3LV0A

Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
258
Chain Sequence
SAVMNVMVQAAMKAGRSLVRDYGEVQNLQVSLKGPADYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPHLPGHGTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of extragenic suppressor protein suhB from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Hydrolase
molecule keywords Extragenic suppressor protein suhB
total genus 84
structure length 258
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3lv0A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3lv0A02
3IFCA 3A29A 1KA1A 4G61A 2WEFA 2JJKA 4KXPA 1DK4A 4PTKA 3BIHA 4GWUA 2R8TA 2OWZA 4I3EA 4GWXA 1NV3A 3B8BA 4HE1A 2WBDA 1JP4A 1NV2A 4GWZA 1IMEA 1IMDA 4GX3A 1FBPA 2FVZA 3RPLA 2BJIA 4FBPA 3T0JA 1FBGA 1YXIA 5ET7A 5J16A 1LBZA 1NV4A 2F3BA 5IZ1A 1FBFA 2FBPA 2Y5LA 5A5LA 1FPBA 1FSAA 5ESYA 2P3VA 1LBVA 2FHYA 4I3YA 4I40A 5DW8A 3RPLB 1IMCA 1G0HA 4GBWA 1KZ8A 1LBYA 2CZKA 4GBVA 5T3JA 1BK4A 4HXVA 2FIEA 2CZIA 1FBEA 1NV7A 1FPDA 1Q9DA 5EQ9A 2Q8MA 2Q74A 1VDWA 5F24A 1FRPA 1KA0A 4O7IA 1FPLA 5IZ3A 3RYDA 2Y5KA 4GWWA 1LEVA 1FBCA 1FPKA 2P3NA 1EYIA 2PCRA 2QFLA 1G0IA 3LV0A 4IR8A 1IMBA 1EYJA 4HE2A 3D1RA 2FIXA 1NUYA 1AWBA 1EYKA 2HHMA 4GX4A 2QVRA 2F3DA 3ROJA 1RDXA 1XI6A 1LBXA 5EQ7A 5ET8A 1YYZA 3QMFA 1YZ0A 2QVVA 3KBZA 1DCUA 1NI9A 2CZHA 4GWSA 1FJ6A 1NV0A 4GWYA 3IFAA 1DBZA 1FBHA 4QXDA 1INPA 1NUWA 5EYHA 1NUZA 2QVUA 5FBPA 1FPEA 1NV1A 3LUZA 1K9YA 1LBWA 5ET6A 3KC1A 1FBDA 3FBPA 2GQ1A 5I3SA 1NV5A 4GX6A 5ET5A 1K9ZA 1IMAA 2VT5A 1FPIA 3BIGA 1RDZA 1CNQA 1SPIA 4HE0A 1FTAA 2OX3A 1NV6A 5EQ8A 4AS5A 1FJ9A 1FPJA 5IZ3B 1NUXA 2DDKA 4N81A 4AS4A 1IMFA 1QGXA 1RDYA 5EYGA 5EQAA 4MJOA 5LDZA 4H46A 1FPFA 1D9QA 3KC0A 1FPGA 4H45A 2WBBA
chains in the Genus database with same CATH superfamily
1KA1A 1B3FA 4U1OA 3FVOA 3SEWA 4R74A 4IY6A 3O6HA 5F1QA 1Q35A 2RF1A 3B6QA 3GBBA 3A09A 4QFNA 2ZNUA 4PGNA 3B7DA 4Q30B 4QSEA 3MP6A 4N4UA 1DPEA 2BJIA 3T0JA 1NNTA 2NVUB 4MMPA 3M3KA 4O8MA 4NF8B 2I4CA 1G0HA 1URGA 2Z22A 1BK4A 3S9MC 4O3CA 1DSNA 3OD7A 4AB5A 1NV7A 3LUYA 4KYEA 5AA2B 5IZ3A 2OWTA 1MQJA 4PFWA 2XWOA 4HCYA 1EYKA 1B1XA 3KN3A 1RDXA 2ZZXA 4PF6A 1LFIA 3OXNA 3RQTA 1OQGA 1LGBC 1NFTA 1NNPA 4OVTA 5EHMA 1DBZA 4PAKA 2QSXA 2F6PA 1L5TA 5ET6A 1R6ZA 2XXXA 3CFLA 3RUMA 3FASA 1I6AA 1OVBA 3HCQA 4N13A 2NXOA 2OCUA 3FIRA 4P56A 2DXRA 3U65A 1N0TA 4NMYA 4X8RA 4C1UA 4LP2B 2DSFA 2XD3A 4XF5A 3DM0A 2WEFA 4RJZA 5IGAA 4GWXA 1RKMA 2P2AA 2ZZVA 4BLAA 1FTMA 1TFAA 4GWOA 4BDRA 4U1ZA 4IO2A 5ET7A 4OZ9A 2Y5LA 3C34A 1QKBA 2I0BA 3RPLB 5HM4B 4GBWA 1URDA 5ITOA 2Q74A 3PPNA 1KA0A 3T1BA 4P9KA 2Y5KA 4ZS9A 4IGRA 1IXHA 3TYHA 2PCRA 4OHNA 2XXKA 2QS3A 3CG3A 4XKNA 4ZZAA 3EKIA 5BUUA 3WAFA 3OEMA 3D4GA 3FGSA 3IFAA 1BP5A 2VPNA 1MXUA 4HW8A 5L8DA 1ZU0A 4ZEKA 3IB0A 3QIMA 1MPBA 4I1DA 1WVJA 1QUIA 4YKPA 3O66A 1FBDA 3E79A 3FUZA 3MSTA 1IMAA 3VXCA 2QJEA 1CNQA 2Y7WA 3Q28A 3FXRA 3JV9A 4N81A 2ONRA 3A3CA 3BFTA 1B1HA 4O94A 3FVGA 1IIWA 2WBBA 2DWAA 3LSWA 3MAMA 3R26A 5I5PA 1MXXA 4RA1A 3CIJA 1DPPA 1FCKA 5FHOA 4H1XA 5K2YA 4HE1A 5CMMA 4KD5A 3D4CA 1HSEA 1FBPA 3ZKLA 3RPLA 4F29A 5DVFA 3U72A 2F3BA 3FXBA 3MVXA 1FSAA 2P3VA 3K6XA 1B58A 3VE1B 4C0RA 3ISPA 1MPCA 1O63A 3RY3A 3FATA 2HCAA 4QFLA 3TQLA 4O3BA 4OWDA 3C35A 4ISUA 3T9UA 2BJJX 3OSRA 4KI0E 4DLDA 3CG1A 4C1TA 4JXIA 3DELB 4HCWA 3TTLA 1QKAA 1SI0A 1PEBA 4NF4B 1XI6A 1MY0A 3RPWA 3CHGA 3UIFA 3H06B 1SI1A 2O7UA 3SEYA 3T9VA 3PMXA 1TXFA 4PETA 4R72A 4P8BA 2Q9TA 3HO7A 3UGWA 2XXIA 5I3SA 3G3JA 3TDJA 4OA4A 1ZIUA 1R1NA 5TPAA 2UYFA 3MYUA 1RDYA 4U4SA 4QRZA 3VLWA 4JVCA 4ZEIA 1QJMA 1Y3NA 2HXRA 1JQFA 4HTGA 5CMBA 3T66A 3IOUA 4ELPA 2RC7A 3UORA 4EQ9A 3SKPA 1SVXB 3QYTA 2WYKA 1A7LA 1NH8A 3N94A 3H6UA 2CEXA 4OEUA 5H8NA 2F5XA 1Z7ME 5FHMA 4NF6B 1LCTA 5ESYA 4FECA 2F7AA 5I2KA 2QS2A 2O6AA 3KFMA 4FATA 4ELQA 3OSQA 4P3LA 2PFZA 4MLVA 3U92A 3TQWA 4NF4A 1LCFA 2DWHA 3K0VA 3U1OA 3U8QA 4H65A 3H6VA 1MDQA 4HE2A 3PMVA 2QVRA 1FTKA 4H6DA 1LBXA 4F39A 5EQ7A 4G8HA 2VOZA 1S9TA 1B32A 3HHFA 4RYAA 4THIA 1USYH 3RGYA 1IZ1A 1H44A 5H8FB 3KOTA 4OXVA 4RPOA 1K9ZA 3PUZE 3BIGA 4P1EA 3VLVA 1USYE 1OQHA 2Q2CA 2E0SA 3R6UA 3V8XB 5LDZA 4NWCA 1US4A 4N6KA 2H99A 1FW0A 3RN8A 1TWYA 4F1VA 1SW2A 2XXPA 1LBCA 2XXHA 1DK4A 4DIGA 2B3FA 4X9TA 1QUKA 2YJPA 2PBWA 3MC2A 1BIYA 1B51A 4F22A 5KCJB 3UP9A 3VDFA 2YPNA 4PFUA 2B65A 4ONYA 