 4NMYA 1XVYA 1GR2A 2Y7RA 3D1RA 4X1DA 2Y5LA 2PFZA 5I5PA 2OPEA 4FIMA 3CI8A 3TCFA 1XI6A 4OESA 5F24A 4NF4B 2QRYA 1MXVA 3K1NA 3M3KA 1URSA 3MC2A 1S7YA 2DWJA 1Y9UA 4XKPA 4GX6A 3W9VA 1POY1 3VV5A 3UP9A 4DI3D 4JWYA 1S50A 3VE1B 2I4CA 5I57A 3B6TA 4XKNA 4MHFA 1SW4A 2HAUA 4GBWA 3B6WA 3C33A 1QULA 1GV8A 4EXLA 2RF1A 3M8UA 2OPDA 3B50A 3MP8A 4IGRA 3O6GA 4LVQA 1LBXA 1JETA 3SEVA 1KA1A 1LGBC 4I40A 4G4PA 2XD3A 5ISUA 3FJGA 2QS4A 4GLIA 2VPNA 4OETA 3B8BA 4DXBA 2NOOA 2HEUA 3T9HB 3W9WA 2CZHA 1NV6A 4UACA 1D9QA 1L5TA 5DEXA 4X1BA 2UYFA 4I1DA 2I0CA 3B6QA 5KCJA 3HPIA 1IMBA 2P3VA 3FJ7A 2QS2A 5JTYB 4ZE8A 1Y3QA 2P2AA 4G8MA 1MG1A 2PCRA 3PMVA 1SW1A 2A5TA 3G3KA 1NMUA 3T66A 3W15C 4KD5A 4UA8A 2V4CA 2DE2A 2YPNA 4TLLB 1JVYA 1QKBA 2G29A 4N6DA 1M5CA 2NWJA 3UORA 3OO7A 4GWOA 1FPEA 3O29A 3UIFA 3PU5A 4H65A 1OLCA 1P1WA 4NGUA 4YMBA 2PYYA 1B1HA 4ZZAA 1SW2A 4GOTA 5H8HB 3UK4A 1CNQA 2XX7A 4OFJA 3ZKKA 1JQFA 4Q0CA 1LCTA 1EH3A 4PDDA 4I3YA 4MLVA 1USYH 3Q25A 4XF5A 2RINA 5L9MA 1VR5A 4QFLA 3IORA 4NEDA 1LBZA 1SW5A 5AA1A 2FYIA 4QFNA 2R6GE 1I6QA 3VXCA 1Q9DA 1QUJA 3UN6A 4IO6A 1MS7A 5I84A 1OQGA 3K2DA 4O8MA 4DLDA 4YB5A 5F1QA 2XWVA 1FBCA 4NQ8A 1N04A 1IIWA 1BLFA 4N13A 1P1OA 4DCXA 4OXVA 3V89B 3O97A 2V84A 1EZOA 3C34A 4KQPA 3IOUA 2G93A 3H6VA 4YU0A 4DZ1A 3MP6A 4QFKA 3C32A 4PDHA 1FQAA 1BK4A 3FV2A 1FPJA 2KLFA 2KQZA 1BKAA 4NG7A 4GD5A 4JSOA 4N91A 4PFWA 1Y4TA 3LUYA 1P99A 4NF5B 3U94A 1EU8A 2X26A 3ODBA 2F8DA 4OFLA 2DP8A 4C1UA 1QGXA 3A09A 3H03A 1H45A 4YB7A 1LLSA 1O7TA 2WX9A 3CFXA 3EKIA 1MDP1 3IB1A 4PFUA 2F78A 1XS5A 3TQLA 2FHYA 4OTEA 1IXHA 5I58B 1B7UA 5DTBA 2GH9A 4ELPA 5IZZA 1RDXA 1M5DA 3FVKA 3VDFA 4Q5TA 2XXUA 1I6AA 2CEYA 3PV0E 1B7HA 1D3KA 3K6VA 2R71A 1B46A 2DXRA 3R26A 4EF1A 3DELB 1UTHA 3TPAA 4THIA 2OWSA 1J1NA 4U22A 2ONRA 1O64A 4PFTA 4GXSB 3S9LC 4P1LA 3PPRA 4ZE9A 5AA4A 4PGPA 4BDMA 2CMOA 2O6AA 2XWIA 4R9GA 3JYRA 4WKMA 1PBPA 2RKMA 1FQCA 4NE4A 4JSDA 2ALUA 2Z8DA 3DM0A 4FEDA 3TUSA 3FVOA 3MZ1A 3A3CA 3O9PA 2QPQA 4U2RA 3TTMA 4KYEA 4FAJA 1VFDA 1SVXB 4MEVA 4GRKA 5H8QA 1UQWA 3TQWA 2ZYOA 5K2XA 1FTLA 4AB5A 4P56A 5EYGA 5EYHA 1LBBA 1EYJA 3FIRA 3G3GA 3LC8A 3QXMA 3MZ9A 1PB9A 4NHBA 4IR8A 1DPPA 1B3GA 3BIGA 3RQTA 3MAMA 4MNCA 1B0HA 3PUYE 4ELRA 4ESWA 1CB6A 3TAJA 1ZLQA 2B4LA 4R6KA 3RT8A 4PFBA 2I6EA 2RCAA 4KFQA 3S9NC 3MQ9A 4F39A 3TKDA 5LTCA 3G3JA 4MIJA 2XA5A 3FD3A 3OO6A 3TODA 1FTOA 1QKAA 3R7XA 2O69A 3H6WA 3T9VA 4G68A 2HAVA 4O3BA 1NH8A 1LB9A 2H9BA 4LN5A 4PTKA 3USDA 4AQ4A 5I59A 2X7PA 1SI0A 5IAIA 1ATGA 1B58A 4WEPA 2XXXA 2ZYNA 1FRPA 1K9ZA 4MBPA 2REGA 2ONKE 2VPOA 1LAFE 1R9QA 1MPBA 4MFIA 5EYFA 4U4SA 3EN3A 2WYKA 4JVCA 3FASA 5ITPA 1YZ0A 2QJEA 4QHQA 5FHOA 1N7XA 2UVHA 4PFRA 1N84A 1AWBA 4FJPA 1RDYA 4KHZE 4LONB 5H8HA 2F7BA 4YKIA 2CZKA 1B5IA 4MH5A 5CI5A 4MNIA 4H5GA 3K6UA 1LAXA 1FBPA 3O6HA 3PD9A 4QBAA 4R6YA 1HSEA 4RPOA 4RY1A 2Y7IA 2XXKA 3P7IA 4XTCQ 3RYDA 4ZS9A 1MY4A 3ZSFA 1UIVA 5I56A 3FUZA 1Y1MA 3ROJA 3LSLA 3WAEA 3H6UA 3BBRA 3TMGA 3HSTA 3SEWA 3TTKA 3H6TA 3OO9A 3DLNA 4GWZA 4P47A 3OSQA 3MZBA 3RPLB 4PF8A 1B9JA 1IEJA 4FATA 2O7UA 3KBZA 3K6XA 4NF6B 1B4HA 2Z23A 4OEUA 3F11A 1HSLA 3EHUA 4F1UA 4ZEBA 1LAHE 2R9JA 1UTBA 3KC1A 3Q29A 3GZGA 3HV1A 2PBWA 4MX6A 1A55A 5FHMA 4QSDA 2GHBA 1MXWA 4QFOA 1LSTA 4NF5A 4DDDA 2XXQA 4PP0A 4PAKA 3MBPA 5AE4A 2WKYA 3FVNA 1KWHA 1LBWA 1WDNA 1Y3PA 4ESXA 2DQVA 4LP2B 1SYHA 2DS9A 5TP9B 4O7MA 2O68A 2ONSA 3PPPA 1CE2A 5TPAA 2DWIA 2QL3A 4OMBA 2HFBA 1A8EA 4F1YA 2D21A 2HQ0A 3I5OA 5I7IA 4GX4A 4ND9A 3KN8A 5ICQA 4IY5A 2Y7PA 