3B8BA

Crystal structure of cysq from bacteroides thetaiotaomicron, a bacterial member of the inositol monophosphatase family
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
270
Chain Sequence
NLYFQSNAMAAIDAALKAGEKILSIYEDPKSDFEIADNSPLTIADRKAHEAIVAILNETPFPVLSEEGKMDYAVRRGWDTLWIVDPLDGTKEFIKRNGEFTVNIALVQNAVPVMGVIYVPVKKELYFAVEGTGAYKSGIVGLEDEGVTLQQMIEKSERMPLADARDHFIAVASRSHLTPETETYIADLKKKHGNVELISSGSSIKICLVAEGKADVYPRFAPTMEWDTAAGHAIARAAGMEVYQAGKEEPLRYNKEDLLNPWFIVEAKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CysQ, sulfite synthesis pathway protein
publication title The structure of CysQ from Bacteroides thetaiotaomicron, a bacterial member of the inositol monophosphatase family.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 77
structure length 270
sequence length 275
ec nomenclature
pdb deposition date 2007-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3b8bA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3b8bA02
4GWXA 1IMFA 2Y5LA 2Y5KA 2FIXA 4G61A 1FBCA 5ET7A 2FHYA 5IZ3A 3KC1A 2WBDA 4HE2A 1LBVA 4HE1A 5EYHA 1NV5A 1FBEA 2FBPA 2Q74A 5ESYA 1EYIA 2P3NA 1VDWA 3FBPA 2FVZA 5DW8A 1YYZA 4I3EA 3T0JA 4GX3A 5ET6A 2VT5A 1Q9DA 2R8TA 3QMFA 1D9QA 5FBPA 1FBFA 5ET5A 5J16A 1BK4A 1RDZA 1YZ0A 1FJ6A 1G0HA 2GQ1A 1RDXA 1DBZA 2HHMA 1LEVA 4GWUA 1NUXA 5EQ7A 1NV0A 1FPKA 2OWZA 1NUYA 2CZIA 1IMBA 1IMAA 2F3BA 5EYGA 4AS4A 1FPDA 2FIEA 1FPEA 1IMCA 1QGXA 2OX3A 1FBHA 1LBZA 3ROJA 2QFLA 4MJOA 3RYDA 5LDZA 2QVUA 1EYJA 3IFAA 1FBPA 3RPLA 4H45A 3A29A 1NV1A 1NV6A 5I3SA 1AWBA 2QVVA 4I3YA 1SPIA 2WEFA 1KZ8A 5IZ3B 3KC0A 1FPBA 2F3DA 5ET8A 1NI9A 1FSAA 1NV7A 1FRPA 4HXVA 1KA0A 4FBPA 4KXPA 4QXDA 1EYKA 3BIGA 1FPJA 1INPA 1DK4A 1NUWA 1LBXA 2QVRA 1K9YA 5EQ9A 5IZ1A 4AS5A 4H46A 4IR8A 2Q8MA 1NV2A 3B8BA 4GWWA 1YXIA 1FTAA 4O7IA 3RPLB 2CZHA 2P3VA 5A5LA 4I40A 3IFCA 1K9ZA 1FPGA 5F24A 1NV4A 1G0IA 1IMEA 1XI6A 3LUZA 1NUZA 1FBDA 4GWZA 1FJ9A 3BIHA 4GX4A 1DCUA 3D1RA 5EQAA 1LBYA 2DDKA 1LBWA 2PCRA 4GWYA 1FBGA 4HE0A 4GBWA 1FPIA 1JP4A 5T3JA 5EQ8A 1KA1A 4GBVA 2WBBA 1FPLA 3LV0A 4GX6A 1CNQA 1IMDA 4N81A 2BJIA 1RDYA 4PTKA 1NV3A 3KBZA 2CZKA 2JJKA 4GWSA 1FPFA
chains in the Genus database with same CATH superfamily
4G61A 2IEEA 4U2RA 4GD5A 1QUJA 4U21A 4R6KA 3K01A 3IB1A 4NTLA 2AL4A 5ITPA 1MH3A 1DBZA 2DQVA 5AA4B 5ISUA 4RNSA 3G7WA 4ZEFA 1VR5A 4Q8RA 2Y7PA 2NOOA 4NWCA 2H4IA 1MG1A 1OMPA 2ZYNA 2Z8DA 4OETA 1I69A 3K1NA 2A5SA 3PU5A 5AA3A 4GXSB 4BDNA 4DI3D 1PB7A 5DT6A 3OENA 3E9XA 4RXLA 2OPEA 1EYKA 1FPJA 1DK4A 4EXLA 1B52A 3K00A 3RTWB 4FAJA 3ILTB 4IR8A 1B3FA 1ZLQA 5H8QA 3MBPA 2RCAA 2HQ0A 4OERA 4PFWA 2OWSA 5DEXB 1MY2A 5EQAA 2Q89A 4LQ5A 2YLNA 2DVZA 4I62A 4MHFA 3EHUA 2E0SA 4GBWA 2YPNA 2ONKE 2XA5A 4OVJA 4YICA 3ZKKA 5FTIA 3TUSA 4N4UA 4PTKA 3A3CA 4G68A 3SEWA 2CZKA 4KYDA 2XD2A 4F3SA 2XX7A 1Z7ME 2VHAA 4MFIA 2OLBA 4JXIA 4PDHA 1ZMGA 3IB2A 3KN7A 3CFZA 1B4ZA 2P3NA 1S9TA 4X9TA 4I3EA 4H6DA 2HAUA 2OJTA 3L6GA 5I84A 2OCUA 4OMBA 1PBPA 4GWUA 3THIA 1NV0A 4ZZAA 2CZIA 3R6UA 3TQLA 4WXJA 3PTYA 2WYPA 4LZ7A 1BP5A 4PGPA 2XXRA 3ROJA 1SYIA 4N17A 4NF6B 4MBPA 3ODBA 4G2ZA 1MXWA 2CZLA 4OEVA 1N0TA 4QSCA 2F3DA 4NMYA 2ZZVA 1Y1MA 3HN0A 2D5WA 4JBZA 3M3LA 4QXDA 2KR0A 5KCJB 4PF6A 4EDPA 4QFPA 4E0WA 4YMBA 4FJPA 1DOTA 3SZPA 1EZPA 2RCBA 2ABHA 1MXVA 3RGYA 3VLWA 2Q8JA 3OO8A 3K2DA 3QAXA 3BKIB 4X1DA 4BDMA 2CEXA 1UQWA 4QSEA 1KA1A 2GHAA 1URDA 2KLFA 1MXUA 1IITA 1JVXA 3MSTA 1B51A 4PBHA 4DCXA 2B3BA 2DWIA 3IOTA 3MP6A 3PUXE 2QJEA 2PX1A 1VFEA 1MS7A 1QKAA 3FBPA 1SDXA 2ESNA 2OBGA 1JW1A 5A5XB 3H7MA 2HXWA 2H99A 3N94A 1IMAA 5L9SA 3MVXA 4H8JA 1EU8A 3BFUA 2V93A 1FPEA 1CE2A 1I6BA 5I2KA 4G4PA 1BIYA 2DSFA 3CRBA 3EHTA 4LN5A 3FJGA 1JW4A 1POY1 4P0IA 1LFHA 1Q1KA 4H1XA 4F22A 3KSXA 4TOZA 3KBRA 4XF5A 5ICTA 4HW8A 3UN6A 1TT1A 4OENA 3E79A 1NH8A 3I5OA 1K9YA 4KQPA 4AS5A 1JVYA 1GGGA 1LB8A 3E13X 2XXKA 3Q27A 3PD9A 4ECFA 1G0IA 3G3GA 5CMMA 4MLVA 4P3LA 2QMWA 5IAIA 2GHBA 4YKKA 1LBWA 3MPLA 5ITOA 2I4BA 3TYHA 5KZTA 4F3BA 3FJMA 4YZZA 4OQOA 3MAMA 1PC3A 1MQHA 1A8FA 4LZ5A 4N81A 4TQUQ 1B5IA 4R9GA 4PAFA 3K6XA 5CMBA 3O29A 4OVTA 1FW0A 4BDOA 3U8QA 3OEMA 5I7IA 2CMOA 1FBCA 5ET7A 3TFLA 2V4CA 5EYHA 5EHMA 3CSGA 3MWBA 3K6WA 3HFUA 4PE5B 5TP9B 4HCYA 4PFUA 3VVFA 1G0HA 2HHMA 1EZOA 3T1BA 1TWYA 4ELPA 5L9OA 3OO9A 2O51A 1FPDA 4P1EA 3IJOB 1FBHA 3GLBA 4NN3A 4I8CA 3G3KA 2B65A 4LONB 4MNCA 2O69A 1SYHA 