3LV0A

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
258
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEVQNLQVSLKGPADYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPHLPGHGTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extragenic suppressor protein suhB
publication title Crystal structure of extragenic suppressor protein suhB from Bartonella henselae
rcsb
source organism Bartonella henselae
total genus 84
structure length 258
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3lv0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3lv0A02
1FBHA 5IZ3B 1D9QA 4H46A 3D1RA 1IMDA 1FJ9A 1NV6A 2QVRA 4GWSA 5IZ3A 1NUXA 2FHYA 2FIXA 1FBFA 3KC0A 2QVUA 3B8BA 2CZKA 1NUZA 3KBZA 5ET8A 3BIHA 1FRPA 3ROJA 1FSAA 2FVZA 1G0HA 4GWYA 1NV5A 1FBGA 2BJIA 5I3SA 4GX6A 2OX3A 1LBXA 1NI9A 4GWWA 5EQ7A 1FJ6A 4GX3A 2FIEA 1LBVA 2R8TA 4I3EA 1NV4A 1DCUA 5FBPA 4GX4A 4QXDA 1FBPA 1FPLA 2WBDA 4AS4A 2WBBA 3QMFA 5EYGA 4KXPA 1G0IA 3LUZA 1QGXA 1VDWA 4H45A 4PTKA 2Q8MA 3IFAA 1AWBA 2QFLA 5IZ1A 3KC1A 1NUWA 5EQ8A 1NV2A 5F24A 1DK4A 5ET7A 1YZ0A 1FPKA 1EYKA 5A5LA 1FPBA 2Y5KA 1FPFA 1INPA 1NUYA 4MJOA 1XI6A 5ET5A 3IFCA 5ET6A 4GWUA 1FBDA 4IR8A 2P3NA 1BK4A 1LBYA 3T0JA 1JP4A 1K9ZA 1IMAA 2OWZA 1KZ8A 4AS5A 1NV7A 2PCRA 1DBZA 1NV3A 2QVVA 2CZHA 3LV0A 5LDZA 3RYDA 1IMEA 1FPIA 4GBVA 1SPIA 2Q74A 4GWXA 4I3YA 2CZIA 4HE0A 1LBZA 2GQ1A 3FBPA 1YXIA 1IMCA 1NV0A 3A29A 1EYIA 2F3DA 5DW8A 1YYZA 4GWZA 2VT5A 5EQAA 1RDZA 4N81A 4HE1A 1RDYA 1Q9DA 1CNQA 1LBWA 1RDXA 2FBPA 2P3VA 2F3BA 1IMBA 4HXVA 1EYJA 5J16A 5EQ9A 3BIGA 2Y5LA 4O7IA 1FPEA 1FPDA 5ESYA 4HE2A 1FPJA 2JJKA 1FTAA 2WEFA 1FBEA 1FBCA 4GBWA 1KA1A 1FPGA 1LEVA 2DDKA 4FBPA 2HHMA 3RPLB 5T3JA 4G61A 4I40A 1IMFA 1NV1A 5EYHA 1KA0A 3RPLA 1K9YA
chains in the Genus database with same CATH superfamily
3S9LC 3IO6A 4QF9A 1LAXA 2XWKA 3LBSA 1AIVA 3SERA 2Y7IA 4G68A 3EHSA 1Q1KA 2XHDA 2ZYNA 5AA4A 2DSFA 3H6VA 3KN8A 4F3PA 5DEXA 3UGWA 1FJ6A 3VVDA 5KCJA 2B4LA 4H6DA 1A8FA 2ZYMA 1AMFA 1M5BA 3TELA 2CZLA 5I7IA 4QBAA 4MCOA 2ALUA 2B3BA 2XX7A 2CMOA 3K6XA 5ET7A 1B5JA 3M8UA 3C34A 2I48A 3FASA 2Q2CA 4QSCA 3TPAA 3KBRA 4IR8A 3N94A 4DCYA 1LAGE 2DYXA 4O3BA 4U1ZA 4F1YA 4KHZE 1MQHA 4Q8RA 1NKXA 1QW0A 1NV0A 4GFRA 1Y4TA 1MY1A 1QJMA 2PVUA 4P9KA 4GWZA 1SW2A 1OVBA 3RT6B 1LGBC 2Y7RA 1FW0A 4KCDA 4QFPA 4N91A 1FQEA 4JWXA 4G8HA 1XVYA 3RTWB 4F18A 1FTAA 3RLFE 2DDKA 1UQWA 3LSXA 4NG7A 1KA0A 5I57A 4U22A 4YMBA 1VFDA 4OQOA 4U23A 3E79A 3CFZA 4LA9A 1FJ9A 1UTBA 1NH8A 4PE3A 3KSXA 3PPRA 1G0HA 1US5A 4JWOA 3USDA 3PV0E 3RUMA 2FIEA 2DWIA 2XXUA 2PBWA 3K1NA 3OENA 5H8HB 3HO7A 2E0SA 3Q28A 4TLMB 2IEEA 1H76A 4NF0A 4U21A 3KN3A 1VR5A 1GVCA 3KC1A 4Z7EA 2VPNA 3T1BA 3O66A 1OLAA 3CG1A 2I0BA 3U65A 1OIBA 3IFCA 1B7ZA 1K9ZA 3PUVE 5CBSA 5TU0A 1TWYA 4NQ8A 2ZZWA 2DVZA 3DELB 3BKIB 4OXVA 4GWXA 5TP9A 4EXKA 1R9LA 5DYHA 3M3KA 1ZU0A 3TTLA 4PFBA 3IX1A 3VFJA 3Q25A 5AA3A 1DTGA 3BIGA 3B6WA 3B50A 1Y3NA 4FAJA 2H9BA 1FBCA 4R9FA 1KA1A 3G3FA 1F9BA 4NGUA 1P1WA 3PUXE 3O9PA 2KQZA 1P1UA 4PBQA 1PB9A 1RYOA 4H1XA 2V84A 2RC9A 1N7WA 1D9VA 1NUZA 3E78A 1N04A 1VFEA 2H98A 2E1SA 1NV5A 1FBGA 1OQGA 3FV1A 2DS9A 4PAIA 1B05A 5KDTB 1URDA 1JETA 3PU5A 2Z8EA 4R2FA 3TEPA 5AA2A 2WYKA 3TFLA 1T0KA 4PE5B 3DP4A 5EQ8A 1LCFA 4ELOA 1TT1A 4PFTA 1BK4A 5KZTA 4BDNA 2OWZA 3MWBA 1UIUA 4OZ9A 2OZZA 1B2HA 2Y7WA 2D3IA 4H67A 4LZ7A 4NF5B 3OOAA 4PGNA 3O6GA 3U92A 3UORA 1M5DA 4MIJA 1MQDA 4HE1A 4NX1A 1FTLA 4QFOA 1IMBA 1S9TA 5J16A 4EDPA 2VPOA 4WKMA 4ZEFA 1KWHA 2RC7A 5CMKA 1LB8A 2UYFA 2CEYA 1NV1A 1FTJA 3VXCA 1O63A 1TFAA 4UACA 1MPCA 4N4UA 2XXHA 5FHMA 2L5VA 4TQUQ 4PP0A 5BUUA 2I3WA 4ZZAA 2RC8A 3R26A 4GWYA 3MPKA 4G77A 3N5LA 4OESA 1SW1A 4ZE8A 1MY3A 1B52A 4TOZA 4QRZA 1DCUA 4XTCQ 1M5EA 3RY3A 2F8DA 5A5XB 2F35A 2QS2A 4POWA 5EYGA 4NWDA 5H8HA 5AA4B 4PC9A 1N84A 3FVOA 1MPDA 2VOZA 4JBZA 4GXSB 5H8QB 1FPFA 4MEVA 1WDNA 4MJOA 2NVUB 1DMBA 2DWAA 3CVGA 4P1EA 3MJNA 4AS5A 5L9MA 3UP9A 1MH4A 4GBVA 4FJPA 1DSNA 4U2RA 4DDDA 3LR1A 3PD9A 1B4ZA 2Q74A 3GYYA 1B3LA 4NMYA 3PUZE 4IGTA 2GQ1A 5EYFA 1H43A 3SKPA 3VE1B 3BFUA 1R9QA 5EQAA 1RDZA 3B7DA 3M3FA 4THIA 2IA4A 3GLBA 5TPAA 2FBPA 3C36A 3DP6A 1B6HA 3RN8A 4F2QA 2P0SA 5L9OA 4O7IA 1JEUA 2XX9A 1NNKA 2G93A 2DE3A 1J1NA 5EYHA 4NF8B 4BLAA 3D1RA 2ZNUA 1MM7A 4P11A 3T9HB 1SVXB 3KC0A 1N0TA 2QVUA 3GBAA 1M5FA 3L6HA 3T22A 