3B8BA

Crystal structure of cysq from bacteroides thetaiotaomicron, a bacterial member of the inositol monophosphatase family
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
270
Chain Sequence
NLYFQSNAMAAIDAALKAGEKILSIYEDPKSDFEIADNSPLTIADRKAHEAIVAILNETPFPVLSEEGKMDYAVRRGWDTLWIVDPLDGTKEFIKRNGEFTVNIALVQNAVPVMGVIYVPVKKELYFAVEGTGAYKSGIVGLEDEGVTLQQMIEKSERMPLADARDHFIAVASRSHLTPETETYIADLKKKHGNVELISSGSSIKICLVAEGKADVYPRFAPTMEWDTAAGHAIARAAGMEVYQAGKEEPLRYNKEDLLNPWFIVEAKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of CysQ from Bacteroides thetaiotaomicron, a bacterial member of the inositol monophosphatase family.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
molecule keywords CysQ, sulfite synthesis pathway protein
total genus 77
structure length 270
sequence length 275
ec nomenclature
pdb deposition date 2007-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3b8bA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3b8bA02
2BJIA 1Q9DA 1RDYA 1FJ9A 1FPJA 2VT5A 1KZ8A 1LBYA 2P3VA 4GBVA 1G0HA 3RYDA 2CZKA 2Q8MA 1NUWA 2WEFA 5EQ9A 2R8TA 1FTAA 1NUYA 1NV1A 5EYHA 3BIGA 1KA0A 3KC1A 1NV4A 2WBBA 1INPA 1IMBA 5ET7A 1KA1A 1FPFA 5LDZA 2JJKA 2FIXA 4FBPA 4GBWA 4AS4A 2QVRA 1D9QA 1NV0A 2FHYA 1FPBA 2FIEA 1FPLA 5ET5A 5ET8A 3FBPA 1K9YA 3IFAA 3D1RA 1EYJA 4GWWA 2P3NA 5EYGA 1IMEA 3QMFA 2QVVA 5T3JA 1DCUA 3RPLB 3A29A 1FBEA 1NV7A 1YZ0A 1RDXA 1FJ6A 4KXPA 3LV0A 1NUXA 1NV6A 3B8BA 5IZ3A 1FPKA 4GWUA 2Y5KA 4IR8A 2WBDA 2QVUA 5ESYA 4HE2A 2FBPA 1FPGA 4I40A 5J16A 1FBHA 1IMFA 4PTKA 1YXIA 4H45A 1FBPA 1LBZA 4GWXA 1FPDA 4AS5A 2F3BA 4HE0A 4GX6A 4N81A 5I3SA 4GX3A 1NV5A 2PCRA 1NV3A 2F3DA 4G61A 1EYIA 1FBGA 1LEVA 2HHMA 2OWZA 2Q74A 1LBWA 1FRPA 3LUZA 4GWZA 5EQ7A 3KC0A 3ROJA 1FBFA 4GWYA 1FPIA 2CZHA 1FBDA 1K9ZA 1QGXA 5IZ3B 5DW8A 2Y5LA 1NUZA 4H46A 1XI6A 1VDWA 1LBVA 5IZ1A 1RDZA 1EYKA 1FBCA 4HE1A 3KBZA 1FPEA 4GWSA 1NV2A 4MJOA 4O7IA 2DDKA 5EQ8A 3T0JA 5ET6A 1DBZA 1NI9A 2QFLA 4QXDA 5EQAA 5FBPA 5F24A 1IMCA 1CNQA 1LBXA 4GX4A 2OX3A 3IFCA 4HXVA 1IMDA 1DK4A 4I3YA 5A5LA 1G0IA 2GQ1A 1JP4A 2FVZA 4I3EA 3BIHA 1YYZA 1IMAA 1SPIA 3RPLA 1FSAA 2CZIA 1BK4A 1AWBA
