3LV0A

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
258
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEVQNLQVSLKGPADYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPHLPGHGTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extragenic suppressor protein suhB
publication title Crystal structure of extragenic suppressor protein suhB from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Hydrolase
total genus 84
structure length 258
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3lv0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3lv0A02
1LBVA 5ET6A 2CZKA 1YYZA 1RDXA 5ET7A 2WEFA 1YXIA 5LDZA 1IMBA 2FVZA 2Y5LA 1FSAA 4GWYA 4GWWA 2Q8MA 4G61A 4GWXA 2FHYA 1YZ0A 2P3NA 5IZ3A 3RPLA 1NV1A 1NUZA 4PTKA 4H46A 3B8BA 4I3EA 4HE1A 5ESYA 5IZ3B 1DK4A 2DDKA 1KA0A 5EQ7A 1FJ9A 2R8TA 1FBEA 1CNQA 3FBPA 4O7IA 1NUYA 4GBWA 4KXPA 4GWZA 1EYJA 5EQAA 1FTAA 1RDZA 1SPIA 1NV2A 5F24A 2FIEA 4I40A 1LEVA 1LBYA 2JJKA 1FPBA 1AWBA 3IFCA 1LBXA 1QGXA 1FBFA 5FBPA 2QFLA 1IMFA 1NUWA 4HE0A 1RDYA 1NI9A 1EYIA 4MJOA 1G0IA 2Q74A 2VT5A 1Q9DA 1K9YA 1NV6A 3BIGA 5ET8A 4QXDA 2F3DA 1KA1A 2FIXA 1LBWA 1DCUA 5EQ8A 1FPLA 1FPJA 5I3SA 3RPLB 1K9ZA 5T3JA 3D1RA 4HXVA 5IZ1A 1FPEA 1NV4A 1IMAA 4GWSA 1BK4A 5DW8A 2CZHA 5EYHA 2OWZA 4HE2A 1JP4A 3BIHA 2GQ1A 1FPDA 3QMFA 1FBPA 3A29A 3LV0A 2BJIA 3T0JA 4I3YA 1IMDA 1LBZA 1FBGA 2Y5KA 3IFAA 2OX3A 2P3VA 1NV5A 1NUXA 1XI6A 4GX4A 1IMCA 1FRPA 1KZ8A 1NV0A 4GX6A 5J16A 1FBDA 2F3BA 4GWUA 4N81A 4GX3A 3RYDA 2PCRA 3KC0A 2HHMA 2QVUA 1FPFA 4FBPA 5EYGA 2CZIA 1FPIA 4AS4A 3ROJA 1FPKA 4AS5A 1IMEA 1DBZA 1FPGA 1D9QA 2QVRA 3KC1A 3LUZA 1INPA 1VDWA 1FBCA 3KBZA 4IR8A 5EQ9A 4H45A 2WBBA 1FBHA 5ET5A 2FBPA 1EYKA 2QVVA 1G0HA 4GBVA 5A5LA 2WBDA 1FJ6A 1NV7A 1NV3A
chains in the Genus database with same CATH superfamily
2ONRA 2DVZA 4QFNA 4QFOA 4N13A 1DMBA 4IO6A 4GWOA 4E0WA 3H6UA 5LTCA 1BLFA 2FVZA 4IO4A 3OO6A 4KCCA 4KYEA 4PAFA 3KN8A 4EXLA 2I0BA 3ECRA 3N94A 3FD3A 3F11A 3EKIA 4BDMA 3SERA 2V3TA 2Q9TA 2O51A 4U1OA 3OMBA 2ONSA 4PQJA 1FBEA 4ZEFA 4DZ1A 3KZGA 3FXRA 2BJJX 4NAPA 2OZZA 5H8QA 3OEMA 2DOJA 3A3CA 1MG1A 3IORA 4MLQA 3KJ7A 4LQ2A 1WODA 4PE3A 4GL8A 3UN6A 1Y9UA 1JW4A 4JSOA 2RF1A 4H5GA 3OEKA 2LAOA 4EXKA 3TFLA 4ZZEA 2CZHA 4NF0A 4KCDA 4F39A 2F6GA 4IO5A 1IUDA 4ISUA 1H76A 1LB9A 2P2AA 5AA4A 2UVIA 2OWTA 2O68A 2R9JA 1QJMA 4MNCA 4H8IA 4GOTA 4PF8A 2Y84A 2XXPA 4U21A 2FYIA 1FPGA 3LUZA 3DM0A 3MYUA 3ISPA 4C0RA 3K6XA 4RNSA 5BWJA 5DT6A 2MKZA 4ZEBA 5EHSA 2P1SA 4MMPA 3NOHA 4TOZA 1MQDA 2F36A 2PMSA 5I84A 4NF4A 2VOZA 4GWWA 4G61A 2FNCA 1NUZA 1FQDA 2DWHA 4MHFA 3LBSA 4YB6A 4ZEDA 4XKPA 3OSRA 4WEDA 5I59B 1MDQA 4I40A 2P0SA 3S4UA 3TCHA 4F3BA 4NG7A 3O2AA 4BDRA 3PUXE 1VSOA 2VHAA 1MY1A 1JVYA 4UACA 2GH9A 2B3FA 5FTIA 2F7CA 4LVQA 1TT1A 4F29A 3T93B 4TQUQ 4IO7A 3V83A 3LSXA 3OD7A 5AA3A 1XVXA 1XI6A 3QUJA 4GX4A 2I58A 5KDTA 1VE4A 4P3LA 5ITPA 3O97A 5IZZA 5FHNA 1MY4A 4H5FA 1ZTYA 1JW1A 4ELPA 4N07A 1A99A 3N26A 3MUQA 1TWYA 4F31B 1IXHA 4R6KA 4DCXA 1N3XA 1UTHB 4XFEA 4ND9A 4G77A 4F1VA 4ZE9A 4R6HA 4N17A 2AL5A 1B58A 2D5WA 2VD3A 1B0LA 5ET6A 1YYZA 1OIBA 3I3VA 4MNIA 2KLFA 3OENA 5I2KB 1Y1MA 4PAKA 3PMXA 4EF2A 4G68A 4JWYA 4PFRA 4Z7EA 1NH7A 4ONYA 5IZ3B 1EZ9A 4F18A 1SBPA 3V8XB 1MXWA 4PCDA 5F7VA 4X8RA 1RDZA 1LFGA 3CIJA 3N6TA 3G3HA 2B4LA 1LBXA 3C35A 1ELJA 1G0IA 1NV6A 5AA2A 1LBWA 1P1UA 3PPPA 3RLFE 4DCYA 1GTKA 3R6UA 1URSA 3GLBA 3MW0A 4OFLA 1BK4A 1QUIA 2IA4A 5H8NA 5CBSA 1R6ZA 2GQ1A 3TAJA 2XX7A 1LCFA 2ZYMA 1IZ1A 1FBGA 2V3QA 3IFAA 5I5PA 1FTKA 2Z22A 4GFRA 3MVXA 2F3BA 4IB2A 4GWUA 2H25A 4RY1A 3UP9A 1B6HA 1RYXA 2HCAA 5I58A 1OVBA 4IY5A 1B7ZA 3PGFA 4GLIA 5B7DA 5TPAB 4MAGA 3SESA 4PAIA 1IIWA 3MVZA 1SDXA 4U22A 3THIA 4RYAA 1A8EA 4TLMB 3MP8A 2CZKA 3PUWE 4QSEA 3DP4A 4FORA 5LDZA 3PPOA 3G7WA 4Q30B 2NVUB 1RYOA 4BDNA 3E79A 4PTKA 1AOVA 4I3EA 3B8BA 3K01A 4KYSA 1DK4A 3PPNA 4OVPA 4N91A 3PD8A 3E4RA 3FXBA 3GXAA 3VLWA 1PBPA 3T9UA 4GL0A 4N6PA 2AL4A 2DYXA 4PFYA 1LAFE 4YKPA 5ICTA 3RPWA 5ISUA 1DTZA 2VT5A 2OWSA 3MVYA 3HHFA 4YKKA 3K6VA 2DP8A 1PC3A 3D1RA 4DLDA 3IOWA 4MLVA 4OZ9A 3M3KA 1Y3PA 1LB8A 3BIHA 3MVWA 2RINA 3B7DA 3H6VA 3RUMA 4RXLA 1N0TA 3H7MA 5ICQA 2Y5KA 3EPEA 2OX3A 3K4UA 4X1BA 2QRYA 4P1LA 3SEUA 4NWDA 2WYKA 3S9MC 2E0SA 2HHMA 4MCOA 2HXRA 2A5TB 4M1VA 3ROJA 5DTBA 1IMEA 1D9QA 3PU5A 2Y7WA 3QK6A 