5IZ3B 5LTCA 1MDQA 1NV7A 1M5BA 3TTNA 3N5LA 1FTKA 1LCFA 1WODA 4XKPA 3D4CA 5HPQA 2DP8A 2F8DA 2ZNSA 5AA1A 3U72A 4OVQA 2F6GA 3I6VA 3EKIA 2QPQA 4K3FA 2R9JA 3FZVA 1KWHA 3MVWA 2DDKA 2R71A 4N15A 3QIMA 3VE1B 4JWOA 4OFLA 3O6GA 2O7UA 4U1OA 4JSDA 1PB8A 3KBZA 3GZGA 5AA2B 4F1UA 1QVSA 1QJMA 3IR1A 2Y5KA 2X26A 5BUUA 3S9LC 3MZ9A 1MY1A 3OSQA 2XX9A 3V83A 1MXYA 3KGCA 2XWIA 2CEYA 2FVZA 1LFIA 4EQ7A 5J1DA 2HZKA 1FBFA 4OVRA 2P0SA 4OVPA 4THIA 3SEYA 3S2VA 5EQ7A 3ZS6A 4FATA 2VD3A 4MX6A 3FGSA 3FIRA 1N3WA 2GRVA 1MH4A 1O63A 2XXYA 1USYE 5L9MA 4RPNA 4PGNA 5I56B 1ZBMA 1NV1A 1PDAA 1YTVA 1FTLA 2DWAA 4LQ2A 1UTBA 2V84A 2ANJA 3K1MA 4IY5A 4FE8A 1LBXA 4AQ4A 1UTHB 4HCWA 2IA4A 3MUQA 4C1TA 1US4A 4RPOA 2PCRA 2WYKA 3OOAA 3PPNA 4LATA 3MW0A 5EQ8A 1I6QA 2PYYA 3PPRA 3Q26A 4YB7A 5EHSA 1FQDA 5B7DA 3CG1A 1OQHA 1MY4A 4PQJA 3AXFA 2NVUB 2E1SA 3TTLA 2HZLA 3TKDA 2JJKA 2RC7A 1B1HA 3M8UA 4GWXA 1SVXB 2O6AA 4NEDA 1ZKBA 4R72A 1LBVA 4N6DA 3SKPA 4ESWA 1A8EA 1B6HA 1WDNA 1NFTA 3PMVA 3IO4A 4Z0IA 4GX3A 4JVDA 4G68B 1B5JA 3U93A 1QW0A 3MZ1A 2HCAA 1FJ6A 3K4UA 1RDXA 2Z8EA 2I0BA 4UABA 1LEVA 4ZS9A 3OEKA 1Q35A 2UXAA 1AL3A 2UVJA 4QF9A 4U22A 3TCGA 4QFOA 1B7HA 1OLAA 1BLFA 5L8DA 1FTOA 3TMGA 5LDZA 4JWYA 2PFZA 4QBAA 5CI5A 3T9HB 4I1DA 4I3YA 1M5FA 2VD2A 4JVIA 2WEFA 4OFOA 5H8NA 3KC0A 5H8SA 2GFEA 4C1UA 1A54A 2D3IA 4NG7A 1MPDA 1LLSA 2NWJA 3B8BA 3G3JA 2XXUA 4NF4A 4KPTA 1MY3A 3MC2A 3N26A 2I58A 1FBDA 2RC8A 1IXGA 3D1RA 1MRPA 1SW5A 3VXBA 1Y1ZA 4ZE8A 3OSRA 4IGRA 2XWVA 3MP1A 2ZYKA 1B3LA 4EUOA 2Y7KA 4EQBA 5T3JA 3H6VA 1DTZA 1UIVA 4GX6A 1EZ9A 1NV3A 4H8IA 4N13A 4GWSA 3RN8A 5ICQA 1H76A 4ZECA 2REGA 3ISPA 3KC1A 2WBDA 4ZDMA 2AL5A 4R73A 3VLVA 2Q88A 4GWOA 1DSNA 3FV2A 4LP2B 1B9JA 2VT5A 5I59B 4FIMA 1XS5A 2XX8A 3FVKA 3A09A 2QS3A 3QK6A 2DWHA 4RY1A 1SI1A 3ONMA 3DP4A 4F2OA 1AOVA 5I57A 3G3HA 3KEIA 3SESA 2P2AA 5M2VA 1B1XA 4RA1A 5KDTB 4YB6A 4ONYA 2RC9A 4O7MA 1ELJA 3RT8A 1ZU0A 5I3SA 1AWBA 5K2XA 2F7BA 3LUYA 2DE4A 4R2FA 3LC8A 1NI9A 4N6PA 3F11A 3IX1A 5IM2A 5I2KB 4BDRA 3B7DA 5DVJA 5EQ9A 3D4GA 3KN3A 2VOZA 4IO3A 3IFCA 5F24A 2OK2A 3HV1A 3FUZA 5AA4A 4EQ9A 2HXRA 4PBQA 4M1VA 2XWKA 1R6ZA 5IZZA 4N91A 4DXCA 4GLIA 4GBVA 4F29A 3E78A 3SEXA 1XC1A 2BJIA 4PP0A 2F5XA 3MPKA 4PE3A 2Y5LA 4XKRA 1N84A 3PV0E 3N6UA 2ZXTA 5F1QA 5DW8A 1YYZA 1LBBA 5K2YA 4IGTA 1Q9DA 5FBPA 3PUYE 4ISUA 1BK4A 1RDZA 1IEJA 2XXVA 1QUKA 2F34A 3OD7A 4FECA 2D21A 1XHYA 3WAEA 4F18A 3LSXA 3C32A 1Y3PA 1LGBC 1LBZA 4GF8A 2DE2A 4P1LA 2QVUA 2O7IA 2ZZWA 2ZNTA 3RPLA 1NV6A 2REJA 1FCKA 1IXIA 2F97A 4ZEKA 5ET8A 1EH3A 3IAZA 4XFEA 1AH5A 1AIVA 1DTGA 3N6TA 4H46A 2QMXA 2HAVA 3VLUA 4PFRA 1ANFA 2Y7RA 4H0WA 3W15C 3LR1A 1AMFA 1NUZA 2PVUA 4L17A 2QSXA 3T96B 4GRKA 4P11A 4GWYA 1FBGA 1VFDA 3O28A 3TZAA 1IQ7A 2Z8FA 3BBRA 2WBBA 3CSBA 3QYTA 1CNQA 3ZSFA 1RDYA 1SD3A 4NF6A 3SERA 4G8HA 1MXXA 3FASA 4QSDA 1MQDA 4MNIA 4YU0A 3A3UA 1LAGE 1IMFA 4LVQA 2UVIA 3TTRA 4FORA 5H8HB 5AA2D 4Q0CA 4KYEA 3PPPA 5KCJA 2LAOA 4N8YA 4NWDA 5ET6A 3FXUA 3MZBA 3QMFA 1RYOA 1H45A 4Z7EA 1NUYA 3V89B 4NF8A 2OZZA 2M8CA 4GOTA 3TDJA 3TELA 1QKBA 4F1VA 1D3KA 4YKJA 1Y20A 3LSLA 1VSOA 4YB5A 4IB2A 3FVGA 3FXRA 2UVHA 4ELQA 3TAJA 2Y7IA 2Y7WA 2F36A 1P1OA 1NL5A 5FHNA 5TPAA 1J1NA 3Q28A 3C34A 2QVRA 4NF5B 3PPQA 1B58A 1DPPA 3S4UA 3PGFA 1BTJA 4P56A 4R74A 3RQTA 3M3FA 3H4ZA 1JQFA 2ZYMA 1FJ9A 3ECRA 3TTKA 4EF1A 1LBYA 3QUJA 3KJ7A 5JTYB 3PUWE 3U1OA 3IOWA 3PD8A 4ESXA 3MQ9A 1NNKA 3K02A 4GVOA 1DMBA 5I5PA 2X7QA 1FPFA 1MQJA 4KI0E 3CG3A 2ZNUA 1B3GA 1URSA 1B7ZA 4U4SA 3EF7A 4PF8A 1F9BA 1ZIUA 1FBEA 2FBPA 5AE4A 5EYFA 2RINA 1N7XA 4KYSA 4R9FA 1FQEA 1O7TA 1A99A 1LFGA 5TU0A 1IZ1A 4G77A 1N3XA 4ELRA 4XKNA 3T22A 2OWZA 1P99A 1NKXA 4AS4A 3I3VA 3PPOA 3RTFB 4UACA 3C31A 2OX3A 3IO6A 2XXTA 2QFLA 4RK9A 5FHOA 5DYHA 1SBPA 2PBWA 1UIUA 2W7YA 3KSJA 4XEQA 1LB9A 1B3EA 1FPBA 4MCOA 4RJZA 3GBBA 3M3KA 1NUWA 4OHNA 4AB6A 4F19A 4MAGA 1GVCA 4O3AA 4GWWA 1M5CA 3SETA 3FVNA 2XHDA 4F3PA 1B40A 3LBSA 3IOUA 3BIHA 5B70A 3DLNA 3CFXA 5I2NA 3QUFA 3PUZE 5DTBA 4ZEDA 2YJPA 1XVYA 3LV0A 3C35A 3EN3A 3MJNA 1LAFE 3TODA 1RKMA 5LOMA 4ELOA 3QSLA 1GR2A 1H44A 3ZKLA 4H5FA 2PT2A 1N76A 1MM6A 5IZ3A 4HE2A 4X1BA 2QL3A 4MIJA 1Y3NA 1TFDA 1Y4TA 1JEUA 3IL1B 4FEBA 5H8QB 2XXPA 2R8TA 1FTMA 2UYFA 5J16A 3H3GA 2Y84A 4IO6A 1MQGA 1B4HA 3E3KA 4F31B 4ZEIA 2P1SA 3CHGA 1IMBA 2ZZXA 2DVCA 2RKMA 4Q30B 3HPIA 3E4RA 4QHQA 4WKMA 2OPDA 4XKQA 3G3IA 3PMWA 1LAHE 1EYJA 2ZMBA 