5DTBA 1EZPA 4YB5A 3H6UA 5ITOA 3OO7A 3C9HA 3Q26A 3IB2A 1XC1A 2FYIA 4IO5A 2F5XA 3PUWE 2WBDA 3THIA 1MRPA 4DE8A 1VDWA 2XXYA 4DXCA 5IZ1A 2HEUA 2R71A 4PETA 3W9VA 3LSLA 4ELRA 4LP2B 2F36A 1NH7A 2YJPA 2VP1A 4XF5A 2PCRA 1NNFA 3SDFA 3VLWA 4BDLA 3K6VA 4ELQA 3KJTA 3QIMA 1SPIA 3D4CA 3H3GA 5IGAA 4HE0A 1LBZA 4QFKA 4LUBA 4XKRA 2ANJA 3T9XB 1QUKA 3UIFA 2P1SA 3S9MC 1CNQA 4LATA 4XEQA 1FQAA 2RCBA 4U4XA 3FXBA 1O7TA 3OXNA 1FBEA 4P1LA 3U8QA 3TTNA 4FORA 4I8CA 1N76A 4NTLA 3RQTA 5JTYA 1IMDA 1MQJA 2QMWA 2QPQA 3K1MA 3CIJA 4YKIA 4P0GA 1A55A 1FBFA 4DIGA 1POY1 1SQYA 1JNFA 4UABA 2D21A 2UVJA 2F78A 2QS4A 2OX3A 1NI9A 1B7UA 1B3EA 4JWYA 1S7YA 4P56A 5CM6A 1NV4A 3OEMA 3MP1A 4P3LA 3MC2A 1AL3A 3ECRA 4GX4A 3TODA 4MFIA 4MLQA 2H4IA 5A5XA 1Y1ZA 2UVHA 3K00A 2XX8A 3Q29A 3CI8A 4PAFA 4PF6A 3CFLA 4O3AA 5IM2A 5H8QA 3MPLA 1BLFA 1EH3A 4R75A 2I4CA 1B0LA 5AA2B 4KD5A 1WODA 1R6ZA 1O64A 1Z7ME 2DXRA 4RPOA 4I3YA 4G2ZA 4KQPA 4OYVA 5HM4B 4ZECA 1P1NA 1ZMGA 3QUFA 3GZGA 3MUQA 3MVYA 3SEVA 4BDQA 1PBPA 1EU8A 2OK2A 3ZSFA 3VXBA 4EF2A 2XXPA 4HCWA 3VDFA 3ISPA 5CMBA 5ESYA 4LN5A 3IR1A 4MX6A 2JJKA 2WEFA 3MQ9A 1B3FA 4KYSA 1SI0A 5FHOA 4I40A 1FBHA 3O97A 4NF8A 2YPNA 3MAMA 1NUXA 4MF3A 3K01A 3SEWA 1IEJA 4HW8A 1I6QA 5AE4A 2XA5A 4ELPA 2XXTA 4JVIA 4GRKA 2HCAA 5I3SA 1ZBMA 2F97A 5FTIA 4RA1A 4DI4B 1QKBA 4FEDA 4GX3A 1LBVA 4R72A 5DVJA 3MYUA 1TFDA 3PPNA 2QJEA 3AXFA 1FBPA 4GL0A 3WAEA 3QMFA 1G0IA 3FIRA 3ZKKA 3MP6A 3CSGA 4ESXA 2HZLA 3TTKA 1Y1MA 4WEDA 1IIWA 3HCQA 1NV2A 4JVDA 4R6HA 2NWJA 4OANA 2V3QA 4OERA 4N13A 1HSJA 1DBZA 5LDZA 4FATA 1H45A 3W15C 4G4PA 3JV9A 3IORA 2H5YA 1WVJA 3T66A 2DQVA 3FXQA 1DPEA 2F7BA 4H5GA 4YZZA 3FXRA 1RKMA 2VGQA 3IK6B 4OFLA 4G68C 4FEBA 1EYJA 2RF1A 5CMMA 2Q2AA 4RJZA 4U4SA 4HE2A 2V3UA 2QS3A 1N7XA 4JB7A 2O7IA 2LAOA 2HHMA 4RPNA 5T3JA 1PDAA 4G61A 5F1QA 3FJ7A 3VLUA 1FQCA 4OVRA 4F29A 5TPAB 1B5HA 4IGRA 1VSOA 1I69A 2THIA 3K0VA 1IUDA 3FATA 4H0WA 3KBZA 3ROJA 3OEKA 1I6AA 4H8IA 3O6HA 4OWDA 2H99A 3ZKLA 3R6UA 2OJTA 2AIXA 4RK2A 3PMXA 1PEBA 2QMXA 3KGCA 4OFJA 1LFGA 1MH3A 1B4HA 2CEXA 1XHYA 1QKAA 3JYRA 4PTKA 4MNPA 4Q5TA 3BFTA 1HSLA 2ZNTA 2O1MA 1YPNA 3DLNA 2Y5KA 4IO3A 4F19A 1DPPA 4PFYA 3G3JA 2P3NA 1LBYA 4I1DA 5LOMA 5I5PA 5AA1A 1ELJA 3KOSA 5I84A 4PFIA 2XXRA 3OELA 3EPEA 4ZS9A 3DP8A 3MZBA 4MBPA 2AL4A 4RK9A 3S9NC 4X1BA 2DWHA 3F11A 2F3DA 2VT5A 4N8GA 1Q9DA 2UVIA 2V3TA 3EHUA 4OVSA 1SW5A 3OSQA 4HXVA 4GLIA 2O51A 2ESNA 4XIGQ 3BBRA 5DVIA 5ITPA 2XXXA 2OWTA 1A8EA 1N3XA 2HAVA 1FPGA 3FGSA 4C0RA 1DTZA 4N6PA 4X9TA 3SEXA 4ZE9A 4IB2A 3T93B 3FV2A 3ILUB 3QYTA 3P7IA 3HV1A 4KFQA 3SESA 2QS1A 4ISUA 4E0XA 1JVYA 1MS7A 3HSTA 2WYPA 4H65A 3CSBA 1D9YA 3TTMA 2XWVA 5DVFA 4GX6A 5K2XA 5IAIA 4F31B 3FD3A 5JTYB 5CBRA 1FTMA 1GGGA 4F1UA 1ZJLA 2KR0A 2RKMA 2VHAA 4OVTA 4ECFA 2ZNSA 4RXLA 4KR5A 4LQ2A 4NAPA 4NE4A 3KSJA 1JQFA 3PPPA 4OETA 1L5TA 2I4BA 2ABHA 2I58A 4U1OA 4DZ1A 4AQ4A 5A5LA 1FPBA 3I5OA 2XXIA 3H6WA 3ILTB 3OMBA 3K6UA 5DT6A 5ET5A 1D4NA 4K3FA 3EN3A 2DE2A 3TZAA 1NMUA 1MXVA 3TMGA 1FQBA 5FTHA 1IMEA 1P99A 2XXQA 4YMAA 5JEIA 3A3UA 2HXWA 2GRVA 3V8XB 1B7HA 5CC2A 3KFMA 1EYIA 4NEDA 1RDYA 4N07A 3KEIA 4M1VA 5EQ9A 5K2YA 5I59B 4KCCA 1SBPA 1LAHE 3JZJA 3U72A 3LSWA 4GD5A 3MSTA 4FBPA 4NF6B 2I6EA 2G29A 3IOUA 1IMFA 2OCUA 3EF7A 3MBPA 4ESWA 3UK4A 1MY2A 3IJOB 4OEVA 1NNTA 4GL8A 4IO4A 1XT8A 2ZZVA 1LB9A 4I62A 3E3KA 5IKBA 3EQ1A 1FCKA 1IITA 2BJIA 1JW4A 1Q35A 4JSOA 1GR2A 2XD3A 4I3EA 4BDOA 3N6TA 3EKIA 1B1XA 2XWIA 4F3GA 1LLSA 2D5WA 1FPLA 4EUOA 4AS4A 1OLCA 5H8FA 2M8CA 1OMPA 2GHBA 3LUYA 3IFAA 2VD2A 1PB7A 4NN3A 3MVXA 3O2AA 2QL3A 5I56B 3HN0A 3FVNA 4KYDA 1XOCA 3RNNA 3OD7A 3CHGA 2PYYA 1XI6A 3T9VA 1BKAA 3T0JA 1B46A 4N15A 4DCXA 1IZ1A 1QUJA 1FPIA 2DVCA 4QSEA 4PFRA 3KZGA 2CZIA 2R6GE 1JW1A 1QVSA 2A5SA 4C1TA 2UXAA 3V89B 2X7PA 4PF8A 5CRYA 1UIVA 4H5FA 3H7MA 2F6PA 5ISUA 1FPEA 1GV8A 3CFXA 3IOVA 3SETA 2HQ0A 5L8DA 1OQHA 5IZZA 3QAXA 1CE2A 4P0IA 4EQ7A 3C32A 4WXJA 3O28A 3FXUA 1P1OA 4KPTA 1NV6A 2QVRA 3KG2A 3IL1B 3C4MA 3PTYA 3S2VA 4NHBA 3SEUA 2DE4A 3B8BA 1Y3PA 4X48A 5ET8A 2GFEA 3E13X 3RGYA 2ZXTA 4OMBA 3O6IA 1URSA 1LFHA 2Y84A 4OENA 2FNCA 3D4GA 1MQIA 4NF4B 1ZIUA 5JK4A 1B0HA 4F3SA 2PFZA 1Y9UA 1FQFA 4X04A 4PCDA 2RINA 2Q8MA 1LAFE 4UA8A 4ONYA 1H3DA 4N8YA 4OTEA 2ZYKA 3C33A 4PGPA 4R2BA 4IY5A 4F3BA 4ZEKA 4F39A 3RPWA 4X1DA 4XXUA 2F34A 4BDMA 1NV3A 1B3HA 3R7XA 