5IZ3A 4NAPA 3ILUB 4MJOA 1Y3NA 4G61A 1MQJA 5DVIA 1IMFA 1USYE 2O84X 1MXXA 2ZNSA 4N6PA 4R9FA 1P1QA 5H8NB 4PFYA 2CEXA 4RPNA 3E9XA 4ZEIA 4OFOA 1N76A 3SETA 1ELJA 4OANA 4KPTA 4DXCA 3G3IA 5L9SA 2ZNTA 4PGNA 3SZPA 3GLBA 4P3LA 3MJNA 2NXOA 2VD3A 4ZDMA 2I3WA 1NNPA 1D9YA 1H76A 5TU0A 2Z8FA 1IXIA 4N6KA 3D4CA 1HSJA 4O3CA 3PD8A 1WODA 2V3TA 4HE1A 4O3AA 5LOMA 1XVXA 2XHDA 2HCAA 1NUXA 1XC1A 3E78A 2DWAA 3MW0A 3K4UA 3SDFA 3EF7A 4QFPA 2QS1A 3WAFA 1WVJA 3FATA 3IR1A 4N8GA 2OJTA 5I2KA 2F7AA 2I49A 2BJJX 2GRVA 3S2VA 4GBVA 2I48A 3KZGA 3EPEA 3N26A 4ZZEA 3ONMA 4GQOA 5IGAA 3CFZA 2ABHA 4PQJA 2YJPA 2BJIA 4XKRA 4MCOA 2WYPA 4JXIA 3G3FA 5BUUA 1INPA 2GFEA 4QSCA 2VD2A 1NI9A 1FTAA 3PPOA 1B4ZA 1LCFA 3KSJA 1EYIA 4PF6A 3G3HA 3L6GA 2VHAA 3M3LA 3FXUA 1NUZA 3LSXA 5CMCA 4OEVA 3T9XB 1B3LA 5KDTA 3RN8A 3ECRA 3PTYA 3R6UA 4OVRA 3FXQA 2QVUA 4YKKA 2Y84A 2XXYA 2ZYMA 3UA8A 4OVJA 5B7DA 2P3NA 3K6WA 4HCYA 4PC9A 1NL5A 5FHNA 2FBPA 4U1OA 2H98A 1MXYA 4BLAA 3T1BA 3GXAA 5HM4B 3QAXA 1B32A 2I58A 5H8FA 1LAGE 2UXAA 1GTKA 2HZLA 3E4RA 2FNCA 3PUVE 4FBPA 1A99A 1AL3A 4H0WA 3PPNA 4KYSA 4U23A 4GWWA 4H5FA 3RUMA 5FBPA 2XX8A 3CHGA 3RT6B 2H25A 4ONYA 4X48A 4N07A 5CMKA 3K02A 3BIHA 4N81A 5DYHA 3T0JA 5I2NA 4NWDA 3TDJA 1FPLA 5JK4A 4TOZA 4YB6A 3FGSA 1MH3A 2UVIA 3SKPA 1A54A 2UYEA 2F34A 4FE8A 1FBFA 3OXNA 1B40A 3O28A 3EHTA 1NV0A 1IQ7A 4PE3A 1M5BA 1G0HA 1N0TA 3KEIA 4IY6A 5HPQA 1OQHA 3IX1A 4GFRA 1YCJA 1JEVA 3FBPA 1LEVA 2VGQA 2XXIA 4U21A 1NV3A 2FVZA 2VOZA 3OENA 2RC9A 4Q8RA 3IFAA 1PB8A 1O63A 2F5XA 2IA4A 5CMMA 1I69A 2NUVA 5ET7A 4JWOA 1N7WA 5IKBA 1MY1A 3OO8A 2DXYA 3CG1A 2QMWA 3VLVA 1NNKA 3HO7A 4NF0A 3RTWB 1MQHA 3N6UA 4AS5A 3CSGA 3ZKLA 5A5XA 4E0XA 4AS4A 4EDPA 5AA2A 1AOVA 2R8TA 4KCDA 3K1PA 2DVZA 1AMFA 1TWYA 4YZZA 4Z7EA 3OELA 1Q35A 4DE8A 5CBSA 1MXZA 2OWZA 3CR9A 1B7ZA 3VXBA 4G68C 3SEUA 4ZEFA 2ZYKA 1UIUA
chains in the Genus database with same CATH topology
4HE2A 1FPDA 4PAIA 5J16A 1XI6A 4PBHA 2WYKA 4JVCA 5F24A 3NOHA 1YZ0A 4PFRA 1K9YA 4GX6A 1AWBA 2JJKA 1RDYA 3W9VA 4DI3D 3A29A 2CZKA 1G0IA 4O7IA 4MNIA 1FJ6A 1FBPA 2ZZVA 2HZKA 4N17A 2GQ1A 4QBAA 1FPFA 2XXKA 4MHFA 4N4UA 2DE3A 1NV5A 3RYDA 4GBWA 5EQ8A 3MSTA 3QMFA 3ROJA 1FPBA 3E79A 3B50A 4N15A 1DK4A 4XEQA 2QVVA 1LBXA 4GWZA 4P47A 1KA1A 4I40A 3RPLB 4PF8A 3RPLA 2VPNA 3B8BA 4F1VA 3KBZA 3W9WA 2CZHA 1NV6A 1D9QA 4F1UA 3KC1A 2FIEA 3MYUA 4MX6A 4XFEA 1IMBA 2P3VA 3HFUA 1VDWA 4PAKA 5DW8A 1LBWA 1RDZA 4PCDA 2PCRA 4O7MA 2Q9TA 2V4CA 4PAFA 2DE2A 1EYKA 3IFCA 3LUZA 4OVTA 5EQAA 4N6DA 2WBDA 5I7IA 4GX4A 5IZ3B 5ET5A 2ZZWA 5IZ3A 4NAPA 1FPKA 1FPEA 4MJOA 4GX3A 1IMDA 1FBEA 4G61A 1IMFA 5IM2A 4NGUA 1DCUA 4OVPA 5EQ9A 2DE4A 2CEXA 1CNQA 2CZIA 1SPIA 4OANA 4PDDA 4I3YA 4DI4B 1FPIA 4PGNA 4XF5A 3SZPA 2HXRA 4P3LA 4OA4A 1LBZA 2QVRA 1JP4A 4GWUA 2XWOA 4N6KA 1FJ9A 2WEFA 1NUWA 1Q9DA 4O8MA 1IMEA 4HE1A 4O94A 2F3DA 2XWVA 1FBCA 4GWSA 4NQ8A 4P9KA 1NV4A 1NUXA 3E78A 4PETA 2VT5A 1FBDA 4F18A 4N8GA 3ISPA 5ET6A 2FIXA 4GBVA 4PDHA 1BK4A 5IGAA 4OVQA 4H46A 2BJIA 1FPJA 2KQZA 2ZZXA 2KR0A 4MCOA 2WYPA 4NG7A 4MMPA 4X9TA 1INPA 4N91A 4NX1A 1NI9A 1FTAA 1EYIA 4PF6A 1NUYA 1QGXA 2Y5KA 2F3BA 2B4MA 2DDKA 2WX9A 3EKIA 3KC0A 1NUZA 1IMAA 2XWKA 5LDZA 4PBQA 1DBZA 3PTYA 2FHYA 4M1VA 4OVRA 2QVUA 2Q8MA 4MAGA 3U65A 5I3SA 5IZZA 1RDXA 1KZ8A 2P3NA 4HCYA 4PC9A 2CEYA 2FBPA 4N8YA 1KA0A 3T1BA 2HPGA 4X04A 4GWXA 1FBHA 2HZLA 4FBPA 1NV1A 5T3JA 4OVSA 2Q74A 4P1LA 4GWWA 4PGPA 2XWIA 2HHMA 5FBPA 3CHGA 3BIHA 4N81A 4P8BA 4X8RA 2OX3A 3T0JA 2MKZA 4YICA 1FPLA 5JK4A 