2QRYA 4GFRA 1SW1A 5AA2A 3Q25A 4H45A 2I49A 4P0GA 1Y9UA 1OVTA 3KJTA 2DXRA 1FRPA 4KXPA 4PC9A 3GBAA 3RNNA 1LSTA 3K6UA 3OMBA 4PCDA 1FTAA 2CZHA 4F2QA 4I40A 3OXNA 3HHGA 4F1YA 4POWA 3CI8A 1XI6A 3LUZA 1TFAA 4ND9A 3UORA 1R9QA 4GX4A 2I48A 4NAPA 4X48A 3USDA 2QS1A 4OWDA 4R6YA 3FD3A 4GXAA 1T0KA 3PUVE 4R2BA 4MNPA 1S7YA 4QFNA 4F3GA 5I56A 4JDFA 1FTJA 1D4NA 2B4LA 3O66A 3SEUA 3TPAA 1GTKA 5I58A 3OELA 5ESYA 1A7LA 2I4CA 2V25A 3FV1A 4O3CA 4MH5A 4KFQA 3VXCA 1O64A 5DVIA 4NF0A 4ZZEA 3UGWA 1UTHA 4R75A 4LA9A 2B4MA 3KG2A 1NH7A 4KD5A 1FPKA 2Q9TA 4N07A 1IMCA 2XXIA 4WEPA 1HSEA 2KQZA 1ZTYA 3HCQA 1SQYA 4UA8A 2I3VA 4QFKA 5H8FA 3A29A 2F7CA 4DLDA 3FJ7A 1XOCA 1SPIA 2A5TA 4KR5A 4QRZA 4HXVA 2VP1A 1KA0A 3HSTA 3DELB 4NQ8A 3FATA 3TCHA 3C33A 3L6HA 1ATGA 3KOSA 4RYAA 1IUDA 1ZJLA 1NV2A 4O7IA 1YXIA 3RPLB 1Z7NE 4OFJA 5A5LA 5ELVA 3IK6B 1MPBA 4YAHX 1DCUA 1P1UA 3O9PA 1PBQA 4BDQA 2AIXA 2XXHA 2QS4A 2FA7A 1SI0A 2BJJX 5CBRA 5CBSA 1QUIA 1M5EA 1B46A 1B05A 4O3BA 1DPEA 3H6TA 1RYXA 3CIJA 1FQCA 1PB9A 1B3HA 2B3FA 1URGA 3JYRA 4N6KA 4GL8A 4NX1A 1VDWA 4DIGA 4C0RA 3B6QA 1MQIA 5CMKA 4LZ8A 2RF1A 3VV5A 1YZ0A 1YCJA 4ZE9A 1NMUA 3UK4A 2X7PA 1IIWA 4NGUA 1OVBA 5EYGA 1MXZA 3HO7A 3PMXA 3VVEA 4MJOA 2XWOA 1IXCA 3EHSA 3TEPA 2O68A 1POTA 1LBCA 5HBCA 2XXXA 4DCYA 4HS7A 4M4GA 2ONSA 1P1QA 4PAKA 5DEXA 1KZ8A 4NF8B 4QFLA 2PFYA 1LAXA 3BIGA 1INPA 4YMAA 2DE3A 4PFIA 2AYSA 1D9VA 3BFTA 3HHFA 3U94A 2R6GE 1XVXA 2UVGA 5I59A 2V3TA 1FPGA 2ONRA 3KN8A 3MVZA 3VVDA 1M5DA 3R7XA 1MM7A 3ILUB 5TPAB 2DYXA 3C36A 4WEDA 4X04A 1P1NA 5IKBA 5BWJA 1JP4A 1CB6A 1FPLA 1US5A 3DM0A 5KDTA 4XXUA 3H03A 4DZ1A 1S50A 3KZGA 2I0CA 5JEIA 4OYVA 1D9YA 3Q29A 4F39A 3W9WA 2G29A 4PFTA 4JWXA 4OVSA 1B7UA 4OA4A 2Q74A 1I6AA 1EYIA 3CFLA 3S9EA 4KHZE 3CR9A 1D9QA 1NNFA 4MLQA 2I6EA 2GH9A 2ALUA 2O84X 3RLFE 2F6PA 4U23A 3OO6A 3W9VA 3T9XB 2F3BA 1MPCA 1N7WA 1PEBA 4OEUA 3KFMA 1QGXA 1N04A 1H43A 3C9HA 3K0VA 3MYUA 5CMCA 4DE8A 2HFBA 2V3UA 2PMSA 2Q2AA 5IGAA 2XXWA 3NOHA 3FXQA 4FBPA 1TXFA 1NNPA 2H25A 2HPGA 4PAIA 2Q8MA 1USYH 2F78A 3MVYA 1Y3QA 4ZEBA 2NXOA 2H98A 1P1WA 2WX9A 4GWZA 2DS9A 4DDDA 5JK4A 4GL0A 4LUBA 4YKPA 2VPOA 3RUMA 1GV8A 1JW5A 1FPIA 4PFYA 3EQ1A 1HSLA 2VGQA 3VDFA 4P8BA 4FEDA 4JSOA 1MY0A 1A40A 2G93A 3H06B 3O6HA 4BDLA 1YAEA 4MF3A 5A5XA 1UTBB 4OANA 5I2NB 4OTEA 1L5TA 3JZJA 1NV5A 1QULA 4TLMB 4X8RA 4O94A 1Y4CA 1OIBA 2DOJA 3DP6A 3T0JA 3B6TA 3TTMA 3UIFA 4IO2A 4H67A 5ET5A 3LSWA 1JNFA 4P47A 2XD3A 1B5HA 5FTHA 3K1PA 3TCFA 2V3QA 4IO5A 2FIEA 4O8MA 3B50A 4YKIA 3T9VA 2Q2CA 4DI4B 3FXBA 4JB7A 3RYDA 1SW4A 1II5A 4XTCQ 5CM6A 1LCTA 3RT6B 4BLAA 4HTGA 3IFAA 1FBPA 5FHMA 4OZ9A 2O1LA 3V5AA 3T9UA 4N8GA 2FNCA 4EXKA 1FSAA 2L5VA 5H8HA 2DWJA 4G8MA 4KCDA 1FQBA 4TLLB 3R26A 3C4MA 3LSFB 4H65A 4POXA 3H6WA 3GYYA 4U4XA 1H3DA 3S9MC 4Q5TA 2DXYA 4DXBA 3CVGA 4GIZA 4H5GA 4MMPA 4AB5A 4MEVA 3MP8A 3B6WA 2VPNA 3SDFA 1IMDA 5TP9A 3H6UA 2O1MA 4NE4A 1B0HA 4PDDA 1VE4A 2Z22A 5CC2A 3UA8A 2FIXA 5H8NB 1FQFA 4PFBA 3T66A 4G68C 2FHYA 3WAFA 4HE1A 3OO7A 2THIA 4XIGQ 1BKAA 4JVCA 1JETA 3IJXB 3T93B 4RK2A 4NF5A 4NF4B 2UYEA 3V8XB 3EPEA 2GQ1A 2ZYOA 3G3FA 1NUXA 1FQAA 2NUVA 1MDP1 3GXAA 4GQOA 4NHBA 5I58B 1R9LA 4PETA 4IO4A 5JTYA 3DP8A 3S9NC 1B0LA 5CRYA 3U65A 3IOVA 2F7AA 1A55A 2OWTA 1HSJA 1OQGA 1JEVA 4KCCA 4EF2A 2QVVA 4IY6A 2MKZA 3K6VA 1IXHA 1YPNA 3RPWA 4E0XA 1WVJA 3QXMA 2PT1A 2H5YA 3U92A 1B2HA 3TQWA 3KOTA 3O2AA 2HEUA 4OESA 2Z23A 3SEVA 4IO7A 5IZ1A 3UP9A 2I3WA 2QS2A 5F7VA 2P3VA 3JV9A 5H8FB 4R6HA 1K9ZA 5HM4B 4U1ZA 1NV4A 2FYIA 3VFJA 2A5TB 4DXUA 3O97A 1IMEA 1NNTA 1R1NA 3IORA 2XXQA 2F35A 1B32A 5I57B 4HE0A 4G8NA 2WKYA 3P7IA 4I9DA 2H9BA 3O6IA 4P9KA 1SW2A 5DVFA 1OLCA 4OXVA 3FVOA 3RY3A 3IB0A 1XT8A
chains in the Genus database with same CATH topology