4DXUA 3RTFB 3ODBA 2Z22A 2OLBA 3VVFA 3FBPA 2UVGA 3IB0A 3MZ9A 3VV5A 1I6BA 3MW0A 4N81A 1NNPA 2XXVA 4PDHA 3ZS6A 3OO6A 2DOJA 2F3BA 1JVXA 2O6AA 3OO9A 1CB6A 4F1VA 4FECA 3GXAA 5I59A 1JEVA 5I2KB 3A3CA 3SEYA 4GBWA 1IXIA 5BWJA 3KN7A 3G3HA 1QUIA 3CG3A 2B4MA 3MVWA 4NF6A 4JXIA 3H6TA 4H46A 1URGA 4GXAA 4F2OA 1A99A 2FHYA 5H8NB 4N17A 3U94A 4OA4A 3IOTA 4GOTA 4EXLA 4E0WA 1US4A 4GWWA 5EQ7A 2XXKA 4QFNA 3RT8A 2R8TA 1LFIA 5FBPA 1EZOA 3MVZA 5B7DA 3K4UA 2WBBA 1M5CA 2Z8FA 1D3KA 4KXPA 1ANFA 1HSEA 4M4GA 2V25A 2QFLA 1B3GA 1NUWA 1VE4A 4PFWA 4G8NA 2QSXA 1YZ0A 4EQBA 5I56A 3N26A 4FIMA 3TCGA 1ZLQA 4MHFA 4YKJA 4JDFA 1NFTA 1FBDA 5I2NA 2PFYA 5I58A 1IMAA 1KZ8A 5ICTA 1NV7A 5CMCA 2CZHA 3B6TA 2B65A 3U93A 1OVTA 2P2AA 4HTGA 1N3WA 1LBWA 4HS7A 4R9GA 3TAJA 4X8RA 1XVXA 3ONMA 3B6QA 4YKPA 2I3VA 4YKKA 1MDP1 3W9WA 4JVCA 4PBHA 4XKPA 1ZKBA 1SYIA 2OWSA 3RPLB 3TQWA 3UA8A 2O7UA 3V5AA 4LVQA 4PQJA 4GWSA 1TXFA 1A7LA 4RYAA 2X26A 3G3GA 2CZKA 4RY1A 4MNIA 1FRPA 2ZMBA 5J1DA 2FVZA 2HFBA 2OPEA 4LZ5A 3G7WA 3K02A 4XKQA 1PB8A 5HPQA 3LSFB 3MZ1A 3A09A 2V93A 4QXDA 4OVPA 4NF4A 3PUYE 2F6GA 2DP8A 2REGA 2F7CA 1QGXA 5L9SA 3EHTA 4YU0A 3CR9A 5M2VA 2BJJX 2Y7KA 5F24A 2HAUA 2A5TB 3U1OA 4I9DA 1FPKA 1EYKA 4WEPA 1NUYA 4N6KA 3TDJA 1FTOA 3Q27A 3IJXB 1R1NA 5H8FB 1RYXA 3RYDA 4O8MA 5ELVA 2ONSA 1MXYA 4IO2A 3A29A 4OFOA 1XS5A 2Z23A 1QULA 2ONKE 4G8MA 2R9JA 3IOWA 1JW5A 1AH5A 4N6DA 4R6KA 4NWCA 3L6GA 3PD8A 1AOVA 3M3LA 4ZEBA 1EZ9A 2HPGA 1BIYA 4DI3D 5I2KA 2Z8DA 2UYEA 4MH5A 3VLVA 2F7AA 5IZ3B 3FUZA 1D9QA 3H4ZA 3DM0A 4MMPA 4AB5A 1YAEA 2DXYA 2YLNA 1H44A 1SDXA 1PC3A 4OVJA 5H8NA 4KI0E 4O94A 4H8JA 3LC8A 1MM6A 4F22A 1Y20A 4ZDMA 1LSTA 3G3IA 3IO4A 2FA7A 4OVQA 4PDDA 1B40A 4P47A 2HZKA 4JSDA 2PMSA 3WAFA 2WX9A 4Q30B 4TLLB 4H45A 2Q9TA 3QK6A 5H8SA 3TTRA 3C35A 4XKNA 4YB7A 1IXGA 4BDRA 4C1UA 1B32A 3C31A 3K1PA 1SD3A 4MAGA 2O69A 4R6YA 1Y4CA 5HBCA 3QSLA 3K2DA 1MXUA 3VVEA 4OHNA 3H06B 5ICQA 4MNCA 4QFLA 1PBQA 4XFEA 4IO7A 5LTCA 1YXIA 3T96B 2B3FA 1Y3QA 1YYZA 3T9UA 1B51A 4GF8A 1FQDA 2X7QA 4R73A 4DLDA 1UTHB 4O7MA 4YAHX 2O68A 1FPJA 2VD3A 1BTJA 3PPQA 2MKZA 4POXA 4GWOA 2NOOA 3FZVA 3RPLA 1K9YA 3HHGA 2XWOA 1LBBA 1MQGA 4IO6A 4G68B 1YCJA 3FVGA 4O3CA 2FIXA 2Q8JA 1B9JA 3BIHA 3KOTA 3PMVA 4GVOA 1FSAA 3QUJA 5B70A 4FE8A 3PMWA 4GQOA 5DEXB 2NXOA 1LBXA 5KCJB 1A40A 3QXMA 2PX1A 4RNSA 4PFUA 3G3KA 4LQ5A 3FJMA 2I0CA 1IXHA 2XXWA 1MY0A 5EHSA 1DK4A 3UN6A 1MDQA 1INPA 1P1QA 2A5TA 2DWJA 2RCAA 5ET6A 3NOHA 4OEUA 4GWUA 3TUSA 3IAZA 2ONRA 3TKDA 3TYHA 2XD2A 3H03A 2QVVA 4Z0IA 3LV0A 2PT2A 3CRBA 4ND9A 2GH9A 2H25A 4MLVA 1IMCA 5I2NB 4L17A 2V4CA 1MXXA 1RDXA 5I58B 4HCYA 2P3VA 2Q88A 4QSDA 2WKYA 2Y5LA 3FVKA 1A54A 1FPDA 3HFUA 1FTKA 4AB6A 1B58A 2Y7PA 3K6WA 3IB1A 4EQ9A 1LEVA 1IXCA 3E9XA 5I57B 1UTBB 2GHAA 1IQ7A 1POTA 1DOTA 2HXRA 1BP5A 1MY4A 5IZ3A 2NUVA 5KDTA 4R74A 1USYH 3E4RA 5FHNA 5EHMA 2W7YA 4IY6A 3HPIA 2Q89A 3I6VA 3SZPA 1MPBA 3O29A 3N6UA 1NL5A 3S4UA 2PT1A 3GBBA 1USYE 1LCTA 2I49A 2ZZXA 1II5A 2KLFA 3TQLA 3HHFA 4P8BA 3LUZA 2AYSA 5CI5A 1AWBA 4Q0CA 3TCHA 1SW4A 1ZTYA 4YB6A 4YICA 4ZZEA 4NF5A 1B5IA 3S9EA 2QRYA 3TCFA 1S50A 3OO8A 3PGFA 4ZEDA 2O84X 1JP4A 1YTVA 1SYHA 1SI1A 3PPOA 3KJ7A 4QHQA 5TP9B 1GTKA 1MXZA 4LONB 5DW8A 1ATGA 4KYEA 4DXBA 2OPDA 3OSRA 4PAKA 5AA2D 1Z7NE 1LBCA 2OBGA 4ZEIA 2O1LA 1MXWA 3FJGA 4EF1A 3V83A 4LZ8A 4GIZA 1MG1A 1B1HA 1UTHA 5F7VA 2AL5A 3MP8A 2REJA 3I3VA 2ZYOA
chains in the Genus database with same CATH topology
3D1RA 2XWKA 4GWSA 3KC0A 2QVUA 2CZKA 4MNIA 1FRPA 5J1DA 2FVZA 2WYPA 2XWVA 4GX6A 1FJ6A 4F1UA 2B4LA 2KR0A 2F5XA 4QXDA 4OVPA 4OVTA 2WBDA 5I7IA 1QGXA 1VDWA 4QBAA 4NAPA 4MCOA 5IZ1A 4PETA 3W9VA 5F24A 5ET7A 1FPKA 1EYKA 5A5LA 1FPBA 1NUYA 4N6KA 5ET5A 4XF5A 2DE2A 4IR8A 2PCRA 3RYDA 4O8MA 1IMEA 1SPIA 5IGAA 4HE0A 1LBZA 1NV0A 3A29A 1EYIA 4P9KA 4GWZA 1RDYA 1CNQA 4XEQA 4M1VA 5EQ9A 4N6DA 4N91A 4F18A 3FXBA 2HPGA 1FTAA 1FBEA 4P1LA 4DI3D 2DDKA 3MSTA 4FBPA 4NG7A 1IMFA 1KA0A 5IZ3B 1D9QA 1IMDA 2QPQA 3E79A 4MMPA 1FJ9A 1FBFA 4PE3A 2ZZVA 4UABA 4O94A 1G0HA 2BJIA 2OX3A 1NI9A 4OVQA 2FIEA 4PDDA 4P56A 4I3EA 5CM6A 1NV4A 4P47A 3EKIA 4P3LA 2XWIA 4GX4A 1FPLA 4AS4A 2HZKA 2WX9A 4H45A 2Q9TA 3IFAA 4NF0A 4NN3A 3KC1A 4PAFA 4PF6A 2VPNA 3T1BA 3CHGA 5IM2A 3U65A 4MAGA 1XI6A 3IFCA 3T0JA 1K9ZA 4N15A 4NQ8A 2ZZWA 2DVZA 1FPIA 4MNCA 4PFRA 4XFEA 4GWXA 4I3YA 2CZIA 5LTCA 1YXIA 