4H45A 2PFYA 5J1DA 5CM6A 2QPQA 1YYZA 4I3EA 4MEVA 1LBYA 1FBFA 4P56A 5A5LA 1YXIA 5EYGA 5IZ1A 2L5VA 1NV0A 5EYHA 1EYJA 4PE3A 5ET8A 1G0HA 4HCWA 4JVIA 4NHBA 1LBVA 3FBPA 1LEVA 1NV2A 4IR8A 3FXBA 3BIGA 1NV3A 2FVZA 5ESYA 4MNCA 1FPGA 3IFAA 4F19A 2F5XA 5ET7A 3GYYA 5EQ7A 4GWYA 2B4LA 4PFBA 3LV0A 1NV7A 2WBBA 2QFLA 4JVDA 5LTCA 4QXDA 4MIJA 2XA5A 1FSAA 4NF0A 4UABA 4KXPA 5I5PA 4AS5A 1IMCA 1FBGA 4AS4A 4P1EA 2R8TA 4HE0A 2DVZA 4LN5A 4PTKA 4YZZA 4PFIA 4HXVA 4NN3A 2OWZA 4MNPA 2V3QA 1FRPA 3D1RA 1K9ZA 2Y5LA 2PFZA 2VPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE2 A;  1FPD A;  2PCR A;  4H46 A;  2BJI A;  1FPJ A;  5J16 A;  1XI6 A;  5F24 A;  1INP A;  1EYK A;  1YYZ A;  3IFC A;  1YZ0 A;  3LUZ A;  4I3E A;  1NI9 A;  1LBY A;  1K9Y A;  5EQA A;  1FTA A;  2WBD A;  4GX6 A;  1AWB A;  1FBF A;  1RDY A;  2JJK A;  4GX4 A;  5IZ3 B;  5ET5 A;  1EYI A;  1YXI A;  5A5L A;  5IZ3 A;  5EYG A;  3A29 A;  1FPK A;  5IZ1 A;  1NV0 A;  1NUY A;  1FPE A;  2CZK A;  5EYH A;  4MJO A;  1G0I A;  1EYJ A;  1QGX A;  5ET8 A;  4GX3 A;  2Y5K A;  2F3B A;  4O7I A;  1IMD A;  1FBE A;  4G61 A;  1G0H A;  2DDK A;  1IMF A;  1FJ6 A;  1FBP A;  3KC0 A;  1DCU A;  2GQ1 A;  1NUZ A;  1FPF A;  1IMA A;  1LBV A;  3FBP A;  1LEV A;  1NV2 A;  4IR8 A;  5EQ9 A;  1NV5 A;  5LDZ A;  3RYD A;  3BIG A;  1DBZ A;  1NV3 A;  2FVZ A;  4GBW A;  5EQ8 A;  2FHY A;  5ESY A;  2QVU A;  2Q8M A;  1CNQ A;  1FPG A;  3QMF A;  3ROJ A;  3IFA A;  2CZI A;  1SPI A;  4I3Y A;  1FPB A;  5I3S A;  1RDX A;  1FPI A;  5ET7 A;  5EQ7 A;  1KZ8 A;  4GWY A;  1DK4 A;  2P3N A;  2QVV A;  1LBZ A;  1LBX A;  4GWZ A;  2QVR A;  3LV0 A;  2FBP A;  1JP4 A;  1KA1 A;  1KA0 A;  4GWU A;  4I40 A;  1NV7 A;  3RPL B;  2WBB A;  2QFL A;  1FJ9 A;  2WEF A;  1NUW A;  3RPL A;  1Q9D A;  4GWX A;  4QXD A;  1FBH A;  2Y5L A;  3B8B A;  1FSA A;  4KXP A;  1IME A;  3KBZ A;  4HE1 A;  4AS5 A;  1IMC A;  1FBG A;  2CZH A;  1NV6 A;  1D9Q A;  4AS4 A;  2F3D A;  1FBC A;  4GWS A;  1NV4 A;  4FBP A;  1NUX A;  1NV1 A;  5T3J A;  2R8T A;  2VT5 A;  1FBD A;  4HE0 A;  2Q74 A;  4GWW A;  3KC1 A;  2FIE A;  4PTK A;  2HHM A;  5FBP A;  1IMB A;  2P3V A;  4HXV A;  3BIH A;  5ET6 A;  1VDW A;  2OWZ A;  4N81 A;  5DW8 A;  2OX3 A;  2FIX A;  3T0J A;  1LBW A;  1RDZ A;  1FRP A;  3D1R A;  4GBV A;  1K9Z A;  1BK4 A;  1FPL A;  4H45 A; 
#chains in the Genus database with same CATH topology
 1MPC A;  3I3V A;  4PAI A;  2OK2 A;  3H7M A;  4LZ8 A;  4PBH A;  3NOH A;  4C0R A;  4NF4 A;  1Z7M E;  4LQ2 A;  2O7I A;  3HN0 A;  1Z7N E;  5I57 B;  1TFD A;  1G0I A;  5FTH A;  4IO2 A;  3CSB A;  1FJ6 A;  4JDF A;  3E3K A;  4N17 A;  2GQ1 A;  3CFL A;  4N4U A;  1MXU A;  1NV5 A;  2OCU A;  4G2Z A;  1FW0 A;  4FEC A;  3MST A;  2GHA A;  3QMF A;  1FPB A;  1B3H A;  3E79 A;  4N15 A;  1MPD A;  4XEQ A;  2QVV A;  3H06 B;  3VVD A;  4I9D A;  2H5Y A;  1D4N A;  3O2A A;  1NNT A;  1MRP A;  4DIG A;  3PUZ E;  3RGY A;  5DEX B;  3SEY A;  3C31 A;  3ZS6 A;  2B3B A;  5K2Y A;  3FVG A;  1IZ1 A;  1NFT A;  3JZJ A;  3KSX A;  1AH5 A;  5AA2 D;  2FIE A;  1YTV A;  4G77 A;  5KCJ B;  4XFE A;  1ZBM A;  4G8N A;  1MY2 A;  2B3F A;  1VDW A;  4OWD A;  5DW8 A;  3IOV A;  3K1M A;  1RDZ A;  5JTY A;  1QJM A;  4PCD A;  2A5T B;  1JW1 A;  4BDQ A;  3IJX B;  2Q9T A;  4R73 A;  4PAF A;  5CC2 A;  1EYK A;  3LUZ A;  2V25 A;  2D5W A;  3KG2 A;  4G8H A;  5EQA A;  4RK9 A;  3M3F A;  2WBD A;  3OSR A;  2AIX A;  5ET5 A;  1FPK A;  4GX3 A;  1IMD A;  3IO4 A;  2XXT A;  5IM2 A;  1DCU A;  3GBA