4O3AA 3EHTA 4OHNA 2WBDA 1B3FA 1F9BA 3B6QA 3VXCA 4NF5A 1DOTA 3RT6B 5AE4A 4YAHX 4LZ7A 3KBRA 4ZEIA 4RPOA 3CFXA 4GXSB 4YU0A 1M5CA 3K6WA 4O3BA 4GWXA 3TYHA 2XXUA 3O66A 1XS5A 4KFQA 3TTRA 3IB1A 1KA0A 4R2BA 2R8TA 4JBZA 1ZMGA 4F3PA 2XXWA 4UABA 4I8CA 1MPBA 2AIXA 4HE0A 4QSCA 4MJOA 4XXUA 1B51A 1FTLA 3A3UA 2FIXA 3KN3A 3IO6A 1MRPA 1UTBA 3MP1A 1B7HA 5IZ1A 2H9BA 5DEXB 3ZSFA 1URGA 4OA4A 1LBCA 4JVIA 4U23A 1FPDA 4OVSA 2BJIA 3OO9A 2XA5A 3RY3A 4F2QA 1KZ8A 5J16A 5DYHA 3WAEA 1UIVA 5I2NB 1Q35A 4XKQA 2A5SA 4OMBA 4DI3D 3S2VA 3O28A 4RJZA 1SW1A 4NF8B 1JETA 1UIUA 4PBQA 1FBCA 3FGSA 2Y7IA 1EYKA 2VP1A 2Y7RA 1VFDA 3C32A 1SYIA 3RGYA 4I1DA 5IM2A 4LA9A 3AXFA 2E1SA 3KJTA 3S9LC 1TFAA 2I4CA 1ZBMA 3EHUA 1N84A 3FJ7A 1YXIA 4F1UA 3JV9A 3B6TA 3MPKA 1EH3A 3TKDA 1B52A 3TDJA 1SD3A 3USDA 1CNQA 3FBPA 3ONMA 5EQAA 4YB7A 3B50A 3IX1A 3K02A 2V4CA 5H8HB 4KHZE 2CEYA 4NEDA 4YKIA 3C9HA 1P1OA 5TP9B 4H67A 4U1ZA 1DSNA 5FTHA 1KA1A 4THIA 3I5OA 4UA8A 1FPEA 2X7QA 2NOOA 2XXXA 3MQ9A 4GD5A 1BP5A 4GXAA 4PETA 4P47A 4ELQA 3FATA 2OK2A 5L9MA 3SDFA 2O69A 4R73A 1SQYA 1JQFA 3KN7A 1R9QA 3PMVA 5KZTA 2V3UA 1N7XA 5J1DA 3IK6B 1BKAA 2F7AA 1MQJA 3QXMA 1MXXA 2CZIA 5JTYB 2PFYA 3O29A 4NQ8A 4O94A 4OQOA 1B3HA 2GHAA 2I0CA 1INPA 4ZEKA 1YCJA 5CMMA 1FQCA 1FBHA 3RT8A 1US5A 2H5YA 4M4GA 2XHDA 1P99A 5I59A 4R6YA 2XD3A 1NV7A 4RK9A 1DPEA 1R1NA 3SZPA 2F7BA 1US4A 4P11A 3LUYA 3U94A 3FJGA 1MXVA 3M3FA 4ESXA 3K1MA 4GBWA 3RTWB 3FVNA 1N3WA 3S9NC 1LEVA 3PMWA 1B2HA 3H03A 1OQGA 1MQGA 4ECFA 2F34A 3K00A 4LN5A 5H8SA 3O6GA 4KYDA 3SEVA 1UQWA 1K9ZA 4FATA 4ELRA 4GWSA 1NV4A 1IMAA 3PPQA 5EYFA 3TTKA 4HE2A 3LSWA 1UTHA 2XXTA 4BLAA 1NV5A 4RA1A 4F2OA 1YTVA 2Q2AA 2YLNA 2Z8EA 2QS2A 3EHSA 4OFOA 1NKXA 3CI8A 3IOTA 1SI1A 4OTEA 3SETA 3K1NA 4Q5TA 5I2KA 1TXFA 3H3GA 4YMBA 2HXWA 2ZZWA 3C36A 2OCUA 4G8HA 5EQ9A 1G0HA 4GQOA 2I4BA 3CFLA 4GF8A 4AQ4A 1NL5A 3K2DA 3ZKKA 4QFKA 2WEFA 1I6BA 5ELVA 4PGPA 3OOAA 4DDDA 1XHYA 4HW8A 4K3FA 3Q29A 4HTGA 3CVGA 4H46A 4PE5B 5ESYA 3G3GA 3TZAA 1MY0A 2XXYA 1II5A 4MEVA 4KXPA 1B46A 2H99A 2DWJA 3VLVA 1S7YA 1FBFA 4PFUA 1FCKA 2F6PA 2PX1A 1WVJA 2QJEA 4PGNA 1Q9DA 1K9YA 3BIGA 3MJNA 5ET8A 4QXDA 3VVEA 3OO7A 5EQ8A 2ZZVA 3GBAA 1FPLA 1FQFA 4OENA 1Z7NE 1BTJA 4TLLB 3UIFA 4PBHA 5TPAA 4NF6A 1B40A 5DW8A 2DWIA 3TTMA 2B65A 4FEBA 2Q2CA 5HPQA 2RKMA 4F3GA 1EZPA 4DXCA 2GFEA 3T9XB 2ZMBA 2F5XA 4EQBA 2R6GE 1Z7ME 1LGBC 2D3IA 2DSFA 2HAVA 1ZIUA 2CZLA 3QUFA 3FUZA 3K1PA 2ZYNA 1KWHA 1JEVA 1NFTA 2HQ0A 1DTGA 1VDWA 3KBZA 4IR8A 1LFIA 4JDFA 4HCYA 3DELB 2PT1A 2UVGA 4OXVA 1XVYA 2PT2A 4DXBA 2RC9A 1FJ6A 4MIJA 4OETA 3H4ZA 4YKJA 1JNFA 5HM4B 2Q8MA 2HAUA 5JK4A 4PFIA 2ZNTA 2REGA 4G68B 3L6GA 4QSDA 1MY2A 3G3FA 4IO3A 2V93A 1SPIA 2G29A 2DQVA 5CM6A 5L8DA 3FVGA 3BFTA 1NUWA 3ILUB 1NI9A 1B5JA 4LP2B 5A5XB 3T66A 5I57A 1LFHA 4Z0IA 4O3CA 2QS3A 2F3DA 3HO7A 4PFWA 5AA2B 4JXIA 5T3JA 5K2XA 4G68C 3UORA 4NMYA 1SW4A 1I69A 3KFMA 2DE3A 4FJPA 3A29A 3TMGA 3T0JA 4OANA 3N5LA 3VE1B 1IMDA 1LLSA 2PFZA 4X1DA 1NV0A 1TFDA 3CG1A 3TPAA 3TEPA 3C31A 2Y7PA 2Q89A 2Q8JA 3G3KA 4NTLA 4KD5A 5EYGA 5TU0A 2ZZXA 3CRBA 5IKBA 2QPQA 3PPRA 3SKPA 5AA2D 5CMKA 2WBBA 1SVXB 1M5BA 3H6TA 4ZS9A 4MX6A 4MFIA 2Z8FA 1ZU0A 5DVJA 1QW0A 5ET7A 4R72A 4U2RA 1A55A 3K0VA 1ZLQA 4LZ8A 1LAGE 4R9FA 2I48A 4OEVA 2REJA 1NV1A 5HBCA 1Q1KA 4H0WA 5DEXA 4ZECA 4YICA 3V5AA 3M3LA 2ZYOA 2H98A 3IOVA 1IXCA 1H44A 1VR5A 5CI5A 3PUYE 4LUBA 4POWA 4QHQA 2FIEA 3C33A 2GRVA 1EZOA 5DVFA 4OYVA 5H8FB 4DE8A 2ABHA 1XT8A 5I2NA 3OSQA 1O63A 1DPPA 4PF6A 3RPLB 3TTLA 3SEYA 2L5VA 5B70A 1IEJA 4OVQA 2Y7KA 2UXAA 4H1XA 3TCGA 3CG3A 4ZE8A 3UGWA 4EDPA 3LV0A 5M2VA 2B4MA 1FQAA 4MNPA 2XWKA 3TUSA 3A09A 1Y1ZA 5L9SA 2G93A 1YPNA 1OVTA 3LR1A 4XEQA 4OFJA 1FQBA 2VGQA 5KCJA 4H65A 4G4PA 2X26A 4O7MA 2XXHA 1FPFA 2I6EA 3UA8A 3B6WA 3CSBA 2FA7A 3MZ1A 3KEIA 3TQWA 3BKIB 4AB6A 4EQ9A 3TQLA 5CBRA 4NGUA 2IEEA 4H45A 3TCFA 4I9DA 4KPTA 1JEUA 1OQHA 1H3DA 3T1BA 2AYSA 1CE2A 5H8HA 1MH4A 5FHMA 4KI0E 3MZ9A 4MH5A 2OBGA 1Y4TA 1IMBA 4RK2A 1T0KA 3T22A 3Q28A 4BDQA 3RNNA 2ANJA 1SYHA 1S9TA 3TTNA 5EQ7A 3DLNA 4X04A 2XWVA 3RN8A 2QMWA 5F24A 1MPDA 1B1XA 1B3EA 1RKMA 1QGXA 2OJTA 1P1WA 4MBPA 2O6AA 3U8QA 1NNKA 3FVKA 2OLBA 1DCUA 3CHGA 1MS7A 4NE4A 5EHMA 4LATA 3FVOA 4QF9A 4QBAA 1JW5A 1PB9A 3E13X 5I56B 3IB0A 1B05A 1FBPA 1A7LA 4MF3A 1FQEA 3MP6A 1NUXA 1B3LA 2PBWA 4GX6A 1M5DA 3TODA 4PDHA 3DP6A 