1YYZA 4PFBA 4PF8A 3BIGA 4HCWA 3ISPA 1FPEA 5ESYA 3B50A 4LN5A 4O7MA 1FPJA 4MX6A 2JJKA 2WEFA 1FBCA 1KA1A 5IZZA 2MKZA 4NGUA 4I40A 3RPLA 1K9YA 1FBHA 2XWOA 2KQZA 1NV6A 2QVRA 4PBQA 1NUXA 2FIXA 3PTYA 4NHBA 2DE4A 3B8BA 1NUZA 2XA5A 5ET8A 3BIHA 3E78A 4JVIA 1FSAA 1NV5A 1FBGA 5I3SA 1LBXA 4DI4B 4GX3A 1LBVA 4PAIA 3MYUA 5JK4A 1FBPA 2PFZA 3QMFA 4X04A 4PCDA 1G0IA 2Q8MA 2WYKA 2HZLA 5EQ8A 1NV2A 4N8YA 1DK4A 4JVDA 1INPA 4PGPA 5ET6A 3NOHA 4OANA 4GWUA 2V3QA 1BK4A 2OWZA 1DBZA 1NV3A 2QVVA 3LV0A 5LDZA 3FBPA 4PGNA 1IMCA 4MIJA 4YZZA 4N81A 4HE1A 4NX1A 2V4CA 4PDHA 1RDXA 2P3VA 4HCYA 2F3BA 1IMBA 1EYJA 5J16A 4F1VA 2Y5LA 2VPOA 1FPDA 3HFUA 4HE2A 4GBWA 1LEVA 2HHMA 5T3JA 4G61A 2B4MA 2CEYA 1NV1A 4OVRA 4H46A 2HXRA 5IZ3A 2FHYA 4N4UA 2L5VA 4N17A 4OA4A 3KBZA 3ROJA 4GWYA 3SZPA 4GWWA 5EQ7A 2ZZXA 2XXKA 2R8TA 1DCUA 5FBPA 2WBBA 2CEXA 5EYGA 4KXPA 4P8BA 3LUZA 4PTKA 4MNPA 4PC9A 1AWBA 2QFLA 1NUWA 4YICA 1YZ0A 2Y5KA 1FPFA 4MEVA 4F19A 4MJOA 4MHFA 1FBDA 2P3NA 1LBYA 2PFYA 1JP4A 4P1EA 1IMAA 1KZ8A 4AS5A 1NV7A 5I5PA 2CZHA 4PFIA 4GBVA 2Q74A 3GYYA 2GQ1A 2F3DA 5DW8A 2VT5A 5EQAA 1RDZA 4N8GA 1Q9DA 1LBWA 4OVSA 2FBPA 4HXVA 4PAKA 4X8RA 4O7IA 3W9WA 4JVCA 4PBHA 2DE3A 1FPGA 3RPLB 4X9TA 5EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBH A;  5IZ3 B;  1D9Q A;  4H46 A;  3D1R A;  1IMD A;  1FJ9 A;  1NV6 A;  2QVR A;  4GWS A;  5IZ3 A;  1NUX A;  2FHY A;  2FIX A;  1FBF A;  3KC0 A;  2QVU A;  3B8B A;  2CZK A;  1NUZ A;  3KBZ A;  5ET8 A;  3BIH A;  1FRP A;  3ROJ A;  1FSA A;  2FVZ A;  1G0H A;  4GWY A;  1NV5 A;  1FBG A;  2BJI A;  5I3S A;  4GX6 A;  2OX3 A;  1LBX A;  1NI9 A;  4GWW A;  5EQ7 A;  1FJ6 A;  4GX3 A;  2FIE A;  1LBV A;  2R8T A;  4I3E A;  1NV4 A;  1DCU A;  5FBP A;  4GX4 A;  4QXD A;  1FBP A;  1FPL A;  2WBD A;  4AS4 A;  2WBB A;  3QMF A;  5EYG A;  4KXP A;  1G0I A;  3LUZ A;  1QGX A;  1VDW A;  4H45 A;  4PTK A;  2Q8M A;  3IFA A;  1AWB A;  2QFL A;  5IZ1 A;  3KC1 A;  1NUW A;  5EQ8 A;  1NV2 A;  5F24 A;  1DK4 A;  5ET7 A;  1YZ0 A;  1FPK A;  1EYK A;  5A5L A;  1FPB A;  2Y5K A;  1FPF A;  1INP A;  1NUY A;  4MJO A;  1XI6 A;  5ET5 A;  3IFC A;  5ET6 A;  4GWU A;  1FBD A;  4IR8 A;  2P3N A;  1BK4 A;  1LBY A;  3T0J A;  1JP4 A;  1K9Z A;  1IMA A;  2OWZ A;  1KZ8 A;  4AS5 A;  1NV7 A;  2PCR A;  1DBZ A;  1NV3 A;  2QVV A;  2CZH A;  3LV0 A;  5LDZ A;  3RYD A;  1IME A;  1FPI A;  4GBV A;  1SPI A;  2Q74 A;  4GWX A;  4I3Y A;  2CZI A;  4HE0 A;  1LBZ A;  2GQ1 A;  3FBP A;  1YXI A;  1IMC A;  1NV0 A;  3A29 A;  1EYI A;  2F3D A;  5DW8 A;  1YYZ A;  4GWZ A;  2VT5 A;  5EQA A;  1RDZ A;  4N81 A;  4HE1 A;  1RDY A;  1Q9D A;  1CNQ A;  1LBW A;  1RDX A;  2FBP A;  2P3V A;  2F3B A;  1IMB A;  4HXV A;  1EYJ A;  5J16 A;  5EQ9 A;  3BIG A;  2Y5L A;  4O7I A;  1FPE A;  1FPD A;  5ESY A;  4HE2 A;  1FPJ A;  2JJK A;  1FTA A;  2WEF A;  1FBE A;  1FBC A;  4GBW A;  1KA1 A;  1FPG A;  1LEV A;  2DDK A;  4FBP A;  2HHM A;  3RPL B;  5T3J A;  4G61 A;  4I40 A;  1IMF A;  1NV1 A;  5EYH A;  1KA0 A;  3RPL A;  1K9Y A; 
#chains in the Genus database with same CATH topology
 3S9L C;  3IO6 A;  4QF9 A;  1LAX A;  2XWK A;  3LBS A;  1AIV A;  3SER A;  2Y7I A;  4G68 A;  3EHS A;  1Q1K A;  2XHD A;  2ZYN A;  5AA4 A;  2DSF A;  3H6V A;  3KN8 A;  4F3P A;  5DEX A;  3UGW A;  1FJ6 A;  3VVD A;  5KCJ A;  2B4L A;  4H6D A;  1A8F A;  2ZYM A;  1AMF A;  1M5B A;  3TEL A;  2CZL A;  5I7I A;  4QBA A;  4MCO A;  2ALU A;  2B3B A;  2XX7 A;  2CMO A;  3K6X A;  5ET7 A;  1B5J A;  3M8U A;  3C34 A;  2I48 A;  3FAS A;  2Q2C A;  4QSC A;  3TPA A;  3KBR A;  4IR8 A;  3N94 A;  4DCY A;  1LAG E;  2DYX A;  4O3B A;  4U1Z A;  4F1Y A;  4KHZ E;  1MQH A;  4Q8R A;  1NKX A;  1QW0 A;  1NV0 A;  4GFR A;  1Y4T A;  1MY1 A;  1QJM A;  2PVU A;  4P9K A;  4GWZ A;  1SW2 A;  1OVB A;  3RT6 B;  1LGB C;  2Y7R A;  1FW0 A;  4KCD A;  4QFP A;  4N91 A;  1FQE A;  4JWX A;  4G8H A;  1XVY A;  3RTW B;  4F18 A;  1FTA A;  3RLF E;  2DDK A;  1UQW A;  3LSX A;  4NG7 A;  1KA0 A;  5I57 A;  4U22 A;  4YMB A;  1VFD A;  4OQO A;  4U23 A;  3E79 A;  3CFZ A;  4LA9 A;  1FJ9 A;  1UTB A;  1NH8 A;  4PE3 A;  3KSX A;  3PPR A;  1G0H A;  1US5 A;  4JWO A;  3USD A;  3PV0 E;  3RUM A;  2FIE A;  2DWI A;  2XXU A;  2PBW A;  3K1N A;  3OEN A;  5H8H B;  3HO7 A;  2E0S A;  3Q28 A;  4TLM B;  2IEE A;  1H76 A;  4NF0 A;  4U21 A;  3KN3 A;  1VR5 