A;  2XXR A;  4OVP A;  2F97 A;  4GF8 A;  4H8I A;  1ZMG A;  4GVO A;  3TEL A;  5BWJ A;  3S9E A;  2PT2 A;  3HHG A;  4KR5 A;  3BFT A;  2REJ A;  2RCB A;  4QRZ A;  5JEI A;  1PBQ A;  1SPI A;  2P0S A;  1FQD A;  1A8F A;  4EQ7 A;  1FPI A;  4BDR A;  1JEU A;  4OA4 A;  1BTJ A;  2QVR A;  2Q89 A;  4EF2 A;  4GWU A;  1GVC A;  2XWO A;  1FJ9 A;  2F6G A;  2LAO A;  4DXU A;  3N6T A;  3EQ1 A;  4EQ9 A;  4F29 A;  2OZZ A;  4PE5 B;  2A5S A;  3S9M C;  1II5 A;  4IB2 A;  5EHM A;  5L9O A;  4M4G A;  2RC7 A;  1FBD A;  1URD A;  3PMX A;  4R2F A;  4YKJ A;  4IGT A;  2Q8J A;  3OEM A;  2B65 A;  3B7D A;  1ZIU A;  1NNF A;  3FXR A;  3ISP A;  3IO6 A;  2NVU B;  3U8Q A;  1M5E A;  1Y4C A;  5FTI A;  2VP1 A;  4OVQ A;  3OD7 A;  2PVU A;  3K00 A;  4IO5 A;  1YPN A;  2Z8E A;  4MMP A;  1FQE A;  4FEB A;  3KJ7 A;  1B5H A;  2OWT A;  3QUJ A;  3IL1 B;  1LFI A;  3KGC A;  2AL5 A;  2Y5K A;  2F3B A;  3KOS A;  3O66 A;  1QUK A;  2M8C A;  2YLN A;  3T22 A;  2XWK A;  5LDZ A;  4K3F A;  4PBQ A;  1FTJ A;  1RKM A;  4LAT A;  1DBZ A;  3LR1 A;  3AXF A;  2Q8M A;  4RNS A;  2DWH A;  4MAG A;  5I58 A;  5I3S A;  1XOC A;  3KJT A;  2I4B A;  1KZ8 A;  4ZED A;  2HXW A;  4ZEK A;  1B3E A;  1UTH B;  4OER A;  4POX A;  3PMW A;  5DVF A;  3QK6 A;  1N3X A;  1TT1 A;  1NV1 A;  5T3J A;  3U92 A;  3G7W A;  3RNN A;  5AA4 B;  1R1N A;  3VFJ A;  1JVX A;  3IAZ A;  3TTR A;  4JWX A;  5CMB A;  1OLA A;  3U72 A;  1T0K A;  2O51 A;  4OHN A;  4X8R A;  2AYS A;  1JW4 A;  2XXW A;  4KCC A;  5B70 A;  2MKZ A;  1IIT A;  4I62 A;  3MVX A;  4H45 A;  3LSF B;  2P1S A;  3KOT A;  2PFY A;  2E0S A;  5J1D A;  2XX9 A;  3Q28 A;  1SYI A;  5H8Q B;  5CM6 A;  2DOJ A;  1YYZ A;  4I3E A;  2PMS A;  1Y1Z A;  4JB7 A;  1ZU0 A;  2L5V A;  5ET8 A;  3KBR A;  1DTG A;  2XXH A;  4R74 A;  3TCH A;  2DSF A;  4ELO A;  1NV2 A;  3LSW A;  4HS7 A;  1ZTY A;  3VVE A;  5ESY A;  1OVB A;  1FPG A;  1MQI A;  4F19 A;  3GYY A;  1OMP A;  4GWY A;  4F31 B;  2Q2C A;  4P0I A;  3Q27 A;  1XHY A;  4F3S A;  3H4Z A;  1NV7 A;  2WBB A;  2O1M A;  4JVD A;  1FCK A;  2F35 A;  4QXD A;  4BDL A;  2H99 A;  1FSA A;  4YAH X;  2I0B A;  2D3I A;  1IMC A;  1FBG A;  4ELQ A;  4QF9 A;  4G68 B;  3BKI B;  4P1E A;  3IOT A;  1MM6 A;  4HE0 A;  5I59 B;  2THI A;  1B1X A;  5L8D A;  4AB6 A;  1FQB A;  1BIY A;  2FA7 A;  4EXK A;  4NF8 B;  1PDA A;  4NN3 A;  1AIV A;  4MNP A;  2V3Q A;  3HCQ A;  5ITO A;  3QYT A;  4P11 A;  4HE2 A;  1FPD A;  3VVF A;  4OZ9 A;  4Q30 B;  5J16 A;  3N94 A;  1R6Z A;  3KFM A;  3K01 A;  1PC3 A;  3DP6 A;  5CRY A;  1QVS A;  1K9Y A;  3IJO B;  3V8X B;  1JW5 A;  2JJK A;  1VSO A;  4JBZ A;  1A40 A;  3A29 A;  1P1N A;  4O7I A;  1B52 A;  3TCG A;  4U1Z A;  2Q88 A;  2ZZV A;  4XKQ A;  2HZK A;  1MY0 A;  3MVY A;  1JNF A;  1FQF A;  1FPF A;  4WXJ A;  3CG3 A;  1RYX A;  2DE3 A;  4YMA A;  4XXU A;  5I56 B;  1OIB A;  1TXF A;  5EQ8 A;  2XXV A;  1DMB A;  3T93 B;  3KN3 A;  1NKX A;  3C35 A;  1M5F A;  2X7Q A;  2UVG A;  1A7L A;  1F9B A;  5HBC A;  1DK4 A;  3VLW A;  1B6H A;  5F7V A;  4GXA A;  1B51 A;  1EZP A;  4F2Q A;  3FV1 A;  4E0W A;  3RPL A;  4F3P A;  1H43 A;  3EHS A;  1R9L A;  3DP4 A;  4F1V A;  4EUO A;  1QUI A;  3U93 A;  4NWC A;  4EQB A;  4F22 A;  3MPK A;  4NF6 A;  1UTB B;  1SBP A;  3L6H A;  1LFG A;  3MYU A;  4TQU Q;  2CZL A;  2XXP A;  3IB0 A;  1B05 A;  2DYX A;  3OOA A;  3RTF B;  5KZT A;  3HFU A;  2OBG A;  1Y20 A;  1XT8 A;  2XD2 A;  4RXL A;  1B5J A;  3IOW A;  1RYO A;  3OEK A;  5TPA B;  4IO4 A;  5TP9 A;  4BDO A;  