chains in the Genus database with same CATH superfamily
1ZMGA 1MQJA 1FQCA 2H9BA 3O29A 4ELOA 4F3BA 1RYOA 3EHUA 4GXAA 2I4BA 3FXUA 4DI4B 4F19A 2QS2A 4Z7EA 2CZKA 1USYE 4ZEDA 1II5A 2R8TA 2V4CA 5DEXB 1GGGA 4P47A 1KA1A 3LBSA 4GBWA 1PB7A 3DELB 3HCQA 4MIJA 1QJMA 4RY1A 1DCUA 3RPLB 3PMVA 1MXVA 1URSA 2ZYNA 3SEYA 3TPAA 4DCYA 4GOTA 5ESYA 1LFIA 3HN0A 1YXIA 1FBPA 2X7QA 5JEIA 1SBPA 3O2AA 4GRKA 3IL1B 2V84A 1FBGA 1FQEA 3RGYA 4PBHA 5EYFA 3LUZA 1Y9UA 3V83A 5CMBA 1ZBMA 2F36A 2B65A 4GF8A 3SEVA 2XHDA 1S9TA 1OVTA 4EUOA 2B3FA 1B7UA 2HXRA 4OEVA 4P1LA 2DOJA 3G3KA 5L8DA 2OWSA 1ZLQA 4QXDA 5TP9B 4MFIA 3QXMA 1P1NA 1LLSA 4NF4A 3MJNA 5I59B 4NE4A 4I62A 1B1HA 3A09A 2HEUA 4JDFA 2F7CA 1RDYA 1NMUA 3TTNA 3QUJA 4P8BA 2ZNSA 4DZ1A 3USDA 1BKAA 1O63A 1NUYA 5EYHA 3VLVA 1KA0A 5LDZA 1FPFA 2GFEA 1NV0A 2O1LA 3FBPA 1CB6A 4POXA 5ICTA 1P1WA 1MY3A 1MY0A 3DM0A 3VLUA 2NOOA 3BKIB 2E0SA 2VGQA 5KCJB 4QSDA 1UTBB 5CI5A 5K2YA 3CHGA 4RJZA 3FATA 3MP8A 3DP6A 2I48A 4C0RA 3SKPA 3FVNA 2OWZA 1B3GA 2XX9A 4U1OA 4KCCA 2DE2A 5JTYB 2Y5LA 1NUZA 2XWIA 2OPDA 1D9VA 5IAIA 2O69A 3TELA 4IY6A 4JWOA 5I2NB 3H6TA 1H44A 1OIBA 1B51A 1Y20A 3MZBA 4IO4A 5EHMA 2Y7WA 3RPWA 4GX4A 4QBAA 2PVUA 4P0IA 2DS9A 4O3BA 3G7WA 3IOWA 3VVFA 2ZNUA 3FV1A 4JVCA 2CZIA 1JETA 4NN3A 4F2OA 2XXTA 3GZGA 2XA5A 1LBCA 3GBAA 3E13X 5I58A 3MP6A 3K6XA 4P11A 3BBRA 2H4IA 4X9TA 4X04A 4YKIA 2V3QA 1OQGA 4PF6A 4LQ5A 3RT8A 4N15A 1NV1A 4KD5A 2GRVA 2RCAA 1VFDA 2R6GE 1GV8A 2DXRA 1I6AA 3K2DA 4N17A 4XFEA 5HPQA 2XXUA 1M5EA 1PC3A 4HCYA 1A54A 3PPOA 4DE8A 3T66A 3TCFA 4PFIA 1B4HA 4UABA 4H67A 5IZ3A 1NUXA 3O97A 3GYYA 4RA1A 3CSGA 3C4MA 1B5IA 3CVGA 3K6UA 1M5FA 3N94A 2PMSA 2HXWA 2F3BA 3WAFA 3FJMA 5I3SA 1BLFA 5B7DA 1EYIA 4NF4B 4N8YA 1NNTA 2QJEA 1Y4CA 1SDXA 3SZPA 4EF1A 3AXFA 3K6WA 5IZ3B 5H8HB 4DXUA 4UACA 4OFOA 1URDA 4KI0E 1TWYA 4YMBA 2OLBA 2OWTA 1IMCA 3UK4A 2I58A 1Y4TA 1ATGA 1O64A 4WEDA 5BUUA 5I58B 4QFLA 3ZKKA 2HZLA 3TTMA 4WEPA 3HFUA 5J1DA 3B6TA 4IGRA 1Q9DA 2I6EA 3KGCA 2HAVA 4NG7A 3T22A 1BTJA 2B4LA 5CMMA 2UVHA 5H8QA 4G68B 1PB8A 2ZNTA 3KZGA 5F1QA 3R26A 2WEFA 4P9KA 4PFBA 1A7LA 3BFUA 1TFDA 4F29A 2FIXA 1NH8A 4Q30B 3MW0A 3MUQA 3OSRA 4NWDA 3CR9A 