3QAXA 4OESA 1GVCA 3L6HA 1FPKA 4YZZA 3IO4A 4NN3A 3ZKLA 1MXUA 3MZBA 2FBPA 2QVVA 1P1NA 3OO8A 3HFUA 4IGRA 3CFZA 1IITA 1LSTA 3OXNA 2NUVA 4LQ5A 1CB6A 3IJOB 3FASA 3ZS6A 1SI0A 1FTMA 4LZ5A 2CEXA 2P3NA 5FHOA 1Y3NA 2F35A 4GWZA 4F1YA 3O6IA 1NNTA 1P1QA 2ZNSA 5K2YA 1MM6A 4Q8RA 3QYTA 1PEBA 2HFBA 2WX9A 1RDYA 4G2ZA 3E3KA 2D21A 1FTJA 4N6KA 5I3SA 1QUKA 1QVSA 5ITOA 1H45A 3RTFB 4U4SA 2NXOA 3GZGA 1ZJLA 2F78A 5H8QB 3W9VA 4KQPA 1Y4CA 3LSLA 1LBZA 4HS7A 1MXZA 1A40A 4G8NA 2OPDA 1B1HA 1FBDA 4JB7A 1JVXA 1PBQA 4OVJA 1MPCA 4N15A 2XX8A 4DI4B 4GX3A 3RYDA 4ZDMA 2QVUA 2XXVA 1PB7A 3C34A 3QSLA 1GV8A 3LSFB 3KC1A 3W9WA 2QVRA 3I6VA 4DIGA 3JZJA 5DVIA 2V25A 4EQ7A 2QS1A 5AA4B 2NWJA 1AL3A 1ZKBA 4P1EA 2XX9A 4OEUA 3VVFA 2HPGA 1NV3A 2QMXA 4N8GA 3VFJA 2O1MA 2V84A 5CC2A 1B3GA 1N04A 1IXGA 1FSAA 4GWYA 3H6WA 3T9VA 3VDFA 2X7PA 2QSXA 1POTA 3Q27A 2I3VA 3VLUA 5IZ3A 4LONB 4HE1A 4N8YA 4P0IA 5JEIA 3KOSA 1B7UA 2GHBA 2VD2A 3O9PA 1FJ9A 4GRKA 2DVCA 2B3BA 1EYJA 1FTAA 4Q0CA 1NV2A 4EF1A 4RPNA 1LBYA 1HSLA 3GBBA 3R7XA 4C1UA 3PTYA 4NF4B 4POXA 1AIVA 4N4UA 4BDLA 4PFTA 4NHBA 1FPJA 1I6AA 1O7TA 1QKAA 3OELA 2O7UA 1SW2A 5EYHA 4R2FA 1B5HA 1ATGA 1IQ7A 2PVUA 1WDNA 4ESWA 4WKMA 3MAMA 4FECA 3D4CA 3VVDA 4H8JA 1FTOA 1B0HA 4IGTA 3U1OA 2CMOA 3IAZA 2XXKA 1QUJA 3IR1A 2UVJA 1FPIA 4AS4A 2ZYKA 2XXQA 1DBZA 4XKNA 1XC1A 2HEUA 3QIMA 3SEXA 4FE8A 2O84X 3HV1A 1N76A 4P9KA 3JYRA 5KDTB 3HSTA 4P8BA 3Q25A 4FIMA 2DXYA 1H43A 1J1NA 1SW5A 5A5XA 3PD9A 3E78A 3HN0A 4I62A 1YZ0A 1BIYA 2WYPA 4WEPA 1LCTA 5CMCA 1MM7A 4OVRA 2XWOA 2ESNA 1MQHA 2RC8A 3R26A 3U92A 4PFBA 4OERA 2XD2A 3C4MA 4O8MA 4H6DA 4DXUA 1S50A 1FPBA 4PP0A 4JWXA 2DXRA 4JVDA 2UYFA 1OMPA 2XXIA 3HHGA 2Q74A 3E9XA 3T96B 1NNPA 1QKBA 4KR5A 3N6UA 4R74A 3W15C 2RCBA 3FZVA 5I7IA 3CR9A 4HCWA 2ZXTA 4WXJA 3K6UA 2DE4A 4NF6B 3D4GA 2O7IA 3QMFA 3SEWA 2YJPA 3HCQA 4R75A 2Z8DA 1URDA 1Y3QA 2HZKA 1GGGA 1NH8A 4XTCQ 4ELOA 1POY1 2A5TA 2OPEA 1MQIA 2QS4A 3T9HB 3FV2A 1R9LA 1I6QA 5H8NB 4AS5A 4IO2A 4F22A 1USYH 1VFEA 3FXUA 4C1TA 1D4NA 2H4IA 4EUOA 5I58B 3UK4A 4JSDA 1NMUA 2Y5LA 3GYYA 5H8FA 5L9OA 3IB2A 1GR2A 4P56A 5IAIA 4QFPA 3RPLA 3IJXB 4N6DA 3KSJA 3U72A 3V89B 3DP8A 1B4HA 2ONKE 2JJKA 3IFCA 5FBPA 4JVCA 1IMFA 1M5EA 3KOTA 1EYIA 1MY3A 4NX1A 5AA1A 3KGCA 4PC9A 2Z23A 3EQ1A 5BUUA 3KG2A 2UVHA 3EN3A 2RCAA 3MWBA 4FEDA 5I57B 5LOMA 2XXRA 2M8CA 1B9JA 4XKRA 2THIA 4HXVA 3KSXA 2HZLA 3G3JA 2VPNA 1A54A 2QL3A 2OWZA 3VXBA 3BFUA 2I3WA 3G3IA 3PV0E 4QFLA 4XIGQ 1IMCA 3VV5A 3FXQA 2WKYA 1LBBA 3MPLA 3U93A 4JWOA 2UYEA 4F19A 1B32A 4N81A 5F1QA 2I49A 4X9TA 1IXIA 2Q88A 1HSEA 1NNFA 3KC0A 4NF8A 2F8DA 4GIZA 3O6HA 4U4XA 2ALUA 4YMAA 3BBRA 4BDOA 4OWDA 2YPNA 3U65A 3MSTA 5ET5A 4G8MA 5IGAA 4OVTA 4GBVA 5A5LA 3IL1B 4NWCA 5CRYA 2F97A 1AH5A 3MBPA 1Y20A 1LBVA 1OLCA 3FIRA 3FV1A 3IOUA 1RDXA 2VPOA 4ZZAA 1ANFA 1QULA 1D9YA 4PDDA 2O1LA 2KQZA 2XWIA 2FHYA 3LC8A 1L5TA 2DDKA 3HPIA 4IY6A 1MDP1 4FAJA 4O7IA 1NUYA 5I56A 5CMBA 2PYYA 4NF5B 3M8UA 3WAFA 1A8FA 1MH3A 1AWBA 1B5IA 1MXYA 5TP9A 1PB8A 2QFLA 3PUZE 3FJMA 3H06B 2DWAA 4E0XA 4GVOA 4QRZA 1HSJA 1LAXA 2DS9A 1PDAA 3MC2A 2RC7A 1D3KA 1OLAA 3P7IA 3ILTB 4XF5A 4YB5A 3PUVE 4P0GA 2R71A 1JP4A 1XOCA 1O64A 1YAEA 3RQTA 1USYE 4F3SA 4I3YA 2P3VA 2ZNUA 1M5FA 3TELA 4R9GA 1FRPA 3CSGA 2W7YA 1D9VA 1N7WA 1B4ZA 1AMFA 1LAHE 2PCRA 5JTYA 4AB5A 5KCJB 1UTBB 4FBPA 4L17A 3EF7A 4X48A 1FW0A 1EU8A 2DE2A 3Q26A 2KR0A 3ODBA 3S9EA
chains in the Genus database with same CATH topology
4N8GA 2DVZA 5LTCA 2FVZA 1FSAA 4GWYA 2Q8MA 4GWXA 4PAFA 5JK4A 4PFIA 5IZ3A 3EKIA 4HE1A 4N8YA 2Q9TA 1KA0A 1FJ9A 2R8TA 1FBEA 1EYJA 1FTAA 4NAPA 1SPIA 1NV2A 1LBYA 5CM6A 4UABA 1NUWA 4HE0A 3PTYA 1NI9A 4MJOA 4PE3A 4N4UA 2F3DA 2FIXA 4NHBA 1FPJA 5T3JA 5IZ1A 4OA4A 5EYHA 2CZHA 4JVIA 4NF0A 2DE3A 1FPDA 4OVSA 3A29A 2BJIA 3T0JA 4OANA 2XA5A 1IMDA 2PFZA 1KZ8A 1NV0A 4MNCA 5J16A 4PF8A 4DI3D 2XXKA 5EYGA 1FPIA 4AS4A 2ZZXA 3MYUA 1DBZA 1FPGA 3LUZA 2QPQA 3ISPA 4PBQA 1FBCA 2WBBA 2MKZA 1EYKA 4P9KA 5IM2A 4MX6A 4MMPA 4P8BA 3NOHA 5ET7A 1YXIA 4F1UA 4GWWA 3E78A 4G61A 1YZ0A 2WYPA 1NV1A 1NUZA 4OVRA 2XWOA 4MHFA 4YICA 1CNQA 3FBPA 4PFBA 5EQAA 3B50A 2FIEA 4I40A 4O8MA 2V4CA 1FPBA 2CEYA 4JVDA 4NG7A 2Q74A 1KA1A 4PF6A 3RPLB 1FPEA 5I7IA 2L5VA 4HCWA 4OVQA 2DE4A 4PETA 4P47A 3QMFA 3LV0A 2B4MA 1XI6A 4GX4A 2HZKA 4MNPA 2XWKA 4P3LA 4XEQA 5IZZA 5J1DA 4O7MA 1FPFA 2CZIA 2PFYA 