A;  1GVC A;  3KC1 A;  4Z7E A;  2VPN A;  3T1B A;  3O66 A;  1OLA A;  3CG1 A;  2I0B A;  3U65 A;  1OIB A;  3IFC A;  1B7Z A;  1K9Z A;  3PUV E;  5CBS A;  5TU0 A;  1TWY A;  4NQ8 A;  2ZZW A;  2DVZ A;  3DEL B;  3BKI B;  4OXV A;  4GWX A;  5TP9 A;  4EXK A;  1R9L A;  5DYH A;  3M3K A;  1ZU0 A;  3TTL A;  4PFB A;  3IX1 A;  3VFJ A;  3Q25 A;  5AA3 A;  1DTG A;  3BIG A;  3B6W A;  3B50 A;  1Y3N A;  4FAJ A;  2H9B A;  1FBC A;  4R9F A;  1KA1 A;  3G3F A;  1F9B A;  4NGU A;  1P1W A;  3PUX E;  3O9P A;  2KQZ A;  1P1U A;  4PBQ A;  1PB9 A;  1RYO A;  4H1X A;  2V84 A;  2RC9 A;  1N7W A;  1D9V A;  1NUZ A;  3E78 A;  1N04 A;  1VFE A;  2H98 A;  2E1S A;  1NV5 A;  1FBG A;  1OQG A;  3FV1 A;  2DS9 A;  4PAI A;  1B05 A;  5KDT B;  1URD A;  1JET A;  3PU5 A;  2Z8E A;  4R2F A;  3TEP A;  5AA2 A;  2WYK A;  3TFL A;  1T0K A;  4PE5 B;  3DP4 A;  5EQ8 A;  1LCF A;  4ELO A;  1TT1 A;  4PFT A;  1BK4 A;  5KZT A;  4BDN A;  2OWZ A;  3MWB A;  1UIU A;  4OZ9 A;  2OZZ A;  1B2H A;  2Y7W A;  2D3I A;  4H67 A;  4LZ7 A;  4NF5 B;  3OOA A;  4PGN A;  3O6G A;  3U92 A;  3UOR A;  1M5D A;  4MIJ A;  1MQD A;  4HE1 A;  4NX1 A;  1FTL A;  4QFO A;  1IMB A;  1S9T A;  5J16 A;  4EDP A;  2VPO A;  4WKM A;  4ZEF A;  1KWH A;  2RC7 A;  5CMK A;  1LB8 A;  2UYF A;  2CEY A;  1NV1 A;  1FTJ A;  3VXC A;  1O63 A;  1TFA A;  4UAC A;  1MPC A;  4N4U A;  2XXH A;  5FHM A;  2L5V A;  4TQU Q;  4PP0 A;  5BUU A;  2I3W A;  4ZZA A;  2RC8 A;  3R26 A;  4GWY A;  3MPK A;  4G77 A;  3N5L A;  4OES A;  1SW1 A;  4ZE8 A;  1MY3 A;  1B52 A;  4TOZ A;  4QRZ A;  1DCU A;  4XTC Q;  1M5E A;  3RY3 A;  2F8D A;  5A5X B;  2F35 A;  2QS2 A;  4POW A;  5EYG A;  4NWD A;  5H8H A;  5AA4 B;  4PC9 A;  1N84 A;  3FVO A;  1MPD A;  2VOZ A;  4JBZ A;  4GXS B;  5H8Q B;  1FPF A;  4MEV A;  1WDN A;  4MJO A;  2NVU B;  1DMB A;  2DWA A;  3CVG A;  4P1E A;  3MJN A;  4AS5 A;  5L9M A;  3UP9 A;  1MH4 A;  4GBV A;  4FJP A;  1DSN A;  4U2R A;  4DDD A;  3LR1 A;  3PD9 A;  1B4Z A;  2Q74 A;  3GYY A;  1B3L A;  4NMY A;  3PUZ E;  4IGT A;  2GQ1 A;  5EYF A;  1H43 A;  3SKP A;  3VE1 B;  3BFU A;  1R9Q A;  5EQA A;  1RDZ A;  3B7D A;  3M3F A;  4THI A;  2IA4 A;  3GLB A;  5TPA A;  2FBP A;  3C36 A;  3DP6 A;  1B6H A;  3RN8 A;  4F2Q A;  2P0S A;  5L9O A;  4O7I A;  1JEU A;  2XX9 A;  1NNK A;  2G93 A;  2DE3 A;  1J1N A;  5EYH A;  4NF8 B;  4BLA A;  3D1R A;  2ZNU A;  1MM7 A;  4P11 A;  3T9H B;  1SVX B;  3KC0 A;  1N0T A;  2QVU A;  3GBA A;  1M5F A;  3L6H A;  3T22 A;  5DTB A;  1EZP A;  4YB5 A;  3H6U A;  5ITO A;  3OO7 A;  3C9H A;  3Q26 A;  3IB2 A;  1XC1 A;  2FYI A;  4IO5 A;  2F5X A;  3PUW E;  2WBD A;  3THI A;  1MRP A;  4DE8 A;  1VDW A;  2XXY A;  4DXC A;  5IZ1 A;  2HEU A;  2R71 A;  4PET A;  3W9V A;  3LSL A;  4ELR A;  4LP2 B;  2F36 A;  1NH7 A;  2YJP A;  2VP1 A;  4XF5 A;  2PCR A;  1NNF A;  3SDF A;  3VLW A;  4BDL A;  3K6V A;  4ELQ A;  3KJT A;  3QIM A;  1SPI A;  3D4C A;  3H3G A;  5IGA A;  4HE0 A;  1LBZ A;  4QFK A;  4LUB A;  4XKR A;  2ANJ A;  3T9X B;  1QUK A;  3UIF A;  2P1S A;  3S9M C;  1CNQ A;  4LAT A;  4XEQ A;  1FQA A;  2RCB A;  4U4X A;  3FXB A;  1O7T A;  3OXN A;  1FBE A;  4P1L A;  3U8Q A;  3TTN A;  4FOR A;  4I8C A;  1N76 A;  4NTL A;  3RQT A;  5JTY A;  1IMD A;  1MQJ A;  2QMW A;  2QPQ A;  3K1M A;  3CIJ A;  4YKI A;  4P0G A;  1A55 A;  1FBF A;  4DIG A;  1POY 1;  1SQY A;  1JNF A;  4UAB A;  2D21 A;  2UVJ A;  2F78 A;  2QS4 A;  2OX3 A;  1NI9 A;  1B7U A;  1B3E A;  4JWY A;  1S7Y A;  4P56 A;  5CM6 A;  1NV4 A;  3OEM A;  3MP1 A;  4P3L A;  3MC2 A;  1AL3 A;  3ECR A;  4GX4 A;  3TOD A;  4MFI A;  4MLQ A;  2H4I A;  5A5X A;  1Y1Z A;  2UVH A;  3K00 A;  2XX8 A;  3Q29 A;  3CI8 A;  4PAF A;  4PF6 A;  3CFL A;  4O3A A;  5IM2 A;  5H8Q A;  3MPL A;  1BLF A;  1EH3 A;  4R75 A;  2I4C A;  1B0L A;  5AA2 B;  4KD5 A;  1WOD A;  1R6Z A;  1O64 A;  1Z7M E;  2DXR A;  4RPO A;  4I3Y A;  4G2Z A;  4KQP A;  4OYV A;  5HM4 B;  4ZEC A;  1P1N A;  1ZMG A;  3QUF A;  3GZG A;  3MUQ A;  3MVY A;  3SEV A;  4BDQ A;  1PBP A;  1EU8 A;  2OK2 A;  3ZSF A;  3VXB A;  4EF2 A;  2XXP A;  4HCW A;  3VDF A;  3ISP A;  5CMB A;  5ESY A;  4LN5 A;  3IR1 A;  4MX6 A;  2JJK A;  2WEF A;  3MQ9 A;  1B3F A;  4KYS A;  1SI0 A;  5FHO A;  4I40 A;  1FBH A;  3O97 A;  4NF8 A;  2YPN A;  3MAM A;  1NUX A;  4MF3 A;  3K01 A;  3SEW A;  1IEJ A;  4HW8 A;  1I6Q A;  