1IMFA 2Y5KA 4G61A 2XWIA 4N6KA 4NX1A 1VDWA 2CEYA 2FVZA 4N8YA 5ET6A 5J1DA 3QMFA 2HZKA 1FBFA 4OVRA 1YZ0A 4OVPA 1DBZA 5EQ7A 1NUYA 4NGUA 5EYGA 4MX6A 4F1VA 4MJOA 2XWOA 4PGNA 1NV1A 4PAKA 4DI3D 1KZ8A 2PFYA 1EYKA 3BIGA 1FPJA 1INPA 1DK4A 1LBXA 2QVRA 2DE3A 4PFIA 4IR8A 4P56A 4HCWA 1FPGA 1FJ9A 5EQAA 1LBYA 2DVZA 2PCRA 2WYKA 4MHFA 4X04A 4GBWA 1JP4A 5EQ8A 2XA5A 4YICA 1FPLA 4N4UA 4PTKA 5I5PA 2HZLA 2CZKA 2JJKA 1FPFA 4GWXA 3W9WA 1LBVA 4N6DA 4PDHA 4OVSA 4PF8A 1FBEA 2FBPA 4OA4A 2Q74A 1EYIA 2P3NA 4X9TA 4I3EA 4GX3A 4JVDA 1D9QA 1FJ6A 1RDXA 4UABA 1LEVA 4GWUA 1NV0A 2OWZA 3W9VA 2CZIA 2F3BA 4AS4A 3PTYA 2WYPA 4PGPA 1QGXA 2OX3A 3ROJA 2QFLA 5LDZA 4N17A 3MYUA 2PFZA 4QBAA 4I3YA 4XEQA 4JVIA 2WEFA 3KC0A 1FPBA 2F3DA 5IGAA 2ZZVA 3NOHA 4MCOA 4FBPA 4QXDA 2KR0A 4PF6A 1NUWA 4NG7A 4F19A 2HPGA 4MAGA 4PAIA 3SZPA 2Q8MA 3B8BA 4GWWA 2WX9A 1FBDA 4GWZA 3BIHA 3D1RA 5JK4A 2VPOA 2XWVA 2CEXA 1FPIA 5T3JA 1KA1A 3LV0A 4GX6A 3MSTA 4P8BA 4PBHA 1NV3A 4GWSA 5IZ3A 3ISPA 4OANA 3KC1A 2WBDA 4HE2A 1NV5A 4MIJA 4X8RA 4O94A 3FBPA 3T0JA 2VT5A 2R8TA 5ET5A 5J16A 4P47A 3CHGA 1IMBA 2ZZXA 1IMAA 2V3QA 2FIEA 4O8MA 3B50A 1FPEA 4DI4B 3FXBA 3RYDA 1EYJA 5CM6A 4LN5A 3IFAA 1FBPA 4O7MA 4H45A 5I3SA 1AWBA 2DE4A 4N8GA 1NI9A 1FSAA 4XF5A 2L5VA 1FRPA 5IM2A 4KXPA 4PC9A 3E79A 1K9YA 5EQ9A 4AS5A 4PCDA 1FTAA 2CZHA 2XXKA 4I40A 3IFCA 5F24A 1G0IA 3GYYA 1XI6A 3LUZA 4P3LA 4GX4A 4NAPA 1LBWA 2HXRA 4PBQA 4M1VA 2XWKA 4MMPA 5IZZA 4MEVA 4N91A 4GBVA 2VPNA 4MNPA 4YZZA 3E78A 1IMDA 4N81A 2BJIA 4PAFA 2F5XA 4PDDA 4PE3A 4OVTA 2Y5LA 2FIXA 5I7IA 4PFBA 1FBCA 5ET7A 2FHYA 2B4LA 4HE1A 2V4CA 5EYHA 5ESYA 4JVCA 5DW8A 1YYZA 3HFUA 4NF0A 1Q9DA 5FBPA 4HCYA 1BK4A 1RDZA 1G0HA 2GQ1A 2HHMA 1NUXA 2B4MA 3T1BA 1FPKA 2Q9TA 4NHBA 4PETA 4F18A 1FPDA 4P1EA 3U65A 1IMCA 1FBHA 1LBZA 2DE2A 2KQZA 4NN3A 4P1LA 2QVUA 2ZZWA 3RPLA 4MNCA 3A29A 1NV6A 2QVVA 2MKZA 1SPIA 5IZ3B 5LTCA 5ET8A 1NV7A 4HXVA 1KA0A 4XFEA 4NQ8A 5IZ1A 4H46A 1NV2A 4O7IA 1YXIA 3RPLB 4PFRA 2P3VA 5A5LA 1K9ZA 4OVQA 1NV4A 3EKIA 2QPQA 1IMEA 1NUZA 1DCUA 2DDKA 4N15A 4GWYA 1FBGA 4HE0A 2WBBA 4P9KA 1CNQA 1RDYA 3KBZA 4F1UA 4MNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWX A;  1IMF A;  2Y5L A;  2Y5K A;  2FIX A;  4G61 A;  1FBC A;  5ET7 A;  2FHY A;  5IZ3 A;  3KC1 A;  2WBD A;  4HE2 A;  1LBV A;  4HE1 A;  5EYH A;  1NV5 A;  1FBE A;  2FBP A;  2Q74 A;  5ESY A;  1EYI A;  2P3N A;  1VDW A;  3FBP A;  2FVZ A;  5DW8 A;  1YYZ A;  4I3E A;  3T0J A;  4GX3 A;  5ET6 A;  2VT5 A;  1Q9D A;  2R8T A;  3QMF A;  1D9Q A;  5FBP A;  1FBF A;  5ET5 A;  5J16 A;  1BK4 A;  1RDZ A;  1YZ0 A;  1FJ6 A;  1G0H A;  2GQ1 A;  1RDX A;  1DBZ A;  2HHM A;  1LEV A;  4GWU A;  1NUX A;  5EQ7 A;  1NV0 A;  1FPK A;  2OWZ A;  1NUY A;  2CZI A;  1IMB A;  1IMA A;  2F3B A;  5EYG A;  4AS4 A;  1FPD A;  2FIE A;  1FPE A;  1IMC A;  1QGX A;  2OX3 A;  1FBH A;  1LBZ A;  3ROJ A;  2QFL A;  4MJO A;  3RYD A;  5LDZ A;  2QVU A;  1EYJ A;  3IFA A;  1FBP A;  3RPL A;  4H45 A;  3A29 A;  1NV1 A;  1NV6 A;  5I3S A;  1AWB A;  2QVV A;  4I3Y A;  1SPI A;  2WEF A;  1KZ8 A;  5IZ3 B;  3KC0 A;  1FPB A;  2F3D A;  5ET8 A;  1NI9 A;  1FSA A;  1NV7 A;  1FRP A;  4HXV A;  1KA0 A;  4FBP A;  4KXP A;  4QXD A;  1EYK A;  3BIG A;  1FPJ A;  1INP A;  1DK4 A;  1NUW A;  1LBX A;  2QVR A;  1K9Y A;  5EQ9 A;  5IZ1 A;  4AS5 A;  4H46 A;  4IR8 A;  2Q8M A;  1NV2 A;  3B8B A;  4GWW A;  1YXI A;  1FTA A;  4O7I A;  3RPL B;  2CZH A;  2P3V A;  5A5L A;  4I40 A;  3IFC A;  1K9Z A;  1FPG A;  5F24 A;  1NV4 A;  1G0I A;  1IME A;  1XI6 A;  3LUZ A;  1NUZ A;  1FBD A;  4GWZ A;  1FJ9 A;  3BIH A;  4GX4 A;  1DCU A;  3D1R A;  5EQA A;  1LBY A;  2DDK A;  1LBW A;  2PCR A;  4GWY A;  1FBG A;  4HE0 A;  4GBW A;  1FPI A;  1JP4 A;  5T3J A;  5EQ8 A;  1KA1 A;  4GBV A;  2WBB A;  1FPL A;  3LV0 A;  4GX6 A;  1CNQ A;  1IMD A;  4N81 A;  2BJI A;  1RDY A;  4PTK A;  1NV3 A;  3KBZ A;  2CZK A;  2JJK A;  4GWS A;  1FPF A; 
#chains in the Genus database with same CATH topology
 4G61 A;  2IEE A;  4U2R A;  4GD5 A;  1QUJ A;  4U21 A;  4R6K A;  3K01 A;  3IB1 A;  4NTL A;  2AL4 A;  5ITP A;  1MH3 A;  1DBZ A;  2DQV A;  5AA4 B;  5ISU A;  4RNS A;  3G7W A;  4ZEF A;  1VR5 A;  4Q8R A;  2Y7P A;  2NOO A;  4NWC A;  2H4I A;  1MG1 A;  1OMP A;  2ZYN A;  2Z8D A;  4OET A;  1I69 A;  3K1N A;  2A5S A;  3PU5 A;  5AA3 A;  4GXS B;  4BDN A;  4DI3 D;  1PB7 A;  5DT6 A;  3OEN A;  3E9X A;  4RXL A;  2OPE A;  1EYK A;  1FPJ A;  1DK4 A;  4EXL A;  1B52 A;  3K00 A;  3RTW B;  4FAJ A;  3ILT B;  4IR8 A;  1B3F A;  1ZLQ A;  5H8Q A;  3MBP A;  2RCA A;  2HQ0 A;  4OER A;  4PFW A;  2OWS A;  5DEX B;  1MY2 A;  5EQA A;  2Q89 A;  4LQ5 A;  2YLN A;  2DVZ A;  4I62 A;  4MHF A;  3EHU A;  2E0S A;  4GBW A;  2YPN A;  2ONK E;  2XA5 A;  4OVJ A;  4YIC A;  3ZKK A;  5FTI A;  3TUS A;  4N4U A;  4PTK A;  3A3C A;  4G68 A;  3SEW A;  2CZK A;  4KYD A;  2XD2 A;  4F3S A;  2XX7 A;  1Z7M E;  2VHA A;  4MFI A;  2OLB A;  4JXI A;  4PDH A;  1ZMG A;  3IB2 A;  3KN7 A;  3CFZ A;  1B4Z A;  2P3N A;  1S9T A;  4X9T A;  4I3E A;  4H6D