4O94A 4NQ8A 4AS5A 4XFEA 1INPA 4F1VA 4NGUA 4H45A 1FBHA 4N17A 3T1BA 1NV7A 5ET6A 1YYZA 4MNIA 1IMBA 2Y5LA 3SZPA 3GYYA 4PAKA 4P56A 3RPLA 4PFRA 4N6DA 5IZ3B 4F18A 5EQ7A 4PCDA 4GBWA 4X8RA 4X04A 2XWVA 1RDZA 5F24A 1LEVA 2JJKA 2B4LA 3IFCA 1LBXA 1QGXA 5FBPA 4JVCA 1IMFA 1EYIA 4NX1A 1G0IA 4PC9A 1NV6A 4LN5A 1LBWA 1DCUA 3CHGA 1K9ZA 4HXVA 4GWSA 1NV4A 1IMAA 2HZLA 2VPNA 4QBAA 1BK4A 2OWZA 4HE2A 2GQ1A 1FBPA 1FBGA 2V3QA 3IFAA 5I5PA 1NV5A 1NUXA 1IMCA 4GX6A 2F3BA 4PDHA 4GWUA 4F19A 4N81A 4X9TA 3KC0A 4MAGA 1FPKA 4YZZA 4PAIA 4NN3A 2ZZWA 5EQ9A 3U65A 3MSTA 5ET5A 2FBPA 2QVVA 1G0HA 5IGAA 4GBVA 5A5LA 3HFUA 4OVTA 1LBVA 2CZKA 1RDXA 2VPOA 2WEFA 5LDZA 4PDDA 2KQZA 2XWIA 4PGPA 2FHYA 2CEXA 2P3NA 3E79A 4PTKA 4H46A 3B8BA 4I3EA 5ESYA 1DK4A 2DDKA 4OVPA 4MEVA 4N91A 4O7IA 1NUYA 4KXPA 3FXBA 4GWZA 1AWBA 1FBFA 2QFLA 2WX9A 1RDYA 2VT5A 4PGNA 1Q9DA 1K9YA 3BIGA 5ET8A 4QXDA 4N6KA 5EQ8A 2ZZVA 1FPLA 5I3SA 3D1RA 4PBHA 4XF5A 5DW8A 1JP4A 3BIHA 3W9VA 4I3YA 1LBZA 2Y5KA 2OX3A 2P3VA 1FRPA 2F5XA 1FBDA 4P1LA 4N15A 2WYKA 4DI4B 4GX3A 3RYDA 2PCRA 2HHMA 4MCOA 2QVUA 2HXRA 4FBPA 4M1VA 3ROJA 1IMEA 3KC1A 1D9QA 2QVRA 3W9WA 1VDWA 3KBZA 4IR8A 4HCYA 2DE2A 2KR0A 2WBDA 4P1EA 1FJ6A 4MIJA 2HPGA 1NV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBV A;  5ET6 A;  2CZK A;  1YYZ A;  1RDX A;  5ET7 A;  2WEF A;  1YXI A;  5LDZ A;  1IMB A;  2FVZ A;  2Y5L A;  1FSA A;  4GWY A;  4GWW A;  2Q8M A;  4G61 A;  4GWX A;  2FHY A;  1YZ0 A;  2P3N A;  5IZ3 A;  3RPL A;  1NV1 A;  1NUZ A;  4PTK A;  4H46 A;  3B8B A;  4I3E A;  4HE1 A;  5ESY A;  5IZ3 B;  1DK4 A;  2DDK A;  1KA0 A;  5EQ7 A;  1FJ9 A;  2R8T A;  1FBE A;  1CNQ A;  3FBP A;  4O7I A;  1NUY A;  4GBW A;  4KXP A;  4GWZ A;  1EYJ A;  5EQA A;  1FTA A;  1RDZ A;  1SPI A;  1NV2 A;  5F24 A;  2FIE A;  4I40 A;  1LEV A;  1LBY A;  2JJK A;  1FPB A;  1AWB A;  3IFC A;  1LBX A;  1QGX A;  1FBF A;  5FBP A;  2QFL A;  1IMF A;  1NUW A;  4HE0 A;  1RDY A;  1NI9 A;  1EYI A;  4MJO A;  1G0I A;  2Q74 A;  2VT5 A;  1Q9D A;  1K9Y A;  1NV6 A;  3BIG A;  5ET8 A;  4QXD A;  2F3D A;  1KA1 A;  2FIX A;  1LBW A;  1DCU A;  5EQ8 A;  1FPL A;  1FPJ A;  5I3S A;  3RPL B;  1K9Z A;  5T3J A;  3D1R A;  4HXV A;  5IZ1 A;  1FPE A;  1NV4 A;  1IMA A;  4GWS A;  1BK4 A;  5DW8 A;  2CZH A;  5EYH A;  2OWZ A;  4HE2 A;  1JP4 A;  3BIH A;  2GQ1 A;  1FPD A;  3QMF A;  1FBP A;  3A29 A;  3LV0 A;  2BJI A;  3T0J A;  4I3Y A;  1IMD A;  1LBZ A;  1FBG A;  2Y5K A;  3IFA A;  2OX3 A;  2P3V A;  1NV5 A;  1NUX A;  1XI6 A;  4GX4 A;  1IMC A;  1FRP A;  1KZ8 A;  1NV0 A;  4GX6 A;  5J16 A;  1FBD A;  2F3B A;  4GWU A;  4N81 A;  4GX3 A;  3RYD A;  2PCR A;  3KC0 A;  2HHM A;  2QVU A;  1FPF A;  4FBP A;  5EYG A;  2CZI A;  1FPI A;  4AS4 A;  3ROJ A;  1FPK A;  4AS5 A;  1IME A;  1DBZ A;  1FPG A;  1D9Q A;  2QVR A;  3KC1 A;  3LUZ A;  1INP A;  1VDW A;  1FBC A;  3KBZ A;  4IR8 A;  5EQ9 A;  4H45 A;  2WBB A;  1FBH A;  5ET5 A;  2FBP A;  1EYK A;  2QVV A;  1G0H A;  4GBV A;  5A5L A;  2WBD A;  1FJ6 A;  1NV7 A;  1NV3 A; 
#chains in the Genus database with same CATH topology
 2ONR A;  2DVZ A;  4QFN A;  4QFO A;  4N13 A;  1DMB A;  4IO6 A;  4GWO A;  4E0W A;  3H6U A;  5LTC A;  1BLF A;  2FVZ A;  4IO4 A;  3OO6 A;  4KCC A;  4KYE A;  4PAF A;  3KN8 A;  4EXL A;  2I0B A;  3ECR A;  3N94 A;  3FD3 A;  3F11 A;  3EKI A;  4BDM A;  3SER A;  2V3T A;  2Q9T A;  2O51 A;  4U1O A;  3OMB A;  2ONS A;  4PQJ A;  1FBE A;  4ZEF A;  4DZ1 A;  3KZG A;  3FXR A;  2BJJ X;  4NAP A;  2OZZ A;  5H8Q A;  3OEM A;  2DOJ A;  3A3C A;  1MG1 A;  3IOR A;  4MLQ A;  3KJ7 A;  4LQ2 A;  1WOD A;  4PE3 A;  4GL8 A;  3UN6 A;  1Y9U A;  1JW4 A;  4JSO A;  2RF1 A;  4H5G A;  3OEK A;  2LAO A;  4EXK A;  3TFL A;  4ZZE A;  2CZH A;  4NF0 A;  4KCD A;  4F39 A;  2F6G A;  4IO5 A;  1IUD A;  4ISU A;  1H76 A;  1LB9 A;  2P2A A;  5AA4 A;  2UVI A;  2OWT A;  2O68 A;  2R9J A;  1QJM A;  4MNC A;  4H8I A;  4GOT A;  4PF8 A;  2Y84 A;  2XXP A;  4U21 A;  2FYI A;  1FPG A;  3LUZ A;  3DM0 A;  3MYU A;  3ISP A;  4C0R A;  3K6X A;  4RNS A;  5BWJ A;  5DT6 A;  2MKZ A;  4ZEB A;  5EHS A;  2P1S A;  4MMP A;  3NOH A;  4TOZ A;  1MQD A;  2F36 A;  2PMS A;  5I84 A;  4NF4 A;  2VOZ A;  4GWW A;  4G61 A;  2FNC A;  1NUZ A;  1FQD A;  2DWH A;  4MHF A;  3LBS A;  4YB6 A;  4ZED A;  4XKP A;  3OSR A;  4WED A;  5I59 B;  1MDQ A;  4I40 A;  2P0S