5AE4 A;  2XA5 A;  4ELP A;  2XXT A;  4JVI A;  4GRK A;  2HCA A;  5I3S A;  1ZBM A;  2F97 A;  5FTI A;  4RA1 A;  4DI4 B;  1QKB A;  4FED A;  4GX3 A;  1LBV A;  4R72 A;  5DVJ A;  3MYU A;  1TFD A;  3PPN A;  2QJE A;  3AXF A;  1FBP A;  4GL0 A;  3WAE A;  3QMF A;  1G0I A;  3FIR A;  3ZKK A;  3MP6 A;  3CSG A;  4ESX A;  2HZL A;  3TTK A;  1Y1M A;  4WED A;  1IIW A;  3HCQ A;  1NV2 A;  4JVD A;  4R6H A;  2NWJ A;  4OAN A;  2V3Q A;  4OER A;  4N13 A;  1HSJ A;  1DBZ A;  5LDZ A;  4FAT A;  1H45 A;  3W15 C;  4G4P A;  3JV9 A;  3IOR A;  2H5Y A;  1WVJ A;  3T66 A;  2DQV A;  3FXQ A;  1DPE A;  2F7B A;  4H5G A;  4YZZ A;  3FXR A;  1RKM A;  2VGQ A;  3IK6 B;  4OFL A;  4G68 C;  4FEB A;  1EYJ A;  2RF1 A;  5CMM A;  2Q2A A;  4RJZ A;  4U4S A;  4HE2 A;  2V3U A;  2QS3 A;  1N7X A;  4JB7 A;  2O7I A;  2LAO A;  2HHM A;  4RPN A;  5T3J A;  1PDA A;  4G61 A;  5F1Q A;  3FJ7 A;  3VLU A;  1FQC A;  4OVR A;  4F29 A;  5TPA B;  1B5H A;  4IGR A;  1VSO A;  1I69 A;  2THI A;  3K0V A;  1IUD A;  3FAT A;  4H0W A;  3KBZ A;  3ROJ A;  3OEK A;  1I6A A;  4H8I A;  3O6H A;  4OWD A;  2H99 A;  3ZKL A;  3R6U A;  2OJT A;  2AIX A;  4RK2 A;  3PMX A;  1PEB A;  2QMX A;  3KGC A;  4OFJ A;  1LFG A;  1MH3 A;  1B4H A;  2CEX A;  1XHY A;  1QKA A;  3JYR A;  4PTK A;  4MNP A;  4Q5T A;  3BFT A;  1HSL A;  2ZNT A;  2O1M A;  1YPN A;  3DLN A;  2Y5K A;  4IO3 A;  4F19 A;  1DPP A;  4PFY A;  3G3J A;  2P3N A;  1LBY A;  4I1D A;  5LOM A;  5I5P A;  5AA1 A;  1ELJ A;  3KOS A;  5I84 A;  4PFI A;  2XXR A;  3OEL A;  3EPE A;  4ZS9 A;  3DP8 A;  3MZB A;  4MBP A;  2AL4 A;  4RK9 A;  3S9N C;  4X1B A;  2DWH A;  3F11 A;  2F3D A;  2VT5 A;  4N8G A;  1Q9D A;  2UVI A;  2V3T A;  3EHU A;  4OVS A;  1SW5 A;  3OSQ A;  4HXV A;  4GLI A;  2O51 A;  2ESN A;  4XIG Q;  3BBR A;  5DVI A;  5ITP A;  2XXX A;  2OWT A;  1A8E A;  1N3X A;  2HAV A;  1FPG A;  3FGS A;  4C0R A;  1DTZ A;  4N6P A;  4X9T A;  3SEX A;  4ZE9 A;  4IB2 A;  3T93 B;  3FV2 A;  3ILU B;  3QYT A;  3P7I A;  3HV1 A;  4KFQ A;  3SES A;  2QS1 A;  4ISU A;  4E0X A;  1JVY A;  1MS7 A;  3HST A;  2WYP A;  4H65 A;  3CSB A;  1D9Y A;  3TTM A;  2XWV A;  5DVF A;  4GX6 A;  5K2X A;  5IAI A;  4F31 B;  3FD3 A;  5JTY B;  5CBR A;  1FTM A;  1GGG A;  4F1U A;  1ZJL A;  2KR0 A;  2RKM A;  2VHA A;  4OVT A;  4ECF A;  2ZNS A;  4RXL A;  4KR5 A;  4LQ2 A;  4NAP A;  4NE4 A;  3KSJ A;  1JQF A;  3PPP A;  4OET A;  1L5T A;  2I4B A;  2ABH A;  2I58 A;  4U1O A;  4DZ1 A;  4AQ4 A;  5A5L A;  1FPB A;  3I5O A;  2XXI A;  3H6W A;  3ILT B;  3OMB A;  3K6U A;  5DT6 A;  5ET5 A;  1D4N A;  4K3F A;  3EN3 A;  2DE2 A;  3TZA A;  1NMU A;  1MXV A;  3TMG A;  1FQB A;  5FTH A;  1IME A;  1P99 A;  2XXQ A;  4YMA A;  5JEI A;  3A3U A;  2HXW A;  2GRV A;  3V8X B;  1B7H A;  5CC2 A;  3KFM A;  1EYI A;  4NED A;  1RDY A;  4N07 A;  3KEI A;  4M1V A;  5EQ9 A;  5K2Y A;  5I59 B;  4KCC A;  1SBP A;  1LAH E;  3JZJ A;  3U72 A;  3LSW A;  4GD5 A;  3MST A;  4FBP A;  4NF6 B;  2I6E A;  2G29 A;  3IOU A;  1IMF A;  2OCU A;  3EF7 A;  3MBP A;  4ESW A;  3UK4 A;  1MY2 A;  3IJO B;  4OEV A;  1NNT A;  4GL8 A;  4IO4 A;  1XT8 A;  2ZZV A;  1LB9 A;  4I62 A;  3E3K A;  5IKB A;  3EQ1 A;  1FCK A;  1IIT A;  2BJI A;  1JW4 A;  1Q35 A;  4JSO A;  1GR2 A;  2XD3 A;  4I3E A;  4BDO A;  3N6T A;  3EKI A;  1B1X A;  2XWI A;  4F3G A;  1LLS A;  2D5W A;  1FPL A;  4EUO A;  4AS4 A;  1OLC A;  5H8F A;  2M8C A;  1OMP A;  2GHB A;  3LUY A;  3IFA A;  2VD2 A;  1PB7 A;  4NN3 A;  3MVX A;  3O2A A;  2QL3 A;  5I56 B;  3HN0 A;  3FVN A;  4KYD A;  1XOC A;  3RNN A;  3OD7 A;  3CHG A;  2PYY A;  1XI6 A;  3T9V A;  1BKA A;  3T0J A;  1B46 A;  4N15 A;  4DCX A;  1IZ1 A;  1QUJ A;  1FPI A;  2DVC A;  4QSE A;  4PFR A;  3KZG A;  2CZI A;  2R6G E;  1JW1 A;  1QVS A;  2A5S A;  4C1T A;  2UXA A;  3V89 B;  2X7P A;  4PF8 A;  5CRY A;  1UIV A;  4H5F A;  3H7M A;  2F6P A;  5ISU A;  1FPE A;  1GV8 A;  3CFX A;  3IOV A;  3SET A;  2HQ0 A;  5L8D A;  1OQH A;  5IZZ A;  3QAX A;  1CE2 A;  4P0I A;  4EQ7 A;  3C32 A;  4WXJ A;  3O28 A;  3FXU A;  1P1O A;  4KPT A;  1NV6 A;  2QVR A;  3KG2 A;  3IL1 B;  3C4M A;  3PTY A;  3S2V A;  4NHB A;  3SEU A;  2DE4 A;  3B8B A;  1Y3P A;  4X48 A;  5ET8 A;  2GFE A;  3E13 X;  3RGY A;  2ZXT A;  4OMB A;  3O6I A;  1URS A;  1LFH A;  2Y84 A;  4OEN A;  2FNC A;  3D4G A;  1MQI A;  4NF4 B;  1ZIU A;  