A;  2HAU A;  2OJT A;  3L6G A;  5I84 A;  2OCU A;  4OMB A;  1PBP A;  4GWU A;  3THI A;  1NV0 A;  4ZZA A;  2CZI A;  3R6U A;  3TQL A;  4WXJ A;  3PTY A;  2WYP A;  4LZ7 A;  1BP5 A;  4PGP A;  2XXR A;  3ROJ A;  1SYI A;  4N17 A;  4NF6 B;  4MBP A;  3ODB A;  4G2Z A;  1MXW A;  2CZL A;  4OEV A;  1N0T A;  4QSC A;  2F3D A;  4NMY A;  2ZZV A;  1Y1M A;  3HN0 A;  2D5W A;  4JBZ A;  3M3L A;  4QXD A;  2KR0 A;  5KCJ B;  4PF6 A;  4EDP A;  4QFP A;  4E0W A;  4YMB A;  4FJP A;  1DOT A;  3SZP A;  1EZP A;  2RCB A;  2ABH A;  1MXV A;  3RGY A;  3VLW A;  2Q8J A;  3OO8 A;  3K2D A;  3QAX A;  3BKI B;  4X1D A;  4BDM A;  2CEX A;  1UQW A;  4QSE A;  1KA1 A;  2GHA A;  1URD A;  2KLF A;  1MXU A;  1IIT A;  1JVX A;  3MST A;  1B51 A;  4PBH A;  4DCX A;  2B3B A;  2DWI A;  3IOT A;  3MP6 A;  3PUX E;  2QJE A;  2PX1 A;  1VFE A;  1MS7 A;  1QKA A;  3FBP A;  1SDX A;  2ESN A;  2OBG A;  1JW1 A;  5A5X B;  3H7M A;  2HXW A;  2H99 A;  3N94 A;  1IMA A;  5L9S A;  3MVX A;  4H8J A;  1EU8 A;  3BFU A;  2V93 A;  1FPE A;  1CE2 A;  1I6B A;  5I2K A;  4G4P A;  1BIY A;  2DSF A;  3CRB A;  3EHT A;  4LN5 A;  3FJG A;  1JW4 A;  1POY 1;  4P0I A;  1LFH A;  1Q1K A;  4H1X A;  4F22 A;  3KSX A;  4TOZ A;  3KBR A;  4XF5 A;  5ICT A;  4HW8 A;  3UN6 A;  1TT1 A;  4OEN A;  3E79 A;  1NH8 A;  3I5O A;  1K9Y A;  4KQP A;  4AS5 A;  1JVY A;  1GGG A;  1LB8 A;  3E13 X;  2XXK A;  3Q27 A;  3PD9 A;  4ECF A;  1G0I A;  3G3G A;  5CMM A;  4MLV A;  4P3L A;  2QMW A;  5IAI A;  2GHB A;  4YKK A;  1LBW A;  3MPL A;  5ITO A;  2I4B A;  3TYH A;  5KZT A;  4F3B A;  3FJM A;  4YZZ A;  4OQO A;  3MAM A;  1PC3 A;  1MQH A;  1A8F A;  4LZ5 A;  4N81 A;  4TQU Q;  1B5I A;  4R9G A;  4PAF A;  3K6X A;  5CMB A;  3O29 A;  4OVT A;  1FW0 A;  4BDO A;  3U8Q A;  3OEM A;  5I7I A;  2CMO A;  1FBC A;  5ET7 A;  3TFL A;  2V4C A;  5EYH A;  5EHM A;  3CSG A;  3MWB A;  3K6W A;  3HFU A;  4PE5 B;  5TP9 B;  4HCY A;  4PFU A;  3VVF A;  1G0H A;  2HHM A;  1EZO A;  3T1B A;  1TWY A;  4ELP A;  5L9O A;  3OO9 A;  2O51 A;  1FPD A;  4P1E A;  3IJO B;  1FBH A;  3GLB A;  4NN3 A;  4I8C A;  3G3K A;  2B65 A;  4LON B;  4MNC A;  2O69 A;  1SYH A;  5IZ3 B;  5LTC A;  1MDQ A;  1NV7 A;  1M5B A;  3TTN A;  3N5L A;  1FTK A;  1LCF A;  1WOD A;  4XKP A;  3D4C A;  5HPQ A;  2DP8 A;  2F8D A;  2ZNS A;  5AA1 A;  3U72 A;  4OVQ A;  2F6G A;  3I6V A;  3EKI A;  2QPQ A;  4K3F A;  2R9J A;  3FZV A;  1KWH A;  3MVW A;  2DDK A;  2R71 A;  4N15 A;  3QIM A;  3VE1 B;  4JWO A;  4OFL A;  3O6G A;  2O7U A;  4U1O A;  4JSD A;  1PB8 A;  3KBZ A;  3GZG A;  5AA2 B;  4F1U A;  1QVS A;  1QJM A;  3IR1 A;  2Y5K A;  2X26 A;  5BUU A;  3S9L C;  3MZ9 A;  1MY1 A;  3OSQ A;  2XX9 A;  3V83 A;  1MXY A;  3KGC A;  2XWI A;  2CEY A;  2FVZ A;  1LFI A;  4EQ7 A;  5J1D A;  2HZK A;  1FBF A;  4OVR A;  2P0S A;  4OVP A;  4THI A;  3SEY A;  3S2V A;  5EQ7 A;  3ZS6 A;  4FAT A;  2VD3 A;  4MX6 A;  3FGS A;  3FIR A;  1N3W A;  2GRV A;  1MH4 A;  1O63 A;  2XXY A;  1USY E;  5L9M A;  4RPN A;  4PGN A;  5I56 B;  1ZBM A;  1NV1 A;  1PDA A;  1YTV A;  1FTL A;  2DWA A;  4LQ2 A;  1UTB A;  2V84 A;  2ANJ A;  3K1M A;  4IY5 A;  4FE8 A;  1LBX A;  4AQ4 A;  1UTH B;  4HCW A;  2IA4 A;  3MUQ A;  4C1T A;  1US4 A;  4RPO A;  2PCR A;  2WYK A;  3OOA A;  3PPN A;  4LAT A;  3MW0 A;  5EQ8 A;  1I6Q A;  2PYY A;  3PPR A;  3Q26 A;  4YB7 A;  5EHS A;  1FQD A;  5B7D A;  3CG1 A;  1OQH A;  1MY4 A;  4PQJ A;  3AXF A;  2NVU B;  2E1S A;  3TTL A;  2HZL A;  3TKD A;  2JJK A;  2RC7 A;  1B1H A;  3M8U A;  4GWX A;  1SVX B;  2O6A A;  4NED A;  1ZKB A;  4R72 A;  1LBV A;  4N6D A;  3SKP A;  4ESW A;  1A8E A;  1B6H A;  1WDN A;  1NFT A;  3PMV A;  3IO4 A;  4Z0I A;  4GX3 A;  4JVD A;  4G68 B;  1B5J A;  3U93 A;  1QW0 A;  3MZ1 A;  2HCA A;  1FJ6 A;  3K4U A;  1RDX A;  2Z8E A;  2I0B A;  4UAB A;  1LEV A;  4ZS9 A;  3OEK A;  1Q35 A;  2UXA A;  1AL3 A;  2UVJ A;  4QF9 A;  4U22 A;  3TCG A;  4QFO A;  1B7H A;  1OLA A;  1BLF A;  5L8D A;  1FTO A;  3TMG A;  5LDZ A;  4JWY A;  2PFZ A;  4QBA A;  5CI5 A;  3T9H B;  4I1D A;  4I3Y A;  1M5F A;  2VD2 A;  4JVI A;  2WEF A;  4OFO A;  5H8N A;  3KC0 A;  5H8S A;  2GFE A;  4C1U A;  1A54 A;  2D3I A;  4NG7 A;  1MPD A;  1LLS A;  2NWJ A;  3B8B A;  3G3J A;  2XXU A;  4NF4 A;  4KPT A;  1MY3 A;  3MC2 A;  3N26 A;  2I58 A;  1FBD A;  2RC8 A;  1IXG A;  3D1R A;  1MRP A;  1SW5 A;  3VXB A;  1Y1Z A;  4ZE8 A;  3OSR A;  