A;  3S4U A;  3TCH A;  4F3B A;  4NG7 A;  3O2A A;  4BDR A;  3PUX E;  1VSO A;  2VHA A;  1MY1 A;  1JVY A;  4UAC A;  2GH9 A;  2B3F A;  5FTI A;  2F7C A;  4LVQ A;  1TT1 A;  4F29 A;  3T93 B;  4TQU Q;  4IO7 A;  3V83 A;  3LSX A;  3OD7 A;  5AA3 A;  1XVX A;  1XI6 A;  3QUJ A;  4GX4 A;  2I58 A;  5KDT A;  1VE4 A;  4P3L A;  5ITP A;  3O97 A;  5IZZ A;  5FHN A;  1MY4 A;  4H5F A;  1ZTY A;  1JW1 A;  4ELP A;  4N07 A;  1A99 A;  3N26 A;  3MUQ A;  1TWY A;  4F31 B;  1IXH A;  4R6K A;  4DCX A;  1N3X A;  1UTH B;  4XFE A;  4ND9 A;  4G77 A;  4F1V A;  4ZE9 A;  4R6H A;  4N17 A;  2AL5 A;  1B58 A;  2D5W A;  2VD3 A;  1B0L A;  5ET6 A;  1YYZ A;  1OIB A;  3I3V A;  4MNI A;  2KLF A;  3OEN A;  5I2K B;  1Y1M A;  4PAK A;  3PMX A;  4EF2 A;  4G68 A;  4JWY A;  4PFR A;  4Z7E A;  1NH7 A;  4ONY A;  5IZ3 B;  1EZ9 A;  4F18 A;  1SBP A;  3V8X B;  1MXW A;  4PCD A;  5F7V A;  4X8R A;  1RDZ A;  1LFG A;  3CIJ A;  3N6T A;  3G3H A;  2B4L A;  1LBX A;  3C35 A;  1ELJ A;  1G0I A;  1NV6 A;  5AA2 A;  1LBW A;  1P1U A;  3PPP A;  3RLF E;  4DCY A;  1GTK A;  3R6U A;  1URS A;  3GLB A;  3MW0 A;  4OFL A;  1BK4 A;  1QUI A;  2IA4 A;  5H8N A;  5CBS A;  1R6Z A;  2GQ1 A;  3TAJ A;  2XX7 A;  1LCF A;  2ZYM A;  1IZ1 A;  1FBG A;  2V3Q A;  3IFA A;  5I5P A;  1FTK A;  2Z22 A;  4GFR A;  3MVX A;  2F3B A;  4IB2 A;  4GWU A;  2H25 A;  4RY1 A;  3UP9 A;  1B6H A;  1RYX A;  2HCA A;  5I58 A;  1OVB A;  4IY5 A;  1B7Z A;  3PGF A;  4GLI A;  5B7D A;  5TPA B;  4MAG A;  3SES A;  4PAI A;  1IIW A;  3MVZ A;  1SDX A;  4U22 A;  3THI A;  4RYA A;  1A8E A;  4TLM B;  3MP8 A;  2CZK A;  3PUW E;  4QSE A;  3DP4 A;  4FOR A;  5LDZ A;  3PPO A;  3G7W A;  4Q30 B;  2NVU B;  1RYO A;  4BDN A;  3E79 A;  4PTK A;  1AOV A;  4I3E A;  3B8B A;  3K01 A;  4KYS A;  1DK4 A;  3PPN A;  4OVP A;  4N91 A;  3PD8 A;  3E4R A;  3FXB A;  3GXA A;  3VLW A;  1PBP A;  3T9U A;  4GL0 A;  4N6P A;  2AL4 A;  2DYX A;  4PFY A;  1LAF E;  4YKP A;  5ICT A;  3RPW A;  5ISU A;  1DTZ A;  2VT5 A;  2OWS A;  3MVY A;  3HHF A;  4YKK A;  3K6V A;  2DP8 A;  1PC3 A;  3D1R A;  4DLD A;  3IOW A;  4MLV A;  4OZ9 A;  3M3K A;  1Y3P A;  1LB8 A;  3BIH A;  3MVW A;  2RIN A;  3B7D A;  3H6V A;  3RUM A;  4RXL A;  1N0T A;  3H7M A;  5ICQ A;  2Y5K A;  3EPE A;  2OX3 A;  3K4U A;  4X1B A;  2QRY A;  4P1L A;  3SEU A;  4NWD A;  2WYK A;  3S9M C;  2E0S A;  2HHM A;  4MCO A;  2HXR A;  2A5T B;  4M1V A;  3ROJ A;  5DTB A;  1IME A;  1D9Q A;  3PU5 A;  2Y7W A;  3QK6 A;  4O3A A;  3EHT A;  4OHN A;  2WBD A;  1B3F A;  1F9B A;  3B6Q A;  3VXC A;  4NF5 A;  1DOT A;  3RT6 B;  5AE4 A;  4YAH X;  4LZ7 A;  3KBR A;  4ZEI A;  4RPO A;  3CFX A;  4GXS B;  4YU0 A;  1M5C A;  3K6W A;  4O3B A;  4GWX A;  3TYH A;  2XXU A;  3O66 A;  1XS5 A;  4KFQ A;  3TTR A;  3IB1 A;  1KA0 A;  4R2B A;  2R8T A;  4JBZ A;  1ZMG A;  4F3P A;  2XXW A;  4UAB A;  4I8C A;  1MPB A;  2AIX A;  4HE0 A;  4QSC A;  4MJO A;  4XXU A;  1B51 A;  1FTL A;  3A3U A;  2FIX A;  3KN3 A;  3IO6 A;  1MRP A;  1UTB A;  3MP1 A;  1B7H A;  5IZ1 A;  2H9B A;  5DEX B;  3ZSF A;  1URG A;  4OA4 A;  1LBC A;  4JVI A;  4U23 A;  1FPD A;  4OVS A;  2BJI A;  3OO9 A;  2XA5 A;  3RY3 A;  4F2Q A;  1KZ8 A;  5J16 A;  5DYH A;  3WAE A;  1UIV A;  5I2N B;  1Q35 A;  4XKQ A;  2A5S A;  4OMB A;  4DI3 D;  3S2V A;  3O28 A;  4RJZ A;  1SW1 A;  4NF8 B;  1JET A;  1UIU A;  4PBQ A;  1FBC A;  3FGS A;  2Y7I A;  1EYK A;  2VP1 A;  2Y7R A;  1VFD A;  3C32 A;  1SYI A;  3RGY A;  4I1D A;  5IM2 A;  4LA9 A;  3AXF A;  2E1S A;  3KJT A;  3S9L C;  1TFA A;  2I4C A;  1ZBM A;  3EHU A;  1N84 A;  3FJ7 A;  1YXI A;  4F1U A;  3JV9 A;  3B6T A;  3MPK A;  1EH3 A;  3TKD A;  1B52 A;  3TDJ A;  1SD3 A;  3USD A;  1CNQ A;  3FBP A;  3ONM A;  5EQA A;  4YB7 A;  3B50 A;  3IX1 A;  3K02 A;  2V4C A;  5H8H B;  4KHZ E;  2CEY A;  4NED A;  4YKI A;  3C9H A;  1P1O A;  5TP9 B;  4H67 A;  4U1Z A;  1DSN A;  5FTH A;  1KA1 A;  4THI A;  3I5O A;  4UA8 A;  1FPE A;  2X7Q A;  2NOO A;  2XXX A;  3MQ9 A;  4GD5 A;  1BP5 A;  4GXA A;  4PET A;  4P47 A;  4ELQ A;  3FAT A;  2OK2 A;  5L9M A;  3SDF A;  2O69 A;  4R73 A;  1SQY A;  1JQF A;  3KN7 A;  1R9Q A;  3PMV A;  5KZT A;  2V3U A;  1N7X A;  5J1D A;  3IK6 B;  1BKA A;  2F7A A;  1MQJ A;  3QXM A;  1MXX A;  2CZI A;  5JTY B;  2PFY A;  3O29 A;  4NQ8 A;  4O94 A;  4OQO A;  1B3H A;  2GHA A;  2I0C A;  1INP A;  