2XXUA 2DXYA 2GHBA 3USDA 5I2KB 4R6YA 5IZ1A 4XIGQ 3PGFA 2V4CA 4HXVA 3IR1A 2FIEA 2RKMA 4TLLB 4GD5A 3HFUA 3KJ7A 4PC9A 1VDWA 2A5SA 1YAEA 3H4ZA 2RCBA 1LEVA 1Q1KA 2I0CA 2ZNTA 3K1NA 4GXSB 3KZGA 3BBRA 1A55A 4QFKA 2VGQA 3ECRA 3T96B 3CSGA 4POXA 2I3VA 1MQIA 4WEDA 4EDPA 2OPEA 2W7YA 4N17A 5H8NB 2HAUA 1QULA 1R9LA 1O64A 4NF6A 5DVIA 2XHDA 1H3DA 1FPIA 4OERA 2UYEA 2F8DA 3CVGA 3M3LA 2OX3A 3OO7A 2Y7PA 5CMKA 1CB6A 1FPFA 4H8JA 2PT1A 1SW1A 4LONB 2I4BA 3UN6A 3IFCA 4ZE8A 4F3GA 4F3PA 3TKDA 4MIJA 2F97A 3EHSA 4PFTA 2P0SA 4GWUA 2ONSA 3IOWA 4O3AA 4F31B 5H8HA 4JB7A 4PQJA 1B46A 3N6UA 4YICA 1FTJA 4FBPA 1YXIA 1A8EA 2FBPA 4G68A 1LBVA 3MVYA 4FE8A 3W15C 2XXTA 2HZKA 2I3WA 1Q9DA 3E4RA 4P47A 2F78A 4P0IA 3C9HA 5ELVA 5I2NA 4PDHA 3T9XB 2H9BA 2Q2AA 3FJ7A 1O7TA 1HSLA 1LAFE 1VSOA 1AOVA 1GGGA 5L9OA 1MY2A 1PC3A 4LQ2A 4R73A 4GLIA 1ZTYA 4PFRA 4MNCA 5ET8A 4N8YA 3CSBA 1DCUA 1NI9A 1B05A 4G68C 4FORA 3IO6A 4OYVA 2V84A 1LB9A 4QHQA 1LBWA 1TT1A 2FNCA 2R6GE 3QAXA 4ELOA 3P7IA 3SEUA 5H8FA 1YPNA 3MUQA 1SPIA 2ALUA 1PB8A 4AS5A 4R6HA 4NX1A 2V3QA 2WX9A 2DDKA 4IB2A 3E9XA 4DDDA 4MJOA 2H4IA 5DVJA 3K01A 3KSXA 4YB7A 3K02A 3PUVE 3C32A 3FD3A 2H98A 1QUJA 1XOCA 3IO4A 3MZBA 1DTGA 3GLBA 4G61A 4DCYA 5BWJA 4ESXA 2XXQA 3IAZA 4QSCA 4LN5A 4PTKA 3G7WA 5CBSA 1B9JA 1AMFA 2FA7A 4GRKA 2WBDA 5CBRA 4YZZA 5DT6A 4G2ZA 1N7WA 3U93A 1MG1A 4PDDA 3M3FA 4PBHA 4N6DA 1P99A 1EH3A 1S50A 2XWIA 4GQOA 2D3IA 3MP8A 2CZIA 1NKXA 4GF8A 3OEKA 5HBCA 3CR9A 1N3WA 4POWA 3Q25A 2QPQA 3DP4A 2D21A 5DYHA 3TTKA 2F3DA 1D4NA 1N7XA 4OENA 2PT2A 1P1QA 4XEQA 5J1DA 1PB9A 3CRBA 5H8HB 5AA4A 4XKRA 1I6BA 1T0KA 5EYHA 4YMAA 1P1OA 3TAJA 1NV1A 4GOTA 2QS1A 1VFEA 2R9JA 2HZLA 3PPRA 5KZTA 1B0HA 4O7MA 2MKZA 3FBPA 3L6HA 4PP0A 4GX6A 5ET5A 3K4UA 2Q88A 4OVSA 4HE0A 1FTAA 5CC2A 3VVDA 5EQ8A 4MLQA 3S9LC 1IEJA 1JW1A 3UK4A 1QGXA 4X1DA 3VVEA 4IO6A 4RK9A 1MS7A 3Q29A 1OLAA 1QW0A 3FXUA 4OMBA 4KXPA 3O6GA 1A54A 2RINA 3I3VA 3CI8A 4OEVA 3EHUA 4NWDA 4I3EA 1MY3A 4DXBA 5JTYA 1IXCA 2XXWA 2DE4A 2UVGA 4F3SA 2B3BA 4XTCQ 4X48A 5DTBA 4YB6A 1NMUA 1DMBA 2XXRA 1MRPA 4MEVA 2RCAA 1LBZA 4H8IA 4UACA 1JEVA 1XC1A 4NEDA 3S2VA 5FTHA 5I57A 4ZEDA 5L9MA 2IA4A 5JK4A 2O1LA 3O9PA 3FJGA 3RT8A 3SETA 1FRPA 2OZZA 3V5AA 4NF0A 5TPAB 4MCOA 4H0WA 4GWWA 1B5JA 5A5XB 4F18A 5I2NB 4DXUA 4PFYA 2Y7KA 5AA4B 5L9SA 4U21A 4R2BA 4KFQA 4YAHX 1NV0A 2O1MA 2VHAA 1INPA 1POTA 1QVSA 2UVIA 1B3LA 1MY1A 2KR0A 1P1UA 1RYXA 3PUWE 3Q26A 1LAXA 2XX9A 2O7IA 3VFJA 2PX1A 1Z7NE 4OTEA 3VV5A 2QMWA 4EXLA 3KN7A 2UVJA 5I56A 1FPJA 1NNKA 3THIA 2ESNA 4LQ5A 2HAVA 1FQFA 2CMOA 1MQHA 4WEPA 3KSJA 3MPKA 3KC0A 2I6EA 3PUXE 4GFRA 4DI3D 3B6WA 3IJXB 5JTYB 1ELJA 3ZSFA 3GZGA 4EXKA 4Q0CA 4M4GA 1SDXA 3B8BA 1EZPA 4H5FA 2HQ0A 1EZOA 2ZYMA 4GWZA 1IMDA 3MW0A 1IUDA 4ESWA 1WODA 3ZKKA 1N76A 2VP1A 1NV4A 4JBZA 1IXGA 3MWBA 2NWJA 2VD2A 3FXQA 4LVQA 5AA3A 4I40A 2XA5A 1LLSA 4L17A 1IITA 2B4LA 4GL0A 1FBEA 2QL3A 4ZDMA 1MM7A 4RNSA 3SERA 4G4PA 1P1NA 4FEBA 4QF9A 4PF8A 4QSDA 4XXUA 3KGCA 1HSJA 4PCDA 1EYIA 3GYYA 3DP6A 1FQEA 2HHMA 3H7MA 3S4UA 2X26A 1FQDA 4XKQA 3K1MA 5B7DA 2E1SA 4PAFA 3GBAA 4R9GA 3TTMA 1B3GA 5ICTA 3R7XA 2V93A 4MBPA 3MBPA 4NTLA 3K6UA 1US5A 2WYPA 2WKYA 3ILTB 4KHZE 4YKIA 2GQ1A 2HFBA 4UABA 4GVOA 2FYIA 1FJ9A 4NAPA 2H5YA 4JDFA 3VXBA 3IB1A 2Z8DA 3H03A 2XXVA 3BKIB 3W9WA 4F19A 3QK6A 1LAHE 5K2XA 1ZJLA 3MQ9A 4EF1A 1B7UA 2O84X 1GR2A 4P11A 2B4MA 2OWSA 4OANA 2DWJA 1TFDA 3LSLA 2AL4A 1OVTA 3IX1A 5IM2A 1FBGA 1CE2A 3HV1A 2CZKA 2CZLA 3VVFA 5IAIA 4BDQA 2XX8A 1MPDA 1UTHA 3KN8A 1OIBA 4EQBA 4MNIA 5I56B 4O7IA 3RNNA 3L6GA 4MHFA 1D9VA 2UVHA 2P3NA 4IR8A 4LATA 2I58A 2A5TA 3IORA 2M8CA 4JSOA 4YMBA 5ICQA 1XHYA 3BFUA 1YZ0A 1XS5A 4ZE9A 4R75A 1BTJA 4HS7A 4GIZA 1MXVA 1NUZA 3G3HA 3TCFA 2L5VA 3LUZA 3TEPA 2ANJA 3ONMA 1SYIA 4N07A 4FEDA 1PBPA 1JVXA 4G68B 5IZZA 3N26A 4NN3A 3KJTA 5ISUA 3PPPA 3JZJA 2HXWA 1FQBA 1M5FA 1UIUA 1YTVA 4OETA 3RTWB 4F2OA 2NOOA 4H45A 1Y4TA 3KBRA 1M5CA 3OOAA 1URSA 1MY4A 4ZEFA 3BIHA 2OWZA 3HPIA 1UIVA 4KCDA 4ECFA 1B4HA 1XVYA 1IMEA 2FVZA 3PPQA 5J16A 1H45A 4JWOA 4QBAA 5DEXB 4PFBA 3E3KA 4GBVA 1PB7A 2H25A 3G3GA 2KLFA 3HHGA 4DZ1A 2NUVA 4Z0IA 2V3UA 3MZ9A 2GHAA 3D1RA 4GX4A 4AB6A 1BLFA 3OMBA 2DS9A 3M8UA 2Y84A 2Q89A 3HN0A 5EHSA 3KBZA 4N6PA 2CZHA 3C4MA 1FJ6A 3SZPA 3LR1A 4GWYA 4PAIA 1PDAA 2O51A 1B4ZA 1Y4CA 1FPEA 2DOJA 3TZAA 1YCJA 3KG2A 1LBBA 1AIVA 