4IGR A;  2XWV A;  3MP1 A;  2ZYK A;  1B3L A;  4EUO A;  2Y7K A;  4EQB A;  5T3J A;  3H6V A;  1DTZ A;  1UIV A;  4GX6 A;  1EZ9 A;  1NV3 A;  4H8I A;  4N13 A;  4GWS A;  3RN8 A;  5ICQ A;  1H76 A;  4ZEC A;  2REG A;  3ISP A;  3KC1 A;  2WBD A;  4ZDM A;  2AL5 A;  4R73 A;  3VLV A;  2Q88 A;  4GWO A;  1DSN A;  3FV2 A;  4LP2 B;  1B9J A;  2VT5 A;  5I59 B;  4FIM A;  1XS5 A;  2XX8 A;  3FVK A;  3A09 A;  2QS3 A;  3QK6 A;  2DWH A;  4RY1 A;  1SI1 A;  3ONM A;  3DP4 A;  4F2O A;  1AOV A;  5I57 A;  3G3H A;  3KEI A;  3SES A;  2P2A A;  5M2V A;  1B1X A;  4RA1 A;  5KDT B;  4YB6 A;  4ONY A;  2RC9 A;  4O7M A;  1ELJ A;  3RT8 A;  1ZU0 A;  5I3S A;  1AWB A;  5K2X A;  2F7B A;  3LUY A;  2DE4 A;  4R2F A;  3LC8 A;  1NI9 A;  4N6P A;  3F11 A;  3IX1 A;  5IM2 A;  5I2K B;  4BDR A;  3B7D A;  5DVJ A;  5EQ9 A;  3D4G A;  3KN3 A;  2VOZ A;  4IO3 A;  3IFC A;  5F24 A;  2OK2 A;  3HV1 A;  3FUZ A;  5AA4 A;  4EQ9 A;  2HXR A;  4PBQ A;  4M1V A;  2XWK A;  1R6Z A;  5IZZ A;  4N91 A;  4DXC A;  4GLI A;  4GBV A;  4F29 A;  3E78 A;  3SEX A;  1XC1 A;  2BJI A;  4PP0 A;  2F5X A;  3MPK A;  4PE3 A;  2Y5L A;  4XKR A;  1N84 A;  3PV0 E;  3N6U A;  2ZXT A;  5F1Q A;  5DW8 A;  1YYZ A;  1LBB A;  5K2Y A;  4IGT A;  1Q9D A;  5FBP A;  3PUY E;  4ISU A;  1BK4 A;  1RDZ A;  1IEJ A;  2XXV A;  1QUK A;  2F34 A;  3OD7 A;  4FEC A;  2D21 A;  1XHY A;  3WAE A;  4F18 A;  3LSX A;  3C32 A;  1Y3P A;  1LGB C;  1LBZ A;  4GF8 A;  2DE2 A;  4P1L A;  2QVU A;  2O7I A;  2ZZW A;  2ZNT A;  3RPL A;  1NV6 A;  2REJ A;  1FCK A;  1IXI A;  2F97 A;  4ZEK A;  5ET8 A;  1EH3 A;  3IAZ A;  4XFE A;  1AH5 A;  1AIV A;  1DTG A;  3N6T A;  4H46 A;  2QMX A;  2HAV A;  3VLU A;  4PFR A;  1ANF A;  2Y7R A;  4H0W A;  3W15 C;  3LR1 A;  1AMF A;  1NUZ A;  2PVU A;  4L17 A;  2QSX A;  3T96 B;  4GRK A;  4P11 A;  4GWY A;  1FBG A;  1VFD A;  3O28 A;  3TZA A;  1IQ7 A;  2Z8F A;  3BBR A;  2WBB A;  3CSB A;  3QYT A;  1CNQ A;  3ZSF A;  1RDY A;  1SD3 A;  4NF6 A;  3SER A;  4G8H A;  1MXX A;  3FAS A;  4QSD A;  1MQD A;  4MNI A;  4YU0 A;  3A3U A;  1LAG E;  1IMF A;  4LVQ A;  2UVI A;  3TTR A;  4FOR A;  5H8H B;  5AA2 D;  4Q0C A;  4KYE A;  3PPP A;  5KCJ A;  2LAO A;  4N8Y A;  4NWD A;  5ET6 A;  3FXU A;  3MZB A;  3QMF A;  1RYO A;  1H45 A;  4Z7E A;  1NUY A;  3V89 B;  4NF8 A;  2OZZ A;  2M8C A;  4GOT A;  3TDJ A;  3TEL A;  1QKB A;  4F1V A;  1D3K A;  4YKJ A;  1Y20 A;  3LSL A;  1VSO A;  4YB5 A;  4IB2 A;  3FVG A;  3FXR A;  2UVH A;  4ELQ A;  3TAJ A;  2Y7I A;  2Y7W A;  2F36 A;  1P1O A;  1NL5 A;  5FHN A;  5TPA A;  1J1N A;  3Q28 A;  3C34 A;  2QVR A;  4NF5 B;  3PPQ A;  1B58 A;  1DPP A;  3S4U A;  3PGF A;  1BTJ A;  4P56 A;  4R74 A;  3RQT A;  3M3F A;  3H4Z A;  1JQF A;  2ZYM A;  1FJ9 A;  3ECR A;  3TTK A;  4EF1 A;  1LBY A;  3QUJ A;  3KJ7 A;  5JTY B;  3PUW E;  3U1O A;  3IOW A;  3PD8 A;  4ESX A;  3MQ9 A;  1NNK A;  3K02 A;  4GVO A;  1DMB A;  5I5P A;  2X7Q A;  1FPF A;  1MQJ A;  4KI0 E;  3CG3 A;  2ZNU A;  1B3G A;  1URS A;  1B7Z A;  4U4S A;  3EF7 A;  4PF8 A;  1F9B A;  1ZIU A;  1FBE A;  2FBP A;  5AE4 A;  5EYF A;  2RIN A;  1N7X A;  4KYS A;  4R9F A;  1FQE A;  1O7T A;  1A99 A;  1LFG A;  5TU0 A;  1IZ1 A;  4G77 A;  1N3X A;  4ELR A;  4XKN A;  3T22 A;  2OWZ A;  1P99 A;  1NKX A;  4AS4 A;  3I3V A;  3PPO A;  3RTF B;  4UAC A;  3C31 A;  2OX3 A;  3IO6 A;  2XXT A;  2QFL A;  4RK9 A;  5FHO A;  5DYH A;  1SBP A;  2PBW A;  1UIU A;  2W7Y A;  3KSJ A;  4XEQ A;  1LB9 A;  1B3E A;  1FPB A;  4MCO A;  4RJZ A;  3GBB A;  3M3K A;  1NUW A;  4OHN A;  4AB6 A;  4F19 A;  4MAG A;  1GVC A;  4O3A A;  4GWW A;  1M5C A;  3SET A;  3FVN A;  2XHD A;  4F3P A;  1B40 A;  3LBS A;  3IOU A;  3BIH A;  5B70 A;  3DLN A;  3CFX A;  5I2N A;  3QUF A;  3PUZ E;  5DTB A;  4ZED A;  2YJP A;  1XVY A;  3LV0 A;  3C35 A;  3EN3 A;  3MJN A;  1LAF E;  3TOD A;  1RKM A;  5LOM A;  4ELO A;  3QSL A;  1GR2 A;  1H44 A;  3ZKL A;  4H5F A;  2PT2 A;  1N76 A;  1MM6 A;  5IZ3 A;  4HE2 A;  4X1B A;  2QL3 A;  4MIJ A;  1Y3N A;  1TFD A;  1Y4T A;  1JEU A;  3IL1 B;  4FEB A;  5H8Q B;  2XXP A;  2R8T A;  1FTM A;  2UYF A;  5J16 A;  3H3G A;  2Y84 A;  4IO6 A;  1MQG A;  1B4H A;  3E3K A;  4F31 B;  4ZEI A;  2P1S A;  3CHG A;  1IMB A;  2ZZX A;  2DVC A;  2RKM A;  4Q30 B;  3HPI A;  3E4R A;  4QHQ A;  4WKM A;  2OPD A;  4XKQ A;  3G3I A;  3PMW A;  1LAH E;  1EYJ A;  2ZMB A;  2QRY A;  4GFR A;  1SW1 A;  5AA2 