3IFC A;  4LZ5 A;  4OVT A;  3BFU A;  3U1O A;  2ANJ A;  2ZMB A;  5IZ3 B;  2ZZW A;  1IUD A;  1FBE A;  3PPQ A;  4BDN A;  1SQY A;  3TTL A;  1MH4 A;  1B0L A;  5EQ9 A;  1ANF A;  3RPW A;  3MWB A;  5DT6 A;  2DE4 A;  1DOT A;  2V3U A;  5H8N A;  1VFE A;  4TLM B;  3PUW E;  2IEE A;  4ISU A;  2CZI A;  5EHS A;  3Q26 A;  4DI4 B;  2OLB A;  4R2B A;  2HXR A;  3QIM A;  3MPL A;  3V83 A;  3OMB A;  2F7C A;  1MQD A;  3TZA A;  4MF3 A;  1QW0 A;  3QUF A;  4RA1 A;  1SI1 A;  1JP4 A;  3DP8 A;  2F36 A;  3IK6 B;  1GGG A;  2WEF A;  1NUW A;  3D4G A;  4H1X A;  1MY3 A;  4U4X A;  4KYD A;  4QSE A;  1IME A;  4O94 A;  4R6H A;  2F3D A;  4GWS A;  4P9K A;  1NV4 A;  3K0V A;  4PET A;  2VT5 A;  4POW A;  2O1L A;  3PUX E;  3A3U A;  4F18 A;  4LA9 A;  3SES A;  5I2K B;  1IXC A;  5ET6 A;  5ICT A;  1OVT A;  4LZ7 A;  3CIJ A;  1NH7 A;  2FIX A;  3UGW A;  4GL0 A;  4H67 A;  3KN7 A;  1N3W A;  3N5L A;  1URG A;  4H46 A;  1EZ9 A;  3E13 X;  2ZZX A;  2KR0 A;  3S4U A;  4X9T A;  4NX1 A;  1DSN A;  4R75 A;  2PX1 A;  4WED A;  4F2O A;  2W7Y A;  5H8S A;  5AA3 A;  4F3B A;  1POT A;  4RYA A;  1NUY A;  2B4M A;  1LB8 A;  1PB7 A;  2DDK A;  1ZJL A;  4F3G A;  3KC0 A;  4FOR A;  1IMA A;  3FJM A;  5KDT B;  2ZXT A;  3CVG A;  3I6V A;  3MUQ A;  4M1V A;  2F6P A;  3PGF A;  1LBC A;  3O6I A;  2Z22 A;  3U65 A;  1P1U A;  1US4 A;  2UVJ A;  2Y7K A;  3T96 B;  4HW8 A;  4N8Y A;  1KA0 A;  1I6B A;  1SD3 A;  1DPE A;  3MVZ A;  4XIG Q;  5H8F B;  4NF8 A;  2HPG A;  4X04 A;  4GWX A;  4L17 A;  1FBH A;  1IXG A;  3TTN A;  3MVW A;  3LBS A;  3TFL A;  4OVS A;  2DVC A;  4OQO A;  2Q74 A;  1VE4 A;  4NTL A;  3CRB A;  4H6D A;  2HHM A;  1FTK A;  2ZNU A;  3VLU A;  3GBB A;  1LFH A;  1Q1K A;  5I2N B;  4P8B A;  2OX3 A;  3IB2 A;  3MP1 A;  4YIC A;  4RJZ A;  4MLQ A;  4H8J A;  2QS3 A;  2AL4 A;  4HTG A;  2I3V A;  1S9T A;  1TFA A;  3C36 A;  2PT1 A;  1LBY A;  2Y7W A;  5ELV A;  1H44 A;  4YKP A;  1US5 A;  4IO7 A;  5M2V A;  4R72 A;  4IO3 A;  1D9V A;  5A5L A;  1YXI A;  2V93 A;  5IZ1 A;  5DVJ A;  3RLF E;  3THI A;  3SER A;  1MQG A;  4HCW A;  1YAE A;  4JVI A;  4OEN A;  3RY3 A;  1B2H A;  1LBV A;  3TEP A;  3FXB A;  4Z0I A;  3C9H A;  3QSL A;  2E1S A;  4OYV A;  4GL8 A;  2QSX A;  4RK2 A;  1ZKB A;  2RC8 A;  4ZEC A;  1MM7 A;  4LUB A;  3H3G A;  3V5A A;  1H3D A;  5EQ7 A;  3JV9 A;  2H4I A;  4KI0 E;  3T9U A;  5CBR A;  4LQ5 A;  3LV0 A;  3C4M A;  3FZV A;  1DTZ A;  3TYH A;  2QFL A;  4DCY A;  1B3F A;  2Q2A A;  5A5X B;  3SEX A;  1SDX A;  4C1T A;  4UAB A;  3ILT B;  4KXP A;  5AA2 B;  4ECF A;  1MDQ A;  4GIZ A;  4P0G A;  2QMX A;  1FTM A;  1PEB A;  2ESN A;  4I8C A;  1BP5 A;  3HHF A;  4PFI A;  4HXV A;  4NMY A;  1XVY A;  1GR2 A;  2Y7R A;  3D1R A;  4X1D A;  2Y5L A;  2PFZ A;  5I5P A;  2OPE A;  4FIM A;  3CI8 A;  3TCF A;  1XI6 A;  4OES A;  5F24 A;  4NF4 B;  2QRY A;  1MXV A;  3K1N A;  3M3K A;  1URS A;  3MC2 A;  1S7Y A;  2DWJ A;  1Y9U A;  4XKP A;  4GX6 A;  3W9V A;  1POY 1;  3VV5 A;  3UP9 A;  4DI3 D;  4JWY A;  1S50 A;  3VE1 B;  2I4C A;  5I57 A;  3B6T A;  4XKN A;  4MHF A;  1SW4 A;  2HAU A;  4GBW A;  3B6W A;  3C33 A;  1QUL A;  1GV8 A;  4EXL A;  2RF1 A;  3M8U A;  2OPD A;  3B50 A;  3MP8 A;  4IGR A;  3O6G A;  4LVQ A;  1LBX A;  1JET A;  3SEV A;  1KA1 A;  1LGB C;  4I40 A;  4G4P A;  2XD3 A;  5ISU A;  3FJG A;  2QS4 A;  4GLI A;  2VPN A;  4OET A;  3B8B A;  4DXB A;  2NOO A;  2HEU A;  3T9H B;  3W9W A;  2CZH A;  1NV6 A;  4UAC A;  1D9Q A;  1L5T A;  5DEX A;  4X1B A;  2UYF A;  4I1D A;  