1N04A 3H6WA 3LSFB 1SBPA 1NNFA 1VR5A 1JW5A 4KYDA 5I59B 3C31A 2ZMBA 2YLNA 2DE2A 4IGTA 3GXAA 1UTHB 3EF7A 1DOTA 5KDTB 1MXZA 3OO9A 3TODA 3T93B 4DCXA 4F1UA 2GH9A 5I58B 1B3EA 3SDFA 1EU8A 2F36A 5FHNA 3OELA 4KYSA 2OPDA 2QS4A 1NV3A 2A5TB 1NH7A 1JP4A 1FQAA 1FTOA 1B7HA 3UA8A 4U22A 1XVXA 3PMWA 4UA8A 4BDLA 3EPEA 3SEVA 1M5DA 3LSXA 4OESA 2THIA 1FPBA 2O69A 1KWHA 4IO7A 1IMCA 3HSTA 1KZ8A 1LBYA 4GXAA 3OO6A 5AA1A 4N91A 2X7QA 5I7IA 5EYFA 4EF2A 1B6HA 3F11A 1SD3A 1LSTA 2VPOA 5TP9B 3ZS6A 4PE5B 2ZYOA 3ODBA 4E0XA 4OVPA 3G3FA 1F9BA 2F35A 4GWSA 3E78A 5I84A 2V3TA 3MJNA 1NL5A 2I48A 3MZ1A 2QVUA 3U94A 3AXFA 4F3BA 4NF8A 3TTRA 4I9DA 1B40A 3O2AA 4P1LA 4NQ8A 5I57B 5AA2A 2ZYNA 4WKMA 5IZ3B 3IK6B 4KQPA 4R6KA 1MH3A 4FIMA 4H46A 3N6TA 1D9QA 4EQ7A 5I58A 3FV2A 4OVJA 3PUYE 3NOHA 3O28A 1WDNA 4ZEBA 5A5XA 1Y3QA 3DLNA 2R8TA 5LTCA 3H3GA 4OFJA 4YU0A 1MQDA 4RY1A 4LZ7A 4OVQA 4YKJA 1B7ZA 3IL1B 4JWYA 4KCCA 4GX3A 3IJOB 4MF3A 2DQVA 2XX7A 4I8CA 4MX6A 1B2HA 2FHYA 2REJA 4E0WA 4WXJA 5CM6A 4IY5A 3PD8A 3TELA 2AIXA 1I69A 2O68A 4K3FA 3K6WA 5DEXA 5TP9A 2HEUA 5F7VA 5I59A 1N3XA 4G8NA 2Z8FA 2X7PA 1FPLA 1A99A 2REGA 1DTZA 3RT6B 4NE4A 3V89B 3IB2A 1FPKA 2QFLA 4BDOA 5IKBA 1ZBMA 3W9VA 5AA2D 3ROJA 3TTNA 1S7YA 4GL8A 1SW5A 3QMFA 4XKPA 2ZXTA 3T9HB 1MQGA 3MP1A 5HPQA 2XWKA 4JSDA 5FBPA 5CI5A 2XXYA 3QUFA 3V83A 3WAEA 2Q8JA 4F1YA 1B52A 2DYXA 2UXAA 1EZ9A 1NUXA 4JWXA 1MH4A 5EYGA 5EQAA 4MFIA 4EUOA 4OFLA 2JJKA 3IOVA 1Y1MA 2G93A 4NHBA 2CEYA 2QRYA 3K6VA 4DXCA 3ILUB 5FTIA 2KQZA 1JEUA 2RC8A 1ZLQA 4H5GA 1AH5A 1Y20A 4IO5A 3K1PA 1Y9UA 1M5BA 1VFDA 3I5OA 3SESA 1AL3A 2AL5A 1D3KA 4MAGA 4TLMB 3MVWA 4BDMA 2PVUA 1LFGA 3SEXA 5TU0A 4I3YA 4FJPA 2DWIA 2IEEA 3B50A 2VD3A 1MDP1 3JYRA 3LBSA 3H6TA 1GVCA 1UTBA 2LAOA 4YKKA 3RYDA 2F34A 4FAJA 2GRVA 3G3IA 5H8QA 3OENA 4Q8RA 2FIXA 1GV8A 3Q27A 5M2VA 4OQOA 1YYZA 2QVVA 5AE4A 4IO3A 3PU5A 3N5LA 1FBHA 1VE4A 3O29A 1POY1 2QMXA 5CRYA 1K9YA 4LZ5A 4Q5TA 4ZZEA 1SYHA 2VT5A 1II5A 1RDZA 3QXMA 2F7CA 1ZKBA 3TCHA 5LOMA 3B6TA 3KOSA 3FVNA 1FPGA 5B70A 1N84A 3FVKA 4KR5A 1JW4A 3A29A 1IXIA 1B5IA 2OK2A 1Y3PA 2Z8EA 3G3KA 4MNPA 4QFPA 1M5EA 1RYOA 4RPNA 2DVZA 3CFZA 1FTLA 3FJMA 1B3HA 1OLCA 4F2QA 2RC9A 3CFXA 3EN3A 4PFIA 4NF5B 4YB5A 3TPAA 1MXWA 1I6QA 4G77A 4IO4A 1B0LA 1Y1ZA 1FPDA 3VLUA 3QSLA 5EQ9A 4DI4B 2Q8MA 5F24A 5H8QB 1LAGE 4X1BA 3K00A 4DE8A 3IOTA 4XFEA 1FBCA 3O97A 1JETA 2DE3A 1IMBA 2V25A 1B5HA 3PPOA 3I6VA 1NUYA 2ABHA 1FQCA 3TUSA 4U4XA 3FV1A 4TQUQ 4PE3A 4U2RA 3KEIA 1J1NA 3QUJA 2R71A 3E13X 2DP8A 4RXLA 1NUWA 3MPLA 3EHTA 4M1VA 4NGUA 3KC1A 1BKAA 1NV5A 2ONKE 3S9EA 1H76A 1H43A 2G29A 1P1WA 2Y7IA 4PGPA 1NV6A 2Y7RA 2PFYA 5JEIA 4ZECA 2ZZWA 3K2DA 3PV0E 1SQYA 1UTBB 4ELRA 4AQ4A 3O6IA 4OVRA 3MVZA 4LA9A 1UQWA 2ZNSA 4KPTA 2XWVA 4X04A 2OLBA 4OFOA 1A40A 1LFHA 1NV2A 1JNFA 1IQ7A 2F7BA 4N8GA 4BDNA 1SW4A 3FZVA 3S9NC 1ATGA 3PD9A 1FBFA 4N15A 4Z7EA 5A5LA 5H8SA 5DW8A 5ITPA 3PTYA 4RK2A 5T3JA 4LZ8A 2HPGA 3C33A 3RLFE 4JVDA 3RTFB 2AYSA 2GFEA 1GTKA 1OMPA 1PBQA 2P1SA 4ND9A 3LC8A 3EQ1A 2OBGA 5CMCA 2I49A 5KDTA 1G0IA 3LV0A 2OJTA 1EYJA 1JVYA 1AWBA 4TOZA 2PYYA 3TCGA 4QFOA 1MXYA 5KCJA 2XD2A 1ZMGA 2F6GA 2ZYKA 2PMSA 3A3UA 2Z23A 3TFLA 4JVIA 4QXDA 3C36A 1D9YA 3TMGA 1A8FA 3OO8A 4MH5A 4R9FA 2D5WA 4NF5A 1LB8A 4LUBA 1R9QA 1XT8A 4NG7A 3T22A 1ANFA 4U23A 4AS4A 4G8MA 4P0GA 1IMFA 1MM6A 3DP8A 4PBQA 4I62A 4R2FA 2DVCA 4H67A
chains in the Genus database with same CATH topology
3W9WA 4F1VA 3IFCA 3A29A 4F19A 1KA1A 4G61A 2WEFA 3NOHA 4MIJA 2JJKA 4KXPA 4F1UA 4NHBA 5I5PA 2CEYA 1DK4A 4LN5A 4MNPA 4PTKA 2WYKA 3BIHA 5IGAA 2XWVA 4GWUA 2R8TA 2OWZA 4I3EA 4GWXA 4X04A 1NV3A 5LTCA 3B8BA 2ZZVA 4X9TA 2CEXA 4HE1A 2KQZA 2DVZA 2WBDA 2B4MA 1JP4A 4OANA 1NV2A 2DE4A 4OVQA 4PGNA 4YZZA 4GWZA 4YICA 1IMEA 2F5XA 1IMDA 4GX3A 1FBPA 4N4UA 4N8GA 2FVZA 3RPLA 2BJIA 4MEVA 4FBPA 3T0JA 5IM2A 1FBGA 1YXIA 5ET7A 5J16A 1LBZA 1NV4A 2F3BA 4MAGA 4PBHA 5IZ1A 3FXBA 1FBFA 4MMPA 4MX6A 4N15A 2FBPA 4N6DA 2Y5LA 4O8MA 5A5LA 1FPBA 1FSAA 4PFIA 4QBAA 5ESYA 2P3VA 1LBVA 2FHYA 4I3YA 4I40A 5DW8A 3RPLB 1IMCA 2XA5A 3B50A 1G0HA 4GBWA 3PTYA 4PFBA 1KZ8A 1LBYA 2V4CA 2CZKA 4GBVA 5T3JA 2XWIA 3ISPA 1BK4A 4HXVA 2FIEA 2B4LA 5CM6A 5JK4A 2HZKA 2CZIA 1FBEA 1NV7A 1FPDA 2HPGA 4N91A 1Q9DA 3HFUA 4P3LA 5EQ9A 4DI4B 2Q8MA 2Q74A 4JVDA 4P47A 1VDWA 4PC9A 5I7IA 5F24A 1FRPA 4MNIA 1KA0A 3T1BA 4O7IA 1FPLA 