4ZEK A;  1YCJ A;  5CMM A;  1FQC A;  1FBH A;  3RT8 A;  1US5 A;  2H5Y A;  4M4G A;  2XHD A;  1P99 A;  5I59 A;  4R6Y A;  2XD3 A;  1NV7 A;  4RK9 A;  1DPE A;  1R1N A;  3SZP A;  2F7B A;  1US4 A;  4P11 A;  3LUY A;  3U94 A;  3FJG A;  1MXV A;  3M3F A;  4ESX A;  3K1M A;  4GBW A;  3RTW B;  3FVN A;  1N3W A;  3S9N C;  1LEV A;  3PMW A;  1B2H A;  3H03 A;  1OQG A;  1MQG A;  4ECF A;  2F34 A;  3K00 A;  4LN5 A;  5H8S A;  3O6G A;  4KYD A;  3SEV A;  1UQW A;  1K9Z A;  4FAT A;  4ELR A;  4GWS A;  1NV4 A;  1IMA A;  3PPQ A;  5EYF A;  3TTK A;  4HE2 A;  3LSW A;  1UTH A;  2XXT A;  4BLA A;  1NV5 A;  4RA1 A;  4F2O A;  1YTV A;  2Q2A A;  2YLN A;  2Z8E A;  2QS2 A;  3EHS A;  4OFO A;  1NKX A;  3CI8 A;  3IOT A;  1SI1 A;  4OTE A;  3SET A;  3K1N A;  4Q5T A;  5I2K A;  1TXF A;  3H3G A;  4YMB A;  2HXW A;  2ZZW A;  3C36 A;  2OCU A;  4G8H A;  5EQ9 A;  1G0H A;  4GQO A;  2I4B A;  3CFL A;  4GF8 A;  4AQ4 A;  1NL5 A;  3K2D A;  3ZKK A;  4QFK A;  2WEF A;  1I6B A;  5ELV A;  4PGP A;  3OOA A;  4DDD A;  1XHY A;  4HW8 A;  4K3F A;  3Q29 A;  4HTG A;  3CVG A;  4H46 A;  4PE5 B;  5ESY A;  3G3G A;  3TZA A;  1MY0 A;  2XXY A;  1II5 A;  4MEV A;  4KXP A;  1B46 A;  2H99 A;  2DWJ A;  3VLV A;  1S7Y A;  1FBF A;  4PFU A;  1FCK A;  2F6P A;  2PX1 A;  1WVJ A;  2QJE A;  4PGN A;  1Q9D A;  1K9Y A;  3BIG A;  3MJN A;  5ET8 A;  4QXD A;  3VVE A;  3OO7 A;  5EQ8 A;  2ZZV A;  3GBA A;  1FPL A;  1FQF A;  4OEN A;  1Z7N E;  1BTJ A;  4TLL B;  3UIF A;  4PBH A;  5TPA A;  4NF6 A;  1B40 A;  5DW8 A;  2DWI A;  3TTM A;  2B65 A;  4FEB A;  2Q2C A;  5HPQ A;  2RKM A;  4F3G A;  1EZP A;  4DXC A;  2GFE A;  3T9X B;  2ZMB A;  2F5X A;  4EQB A;  2R6G E;  1Z7M E;  1LGB C;  2D3I A;  2DSF A;  2HAV A;  1ZIU A;  2CZL A;  3QUF A;  3FUZ A;  3K1P A;  2ZYN A;  1KWH A;  1JEV A;  1NFT A;  2HQ0 A;  1DTG A;  1VDW A;  3KBZ A;  4IR8 A;  1LFI A;  4JDF A;  4HCY A;  3DEL B;  2PT1 A;  2UVG A;  4OXV A;  1XVY A;  2PT2 A;  4DXB A;  2RC9 A;  1FJ6 A;  4MIJ A;  4OET A;  3H4Z A;  4YKJ A;  1JNF A;  5HM4 B;  2Q8M A;  2HAU A;  5JK4 A;  4PFI A;  2ZNT A;  2REG A;  4G68 B;  3L6G A;  4QSD A;  1MY2 A;  3G3F A;  4IO3 A;  2V93 A;  1SPI A;  2G29 A;  2DQV A;  5CM6 A;  5L8D A;  3FVG A;  3BFT A;  1NUW A;  3ILU B;  1NI9 A;  1B5J A;  4LP2 B;  5A5X B;  3T66 A;  5I57 A;  1LFH A;  4Z0I A;  4O3C A;  2QS3 A;  2F3D A;  3HO7 A;  4PFW A;  5AA2 B;  4JXI A;  5T3J A;  5K2X A;  4G68 C;  3UOR A;  4NMY A;  1SW4 A;  1I69 A;  3KFM A;  2DE3 A;  4FJP A;  3A29 A;  3TMG A;  3T0J A;  4OAN A;  3N5L A;  3VE1 B;  1IMD A;  1LLS A;  2PFZ A;  4X1D A;  1NV0 A;  1TFD A;  3CG1 A;  3TPA A;  3TEP A;  3C31 A;  2Y7P A;  2Q89 A;  2Q8J A;  3G3K A;  4NTL A;  4KD5 A;  5EYG A;  5TU0 A;  2ZZX A;  3CRB A;  5IKB A;  2QPQ A;  3PPR A;  3SKP A;  5AA2 D;  5CMK A;  2WBB A;  1SVX B;  1M5B A;  3H6T A;  4ZS9 A;  4MX6 A;  4MFI A;  2Z8F A;  1ZU0 A;  5DVJ A;  1QW0 A;  5ET7 A;  4R72 A;  4U2R A;  1A55 A;  3K0V A;  1ZLQ A;  4LZ8 A;  1LAG E;  4R9F A;  2I48 A;  4OEV A;  2REJ A;  1NV1 A;  5HBC A;  1Q1K A;  4H0W A;  5DEX A;  4ZEC A;  4YIC A;  3V5A A;  3M3L A;  2ZYO A;  2H98 A;  3IOV A;  1IXC A;  1H44 A;  1VR5 A;  5CI5 A;  3PUY E;  4LUB A;  4POW A;  4QHQ A;  2FIE A;  3C33 A;  2GRV A;  1EZO A;  5DVF A;  4OYV A;  5H8F B;  4DE8 A;  2ABH A;  1XT8 A;  5I2N A;  3OSQ A;  1O63 A;  1DPP A;  4PF6 A;  3RPL B;  3TTL A;  3SEY A;  2L5V A;  5B70 A;  1IEJ A;  4OVQ A;  2Y7K A;  2UXA A;  4H1X A;  3TCG A;  3CG3 A;  4ZE8 A;  3UGW A;  4EDP A;  3LV0 A;  5M2V A;  2B4M A;  1FQA A;  4MNP A;  2XWK A;  3TUS A;  3A09 A;  1Y1Z A;  5L9S A;  2G93 A;  1YPN A;  1OVT A;  3LR1 A;  4XEQ A;  4OFJ A;  1FQB A;  2VGQ A;  5KCJ A;  4H65 A;  4G4P A;  2X26 A;  4O7M A;  2XXH A;  1FPF A;  2I6E A;  3UA8 A;  3B6W A;  3CSB A;  2FA7 A;  3MZ1 A;  3KEI A;  3TQW A;  3BKI B;  4AB6 A;  4EQ9 A;  3TQL A;  5CBR A;  4NGU A;  2IEE A;  4H45 A;  3TCF A;  4I9D A;  4KPT A;  1JEU A;  1OQH A;  1H3D A;  3T1B A;  2AYS A;  1CE2 A;  5H8H A;  1MH4 A;  5FHM A;  4KI0 E;  3MZ9 A;  4MH5 A;  2OBG A;  1Y4T A;  1IMB A;  4RK2 A;  1T0K A;  3T22 A;  3Q28 A;  4BDQ A;  3RNN A;  2ANJ A;  1SYH A;  1S9T A;  3TTN A;  5EQ7 A;  3DLN A;  4X04 A;  2XWV A;  3RN8 A;  2QMW A;  5F24 A;  1MPD A;  1B1X A;  1B3E A;  1RKM A;  1QGX A;  2OJT A;  1P1W A;  4MBP A;  2O6A A;  