4GWWA 5IZZA 4MEVA 3QMFA 2XXYA 4N07A 2YJPA 2DYXA 1NV6A 1USYH 2P0SA 3OO6A 4O8MA 4JXIA 3MVWA 3CRBA 1NNFA 3FXBA 4G68A 4JWYA 1VE4A 1XC1A 5DVFA 2AL5A 1US5A 4NWCA 4G61A 1LEVA 3EHSA 4QHQA 5DVIA 4KFQA 2RF1A 1FBFA 1MY2A 1MY1A 4U22A 2V3UA 2UVJA 3DP8A 4FEBA 1NNKA 2X7PA 4O3AA 2ZYKA 5DTBA 4TLLB 2R9JA 1N76A 3RQTA 3JV9A 2DE3A 4EXLA 3VLWA 1POY1 4R9FA 3Q26A 4PBQA 3IJXB 4XEQA 2WYPA 5KDTA 1FQDA 1SQYA 3EQ1A 3UORA 3U93A 4OETA 2HQ0A 4OVSA 4ONYA 1O7TA 1ZKBA 3E79A 4PCDA 1A99A 1NH7A 4GWOA 2M8CA 1N7XA 3FJ7A 1JQFA 1KZ8A 3TODA 3JYRA 4LUBA 3SEXA 1B3FA 4G8HA 4U21A 2VPNA 1Y1ZA 2Q8JA 1Q35A 1IMBA 2D3IA 2RKMA 5FTHA 5I56A 4O94A 3V5AA 3EKIA 1FPLA 2ANJA 1K9YA 4PDDA 4RPOA 3C31A 3KG2A 3O28A 3B8BA 1FTLA 4PAIA 1FPKA 3UIFA 3GXAA 3TMGA 3K02A 2DWJA 2H25A 3H03A 4I40A 1RKMA 3E9XA 4YAHX 5I57B 3RT6B 4NF5B 4MNCA 2Q88A 1MQDA 1PEBA 4R72A 3Q27A 3LSLA 4XIGQ 4PC9A 4MNPA 3T9VA 3TDJA 3LSXA 3ZS6A 3D4GA 3I6VA 3QYTA 4DXCA 2RC7A 5EQ7A 1IXIA 1P1QA 5LTCA 3S4UA 2UVIA 1NL5A 3KBRA 5IZ1A 3FV2A 3OEKA 1WODA 4PP0A 1HSJA 4JSOA 3HHGA 3UA8A 3BFTA 5EQAA 1XT8A 3H3GA 4AB5A 4OESA 3M3FA 1IQ7A 1OLAA 1OVBA 2DQVA 4TOZA 3RPLA 3DP4A 1FSAA 3K4UA 1SYIA 5HBCA 4K3FA 4BDLA 3O9PA 3MYUA 3T1BA 2GHAA 4GL0A 3CSBA 4H5GA 4GD5A 4MF3A 4R9GA 1B52A 3ISPA 3ZSFA 4MNIA 1WDNA 3BIGA 1MPBA 1ZIUA 5CM6A 4JBZA 2XXPA 3TYHA 1MDP1 4OVQA 1B3HA 1N7WA 4E0XA 5T3JA 3FXQA 1NFTA 1NV7A 2Y7KA 1A40A 4IR8A 4R6HA 1D9YA 4OYVA 1UTHB 2XXVA 2VP1A 5TP9A 3IO6A 2XXRA 4OVJA 1JW5A 1R1NA 3IOUA 1B40A 3I5OA 1N0TA 4Z0IA 2Q74A 1AL3A 3UN6A 4DCXA 1B32A 1DSNA 3HV1A 3ECRA 4IO2A 1FTOA 3RNNA 4ZECA 4X1BA 3KN7A 3S9EA 3FVOA 1LAXA 1XVXA 4N6DA 2Z8FA 4GWSA 4MJOA 1NV2A 2HPGA 4H8IA 5F24A 2REGA 3TCHA 5AE4A 1KWHA 2A5SA 4OHNA 2GQ1A 2DE4A 5TPAA 2FVZA 2ZYOA 4PGPA 1HSEA 2Y84A 1AWBA 3U1OA 1LB9A 1EZ9A 3VDFA 1F9BA 1MPCA 1YCJA 4PFWA 4XKPA 5I59A 4ZS9A 2KQZA 3KJ7A 3OO8A 3OO7A 2OJTA 2O6AA 2PFYA 3PUZE 2F35A 1I6BA 5I7IA 4PFRA 2DSFA 3QIMA 2LAOA 4NF0A 1B58A 1DPEA 1SW1A 2H99A 3A29A 3G3GA 3MQ9A 1Y3PA 4QFNA 1NNPA 2I3WA 3ONMA 3H6VA 4QFPA 5J16A 1EH3A 3E4RA 1FPDA 4YKPA 1LGBC 1B7HA 1IEJA 3U8QA 3VFJA 3GLBA 2R71A 1LBWA 4GWZA 3L6GA 4Q5TA 1QULA 4MH5A 5L9MA 3KC0A 1SYHA 5AA2A 