2PFZA 4NF0A 4MCOA 5IZ3A 4MHFA 4PDHA 4P9KA 3RYDA 2VPOA 4PF8A 2QPQA 4XFEA 2Y5KA 4GWWA 1LEVA 1FBCA 4PCDA 1FPKA 2P3NA 1EYIA 2PCRA 2QFLA 2XWOA 3GYYA 1G0IA 3LV0A 4HCYA 4IR8A 2DE3A 1IMBA 2XXKA 4F18A 1EYJA 4HE2A 4HCWA 3D1RA 2FIXA 1NUYA 1AWBA 1EYKA 2HHMA 4GX4A 2QVRA 3W9VA 2F3DA 3ROJA 1RDXA 1XI6A 2ZZXA 3EKIA 1LBXA 4OVPA 4MNCA 5EQ7A 4PFRA 5ET8A 1YYZA 4PF6A 3QMFA 1YZ0A 2QVVA 3KBZA 4N8YA 4PAFA 4PE3A 3CHGA 1DCUA 1NI9A 2CZHA 4GWSA 4XEQA 3E78A 5J1DA 1FJ6A 3SZPA 1NV0A 4GWYA 4OVTA 3IFAA 1DBZA 1FBHA 2VPNA 4JVIA 4QXDA 4PAKA 4PAIA 1INPA 2XWKA 1NUWA 5EYHA 1NUZA 4N17A 2QVUA 2L5VA 5FBPA 4PETA 1FPEA 1NV1A 3LUZA 2WYPA 4M1VA 1K9YA 4P8BA 2KR0A 1LBWA 2Q9TA 2HZLA 5ET6A 4NGUA 3KC1A 4O7MA 2MKZA 1FBDA 3FBPA 2GQ1A 3E79A 5I3SA 1NV5A 4GX6A 4P1LA 5ET5A 1K9ZA 3MSTA 1IMAA 2VT5A 1FPIA 3BIGA 4P1EA 4OA4A 5IZZA 4NQ8A 1RDZA 1CNQA 4UABA 1SPIA 4NN3A 4OVSA 4HE0A 4PDDA 1FTAA 2OX3A 4PGPA 1NV6A 5EQ8A 4AS5A 1FJ9A 2PFYA 1FPJA 4NAPA 4NG7A 4NX1A 2DE2A 2V3QA 5IZ3B 1NUXA 2DDKA 4N81A 4AS4A 2WX9A 3MYUA 4P56A 3U65A 1IMFA 1QGXA 1RDYA 5EYGA 2ZZWA 4JVCA 5EQAA 4MJOA 5LDZA 4H46A 1FPFA 1D9QA 3KC0A 4N6KA 4O94A 4X8RA 1FPGA 2HXRA 4PBQA 4H45A 4XF5A 2WBBA 4DI3D 4OVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFC A;  3A29 A;  1KA1 A;  4G61 A;  2WEF A;  2JJK A;  4KXP A;  1DK4 A;  4PTK A;  3BIH A;  4GWU A;  2R8T A;  2OWZ A;  4I3E A;  4GWX A;  1NV3 A;  3B8B A;  4HE1 A;  2WBD A;  1JP4 A;  1NV2 A;  4GWZ A;  1IME A;  1IMD A;  4GX3 A;  1FBP A;  2FVZ A;  3RPL A;  2BJI A;  4FBP A;  3T0J A;  1FBG A;  1YXI A;  5ET7 A;  5J16 A;  1LBZ A;  1NV4 A;  2F3B A;  5IZ1 A;  1FBF A;  2FBP A;  2Y5L A;  5A5L A;  1FPB A;  1FSA A;  5ESY A;  2P3V A;  1LBV A;  2FHY A;  4I3Y A;  4I40 A;  5DW8 A;  3RPL B;  1IMC A;  1G0H A;  4GBW A;  1KZ8 A;  1LBY A;  2CZK A;  4GBV A;  5T3J A;  1BK4 A;  4HXV A;  2FIE A;  2CZI A;  1FBE A;  1NV7 A;  1FPD A;  1Q9D A;  5EQ9 A;  2Q8M A;  2Q74 A;  1VDW A;  5F24 A;  1FRP A;  1KA0 A;  4O7I A;  1FPL A;  5IZ3 A;  3RYD A;  2Y5K A;  4GWW A;  1LEV A;  1FBC A;  1FPK A;  2P3N A;  1EYI A;  2PCR A;  2QFL A;  1G0I A;  3LV0 A;  4IR8 A;  1IMB A;  1EYJ A;  4HE2 A;  3D1R A;  2FIX A;  1NUY A;  1AWB A;  1EYK A;  2HHM A;  4GX4 A;  2QVR A;  2F3D A;  3ROJ A;  1RDX A;  1XI6 A;  1LBX A;  5EQ7 A;  5ET8 A;  1YYZ A;  3QMF A;  1YZ0 A;  2QVV A;  3KBZ A;  1DCU A;  1NI9 A;  2CZH A;  4GWS A;  1FJ6 A;  1NV0 A;  4GWY A;  3IFA A;  1DBZ A;  1FBH A;  4QXD A;  1INP A;  1NUW A;  5EYH A;  1NUZ A;  2QVU A;  5FBP A;  1FPE A;  1NV1 A;  3LUZ A;  1K9Y A;  1LBW A;  5ET6 A;  3KC1 A;  1FBD A;  3FBP A;  2GQ1 A;  5I3S A;  1NV5 A;  4GX6 A;  5ET5 A;  1K9Z A;  1IMA A;  2VT5 A;  1FPI A;  3BIG A;  1RDZ A;  1CNQ A;  1SPI A;  4HE0 A;  1FTA A;  2OX3 A;  1NV6 A;  5EQ8 A;  4AS5 A;  1FJ9 A;  1FPJ A;  5IZ3 B;  1NUX A;  2DDK A;  4N81 A;  4AS4 A;  1IMF A;  1QGX A;  1RDY A;  5EYG A;  5EQA A;  4MJO A;  5LDZ A;  4H46 A;  1FPF A;  1D9Q A;  3KC0 A;  1FPG A;  4H45 A;  2WBB A; 
#chains in the Genus database with same CATH topology
 1KA1 A;  1B3F A;  4U1O A;  3FVO A;  3SEW A;  4R74 A;  4IY6 A;  3O6H A;  5F1Q A;  1Q35 A;  2RF1 A;  3B6Q A;  3GBB A;  3A09 A;  4QFN A;  2ZNU A;  4PGN A;  3B7D A;  4Q30 B;  4QSE A;  3MP6 A;  4N4U A;  1DPE A;  2BJI A;  3T0J A;  1NNT A;  2NVU B;  4MMP A;  3M3K A;  4O8M A;  4NF8 B;  2I4C A;  1G0H A;  1URG A;  2Z22 A;  1BK4 A;  3S9M C;  4O3C A;  1DSN A;  3OD7 A;  4AB5 A;  1NV7 A;  3LUY A;  4KYE A;  5AA2 B;  5IZ3 A;  2OWT A;  1MQJ A;  4PFW A;  2XWO A;  4HCY A;  1EYK A;  1B1X A;  3KN3 A;  1RDX A;  2ZZX A;  4PF6 A;  1LFI A;  3OXN A;  3RQT A;  1OQG A;  1LGB C;  1NFT A;  1NNP A;  4OVT A;  5EHM A;  1DBZ A;  4PAK A;  2QSX A;  2F6P A;  1L5T A;  5ET6 A;  1R6Z A;  2XXX A;  3CFL A;  3RUM A;  3FAS A;  1I6A A;  1OVB A;  3HCQ A;  4N13 A;  2NXO A;  2OCU A;  3FIR A;  4P56 A;  2DXR A;  3U65 A;  1N0T A;  4NMY A;  4X8R A;  4C1U A;  4LP2 B;  2DSF A;  2XD3 A;  4XF5 A;  3DM0 A;  2WEF A;  4RJZ A;  5IGA A;  4GWX A;  1RKM A;  2P2A A;  2ZZV A;  4BLA A;  1FTM A;  1TFA A;  4GWO A;  4BDR A;  4U1Z A;  4IO2 A;  5ET7 A;  4OZ9 A;  2Y5L A;  3C34 A;  1QKB A;  2I0B A;  3RPL B;  5HM4 B;  4GBW A;  1URD A;  5ITO A;  2Q74 A;  3PPN A;  1KA0 A;  3T1B A;  4P9K A;  2Y5K A;  4ZS9 A;  4IGR A;  1IXH A;  3TYH A;  2PCR A;  