3U8Q A;  1NNK A;  3FVK A;  2OLB A;  1DCU A;  3CHG A;  1MS7 A;  4NE4 A;  5EHM A;  4LAT A;  3FVO A;  4QF9 A;  4QBA A;  1JW5 A;  1PB9 A;  3E13 X;  5I56 B;  3IB0 A;  1B05 A;  1FBP A;  1A7L A;  4MF3 A;  1FQE A;  3MP6 A;  1NUX A;  1B3L A;  2PBW A;  4GX6 A;  1M5D A;  3TOD A;  4PDH A;  3DP6 A;  3QAX A;  4OES A;  1GVC A;  3L6H A;  1FPK A;  4YZZ A;  3IO4 A;  4NN3 A;  3ZKL A;  1MXU A;  3MZB A;  2FBP A;  2QVV A;  1P1N A;  3OO8 A;  3HFU A;  4IGR A;  3CFZ A;  1IIT A;  1LST A;  3OXN A;  2NUV A;  4LQ5 A;  1CB6 A;  3IJO B;  3FAS A;  3ZS6 A;  1SI0 A;  1FTM A;  4LZ5 A;  2CEX A;  2P3N A;  5FHO A;  1Y3N A;  2F35 A;  4GWZ A;  4F1Y A;  3O6I A;  1NNT A;  1P1Q A;  2ZNS A;  5K2Y A;  1MM6 A;  4Q8R A;  3QYT A;  1PEB A;  2HFB A;  2WX9 A;  1RDY A;  4G2Z A;  3E3K A;  2D21 A;  1FTJ A;  4N6K A;  5I3S A;  1QUK A;  1QVS A;  5ITO A;  1H45 A;  3RTF B;  4U4S A;  2NXO A;  3GZG A;  1ZJL A;  2F78 A;  5H8Q B;  3W9V A;  4KQP A;  1Y4C A;  3LSL A;  1LBZ A;  4HS7 A;  1MXZ A;  1A40 A;  4G8N A;  2OPD A;  1B1H A;  1FBD A;  4JB7 A;  1JVX A;  1PBQ A;  4OVJ A;  1MPC A;  4N15 A;  2XX8 A;  4DI4 B;  4GX3 A;  3RYD A;  4ZDM A;  2QVU A;  2XXV A;  1PB7 A;  3C34 A;  3QSL A;  1GV8 A;  3LSF B;  3KC1 A;  3W9W A;  2QVR A;  3I6V A;  4DIG A;  3JZJ A;  5DVI A;  2V25 A;  4EQ7 A;  2QS1 A;  5AA4 B;  2NWJ A;  1AL3 A;  1ZKB A;  4P1E A;  2XX9 A;  4OEU A;  3VVF A;  2HPG A;  1NV3 A;  2QMX A;  4N8G A;  3VFJ A;  2O1M A;  2V84 A;  5CC2 A;  1B3G A;  1N04 A;  1IXG A;  1FSA A;  4GWY A;  3H6W A;  3T9V A;  3VDF A;  2X7P A;  2QSX A;  1POT A;  3Q27 A;  2I3V A;  3VLU A;  5IZ3 A;  4LON B;  4HE1 A;  4N8Y A;  4P0I A;  5JEI A;  3KOS A;  1B7U A;  2GHB A;  2VD2 A;  3O9P A;  1FJ9 A;  4GRK A;  2DVC A;  2B3B A;  1EYJ A;  1FTA A;  4Q0C A;  1NV2 A;  4EF1 A;  4RPN A;  1LBY A;  1HSL A;  3GBB A;  3R7X A;  4C1U A;  3PTY A;  4NF4 B;  4POX A;  1AIV A;  4N4U A;  4BDL A;  4PFT A;  4NHB A;  1FPJ A;  1I6A A;  1O7T A;  1QKA A;  3OEL A;  2O7U A;  1SW2 A;  5EYH A;  4R2F A;  1B5H A;  1ATG A;  1IQ7 A;  2PVU A;  1WDN A;  4ESW A;  4WKM A;  3MAM A;  4FEC A;  3D4C A;  3VVD A;  4H8J A;  1FTO A;  1B0H A;  4IGT A;  3U1O A;  2CMO A;  3IAZ A;  2XXK A;  1QUJ A;  3IR1 A;  2UVJ A;  1FPI A;  4AS4 A;  2ZYK A;  2XXQ A;  1DBZ A;  4XKN A;  1XC1 A;  2HEU A;  3QIM A;  3SEX A;  4FE8 A;  2O84 X;  3HV1 A;  1N76 A;  4P9K A;  3JYR A;  5KDT B;  3HST A;  4P8B A;  3Q25 A;  4FIM A;  2DXY A;  1H43 A;  1J1N A;  1SW5 A;  5A5X A;  3PD9 A;  3E78 A;  3HN0 A;  4I62 A;  1YZ0 A;  1BIY A;  2WYP A;  4WEP A;  1LCT A;  5CMC A;  1MM7 A;  4OVR A;  2XWO A;  2ESN A;  1MQH A;  2RC8 A;  3R26 A;  3U92 A;  4PFB A;  4OER A;  2XD2 A;  3C4M A;  4O8M A;  4H6D A;  4DXU A;  1S50 A;  1FPB A;  4PP0 A;  4JWX A;  2DXR A;  4JVD A;  2UYF A;  1OMP A;  2XXI A;  3HHG A;  2Q74 A;  3E9X A;  3T96 B;  1NNP A;  1QKB A;  4KR5 A;  3N6U A;  4R74 A;  3W15 C;  2RCB A;  3FZV A;  5I7I A;  3CR9 A;  4HCW A;  2ZXT A;  4WXJ A;  3K6U A;  2DE4 A;  4NF6 B;  3D4G A;  2O7I A;  3QMF A;  3SEW A;  2YJP A;  3HCQ A;  4R75 A;  2Z8D A;  1URD A;  1Y3Q A;  2HZK A;  1GGG A;  1NH8 A;  4XTC Q;  4ELO A;  1POY 1;  2A5T A;  2OPE A;  1MQI A;  2QS4 A;  3T9H B;  3FV2 A;  1R9L A;  1I6Q A;  5H8N B;  4AS5 A;  4IO2 A;  4F22 A;  1USY H;  1VFE A;  3FXU A;  4C1T A;  1D4N A;  2H4I A;  4EUO A;  5I58 B;  3UK4 A;  4JSD A;  1NMU A;  2Y5L A;  3GYY A;  5H8F A;  5L9O A;  3IB2 A;  1GR2 A;  4P56 A;  5IAI A;  4QFP A;  3RPL A;  3IJX B;  4N6D A;  3KSJ A;  3U72 A;  3V89 B;  3DP8 A;  1B4H A;  2ONK E;  2JJK A;  3IFC A;  5FBP A;  4JVC A;  1IMF A;  1M5E A;  3KOT A;  1EYI A;  1MY3 A;  4NX1 A;  5AA1 A;  3KGC A;  4PC9 A;  2Z23 A;  3EQ1 A;  5BUU A;  3KG2 A;  2UVH A;  3EN3 A;  2RCA A;  3MWB A;  4FED A;  5I57 B;  5LOM A;  2XXR A;  2M8C A;  1B9J A;  4XKR A;  2THI A;  4HXV A;  3KSX A;  2HZL A;  3G3J A;  2VPN A;  1A54 A;  2QL3 A;  2OWZ A;  3VXB A;  3BFU A;  2I3W A;  3G3I A;  3PV0 E;  4QFL A;  4XIG Q;  1IMC A;  3VV5 A;  3FXQ A;  2WKY A;  1LBB A;  3MPL A;  3U93 A;  4JWO A;  2UYE A;  4F19 A;  1B32 A;  4N81 A;  5F1Q A;  2I49 A;  4X9T A;  1IXI A;  2Q88 A;  1HSE A;  1NNF A;  3KC0 A;  4NF8 A;  2F8D A;  4GIZ A;  3O6H A;  4U4X A;  2ALU A;  4YMA A;  3BBR A;  4BDO A;  4OWD A;  2YPN A;  3U65 A;  3MST A;  5ET5 A;  4G8M A;  5IGA