5JK4 A;  1B0H A;  4F3S A;  2PFZ A;  1Y9U A;  1FQF A;  4X04 A;  4PCD A;  2RIN A;  2Q8M A;  1LAF E;  4UA8 A;  4ONY A;  1H3D A;  4N8Y A;  4OTE A;  2ZYK A;  3C33 A;  4PGP A;  4R2B A;  4IY5 A;  4F3B A;  4ZEK A;  4F39 A;  3RPW A;  4X1D A;  4XXU A;  2F34 A;  4BDM A;  1NV3 A;  1B3H A;  3R7X A;  4DXU A;  3RTF B;  3ODB A;  2Z22 A;  2OLB A;  3VVF A;  3FBP A;  2UVG A;  3IB0 A;  3MZ9 A;  3VV5 A;  1I6B A;  3MW0 A;  4N81 A;  1NNP A;  2XXV A;  4PDH A;  3ZS6 A;  3OO6 A;  2DOJ A;  2F3B A;  1JVX A;  2O6A A;  3OO9 A;  1CB6 A;  4F1V A;  4FEC A;  3GXA A;  5I59 A;  1JEV A;  5I2K B;  3A3C A;  3SEY A;  4GBW A;  1IXI A;  5BWJ A;  3KN7 A;  3G3H A;  1QUI A;  3CG3 A;  2B4M A;  3MVW A;  4NF6 A;  4JXI A;  3H6T A;  4H46 A;  1URG A;  4GXA A;  4F2O A;  1A99 A;  2FHY A;  5H8N B;  4N17 A;  3U94 A;  4OA4 A;  3IOT A;  4GOT A;  4EXL A;  4E0W A;  1US4 A;  4GWW A;  5EQ7 A;  2XXK A;  4QFN A;  3RT8 A;  2R8T A;  1LFI A;  5FBP A;  1EZO A;  3MVZ A;  5B7D A;  3K4U A;  2WBB A;  1M5C A;  2Z8F A;  1D3K A;  4KXP A;  1ANF A;  1HSE A;  4M4G A;  2V25 A;  2QFL A;  1B3G A;  1NUW A;  1VE4 A;  4PFW A;  4G8N A;  2QSX A;  1YZ0 A;  4EQB A;  5I56 A;  3N26 A;  4FIM A;  3TCG A;  1ZLQ A;  4MHF A;  4YKJ A;  4JDF A;  1NFT A;  1FBD A;  5I2N A;  2PFY A;  5I58 A;  1IMA A;  1KZ8 A;  5ICT A;  1NV7 A;  5CMC A;  2CZH A;  3B6T A;  2B65 A;  3U93 A;  1OVT A;  2P2A A;  4HTG A;  1N3W A;  1LBW A;  4HS7 A;  4R9G A;  3TAJ A;  4X8R A;  1XVX A;  3ONM A;  3B6Q A;  4YKP A;  2I3V A;  4YKK A;  1MDP 1;  3W9W A;  4JVC A;  4PBH A;  4XKP A;  1ZKB A;  1SYI A;  2OWS A;  3RPL B;  3TQW A;  3UA8 A;  2O7U A;  3V5A A;  4LVQ A;  4PQJ A;  4GWS A;  1TXF A;  1A7L A;  4RYA A;  2X26 A;  3G3G A;  2CZK A;  4RY1 A;  4MNI A;  1FRP A;  2ZMB A;  5J1D A;  2FVZ A;  2HFB A;  2OPE A;  4LZ5 A;  3G7W A;  3K02 A;  4XKQ A;  1PB8 A;  5HPQ A;  3LSF B;  3MZ1 A;  3A09 A;  2V93 A;  4QXD A;  4OVP A;  4NF4 A;  3PUY E;  2F6G A;  2DP8 A;  2REG A;  2F7C A;  1QGX A;  5L9S A;  3EHT A;  4YU0 A;  3CR9 A;  5M2V A;  2BJJ X;  2Y7K A;  5F24 A;  2HAU A;  2A5T B;  3U1O A;  4I9D A;  1FPK A;  1EYK A;  4WEP A;  1NUY A;  4N6K A;  3TDJ A;  1FTO A;  3Q27 A;  3IJX B;  1R1N A;  5H8F B;  1RYX A;  3RYD A;  4O8M A;  5ELV A;  2ONS A;  1MXY A;  4IO2 A;  3A29 A;  4OFO A;  1XS5 A;  2Z23 A;  1QUL A;  2ONK E;  4G8M A;  2R9J A;  3IOW A;  1JW5 A;  1AH5 A;  4N6D A;  4R6K A;  4NWC A;  3L6G A;  3PD8 A;  1AOV A;  3M3L A;  4ZEB A;  1EZ9 A;  2HPG A;  1BIY A;  4DI3 D;  5I2K A;  2Z8D A;  2UYE A;  4MH5 A;  3VLV A;  2F7A A;  5IZ3 B;  3FUZ A;  1D9Q A;  3H4Z A;  3DM0 A;  4MMP A;  4AB5 A;  1YAE A;  2DXY A;  2YLN A;  1H44 A;  1SDX A;  1PC3 A;  4OVJ A;  5H8N A;  4KI0 E;  4O94 A;  4H8J A;  3LC8 A;  1MM6 A;  4F22 A;  1Y20 A;  4ZDM A;  1LST A;  3G3I A;  3IO4 A;  2FA7 A;  4OVQ A;  4PDD A;  1B40 A;  4P47 A;  2HZK A;  4JSD A;  2PMS A;  3WAF A;  2WX9 A;  4Q30 B;  4TLL B;  4H45 A;  2Q9T A;  3QK6 A;  5H8S A;  3TTR A;  3C35 A;  4XKN A;  4YB7 A;  1IXG A;  4BDR A;  4C1U A;  1B32 A;  3C31 A;  3K1P A;  1SD3 A;  4MAG A;  2O69 A;  4R6Y A;  1Y4C A;  5HBC A;  3QSL A;  3K2D A;  1MXU A;  3VVE A;  4OHN A;  3H06 B;  5ICQ A;  4MNC A;  4QFL A;  1PBQ A;  4XFE A;  4IO7 A;  5LTC A;  1YXI A;  3T96 B;  2B3F A;  1Y3Q A;  1YYZ A;  3T9U A;  1B51 A;  4GF8 A;  1FQD A;  2X7Q A;  4R73 A;  4DLD A;  1UTH B;  4O7M A;  4YAH X;  2O68 A;  1FPJ A;  2VD3 A;  1BTJ A;  3PPQ A;  2MKZ A;  4POX A;  4GWO A;  2NOO A;  3FZV A;  3RPL A;  1K9Y A;  3HHG A;  2XWO A;  1LBB A;  1MQG A;  4IO6 A;  4G68 B;  1YCJ A;  3FVG A;  4O3C A;  2FIX A;  2Q8J A;  1B9J A;  3BIH A;  3KOT A;  3PMV A;  4GVO A;  1FSA A;  3QUJ A;  5B70 A;  4FE8 A;  3PMW A;  4GQO A;  5DEX B;  2NXO A;  1LBX A;  5KCJ B;  1A40 A;  3QXM A;  2PX1 A;  4RNS A;  4PFU A;  3G3K A;  4LQ5 A;  3FJM A;  2I0C A;  1IXH A;  2XXW A;  1MY0 A;  5EHS A;  1DK4 A;  3UN6 A;  1MDQ A;  1INP A;  1P1Q A;  2A5T A;  2DWJ A;  2RCA A;  5ET6 A;  3NOH A;  4OEU A;  4GWU A;  3TUS A;  3IAZ A;  2ONR A;  3TKD A;  3TYH A;  2XD2 A;  3H03 A;  2QVV A;  4Z0I A;  3LV0 A;  2PT2 A;  3CRB A;  4ND9 A;  2GH9 A;  2H25 A;  4MLV A;  1IMC A;  5I2N B;  4L17 A;  2V4C A;  1MXX A;  1RDX A;  5I58 B;  4HCY A;  2P3V A;  2Q88 A;  4QSD A;  2WKY A;  2Y5L A;  3FVK A;  1A54 A;  1FPD A;  3HFU A;  1FTK