A;  3Q25 A;  4H45 A;  2I49 A;  4P0G A;  1Y9U A;  1OVT A;  3KJT A;  2DXR A;  1FRP A;  4KXP A;  4PC9 A;  3GBA A;  3RNN A;  1LST A;  3K6U A;  3OMB A;  4PCD A;  1FTA A;  2CZH A;  4F2Q A;  4I40 A;  3OXN A;  3HHG A;  4F1Y A;  4POW A;  3CI8 A;  1XI6 A;  3LUZ A;  1TFA A;  4ND9 A;  3UOR A;  1R9Q A;  4GX4 A;  2I48 A;  4NAP A;  4X48 A;  3USD A;  2QS1 A;  4OWD A;  4R6Y A;  3FD3 A;  4GXA A;  1T0K A;  3PUV E;  4R2B A;  4MNP A;  1S7Y A;  4QFN A;  4F3G A;  5I56 A;  4JDF A;  1FTJ A;  1D4N A;  2B4L A;  3O66 A;  3SEU A;  3TPA A;  1GTK A;  5I58 A;  3OEL A;  5ESY A;  1A7L A;  2I4C A;  2V25 A;  3FV1 A;  4O3C A;  4MH5 A;  4KFQ A;  3VXC A;  1O64 A;  5DVI A;  4NF0 A;  4ZZE A;  3UGW A;  1UTH A;  4R75 A;  4LA9 A;  2B4M A;  3KG2 A;  1NH7 A;  4KD5 A;  1FPK A;  2Q9T A;  4N07 A;  1IMC A;  2XXI A;  4WEP A;  1HSE A;  2KQZ A;  1ZTY A;  3HCQ A;  1SQY A;  4UA8 A;  2I3V A;  4QFK A;  5H8F A;  3A29 A;  2F7C A;  4DLD A;  3FJ7 A;  1XOC A;  1SPI A;  2A5T A;  4KR5 A;  4QRZ A;  4HXV A;  2VP1 A;  1KA0 A;  3HST A;  3DEL B;  4NQ8 A;  3FAT A;  3TCH A;  3C33 A;  3L6H A;  1ATG A;  3KOS A;  4RYA A;  1IUD A;  1ZJL A;  1NV2 A;  4O7I A;  1YXI A;  3RPL B;  1Z7N E;  4OFJ A;  5A5L A;  5ELV A;  3IK6 B;  1MPB A;  4YAH X;  1DCU A;  1P1U A;  3O9P A;  1PBQ A;  4BDQ A;  2AIX A;  2XXH A;  2QS4 A;  2FA7 A;  1SI0 A;  2BJJ X;  5CBR A;  5CBS A;  1QUI A;  1M5E A;  1B46 A;  1B05 A;  4O3B A;  1DPE A;  3H6T A;  1RYX A;  3CIJ A;  1FQC A;  1PB9 A;  1B3H A;  2B3F A;  1URG A;  3JYR A;  4N6K A;  4GL8 A;  4NX1 A;  1VDW A;  4DIG A;  4C0R A;  3B6Q A;  1MQI A;  5CMK A;  4LZ8 A;  2RF1 A;  3VV5 A;  1YZ0 A;  1YCJ A;  4ZE9 A;  1NMU A;  3UK4 A;  2X7P A;  1IIW A;  4NGU A;  1OVB A;  5EYG A;  1MXZ A;  3HO7 A;  3PMX A;  3VVE A;  4MJO A;  2XWO A;  1IXC A;  3EHS A;  3TEP A;  2O68 A;  1POT A;  1LBC A;  5HBC A;  2XXX A;  4DCY A;  4HS7 A;  4M4G A;  2ONS A;  1P1Q A;  4PAK A;  5DEX A;  1KZ8 A;  4NF8 B;  4QFL A;  2PFY A;  1LAX A;  3BIG A;  1INP A;  4YMA A;  2DE3 A;  4PFI A;  2AYS A;  1D9V A;  3BFT A;  3HHF A;  3U94 A;  2R6G E;  1XVX A;  2UVG A;  5I59 A;  2V3T A;  1FPG A;  2ONR A;  3KN8 A;  3MVZ A;  3VVD A;  1M5D A;  3R7X A;  1MM7 A;  3ILU B;  5TPA B;  2DYX A;  3C36 A;  4WED A;  4X04 A;  1P1N A;  5IKB A;  5BWJ A;  1JP4 A;  1CB6 A;  1FPL A;  1US5 A;  3DM0 A;  5KDT A;  4XXU A;  3H03 A;  4DZ1 A;  1S50 A;  3KZG A;  2I0C A;  5JEI A;  4OYV A;  1D9Y A;  3Q29 A;  4F39 A;  3W9W A;  2G29 A;  4PFT A;  4JWX A;  4OVS A;  1B7U A;  4OA4 A;  2Q74 A;  1I6A A;  1EYI A;  3CFL A;  3S9E A;  4KHZ E;  3CR9 A;  1D9Q A;  1NNF A;  4MLQ A;  2I6E A;  2GH9 A;  2ALU A;  2O84 X;  3RLF E;  2F6P A;  4U23 A;  3OO6 A;  3W9V A;  3T9X B;  2F3B A;  1MPC A;  1N7W A;  1PEB A;  4OEU A;  3KFM A;  1QGX A;  1N04 A;  1H43 A;  3C9H A;  3K0V A;  3MYU A;  5CMC A;  4DE8 A;  2HFB A;  2V3U A;  2PMS A;  2Q2A A;  5IGA A;  2XXW A;  3NOH A;  3FXQ A;  4FBP A;  1TXF A;  1NNP A;  2H25 A;  2HPG A;  4PAI A;  2Q8M A;  1USY H;  2F78 A;  3MVY A;  1Y3Q A;  4ZEB A;  2NXO A;  2H98 A;  1P1W A;  2WX9 A;  4GWZ A;  2DS9 A;  4DDD A;  5JK4 A;  4GL0 A;  4LUB A;  4YKP A;  2VPO A;  3RUM A;  1GV8 A;  1JW5 A;  1FPI A;  4PFY A;  3EQ1 A;  1HSL A;  2VGQ A;  3VDF A;  4P8B A;  4FED A;  4JSO A;  1MY0 A;  1A40 A;  2G93 A;  3H06 B;  3O6H A;  4BDL A;  1YAE A;  4MF3 A;  5A5X A;  1UTB B;  4OAN A;  5I2N B;  4OTE A;  1L5T A;  3JZJ A;  1NV5 A;  1QUL A;  4TLM B;  4X8R A;  4O94 A;  1Y4C A;  1OIB A;  2DOJ A;  3DP6 A;  3T0J A;  3B6T A;  3TTM A;  3UIF A;  4IO2 A;  4H67 A;  5ET5 A;  3LSW A;  1JNF A;  4P47 A;  2XD3 A;  1B5H A;  5FTH A;  3K1P A;  3TCF A;  2V3Q A;  4IO5 A;  2FIE A;  4O8M A;  3B50 A;  4YKI A;  3T9V A;  2Q2C A;  4DI4 B;  3FXB A;  4JB7 A;  3RYD A;  1SW4 A;  1II5 A;  4XTC Q;  5CM6 A;  1LCT A;  3RT6 B;  4BLA A;  4HTG A;  3IFA A;  1FBP A;  5FHM A;  4OZ9 A;  2O1L A;  3V5A A;  3T9U A;  4N8G A;  2FNC A;  4EXK A;  1FSA A;  2L5V A;  5H8H A;  2DWJ A;  4G8M A;  4KCD A;  1FQB A;  4TLL B;  3R26 A;  3C4M A;  3LSF B;  4H65 A;  4POX A;  3H6W A;  3GYY A;  4U4X A;  1H3D A;  3S9M C;  4Q5T A;  2DXY A;  4DXB A;  3CVG A;  4GIZ A;  4H5G A;  4MMP A;  4AB5 A;  4MEV A;  3MP8 A;  3B6W A;  2VPN A;  3SDF A;  1IMD A;  5TP9 A;  3H6U A;  2O1M A;  4NE4 A;  1B0H A;  4PDD A;  1VE4 A;  2Z22 A;  5CC2 A;  3UA8 A;  2FIX A;  5H8N B;  