2I0C A;  3B6Q A;  5KCJ A;  3HPI A;  1IMB A;  2P3V A;  3FJ7 A;  2QS2 A;  5JTY B;  4ZE8 A;  1Y3Q A;  2P2A A;  4G8M A;  1MG1 A;  2PCR A;  3PMV A;  1SW1 A;  2A5T A;  3G3K A;  1NMU A;  3T66 A;  3W15 C;  4KD5 A;  4UA8 A;  2V4C A;  2DE2 A;  2YPN A;  4TLL B;  1JVY A;  1QKB A;  2G29 A;  4N6D A;  1M5C A;  2NWJ A;  3UOR A;  3OO7 A;  4GWO A;  1FPE A;  3O29 A;  3UIF A;  3PU5 A;  4H65 A;  1OLC A;  1P1W A;  4NGU A;  4YMB A;  2PYY A;  1B1H A;  4ZZA A;  1SW2 A;  4GOT A;  5H8H B;  3UK4 A;  1CNQ A;  2XX7 A;  4OFJ A;  3ZKK A;  1JQF A;  4Q0C A;  1LCT A;  1EH3 A;  4PDD A;  4I3Y A;  4MLV A;  1USY H;  3Q25 A;  4XF5 A;  2RIN A;  5L9M A;  1VR5 A;  4QFL A;  3IOR A;  4NED A;  1LBZ A;  1SW5 A;  5AA1 A;  2FYI A;  4QFN A;  2R6G E;  1I6Q A;  3VXC A;  1Q9D A;  1QUJ A;  3UN6 A;  4IO6 A;  1MS7 A;  5I84 A;  1OQG A;  3K2D A;  4O8M A;  4DLD A;  4YB5 A;  5F1Q A;  2XWV A;  1FBC A;  4NQ8 A;  1N04 A;  1IIW A;  1BLF A;  4N13 A;  1P1O A;  4DCX A;  4OXV A;  3V89 B;  3O97 A;  2V84 A;  1EZO A;  3C34 A;  4KQP A;  3IOU A;  2G93 A;  3H6V A;  4YU0 A;  4DZ1 A;  3MP6 A;  4QFK A;  3C32 A;  4PDH A;  1FQA A;  1BK4 A;  3FV2 A;  1FPJ A;  2KLF A;  2KQZ A;  1BKA A;  4NG7 A;  4GD5 A;  4JSO A;  4N91 A;  4PFW A;  1Y4T A;  3LUY A;  1P99 A;  4NF5 B;  3U94 A;  1EU8 A;  2X26 A;  3ODB A;  2F8D A;  4OFL A;  2DP8 A;  4C1U A;  1QGX A;  3A09 A;  3H03 A;  1H45 A;  4YB7 A;  1LLS A;  1O7T A;  2WX9 A;  3CFX A;  3EKI A;  1MDP 1;  3IB1 A;  4PFU A;  2F78 A;  1XS5 A;  3TQL A;  2FHY A;  4OTE A;  1IXH A;  5I58 B;  1B7U A;  5DTB A;  2GH9 A;  4ELP A;  5IZZ A;  1RDX A;  1M5D A;  3FVK A;  3VDF A;  4Q5T A;  2XXU A;  1I6A A;  2CEY A;  3PV0 E;  1B7H A;  1D3K A;  3K6V A;  2R71 A;  1B46 A;  2DXR A;  3R26 A;  4EF1 A;  3DEL B;  1UTH A;  3TPA A;  4THI A;  2OWS A;  1J1N A;  4U22 A;  2ONR A;  1O64 A;  4PFT A;  4GXS B;  3S9L C;  4P1L A;  3PPR A;  4ZE9 A;  5AA4 A;  4PGP A;  4BDM A;  2CMO A;  2O6A A;  2XWI A;  4R9G A;  3JYR A;  4WKM A;  1PBP A;  2RKM A;  1FQC A;  4NE4 A;  4JSD A;  2ALU A;  2Z8D A;  3DM0 A;  4FED A;  3TUS A;  3FVO A;  3MZ1 A;  3A3C A;  3O9P A;  2QPQ A;  4U2R A;  3TTM A;  4KYE A;  4FAJ A;  1VFD A;  1SVX B;  4MEV A;  4GRK A;  5H8Q A;  1UQW A;  3TQW A;  2ZYO A;  5K2X A;  1FTL A;  4AB5 A;  4P56 A;  5EYG A;  5EYH A;  1LBB A;  1EYJ A;  3FIR A;  3G3G A;  3LC8 A;  3QXM A;  3MZ9 A;  1PB9 A;  4NHB A;  4IR8 A;  1DPP A;  1B3G A;  3BIG A;  3RQT A;  3MAM A;  4MNC A;  1B0H A;  3PUY E;  4ELR A;  4ESW A;  1CB6 A;  3TAJ A;  1ZLQ A;  2B4L A;  4R6K A;  3RT8 A;  4PFB A;  2I6E A;  2RCA A;  4KFQ A;  3S9N C;  3MQ9 A;  4F39 A;  3TKD A;  5LTC A;  3G3J A;  4MIJ A;  2XA5 A;  3FD3 A;  3OO6 A;  3TOD A;  1FTO A;  1QKA A;  3R7X A;  2O69 A;  3H6W A;  3T9V A;  4G68 A;  2HAV A;  4O3B A;  1NH8 A;  1LB9 A;  2H9B A;  4LN5 A;  4PTK A;  3USD A;  4AQ4 A;  5I59 A;  2X7P A;  1SI0 A;  5IAI A;  1ATG A;  1B58 A;  4WEP A;  2XXX A;  2ZYN A;  1FRP A;  1K9Z A;  4MBP A;  2REG A;  2ONK E;  2VPO A;  1LAF E;  1R9Q A;  1MPB A;  4MFI A;  5EYF A;  4U4S A;  3EN3 A;  2WYK A;  4JVC A;  3FAS A;  5ITP A;  1YZ0 A;  2QJE A;  4QHQ A;  5FHO A;  1N7X A;  2UVH A;  4PFR A;  1N84 A;  1AWB A;  4FJP A;  1RDY A;  4KHZ E;  4LON B;  5H8H A;  2F7B A;  4YKI A;  2CZK A;  1B5I A;  4MH5 A;  5CI5 A;  4MNI A;  4H5G A;  3K6U A;  1LAX A;  1FBP A;  3O6H A;  3PD9 A;  4QBA A;  4R6Y A;  1HSE A;  4RPO A;  4RY1 A;  2Y7I A;  2XXK A;  3P7I A;  4XTC Q;  3RYD A;  4ZS9 A;  1MY4 