A;  4AB6 A;  1B58 A;  2Y7P A;  3K6W A;  3IB1 A;  4EQ9 A;  1LEV A;  1IXC A;  3E9X A;  5I57 B;  1UTB B;  2GHA A;  1IQ7 A;  1POT A;  1DOT A;  2HXR A;  1BP5 A;  1MY4 A;  5IZ3 A;  2NUV A;  5KDT A;  4R74 A;  1USY H;  3E4R A;  5FHN A;  5EHM A;  2W7Y A;  4IY6 A;  3HPI A;  2Q89 A;  3I6V A;  3SZP A;  1MPB A;  3O29 A;  3N6U A;  1NL5 A;  3S4U A;  2PT1 A;  3GBB A;  1USY E;  1LCT A;  2I49 A;  2ZZX A;  1II5 A;  2KLF A;  3TQL A;  3HHF A;  4P8B A;  3LUZ A;  2AYS A;  5CI5 A;  1AWB A;  4Q0C A;  3TCH A;  1SW4 A;  1ZTY A;  4YB6 A;  4YIC A;  4ZZE A;  4NF5 A;  1B5I A;  3S9E A;  2QRY A;  3TCF A;  1S50 A;  3OO8 A;  3PGF A;  4ZED A;  2O84 X;  1JP4 A;  1YTV A;  1SYH A;  1SI1 A;  3PPO A;  3KJ7 A;  4QHQ A;  5TP9 B;  1GTK A;  1MXZ A;  4LON B;  5DW8 A;  1ATG A;  4KYE A;  4DXB A;  2OPD A;  3OSR A;  4PAK A;  5AA2 D;  1Z7N E;  1LBC A;  2OBG A;  4ZEI A;  2O1L A;  1MXW A;  3FJG A;  4EF1 A;  3V83 A;  4LZ8 A;  4GIZ A;  1MG1 A;  1B1H A;  1UTH A;  5F7V A;  2AL5 A;  3MP8 A;  2REJ A;  3I3V A;  2ZYO A; 
#chains in the Genus database with same CATH homology
 3D1R A;  2XWK A;  4GWS A;  3KC0 A;  2QVU A;  2CZK A;  4MNI A;  1FRP A;  5J1D A;  2FVZ A;  2WYP A;  2XWV A;  4GX6 A;  1FJ6 A;  4F1U A;  2B4L A;  2KR0 A;  2F5X A;  4QXD A;  4OVP A;  4OVT A;  2WBD A;  5I7I A;  1QGX A;  1VDW A;  4QBA A;  4NAP A;  4MCO A;  5IZ1 A;  4PET A;  3W9V A;  5F24 A;  5ET7 A;  1FPK A;  1EYK A;  5A5L A;  1FPB A;  1NUY A;  4N6K A;  5ET5 A;  4XF5 A;  2DE2 A;  4IR8 A;  2PCR A;  3RYD A;  4O8M A;  1IME A;  1SPI A;  5IGA A;  4HE0 A;  1LBZ A;  1NV0 A;  3A29 A;  1EYI A;  4P9K A;  4GWZ A;  1RDY A;  1CNQ A;  4XEQ A;  4M1V A;  5EQ9 A;  4N6D A;  4N91 A;  4F18 A;  3FXB A;  2HPG A;  1FTA A;  1FBE A;  4P1L A;  4DI3 D;  2DDK A;  3MST A;  4FBP A;  4NG7 A;  1IMF A;  1KA0 A;  5IZ3 B;  1D9Q A;  1IMD A;  2QPQ A;  3E79 A;  4MMP A;  1FJ9 A;  1FBF A;  4PE3 A;  2ZZV A;  4UAB A;  4O94 A;  1G0H A;  2BJI A;  2OX3 A;  1NI9 A;  4OVQ A;  2FIE A;  4PDD A;  4P56 A;  4I3E A;  5CM6 A;  1NV4 A;  4P47 A;  3EKI A;  4P3L A;  2XWI A;  4GX4 A;  1FPL A;  4AS4 A;  2HZK A;  2WX9 A;  4H45 A;  2Q9T A;  3IFA A;  4NF0 A;  4NN3 A;  3KC1 A;  4PAF A;  4PF6 A;  2VPN A;  3T1B A;  3CHG A;  5IM2 A;  3U65 A;  4MAG A;  1XI6 A;  3IFC A;  3T0J A;  1K9Z A;  4N15 A;  4NQ8 A;  2ZZW A;  2DVZ A;  1FPI A;  4MNC A;  4PFR A;  4XFE A;  4GWX A;  4I3Y A;  2CZI A;  5LTC A;  1YXI A;  1YYZ A;  4PFB A;  4PF8 A;  3BIG A;  4HCW A;  3ISP A;  1FPE A;  5ESY A;  3B50 A;  4LN5 A;  4O7M A;  1FPJ A;  4MX6 A;  2JJK A;  2WEF A;  1FBC A;  1KA1 A;  5IZZ A;  2MKZ A;  4NGU A;  4I40 A;  3RPL A;  1K9Y A;  1FBH A;  2XWO A;  2KQZ A;  1NV6 A;  2QVR A;  4PBQ A;  1NUX A;  2FIX A;  3PTY A;  4NHB A;  2DE4 A;  3B8B A;  1NUZ A;  2XA5 A;  5ET8 A;  3BIH A;  3E78 A;  4JVI A;  1FSA A;  1NV5 A;  1FBG A;  5I3S A;  1LBX A;  4DI4 B;  4GX3 A;  1LBV A;  4PAI A;  3MYU A;  5JK4 A;  1FBP A;  2PFZ A;  3QMF A;  4X04 A;  4PCD A;  1G0I A;  2Q8M A;  2WYK A;  2HZL A;  5EQ8 A;  1NV2 A;  4N8Y A;  1DK4 A;  4JVD A;  1INP A;  4PGP A;  5ET6 A;  3NOH A;  4OAN A;  4GWU A;  2V3Q A;  1BK4 A;  2OWZ A;  1DBZ A;  1NV3 A;  2QVV A;  3LV0 A;  5LDZ A;  3FBP A;  4PGN A;  1IMC A;  4MIJ A;  4YZZ A;  4N81 A;  4HE1 A;  4NX1 A;  2V4C A;  4PDH A;  1RDX A;  2P3V A;  4HCY A;  2F3B A;  1IMB A;  1EYJ A;  5J16 A;  4F1V A;  2Y5L A;  2VPO A;  1FPD A;  3HFU A;  4HE2 A;  4GBW A;  1LEV A;  2HHM A;  5T3J A;  4G61 A;  2B4M A;  2CEY A;  1NV1 A;  4OVR A;  4H46 A;  2HXR A;  5IZ3 A;  2FHY A;  4N4U A;  2L5V A;  4N17 A;  4OA4 A;  3KBZ A;  3ROJ A;  4GWY A;  3SZP A;  4GWW A;  5EQ7 A;  2ZZX A;  2XXK A;  2R8T A;  1DCU A;  5FBP A;  2WBB A;  2CEX A;  5EYG A;  4KXP A;  4P8B A;  3LUZ A;  4PTK A;  4MNP A;  4PC9 A;  1AWB A;  2QFL A;  1NUW A;  4YIC A;  1YZ0 A;  2Y5K A;  1FPF A;  4MEV A;  4F19 A;  4MJO A;  4MHF A;  1FBD A;  2P3N A;  1LBY A;  2PFY A;  1JP4 A;  4P1E A;  1IMA A;  1KZ8 A;  4AS5 A;  1NV7 A;  5I5P A;  2CZH A;  4PFI A;  4GBV A;  2Q74 A;  3GYY A;  2GQ1 A;  2F3D A;  5DW8 A;  2VT5 A;  5EQA A;  1RDZ A;  4N8G A;  1Q9D A;  1LBW A;  4OVS A;  2FBP A;  4HXV A;  4PAK A;  4X8R A;  4O7I A;  3W9W A;  4JVC A;  4PBH A;  2DE3 A;  1FPG A;  3RPL B;  4X9T A;  5EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...