1FQF A;  4PFB A;  3T66 A;  4G68 C;  2FHY A;  3WAF A;  4HE1 A;  3OO7 A;  2THI A;  4XIG Q;  1BKA A;  4JVC A;  1JET A;  3IJX B;  3T93 B;  4RK2 A;  4NF5 A;  4NF4 B;  2UYE A;  3V8X B;  3EPE A;  2GQ1 A;  2ZYO A;  3G3F A;  1NUX A;  1FQA A;  2NUV A;  1MDP 1;  3GXA A;  4GQO A;  4NHB A;  5I58 B;  1R9L A;  4PET A;  4IO4 A;  5JTY A;  3DP8 A;  3S9N C;  1B0L A;  5CRY A;  3U65 A;  3IOV A;  2F7A A;  1A55 A;  2OWT A;  1HSJ A;  1OQG A;  1JEV A;  4KCC A;  4EF2 A;  2QVV A;  4IY6 A;  2MKZ A;  3K6V A;  1IXH A;  1YPN A;  3RPW A;  4E0X A;  1WVJ A;  3QXM A;  2PT1 A;  2H5Y A;  3U92 A;  1B2H A;  3TQW A;  3KOT A;  3O2A A;  2HEU A;  4OES A;  2Z23 A;  3SEV A;  4IO7 A;  5IZ1 A;  3UP9 A;  2I3W A;  2QS2 A;  5F7V A;  2P3V A;  3JV9 A;  5H8F B;  4R6H A;  1K9Z A;  5HM4 B;  4U1Z A;  1NV4 A;  2FYI A;  3VFJ A;  2A5T B;  4DXU A;  3O97 A;  1IME A;  1NNT A;  1R1N A;  3IOR A;  2XXQ A;  2F35 A;  1B32 A;  5I57 B;  4HE0 A;  4G8N A;  2WKY A;  3P7I A;  4I9D A;  2H9B A;  3O6I A;  4P9K A;  1SW2 A;  5DVF A;  1OLC A;  4OXV A;  3FVO A;  3RY3 A;  3IB0 A;  1XT8 A; 
#chains in the Genus database with same CATH homology
 1IMF A;  2Y5K A;  4G61 A;  2XWI A;  4N6K A;  4NX1 A;  1VDW A;  2CEY A;  2FVZ A;  4N8Y A;  5ET6 A;  5J1D A;  3QMF A;  2HZK A;  1FBF A;  4OVR A;  1YZ0 A;  4OVP A;  1DBZ A;  5EQ7 A;  1NUY A;  4NGU A;  5EYG A;  4MX6 A;  4F1V A;  4MJO A;  2XWO A;  4PGN A;  1NV1 A;  4PAK A;  4DI3 D;  1KZ8 A;  2PFY A;  1EYK A;  3BIG A;  1FPJ A;  1INP A;  1DK4 A;  1LBX A;  2QVR A;  2DE3 A;  4PFI A;  4IR8 A;  4P56 A;  4HCW A;  1FPG A;  1FJ9 A;  5EQA A;  1LBY A;  2DVZ A;  2PCR A;  2WYK A;  4MHF A;  4X04 A;  4GBW A;  1JP4 A;  5EQ8 A;  2XA5 A;  4YIC A;  1FPL A;  4N4U A;  4PTK A;  5I5P A;  2HZL A;  2CZK A;  2JJK A;  1FPF A;  4GWX A;  3W9W A;  1LBV A;  4N6D A;  4PDH A;  4OVS A;  4PF8 A;  1FBE A;  2FBP A;  4OA4 A;  2Q74 A;  1EYI A;  2P3N A;  4X9T A;  4I3E A;  4GX3 A;  4JVD A;  1D9Q A;  1FJ6 A;  1RDX A;  4UAB A;  1LEV A;  4GWU A;  1NV0 A;  2OWZ A;  3W9V A;  2CZI A;  2F3B A;  4AS4 A;  3PTY A;  2WYP A;  4PGP A;  1QGX A;  2OX3 A;  3ROJ A;  2QFL A;  5LDZ A;  4N17 A;  3MYU A;  2PFZ A;  4QBA A;  4I3Y A;  4XEQ A;  4JVI A;  2WEF A;  3KC0 A;  1FPB A;  2F3D A;  5IGA A;  2ZZV A;  3NOH A;  4MCO A;  4FBP A;  4QXD A;  2KR0 A;  4PF6 A;  1NUW A;  4NG7 A;  4F19 A;  2HPG A;  4MAG A;  4PAI A;  3SZP A;  2Q8M A;  3B8B A;  4GWW A;  2WX9 A;  1FBD A;  4GWZ A;  3BIH A;  3D1R A;  5JK4 A;  2VPO A;  2XWV A;  2CEX A;  1FPI A;  5T3J A;  1KA1 A;  3LV0 A;  4GX6 A;  3MST A;  4P8B A;  4PBH A;  1NV3 A;  4GWS A;  5IZ3 A;  3ISP A;  4OAN A;  3KC1 A;  2WBD A;  4HE2 A;  1NV5 A;  4MIJ A;  4X8R A;  4O94 A;  3FBP A;  3T0J A;  2VT5 A;  2R8T A;  5ET5 A;  5J16 A;  4P47 A;  3CHG A;  1IMB A;  2ZZX A;  1IMA A;  2V3Q A;  2FIE A;  4O8M A;  3B50 A;  1FPE A;  4DI4 B;  3FXB A;  3RYD A;  1EYJ A;  5CM6 A;  4LN5 A;  3IFA A;  1FBP A;  4O7M A;  4H45 A;  5I3S A;  1AWB A;  2DE4 A;  4N8G A;  1NI9 A;  1FSA A;  4XF5 A;  2L5V A;  1FRP A;  5IM2 A;  4KXP A;  4PC9 A;  3E79 A;  1K9Y A;  5EQ9 A;  4AS5 A;  4PCD A;  1FTA A;  2CZH A;  2XXK A;  4I40 A;  3IFC A;  5F24 A;  1G0I A;  3GYY A;  1XI6 A;  3LUZ A;  4P3L A;  4GX4 A;  4NAP A;  1LBW A;  2HXR A;  4PBQ A;  4M1V A;  2XWK A;  4MMP A;  5IZZ A;  4MEV A;  4N91 A;  4GBV A;  2VPN A;  4MNP A;  4YZZ A;  3E78 A;  1IMD A;  4N81 A;  2BJI A;  4PAF A;  2F5X A;  4PDD A;  4PE3 A;  4OVT A;  2Y5L A;  2FIX A;  5I7I A;  4PFB A;  1FBC A;  5ET7 A;  2FHY A;  2B4L A;  4HE1 A;  2V4C A;  5EYH A;  5ESY A;  4JVC A;  5DW8 A;  1YYZ A;  3HFU A;  4NF0 A;  1Q9D A;  5FBP A;  4HCY A;  1BK4 A;  1RDZ A;  1G0H A;  2GQ1 A;  2HHM A;  1NUX A;  2B4M A;  3T1B A;  1FPK A;  2Q9T A;  4NHB A;  4PET A;  4F18 A;  1FPD A;  4P1E A;  3U65 A;  1IMC A;  1FBH A;  1LBZ A;  2DE2 A;  2KQZ A;  4NN3 A;  4P1L A;  2QVU A;  2ZZW A;  3RPL A;  4MNC A;  3A29 A;  1NV6 A;  2QVV A;  2MKZ A;  1SPI A;  5IZ3 B;  5LTC A;  5ET8 A;  1NV7 A;  4HXV A;  1KA0 A;  4XFE A;  4NQ8 A;  5IZ1 A;  4H46 A;  1NV2 A;  4O7I A;  1YXI A;  3RPL B;  4PFR A;  2P3V A;  5A5L A;  1K9Z A;  4OVQ A;  1NV4 A;  3EKI A;  2QPQ A;  1IME A;  1NUZ A;  1DCU A;  2DDK A;  4N15 A;  4GWY A;  1FBG A;  4HE0 A;  2WBB A;  4P9K A;  1CNQ A;  1RDY A;  3KBZ A;  4F1U A;  4MNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...