A;  4OVT A;  4GBV A;  5A5L A;  3IL1 B;  4NWC A;  5CRY A;  2F97 A;  1AH5 A;  3MBP A;  1Y20 A;  1LBV A;  1OLC A;  3FIR A;  3FV1 A;  3IOU A;  1RDX A;  2VPO A;  4ZZA A;  1ANF A;  1QUL A;  1D9Y A;  4PDD A;  2O1L A;  2KQZ A;  2XWI A;  2FHY A;  3LC8 A;  1L5T A;  2DDK A;  3HPI A;  4IY6 A;  1MDP 1;  4FAJ A;  4O7I A;  1NUY A;  5I56 A;  5CMB A;  2PYY A;  4NF5 B;  3M8U A;  3WAF A;  1A8F A;  1MH3 A;  1AWB A;  1B5I A;  1MXY A;  5TP9 A;  1PB8 A;  2QFL A;  3PUZ E;  3FJM A;  3H06 B;  2DWA A;  4E0X A;  4GVO A;  4QRZ A;  1HSJ A;  1LAX A;  2DS9 A;  1PDA A;  3MC2 A;  2RC7 A;  1D3K A;  1OLA A;  3P7I A;  3ILT B;  4XF5 A;  4YB5 A;  3PUV E;  4P0G A;  2R71 A;  1JP4 A;  1XOC A;  1O64 A;  1YAE A;  3RQT A;  1USY E;  4F3S A;  4I3Y A;  2P3V A;  2ZNU A;  1M5F A;  3TEL A;  4R9G A;  1FRP A;  3CSG A;  2W7Y A;  1D9V A;  1N7W A;  1B4Z A;  1AMF A;  1LAH E;  2PCR A;  5JTY A;  4AB5 A;  5KCJ B;  1UTB B;  4FBP A;  4L17 A;  3EF7 A;  4X48 A;  1FW0 A;  1EU8 A;  2DE2 A;  3Q26 A;  2KR0 A;  3ODB A;  3S9E A; 
#chains in the Genus database with same CATH homology
 4N8G A;  2DVZ A;  5LTC A;  2FVZ A;  1FSA A;  4GWY A;  2Q8M A;  4GWX A;  4PAF A;  5JK4 A;  4PFI A;  5IZ3 A;  3EKI A;  4HE1 A;  4N8Y A;  2Q9T A;  1KA0 A;  1FJ9 A;  2R8T A;  1FBE A;  1EYJ A;  1FTA A;  4NAP A;  1SPI A;  1NV2 A;  1LBY A;  5CM6 A;  4UAB A;  1NUW A;  4HE0 A;  3PTY A;  1NI9 A;  4MJO A;  4PE3 A;  4N4U A;  2F3D A;  2FIX A;  4NHB A;  1FPJ A;  5T3J A;  5IZ1 A;  4OA4 A;  5EYH A;  2CZH A;  4JVI A;  4NF0 A;  2DE3 A;  1FPD A;  4OVS A;  3A29 A;  2BJI A;  3T0J A;  4OAN A;  2XA5 A;  1IMD A;  2PFZ A;  1KZ8 A;  1NV0 A;  4MNC A;  5J16 A;  4PF8 A;  4DI3 D;  2XXK A;  5EYG A;  1FPI A;  4AS4 A;  2ZZX A;  3MYU A;  1DBZ A;  1FPG A;  3LUZ A;  2QPQ A;  3ISP A;  4PBQ A;  1FBC A;  2WBB A;  2MKZ A;  1EYK A;  4P9K A;  5IM2 A;  4MX6 A;  4MMP A;  4P8B A;  3NOH A;  5ET7 A;  1YXI A;  4F1U A;  4GWW A;  3E78 A;  4G61 A;  1YZ0 A;  2WYP A;  1NV1 A;  1NUZ A;  4OVR A;  2XWO A;  4MHF A;  4YIC A;  1CNQ A;  3FBP A;  4PFB A;  5EQA A;  3B50 A;  2FIE A;  4I40 A;  4O8M A;  2V4C A;  1FPB A;  2CEY A;  4JVD A;  4NG7 A;  2Q74 A;  1KA1 A;  4PF6 A;  3RPL B;  1FPE A;  5I7I A;  2L5V A;  4HCW A;  4OVQ A;  2DE4 A;  4PET A;  4P47 A;  3QMF A;  3LV0 A;  2B4M A;  1XI6 A;  4GX4 A;  2HZK A;  4MNP A;  2XWK A;  4P3L A;  4XEQ A;  5IZZ A;  5J1D A;  4O7M A;  1FPF A;  2CZI A;  2PFY A;  4O94 A;  4NQ8 A;  4AS5 A;  4XFE A;  1INP A;  4F1V A;  4NGU A;  4H45 A;  1FBH A;  4N17 A;  3T1B A;  1NV7 A;  5ET6 A;  1YYZ A;  4MNI A;  1IMB A;  2Y5L A;  3SZP A;  3GYY A;  4PAK A;  4P56 A;  3RPL A;  4PFR A;  4N6D A;  5IZ3 B;  4F18 A;  5EQ7 A;  4PCD A;  4GBW A;  4X8R A;  4X04 A;  2XWV A;  1RDZ A;  5F24 A;  1LEV A;  2JJK A;  2B4L A;  3IFC A;  1LBX A;  1QGX A;  5FBP A;  4JVC A;  1IMF A;  1EYI A;  4NX1 A;  1G0I A;  4PC9 A;  1NV6 A;  4LN5 A;  1LBW A;  1DCU A;  3CHG A;  1K9Z A;  4HXV A;  4GWS A;  1NV4 A;  1IMA A;  2HZL A;  2VPN A;  4QBA A;  1BK4 A;  2OWZ A;  4HE2 A;  2GQ1 A;  1FBP A;  1FBG A;  2V3Q A;  3IFA A;  5I5P A;  1NV5 A;  1NUX A;  1IMC A;  4GX6 A;  2F3B A;  4PDH A;  4GWU A;  4F19 A;  4N81 A;  4X9T A;  3KC0 A;  4MAG A;  1FPK A;  4YZZ A;  4PAI A;  4NN3 A;  2ZZW A;  5EQ9 A;  3U65 A;  3MST A;  5ET5 A;  2FBP A;  2QVV A;  1G0H A;  5IGA A;  4GBV A;  5A5L A;  3HFU A;  4OVT A;  1LBV A;  2CZK A;  1RDX A;  2VPO A;  2WEF A;  5LDZ A;  4PDD A;  2KQZ A;  2XWI A;  4PGP A;  2FHY A;  2CEX A;  2P3N A;  3E79 A;  4PTK A;  4H46 A;  3B8B A;  4I3E A;  5ESY A;  1DK4 A;  2DDK A;  4OVP A;  4MEV A;  4N91 A;  4O7I A;  1NUY A;  4KXP A;  3FXB A;  4GWZ A;  1AWB A;  1FBF A;  2QFL A;  2WX9 A;  1RDY A;  2VT5 A;  4PGN A;  1Q9D A;  1K9Y A;  3BIG A;  5ET8 A;  4QXD A;  4N6K A;  5EQ8 A;  2ZZV A;  1FPL A;  5I3S A;  3D1R A;  4PBH A;  4XF5 A;  5DW8 A;  1JP4 A;  3BIH A;  3W9V A;  4I3Y A;  1LBZ A;  2Y5K A;  2OX3 A;  2P3V A;  1FRP A;  2F5X A;  1FBD A;  4P1L A;  4N15 A;  2WYK A;  4DI4 B;  4GX3 A;  3RYD A;  2PCR A;  2HHM A;  4MCO A;  2QVU A;  2HXR A;  4FBP A;  4M1V A;  3ROJ A;  1IME A;  3KC1 A;  1D9Q A;  2QVR A;  3W9W A;  1VDW A;  3KBZ A;  4IR8 A;  4HCY A;  2DE2 A;  2KR0 A;  2WBD A;  4P1E A;  1FJ6 A;  4MIJ A;  2HPG A;  1NV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...