4OHN A;  2XXK A;  2QS3 A;  3CG3 A;  4XKN A;  4ZZA A;  3EKI A;  5BUU A;  3WAF A;  3OEM A;  3D4G A;  3FGS A;  3IFA A;  1BP5 A;  2VPN A;  1MXU A;  4HW8 A;  5L8D A;  1ZU0 A;  4ZEK A;  3IB0 A;  3QIM A;  1MPB A;  4I1D A;  1WVJ A;  1QUI A;  4YKP A;  3O66 A;  1FBD A;  3E79 A;  3FUZ A;  3MST A;  1IMA A;  3VXC A;  2QJE A;  1CNQ A;  2Y7W A;  3Q28 A;  3FXR A;  3JV9 A;  4N81 A;  2ONR A;  3A3C A;  3BFT A;  1B1H A;  4O94 A;  3FVG A;  1IIW A;  2WBB A;  2DWA A;  3LSW A;  3MAM A;  3R26 A;  5I5P A;  1MXX A;  4RA1 A;  3CIJ A;  1DPP A;  1FCK A;  5FHO A;  4H1X A;  5K2Y A;  4HE1 A;  5CMM A;  4KD5 A;  3D4C A;  1HSE A;  1FBP A;  3ZKL A;  3RPL A;  4F29 A;  5DVF A;  3U72 A;  2F3B A;  3FXB A;  3MVX A;  1FSA A;  2P3V A;  3K6X A;  1B58 A;  3VE1 B;  4C0R A;  3ISP A;  1MPC A;  1O63 A;  3RY3 A;  3FAT A;  2HCA A;  4QFL A;  3TQL A;  4O3B A;  4OWD A;  3C35 A;  4ISU A;  3T9U A;  2BJJ X;  3OSR A;  4KI0 E;  4DLD A;  3CG1 A;  4C1T A;  4JXI A;  3DEL B;  4HCW A;  3TTL A;  1QKA A;  1SI0 A;  1PEB A;  4NF4 B;  1XI6 A;  1MY0 A;  3RPW A;  3CHG A;  3UIF A;  3H06 B;  1SI1 A;  2O7U A;  3SEY A;  3T9V A;  3PMX A;  1TXF A;  4PET A;  4R72 A;  4P8B A;  2Q9T A;  3HO7 A;  3UGW A;  2XXI A;  5I3S A;  3G3J A;  3TDJ A;  4OA4 A;  1ZIU A;  1R1N A;  5TPA A;  2UYF A;  3MYU A;  1RDY A;  4U4S A;  4QRZ A;  3VLW A;  4JVC A;  4ZEI A;  1QJM A;  1Y3N A;  2HXR A;  1JQF A;  4HTG A;  5CMB A;  3T66 A;  3IOU A;  4ELP A;  2RC7 A;  3UOR A;  4EQ9 A;  3SKP A;  1SVX B;  3QYT A;  2WYK A;  1A7L A;  1NH8 A;  3N94 A;  3H6U A;  2CEX A;  4OEU A;  5H8N A;  2F5X A;  1Z7M E;  5FHM A;  4NF6 B;  1LCT A;  5ESY A;  4FEC A;  2F7A A;  5I2K A;  2QS2 A;  2O6A A;  3KFM A;  4FAT A;  4ELQ A;  3OSQ A;  4P3L A;  2PFZ A;  4MLV A;  3U92 A;  3TQW A;  4NF4 A;  1LCF A;  2DWH A;  3K0V A;  3U1O A;  3U8Q A;  4H65 A;  3H6V A;  1MDQ A;  4HE2 A;  3PMV A;  2QVR A;  1FTK A;  4H6D A;  1LBX A;  4F39 A;  5EQ7 A;  4G8H A;  2VOZ A;  1S9T A;  1B32 A;  3HHF A;  4RYA A;  4THI A;  1USY H;  3RGY A;  1IZ1 A;  1H44 A;  5H8F B;  3KOT A;  4OXV A;  4RPO A;  1K9Z A;  3PUZ E;  3BIG A;  4P1E A;  3VLV A;  1USY E;  1OQH A;  2Q2C A;  2E0S A;  3R6U A;  3V8X B;  5LDZ A;  4NWC A;  1US4 A;  4N6K A;  2H99 A;  1FW0 A;  3RN8 A;  1TWY A;  4F1V A;  1SW2 A;  2XXP A;  1LBC A;  2XXH A;  1DK4 A;  4DIG A;  2B3F A;  4X9T A;  1QUK A;  2YJP A;  2PBW A;  3MC2 A;  1BIY A;  1B51 A;  4F22 A;  5KCJ B;  3UP9 A;  3VDF A;  2YPN A;  4PFU A;  2B65 A;  4ONY A;  2XXU A;  2DXY A;  2GHB A;  3USD A;  5I2K B;  4R6Y A;  5IZ1 A;  4XIG Q;  3PGF A;  2V4C A;  4HXV A;  3IR1 A;  2FIE A;  2RKM A;  4TLL B;  4GD5 A;  3HFU A;  3KJ7 A;  4PC9 A;  1VDW A;  2A5S A;  1YAE A;  3H4Z A;  2RCB A;  1LEV A;  1Q1K A;  2I0C A;  2ZNT A;  3K1N A;  4GXS B;  3KZG A;  3BBR A;  1A55 A;  4QFK A;  2VGQ A;  3ECR A;  3T96 B;  3CSG A;  4POX A;  2I3V A;  1MQI A;  4WED A;  4EDP A;  2OPE A;  2W7Y A;  4N17 A;  5H8N B;  2HAU A;  1QUL A;  1R9L A;  1O64 A;  4NF6 A;  5DVI A;  2XHD A;  1H3D A;  1FPI A;  4OER A;  2UYE A;  2F8D A;  3CVG A;  3M3L A;  2OX3 A;  3OO7 A;  2Y7P A;  5CMK A;  1CB6 A;  1FPF A;  4H8J A;  2PT1 A;  1SW1 A;  4LON B;  2I4B A;  3UN6 A;  3IFC A;  4ZE8 A;  4F3G A;  4F3P A;  3TKD A;  4MIJ A;  2F97 A;  3EHS A;  4PFT A;  2P0S A;  4GWU A;  2ONS A;  3IOW A;  4O3A A;  4F31 B;  5H8H A;  4JB7 A;  4PQJ A;  1B46 A;  3N6U A;  4YIC A;  1FTJ A;  4FBP A;  1YXI A;  1A8E A;  2FBP A;  4G68 A;  1LBV A;  3MVY A;  4FE8 A;  3W15 C;  2XXT A;  2HZK A;  2I3W A;  1Q9D A;  3E4R A;  4P47 A;  2F78 A;  4P0I A;  3C9H A;  5ELV A;  5I2N A;  4PDH A;  3T9X B;  2H9B A;  2Q2A A;  3FJ7 A;  1O7T A;  1HSL A;  1LAF E;  1VSO A;  1AOV A;  1GGG A;  5L9O A;  1MY2 A;  1PC3 A;  4LQ2 A;  4R73 A;  4GLI A;  1ZTY A;  4PFR A;  4MNC A;  5ET8 A;  4N8Y A;  3CSB A;  1DCU A;  1NI9 A;  1B05 A;  4G68 C;  4FOR A;  3IO6 A;  4OYV A;  2V84 A;  1LB9 A;  4QHQ A;  1LBW A;  1TT1 A;  2FNC A;  2R6G E;  3QAX A;  4ELO A;  3P7I A;  3SEU A;  5H8F A;  1YPN A;  3MUQ A;  1SPI A;  2ALU A;  1PB8 A;  4AS5 A;  4R6H A;  4NX1 A;  2V3Q A;  2WX9 A;  2DDK A;  4IB2 A;  3E9X A;  4DDD A;  4MJO A;  2H4I A;  5DVJ A;  3K01 A;  3KSX A;  4YB7 A;  3K02 A;  3PUV E;  3C32 A;  3FD3 A;  2H98 A;  1QUJ A;  1XOC A;  3IO4 A;  3MZB A;  1DTG A;  3GLB A;  4G61 A;  