A;  3ZSF A;  1UIV A;  5I56 A;  3FUZ A;  1Y1M A;  3ROJ A;  3LSL A;  3WAE A;  3H6U A;  3BBR A;  3TMG A;  3HST A;  3SEW A;  3TTK A;  3H6T A;  3OO9 A;  3DLN A;  4GWZ A;  4P47 A;  3OSQ A;  3MZB A;  3RPL B;  4PF8 A;  1B9J A;  1IEJ A;  4FAT A;  2O7U A;  3KBZ A;  3K6X A;  4NF6 B;  1B4H A;  2Z23 A;  4OEU A;  3F11 A;  1HSL A;  3EHU A;  4F1U A;  4ZEB A;  1LAH E;  2R9J A;  1UTB A;  3KC1 A;  3Q29 A;  3GZG A;  3HV1 A;  2PBW A;  4MX6 A;  1A55 A;  5FHM A;  4QSD A;  2GHB A;  1MXW A;  4QFO A;  1LST A;  4NF5 A;  4DDD A;  2XXQ A;  4PP0 A;  4PAK A;  3MBP A;  5AE4 A;  2WKY A;  3FVN A;  1KWH A;  1LBW A;  1WDN A;  1Y3P A;  4ESX A;  2DQV A;  4LP2 B;  1SYH A;  2DS9 A;  5TP9 B;  4O7M A;  2O68 A;  2ONS A;  3PPP A;  1CE2 A;  5TPA A;  2DWI A;  2QL3 A;  4OMB A;  2HFB A;  1A8E A;  4F1Y A;  2D21 A;  2HQ0 A;  3I5O A;  5I7I A;  4GX4 A;  4ND9 A;  3KN8 A;  5ICQ A;  4IY5 A;  2Y7P A;  5IZ3 A;  4NAP A;  3ILU B;  4MJO A;  1Y3N A;  4G61 A;  1MQJ A;  5DVI A;  1IMF A;  1USY E;  2O84 X;  1MXX A;  2ZNS A;  4N6P A;  4R9F A;  1P1Q A;  5H8N B;  4PFY A;  2CEX A;  4RPN A;  3E9X A;  4ZEI A;  4OFO A;  1N76 A;  3SET A;  1ELJ A;  4OAN A;  4KPT A;  4DXC A;  3G3I A;  5L9S A;  2ZNT A;  4PGN A;  3SZP A;  3GLB A;  4P3L A;  3MJN A;  2NXO A;  2VD3 A;  4ZDM A;  2I3W A;  1NNP A;  1D9Y A;  1H76 A;  5TU0 A;  2Z8F A;  1IXI A;  4N6K A;  3D4C A;  1HSJ A;  4O3C A;  3PD8 A;  1WOD A;  2V3T A;  4HE1 A;  4O3A A;  5LOM A;  1XVX A;  2XHD A;  2HCA A;  1NUX A;  1XC1 A;  3E78 A;  2DWA A;  3MW0 A;  3K4U A;  3SDF A;  3EF7 A;  4QFP A;  2QS1 A;  3WAF A;  1WVJ A;  3FAT A;  3IR1 A;  4N8G A;  2OJT A;  5I2K A;  2F7A A;  2I49 A;  2BJJ X;  2GRV A;  3S2V A;  4GBV A;  2I48 A;  3KZG A;  3EPE A;  3N26 A;  4ZZE A;  3ONM A;  4GQO A;  5IGA A;  3CFZ A;  2ABH A;  4PQJ A;  2YJP A;  2BJI A;  4XKR A;  4MCO A;  2WYP A;  4JXI A;  3G3F A;  5BUU A;  1INP A;  2GFE A;  4QSC A;  2VD2 A;  1NI9 A;  1FTA A;  3PPO A;  1B4Z A;  1LCF A;  3KSJ A;  1EYI A;  4PF6 A;  3G3H A;  3L6G A;  2VHA A;  3M3L A;  3FXU A;  1NUZ A;  3LSX A;  5CMC A;  4OEV A;  3T9X B;  1B3L A;  5KDT A;  3RN8 A;  3ECR A;  3PTY A;  3R6U A;  4OVR A;  3FXQ A;  2QVU A;  4YKK A;  2Y84 A;  2XXY A;  2ZYM A;  3UA8 A;  4OVJ A;  5B7D A;  2P3N A;  3K6W A;  4HCY A;  4PC9 A;  1NL5 A;  5FHN A;  2FBP A;  4U1O A;  2H98 A;  1MXY A;  4BLA A;  3T1B A;  3GXA A;  5HM4 B;  3QAX A;  1B32 A;  2I58 A;  5H8F A;  1LAG E;  2UXA A;  1GTK A;  2HZL A;  3E4R A;  2FNC A;  3PUV E;  4FBP A;  1A99 A;  1AL3 A;  4H0W A;  3PPN A;  4KYS A;  4U23 A;  4GWW A;  4H5F A;  3RUM A;  5FBP A;  2XX8 A;  3CHG A;  3RT6 B;  2H25 A;  4ONY A;  4X48 A;  4N07 A;  5CMK A;  3K02 A;  3BIH A;  4N81 A;  5DYH A;  3T0J A;  5I2N A;  4NWD A;  3TDJ A;  1FPL A;  5JK4 A;  4TOZ A;  4YB6 A;  3FGS A;  1MH3 A;  2UVI A;  3SKP A;  1A54 A;  2UYE A;  2F34 A;  4FE8 A;  1FBF A;  3OXN A;  1B40 A;  3O28 A;  3EHT A;  1NV0 A;  1IQ7 A;  4PE3 A;  1M5B A;  1G0H A;  1N0T A;  3KEI A;  4IY6 A;  5HPQ A;  1OQH A;  3IX1 A;  4GFR A;  1YCJ A;  1JEV A;  3FBP A;  1LEV A;  2VGQ A;  2XXI A;  4U21 A;  1NV3 A;  2FVZ A;  2VOZ A;  3OEN A;  2RC9 A;  4Q8R A;  3IFA A;  1PB8 A;  1O63 A;  2F5X A;  2IA4 A;  5CMM A;  1I69 A;  2NUV A;  5ET7 A;  4JWO A;  1N7W A;  5IKB A;  1MY1 A;  3OO8 A;  2DXY A;  3CG1 A;  2QMW A;  3VLV A;  1NNK A;  3HO7 A;  4NF0 A;  3RTW B;  1MQH A;  3N6U A;  4AS5 A;  3CSG A;  3ZKL A;  5A5X A;  4E0X A;  4AS4 A;  4EDP A;  5AA2 A;  1AOV A;  2R8T A;  4KCD A;  3K1P A;  2DVZ A;  1AMF A;  1TWY A;  4YZZ A;  4Z7E A;  3OEL A;  1Q35 A;  4DE8 A;  5CBS A;  1MXZ A;  2OWZ A;  3CR9 A;  1B7Z A;  3VXB A;  4G68 C;  3SEU A;  4ZEF A;  2ZYK A;  1UIU A; 