4DCY A;  5BWJ A;  4ESX A;  2XXQ A;  3IAZ A;  4QSC A;  4LN5 A;  4PTK A;  3G7W A;  5CBS A;  1B9J A;  1AMF A;  2FA7 A;  4GRK A;  2WBD A;  5CBR A;  4YZZ A;  5DT6 A;  4G2Z A;  1N7W A;  3U93 A;  1MG1 A;  4PDD A;  3M3F A;  4PBH A;  4N6D A;  1P99 A;  1EH3 A;  1S50 A;  2XWI A;  4GQO A;  2D3I A;  3MP8 A;  2CZI A;  1NKX A;  4GF8 A;  3OEK A;  5HBC A;  3CR9 A;  1N3W A;  4POW A;  3Q25 A;  2QPQ A;  3DP4 A;  2D21 A;  5DYH A;  3TTK A;  2F3D A;  1D4N A;  1N7X A;  4OEN A;  2PT2 A;  1P1Q A;  4XEQ A;  5J1D A;  1PB9 A;  3CRB A;  5H8H B;  5AA4 A;  4XKR A;  1I6B A;  1T0K A;  5EYH A;  4YMA A;  1P1O A;  3TAJ A;  1NV1 A;  4GOT A;  2QS1 A;  1VFE A;  2R9J A;  2HZL A;  3PPR A;  5KZT A;  1B0H A;  4O7M A;  2MKZ A;  3FBP A;  3L6H A;  4PP0 A;  4GX6 A;  5ET5 A;  3K4U A;  2Q88 A;  4OVS A;  4HE0 A;  1FTA A;  5CC2 A;  3VVD A;  5EQ8 A;  4MLQ A;  3S9L C;  1IEJ A;  1JW1 A;  3UK4 A;  1QGX A;  4X1D A;  3VVE A;  4IO6 A;  4RK9 A;  1MS7 A;  3Q29 A;  1OLA A;  1QW0 A;  3FXU A;  4OMB A;  4KXP A;  3O6G A;  1A54 A;  2RIN A;  3I3V A;  3CI8 A;  4OEV A;  3EHU A;  4NWD A;  4I3E A;  1MY3 A;  4DXB A;  5JTY A;  1IXC A;  2XXW A;  2DE4 A;  2UVG A;  4F3S A;  2B3B A;  4XTC Q;  4X48 A;  5DTB A;  4YB6 A;  1NMU A;  1DMB A;  2XXR A;  1MRP A;  4MEV A;  2RCA A;  1LBZ A;  4H8I A;  4UAC A;  1JEV A;  1XC1 A;  4NED A;  3S2V A;  5FTH A;  5I57 A;  4ZED A;  5L9M A;  2IA4 A;  5JK4 A;  2O1L A;  3O9P A;  3FJG A;  3RT8 A;  3SET A;  1FRP A;  2OZZ A;  3V5A A;  4NF0 A;  5TPA B;  4MCO A;  4H0W A;  4GWW A;  1B5J A;  5A5X B;  4F18 A;  5I2N B;  4DXU A;  4PFY A;  2Y7K A;  5AA4 B;  5L9S A;  4U21 A;  4R2B A;  4KFQ A;  4YAH X;  1NV0 A;  2O1M A;  2VHA A;  1INP A;  1POT A;  1QVS A;  2UVI A;  1B3L A;  1MY1 A;  2KR0 A;  1P1U A;  1RYX A;  3PUW E;  3Q26 A;  1LAX A;  2XX9 A;  2O7I A;  3VFJ A;  2PX1 A;  1Z7N E;  4OTE A;  3VV5 A;  2QMW A;  4EXL A;  3KN7 A;  2UVJ A;  5I56 A;  1FPJ A;  1NNK A;  3THI A;  2ESN A;  4LQ5 A;  2HAV A;  1FQF A;  2CMO A;  1MQH A;  4WEP A;  3KSJ A;  3MPK A;  3KC0 A;  2I6E A;  3PUX E;  4GFR A;  4DI3 D;  3B6W A;  3IJX B;  5JTY B;  1ELJ A;  3ZSF A;  3GZG A;  4EXK A;  4Q0C A;  4M4G A;  1SDX A;  3B8B A;  1EZP A;  4H5F A;  2HQ0 A;  1EZO A;  2ZYM A;  4GWZ A;  1IMD A;  3MW0 A;  1IUD A;  4ESW A;  1WOD A;  3ZKK A;  1N76 A;  2VP1 A;  1NV4 A;  4JBZ A;  1IXG A;  3MWB A;  2NWJ A;  2VD2 A;  3FXQ A;  4LVQ A;  5AA3 A;  4I40 A;  2XA5 A;  1LLS A;  4L17 A;  1IIT A;  2B4L A;  4GL0 A;  1FBE A;  2QL3 A;  4ZDM A;  1MM7 A;  4RNS A;  3SER A;  4G4P A;  1P1N A;  4FEB A;  4QF9 A;  4PF8 A;  4QSD A;  4XXU A;  3KGC A;  1HSJ A;  4PCD A;  1EYI A;  3GYY A;  3DP6 A;  1FQE A;  2HHM A;  3H7M A;  3S4U A;  2X26 A;  1FQD A;  4XKQ A;  3K1M A;  5B7D A;  2E1S A;  4PAF A;  3GBA A;  4R9G A;  3TTM A;  1B3G A;  5ICT A;  3R7X A;  2V93 A;  4MBP A;  3MBP A;  4NTL A;  3K6U A;  1US5 A;  2WYP A;  2WKY A;  3ILT B;  4KHZ E;  4YKI A;  2GQ1 A;  2HFB A;  4UAB A;  4GVO A;  2FYI A;  1FJ9 A;  4NAP A;  2H5Y A;  4JDF A;  3VXB A;  3IB1 A;  2Z8D A;  3H03 A;  2XXV A;  3BKI B;  3W9W A;  4F19 A;  3QK6 A;  1LAH E;  5K2X A;  1ZJL A;  3MQ9 A;  4EF1 A;  1B7U A;  2O84 X;  1GR2 A;  4P11 A;  2B4M A;  2OWS A;  4OAN A;  2DWJ A;  1TFD A;  3LSL A;  2AL4 A;  1OVT A;  3IX1 A;  5IM2 A;  1FBG A;  1CE2 A;  3HV1 A;  2CZK A;  2CZL A;  3VVF A;  5IAI A;  4BDQ A;  2XX8 A;  1MPD A;  1UTH A;  3KN8 A;  1OIB A;  4EQB A;  4MNI A;  5I56 B;  4O7I A;  3RNN A;  3L6G A;  4MHF A;  1D9V A;  2UVH A;  2P3N A;  4IR8 A;  4LAT A;  2I58 A;  2A5T A;  3IOR A;  2M8C A;  4JSO A;  4YMB A;  5ICQ A;  1XHY A;  3BFU A;  1YZ0 A;  1XS5 A;  4ZE9 A;  4R75 A;  1BTJ A;  4HS7 A;  4GIZ A;  1MXV A;  1NUZ A;  3G3H A;  3TCF A;  2L5V A;  3LUZ A;  3TEP A;  2ANJ A;  3ONM A;  1SYI A;  4N07 A;  4FED A;  1PBP A;  1JVX A;  4G68 B;  5IZZ A;  3N26 A;  4NN3 A;  3KJT A;  5ISU A;  3PPP A;  3JZJ A;  2HXW A;  1FQB A;  1M5F A;  1UIU A;  1YTV A;  4OET A;  3RTW B;  4F2O A;  2NOO A;  4H45 A;  1Y4T A;  3KBR A;  1M5C A;  3OOA A;  1URS A;  1MY4 A;  4ZEF A;  3BIH A;  2OWZ A;  3HPI A;  1UIV A;  4KCD A;  4ECF A;  1B4H A;  1XVY A;  1IME A;  2FVZ A;  3PPQ A;  5J16 A;  1H45 A;  4JWO A;  4QBA A;  5DEX B;  4PFB A;  3E3K A;  4GBV A;  1PB7 A;  2H25 A;  3G3G A;  2KLF A;  3HHG A;  4DZ1 A;  2NUV A;  4Z0I A;  2V3U A;  3MZ9 A;  2GHA A;  3D1R A;  4GX4 A;  4AB6 A;  1BLF A;  3OMB A;  2DS9 A;  3M8U A;  2Y84 A;  2Q89 A;  3HN0 A;  5EHS A;  3KBZ A;  4N6P A;  2CZH A;  3C4M A;  1FJ6 A;  3SZP A;  3LR1 A;  4GWY A;  4PAI A;  1PDA A;  2O51 A;  1B4Z A;  1Y4C A;  1FPE A;  2DOJ A;  3TZA A;  1YCJ A;  3KG2 A;  1LBB A;  1AIV A;  1N04 A;  3H6W A;  3LSF B;  1SBP A;  1NNF A;  1VR5 A;  1JW5 A;  4KYD A;  5I59 B;  3C31 A;  2ZMB A;  2YLN A;  2DE2 A;  4IGT A;  3GXA A;  1UTH B;  3EF7 A;  1DOT A;  5KDT B;  1MXZ A;  3OO9 A;  3TOD A;  3T93 B;  4DCX A;  4F1U A;  2GH9 A;  5I58 B;  1B3E A;  3SDF A;  1EU8 A;  2F36 A;  5FHN A;  3OEL A;  4KYS A;  2OPD A;  2QS4 A;  1NV3 A;  2A5T B;  1NH7 A;  1JP4 A;  1FQA A;  1FTO A;  1B7H A;  3UA8 A;  4U22 A;  1XVX A;  3PMW A;  4UA8 A;  4BDL A;  3EPE A;  3SEV A;  1M5D A;  3LSX A;  4OES A;  2THI A;  1FPB A;  2O69 A;  1KWH A;  4IO7 A;  1IMC A;  3HST A;  1KZ8 A;  1LBY A;  4GXA A;  3OO6 A;  5AA1 A;  4N91 A;  2X7Q A;  5I7I A;  5EYF A;  4EF2 A;  1B6H A;  3F11 A;  1SD3 A;  1LST A;  2VPO A;  5TP9 B;  3ZS6 A;  4PE5 B;  2ZYO A;  3ODB A;  4E0X A;  4OVP A;  3G3F A;  1F9B A;  2F35 A;  4GWS A;  3E78 A;  5I84 A;  2V3T A;  3MJN A;  1NL5 A;  2I48 A;  3MZ1 A;  2QVU A;  3U94 A;  3AXF A;  4F3B A;  4NF8 A;  3TTR A;  4I9D A;  1B40 A;  3O2A A;  4P1L A;  4NQ8 A;  5I57 B;  5AA2 A;  2ZYN A;  4WKM A;  5IZ3 B;  3IK6 B;  4KQP A;  4R6K A;  1MH3 A;  4FIM A;  4H46 A;  3N6T A;  1D9Q A;  4EQ7 A;  5I58 A;  3FV2 A;  4OVJ A;  3PUY E;  3NOH A;  3O28 A;  1WDN A;  4ZEB A;  5A5X A;  1Y3Q A;  3DLN A;  2R8T A;  5LTC A;  3H3G A;  4OFJ A;  4YU0 A;  1MQD A;  4RY1 A;  4LZ7 A;  4OVQ A;  4YKJ A;  1B7Z A;  3IL1 B;  4JWY A;  4KCC A;  4GX3 A;  3IJO B;  4MF3 A;  2DQV A;  2XX7 A;  4I8C A;  4MX6 A;  1B2H A;  2FHY A;  2REJ A;  4E0W A;  4WXJ A;  5CM6 A;  4IY5 A;  3PD8 A;  3TEL A;  2AIX A;  1I69 A;  2O68 A;  4K3F A;  3K6W A;  5DEX A;  5TP9 A;  2HEU A;  5F7V A;  5I59 A;  1N3X A;  4G8N A;  2Z8F A;  2X7P A;  1FPL A;  1A99 A;  2REG A;  1DTZ A;  3RT6 B;  4NE4 A;  3V89 B;  3IB2 A;  1FPK A;  2QFL A;  4BDO A;  5IKB A;  1ZBM A;  3W9V A;  5AA2 D;  3ROJ A;  3TTN A;  1S7Y A;  4GL8 A;  1SW5 A;  3QMF A;  4XKP A;  2ZXT A;  3T9H B;  1MQG A;  3MP1 A;  5HPQ A;  2XWK A;  4JSD A;  5FBP A;  5CI5 A;  2XXY A;  3QUF A;  3V83 A;  3WAE A;  2Q8J A;  4F1Y A;  1B52 A;  2DYX A;  2UXA A;  1EZ9 A;  1NUX A;  4JWX A;  1MH4 A;  5EYG A;  5EQA A;  4MFI A;  4EUO A;  4OFL A;  2JJK A;  3IOV A;  1Y1M A;  2G93 A;  4NHB A;  2CEY A;  2QRY A;  3K6V A;  4DXC A;  3ILU B;  5FTI A;  2KQZ A;  1JEU A;  2RC8 A;  1ZLQ A;  4H5G A;  1AH5 A;  1Y20 A;  4IO5 A;  3K1P A;  1Y9U A;  1M5B A;  1VFD A;  3I5O A;  3SES A;  1AL3 A;  2AL5 A;  1D3K A;  4MAG A;  4TLM B;  3MVW A;  4BDM A;  2PVU A;  1LFG A;  3SEX A;  5TU0 A;  4I3Y A;  4FJP A;  2DWI A;  2IEE A;  3B50 A;  2VD3 A;  1MDP 1;  3JYR A;  3LBS A;  3H6T A;  1GVC A;  1UTB A;  2LAO A;  4YKK A;  3RYD A;  2F34 A;  4FAJ A;  2GRV A;  3G3I A;  5H8Q A;  3OEN A;  4Q8R A;  2FIX A;  1GV8 A;  3Q27 A;  5M2V A;  4OQO A;  1YYZ A;  2QVV A;  5AE4 A;  4IO3 A;  3PU5 A;  3N5L A;  1FBH A;  1VE4 A;  3O29 A;  1POY 1;  2QMX A;  5CRY A;  1K9Y A;  4LZ5 A;  4Q5T A;  4ZZE A;  1SYH A;  2VT5 A;  1II5 A;  1RDZ A;  3QXM A;  2F7C A;  1ZKB A;  3TCH A;  5LOM A;  3B6T A;  3KOS A;  3FVN A;  1FPG A;  5B70 A;  1N84 A;  3FVK A;  4KR5 A;  1JW4 A;  3A29 A;  1IXI A;  1B5I A;  2OK2 A;  1Y3P A;  2Z8E A;  3G3K A;  4MNP A;  4QFP A;  1M5E A;  1RYO A;  4RPN A;  2DVZ A;  3CFZ A;  1FTL A;  3FJM A;  1B3H A;  1OLC A;  4F2Q A;  2RC9 A;  3CFX A;  3EN3 A;  4PFI A;  4NF5 B;  4YB5 A;  3TPA A;  1MXW A;  1I6Q A;  4G77 A;  4IO4 A;  1B0L A;  1Y1Z A;  1FPD A;  3VLU A;  3QSL A;  5EQ9 A;  4DI4 B;  2Q8M A;  5F24 A;  5H8Q B;  1LAG E;  4X1B A;  3K00 A;  4DE8 A;  3IOT A;  4XFE A;  1FBC A;  3O97 A;  1JET A;  2DE3 A;  1IMB A;  2V25 A;  1B5H A;  3PPO A;  3I6V A;  1NUY A;  2ABH A;  1FQC A;  3TUS A;  4U4X A;  3FV1 A;  4TQU Q;  4PE3 A;  4U2R A;  3KEI A;  1J1N A;  3QUJ A;  2R71 A;  3E13 X;  2DP8 A;  4RXL A;  1NUW A;  3MPL A;  3EHT A;  4M1V A;  4NGU A;  3KC1 A;  1BKA A;  1NV5 A;  2ONK E;  3S9E A;  1H76 A;  1H43 A;  2G29 A;  1P1W A;  2Y7I A;  4PGP A;  1NV6 A;  2Y7R A;  2PFY A;  5JEI A;  4ZEC A;  2ZZW A;  3K2D A;  