#chains in the Genus database with same CATH homology
 4HE2 A;  1FPD A;  4PAI A;  5J16 A;  1XI6 A;  4PBH A;  2WYK A;  4JVC A;  5F24 A;  3NOH A;  1YZ0 A;  4PFR A;  1K9Y A;  4GX6 A;  1AWB A;  2JJK A;  1RDY A;  3W9V A;  4DI3 D;  3A29 A;  2CZK A;  1G0I A;  4O7I A;  4MNI A;  1FJ6 A;  1FBP A;  2ZZV A;  2HZK A;  4N17 A;  2GQ1 A;  4QBA A;  1FPF A;  2XXK A;  4MHF A;  4N4U A;  2DE3 A;  1NV5 A;  3RYD A;  4GBW A;  5EQ8 A;  3MST A;  3QMF A;  3ROJ A;  1FPB A;  3E79 A;  3B50 A;  4N15 A;  1DK4 A;  4XEQ A;  2QVV A;  1LBX A;  4GWZ A;  4P47 A;  1KA1 A;  4I40 A;  3RPL B;  4PF8 A;  3RPL A;  2VPN A;  3B8B A;  4F1V A;  3KBZ A;  3W9W A;  2CZH A;  1NV6 A;  1D9Q A;  4F1U A;  3KC1 A;  2FIE A;  3MYU A;  4MX6 A;  4XFE A;  1IMB A;  2P3V A;  3HFU A;  1VDW A;  4PAK A;  5DW8 A;  1LBW A;  1RDZ A;  4PCD A;  2PCR A;  4O7M A;  2Q9T A;  2V4C A;  4PAF A;  2DE2 A;  1EYK A;  3IFC A;  3LUZ A;  4OVT A;  5EQA A;  4N6D A;  2WBD A;  5I7I A;  4GX4 A;  5IZ3 B;  5ET5 A;  2ZZW A;  5IZ3 A;  4NAP A;  1FPK A;  1FPE A;  4MJO A;  4GX3 A;  1IMD A;  1FBE A;  4G61 A;  1IMF A;  5IM2 A;  4NGU A;  1DCU A;  4OVP A;  5EQ9 A;  2DE4 A;  2CEX A;  1CNQ A;  2CZI A;  1SPI A;  4OAN A;  4PDD A;  4I3Y A;  4DI4 B;  1FPI A;  4PGN A;  4XF5 A;  3SZP A;  2HXR A;  4P3L A;  4OA4 A;  1LBZ A;  2QVR A;  1JP4 A;  4GWU A;  2XWO A;  4N6K A;  1FJ9 A;  2WEF A;  1NUW A;  1Q9D A;  4O8M A;  1IME A;  4HE1 A;  4O94 A;  2F3D A;  2XWV A;  1FBC A;  4GWS A;  4NQ8 A;  4P9K A;  1NV4 A;  1NUX A;  3E78 A;  4PET A;  2VT5 A;  1FBD A;  4F18 A;  4N8G A;  3ISP A;  5ET6 A;  2FIX A;  4GBV A;  4PDH A;  1BK4 A;  5IGA A;  4OVQ A;  4H46 A;  2BJI A;  1FPJ A;  2KQZ A;  2ZZX A;  2KR0 A;  4MCO A;  2WYP A;  4NG7 A;  4MMP A;  4X9T A;  1INP A;  4N91 A;  4NX1 A;  1NI9 A;  1FTA A;  1EYI A;  4PF6 A;  1NUY A;  1QGX A;  2Y5K A;  2F3B A;  2B4M A;  2DDK A;  2WX9 A;  3EKI A;  3KC0 A;  1NUZ A;  1IMA A;  2XWK A;  5LDZ A;  4PBQ A;  1DBZ A;  3PTY A;  2FHY A;  4M1V A;  4OVR A;  2QVU A;  2Q8M A;  4MAG A;  3U65 A;  5I3S A;  5IZZ A;  1RDX A;  1KZ8 A;  2P3N A;  4HCY A;  4PC9 A;  2CEY A;  2FBP A;  4N8Y A;  1KA0 A;  3T1B A;  2HPG A;  4X04 A;  4GWX A;  1FBH A;  2HZL A;  4FBP A;  1NV1 A;  5T3J A;  4OVS A;  2Q74 A;  4P1L A;  4GWW A;  4PGP A;  2XWI A;  2HHM A;  5FBP A;  3CHG A;  3BIH A;  4N81 A;  4P8B A;  4X8R A;  2OX3 A;  3T0J A;  2MKZ A;  4YIC A;  1FPL A;  5JK4 A;  4H45 A;  2PFY A;  5J1D A;  5CM6 A;  2QPQ A;  1YYZ A;  4I3E A;  4MEV A;  1LBY A;  1FBF A;  4P56 A;  5A5L A;  1YXI A;  5EYG A;  5IZ1 A;  2L5V A;  1NV0 A;  5EYH A;  1EYJ A;  4PE3 A;  5ET8 A;  1G0H A;  4HCW A;  4JVI A;  4NHB A;  1LBV A;  3FBP A;  1LEV A;  1NV2 A;  4IR8 A;  3FXB A;  3BIG A;  1NV3 A;  2FVZ A;  5ESY A;  4MNC A;  1FPG A;  3IFA A;  4F19 A;  2F5X A;  5ET7 A;  3GYY A;  5EQ7 A;  4GWY A;  2B4L A;  4PFB A;  3LV0 A;  1NV7 A;  2WBB A;  2QFL A;  4JVD A;  5LTC A;  4QXD A;  4MIJ A;  2XA5 A;  1FSA A;  4NF0 A;  4UAB A;  4KXP A;  5I5P A;  4AS5 A;  1IMC A;  1FBG A;  4AS4 A;  4P1E A;  2R8T A;  4HE0 A;  2DVZ A;  4LN5 A;  4PTK A;  4YZZ A;  4PFI A;  4HXV A;  4NN3 A;  2OWZ A;  4MNP A;  2V3Q A;  1FRP A;  3D1R A;  1K9Z A;  2Y5L A;  2PFZ A;  2VPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...