3PV0 E;  1SQY A;  1UTB B;  4ELR A;  4AQ4 A;  3O6I A;  4OVR A;  3MVZ A;  4LA9 A;  1UQW A;  2ZNS A;  4KPT A;  2XWV A;  4X04 A;  2OLB A;  4OFO A;  1A40 A;  1LFH A;  1NV2 A;  1JNF A;  1IQ7 A;  2F7B A;  4N8G A;  4BDN A;  1SW4 A;  3FZV A;  3S9N C;  1ATG A;  3PD9 A;  1FBF A;  4N15 A;  4Z7E A;  5A5L A;  5H8S A;  5DW8 A;  5ITP A;  3PTY A;  4RK2 A;  5T3J A;  4LZ8 A;  2HPG A;  3C33 A;  3RLF E;  4JVD A;  3RTF B;  2AYS A;  2GFE A;  1GTK A;  1OMP A;  1PBQ A;  2P1S A;  4ND9 A;  3LC8 A;  3EQ1 A;  2OBG A;  5CMC A;  2I49 A;  5KDT A;  1G0I A;  3LV0 A;  2OJT A;  1EYJ A;  1JVY A;  1AWB A;  4TOZ A;  2PYY A;  3TCG A;  4QFO A;  1MXY A;  5KCJ A;  2XD2 A;  1ZMG A;  2F6G A;  2ZYK A;  2PMS A;  3A3U A;  2Z23 A;  3TFL A;  4JVI A;  4QXD A;  3C36 A;  1D9Y A;  3TMG A;  1A8F A;  3OO8 A;  4MH5 A;  4R9F A;  2D5W A;  4NF5 A;  1LB8 A;  4LUB A;  1R9Q A;  1XT8 A;  4NG7 A;  3T22 A;  1ANF A;  4U23 A;  4AS4 A;  4G8M A;  4P0G A;  1IMF A;  1MM6 A;  3DP8 A;  4PBQ A;  4I62 A;  4R2F A;  2DVC A;  4H67 A; 
#chains in the Genus database with same CATH homology
 3W9W A;  4F1V A;  3IFC A;  3A29 A;  4F19 A;  1KA1 A;  4G61 A;  2WEF A;  3NOH A;  4MIJ A;  2JJK A;  4KXP A;  4F1U A;  4NHB A;  5I5P A;  2CEY A;  1DK4 A;  4LN5 A;  4MNP A;  4PTK A;  2WYK A;  3BIH A;  5IGA A;  2XWV A;  4GWU A;  2R8T A;  2OWZ A;  4I3E A;  4GWX A;  4X04 A;  1NV3 A;  5LTC A;  3B8B A;  2ZZV A;  4X9T A;  2CEX A;  4HE1 A;  2KQZ A;  2DVZ A;  2WBD A;  2B4M A;  1JP4 A;  4OAN A;  1NV2 A;  2DE4 A;  4OVQ A;  4PGN A;  4YZZ A;  4GWZ A;  4YIC A;  1IME A;  2F5X A;  1IMD A;  4GX3 A;  1FBP A;  4N4U A;  4N8G A;  2FVZ A;  3RPL A;  2BJI A;  4MEV A;  4FBP A;  3T0J A;  5IM2 A;  1FBG A;  1YXI A;  5ET7 A;  5J16 A;  1LBZ A;  1NV4 A;  2F3B A;  4MAG A;  4PBH A;  5IZ1 A;  3FXB A;  1FBF A;  4MMP A;  4MX6 A;  4N15 A;  2FBP A;  4N6D A;  2Y5L A;  4O8M A;  5A5L A;  1FPB A;  1FSA A;  4PFI A;  4QBA A;  5ESY A;  2P3V A;  1LBV A;  2FHY A;  4I3Y A;  4I40 A;  5DW8 A;  3RPL B;  1IMC A;  2XA5 A;  3B50 A;  1G0H A;  4GBW A;  3PTY A;  4PFB A;  1KZ8 A;  1LBY A;  2V4C A;  2CZK A;  4GBV A;  5T3J A;  2XWI A;  3ISP A;  1BK4 A;  4HXV A;  2FIE A;  2B4L A;  5CM6 A;  5JK4 A;  2HZK A;  2CZI A;  1FBE A;  1NV7 A;  1FPD A;  2HPG A;  4N91 A;  1Q9D A;  3HFU A;  4P3L A;  5EQ9 A;  4DI4 B;  2Q8M A;  2Q74 A;  4JVD A;  4P47 A;  1VDW A;  4PC9 A;  5I7I A;  5F24 A;  1FRP A;  4MNI A;  1KA0 A;  3T1B A;  4O7I A;  1FPL A;  2PFZ A;  4NF0 A;  4MCO A;  5IZ3 A;  4MHF A;  4PDH A;  4P9K A;  3RYD A;  2VPO A;  4PF8 A;  2QPQ A;  4XFE A;  2Y5K A;  4GWW A;  1LEV A;  1FBC A;  4PCD A;  1FPK A;  2P3N A;  1EYI A;  2PCR A;  2QFL A;  2XWO A;  3GYY A;  1G0I A;  3LV0 A;  4HCY A;  4IR8 A;  2DE3 A;  1IMB A;  2XXK A;  4F18 A;  1EYJ A;  4HE2 A;  4HCW A;  3D1R A;  2FIX A;  1NUY A;  1AWB A;  1EYK A;  2HHM A;  4GX4 A;  2QVR A;  3W9V A;  2F3D A;  3ROJ A;  1RDX A;  1XI6 A;  2ZZX A;  3EKI A;  1LBX A;  4OVP A;  4MNC A;  5EQ7 A;  4PFR A;  5ET8 A;  1YYZ A;  4PF6 A;  3QMF A;  1YZ0 A;  2QVV A;  3KBZ A;  4N8Y A;  4PAF A;  4PE3 A;  3CHG A;  1DCU A;  1NI9 A;  2CZH A;  4GWS A;  4XEQ A;  3E78 A;  5J1D A;  1FJ6 A;  3SZP A;  1NV0 A;  4GWY A;  4OVT A;  3IFA A;  1DBZ A;  1FBH A;  2VPN A;  4JVI A;  4QXD A;  4PAK A;  4PAI A;  1INP A;  2XWK A;  1NUW A;  5EYH A;  1NUZ A;  4N17 A;  2QVU A;  2L5V A;  5FBP A;  4PET A;  1FPE A;  1NV1 A;  3LUZ A;  2WYP A;  4M1V A;  1K9Y A;  4P8B A;  2KR0 A;  1LBW A;  2Q9T A;  2HZL A;  5ET6 A;  4NGU A;  3KC1 A;  4O7M A;  2MKZ A;  1FBD A;  3FBP A;  2GQ1 A;  3E79 A;  5I3S A;  1NV5 A;  4GX6 A;  4P1L A;  5ET5 A;  1K9Z A;  3MST A;  1IMA A;  2VT5 A;  1FPI A;  3BIG A;  4P1E A;  4OA4 A;  5IZZ A;  4NQ8 A;  1RDZ A;  1CNQ A;  4UAB A;  1SPI A;  4NN3 A;  4OVS A;  4HE0 A;  4PDD A;  1FTA A;  2OX3 A;  4PGP A;  1NV6 A;  5EQ8 A;  4AS5 A;  1FJ9 A;  2PFY A;  1FPJ A;  4NAP A;  4NG7 A;  4NX1 A;  2DE2 A;  2V3Q A;  5IZ3 B;  1NUX A;  2DDK A;  4N81 A;  4AS4 A;  2WX9 A;  3MYU A;  4P56 A;  3U65 A;  1IMF A;  1QGX A;  1RDY A;  5EYG A;  2ZZW A;  4JVC A;  5EQA A;  4MJO A;  5LDZ A;  4H46 A;  1FPF A;  1D9Q A;  3KC0 A;  4N6K A;  4O94 A;  4X8R A;  1FPG A;  2HXR A;  4PBQ A;  4H45 A;  4XF5 A;  2WBB A;  4DI3 D;  4OVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...