2ABHA 2B4MA 4OENA 1MPDA 2AL4A 1JW4A 2F8DA 3PUXE 2OZZA 3MVYA 3M3KA 4OERA 5CC2A 1D3KA 3N5LA 2O68A 1AIVA 3EN3A 4KCDA 1DBZA 4O7MA 2QFLA 3TUSA 1CNQA 4PETA 1LBXA 3KOSA 5H8NA 4U23A 4NMYA 1QW0A 2DP8A 3H06B 2ONKE 3N6UA 1UTHA 2QS3A 4LATA 2NVUB 1FQFA 3Q29A 2D5WA 1EU8A 4KR5A 3KEIA 2OK2A 2XXQA 3W9WA 1B4ZA 3B7DA 4ZEFA 3E78A 2VPOA 1G0HA 5LOMA 1NUWA 3UP9A 3O6GA 2RCBA 2Q9TA 2PX1A 1MXWA 4OXVA 1Q1KA 1EZPA 2DWAA 5ET8A 4ZZAA 3D1RA 4R74A 5H8HA 1D4NA 4NGUA 4PQJA 5JTYA 2Y7PA 2NWJA 2Y5KA 1UIUA 2F7BA 5CBRA 3U94A 1OLCA 2WBDA 2HFBA 4H1XA 3OD7A 3PTYA 1FBHA 4PTKA 2HCAA 5TU0A 1ZJLA 4OEUA 1B0LA 4OQOA 2F3DA 5HM4B 2FYIA 1MM7A 3C36A 4NF8A 3IAZA 3K1PA 3HHFA 1MXXA 3FGSA 4IO3A 1FBDA 1K9ZA 4F3GA 5BWJA 3FVGA 4OZ9A 3KSJA 1LBVA 1L5TA 5CBSA 3K1MA 3TQWA 2XX8A 4PAFA 4HCWA 1B7ZA 3OSQA 3C33A 3D4CA 5FHMA 1IXGA 1YAEA 4XTCQ 4R6KA 2XWVA 4FIMA 4ECFA 4I3EA 3JZJA 1IMAA 5H8FA 3VVDA 1AMFA 4IY5A 2BJIA 1N84A 4FORA 3MZ1A 5TPAB 4R75A 4AQ4A 3OELA 4JVIA 4QF9A 4TQUQ 4NF6A 3TCGA 3RN8A 1FTAA 1POTA 2F6GA 1JVXA 4IB2A 4OANA 1SVXB 4P0GA 3I3VA 5AA2B 4F1UA 2F5XA 3T96B 2QVRA 1D9QA 1M5CA 1FTJA 3W9VA 3CI8A 1YTVA 1EYJA 2HZKA 4BDNA 2XD3A 4KXPA 2GH9A 4BDOA 2PYYA 3TEPA 4NTLA 4OMBA 2B3BA 2NUVA 1JEVA 2UYEA 5IM2A 4EQBA 1FPGA 3TTRA 1MQHA 1UTBA 1JEUA 4EF2A 2V25A 4QFOA 4HW8A 5DYHA 4H5FA 3MBPA 3MVZA 1DPPA 2FA7A 4H46A 1PB9A 3EF7A 3WAEA 4WKMA 4NAPA 1MXZA 3CFLA 3G3IA 4JWXA 4QRZA 3B6WA 2ONRA 3A3CA 2P2AA 4XXUA 3A3UA 4F1VA 1UIVA 1MH3A 5AA1A 3ZKLA 1Y1MA 1DK4A 2Q89A 1Z7ME 4EDPA 4OFJA 1BP5A 5AA3A 2XXKA 1I6QA 3CIJA 5H8FB 4F22A 5KDTB 4PGNA 2VT5A 3B6QA 1LBYA 2P3VA 4GBVA 3CFXA 3H4ZA 4R2FA 5EQ9A 4NQ8A 3IOVA 2Z22A 2O84X 1NV4A 4OVTA 3P7IA 2RC8A 2FHYA 2OPEA 2FIEA 3TAJA 2P3NA 3RTWB 1IMEA 1MH4A 1MDQA 1QUIA 3OXNA 4TLMB 5ITPA 4UA8A 3C9HA 4IGTA 1IMFA 3MP1A 3MSTA 2L5VA 3THIA 4AS5A 1A8FA 2Y7IA 2ESNA 1NV5A 5KCJA 4OA4A 1B5HA 2UXAA 4P3LA 2CEYA 3QSLA 3QK6A 4G68C 5L9SA 1LAGE 1VR5A 1FPIA 3RY3A 3RUMA 4IO7A 1HSLA 3S9NC 5I2KA 1DTGA 5FBPA 2Z8EA 3IFCA 3HPIA 5AA2D 2ZZVA 5EHSA 4THIA 1P1OA 4G8NA 3N6TA 2VD3A 4H8JA 4DLDA 1BK4A 4LONB 1IXHA 4G4PA 4IO5A 4MLQA 4P56A 4YZZA 3LSWA 1N04A 3RYDA 1PDAA 1S7YA 3S9MC 4KQPA 1LCFA 3KC1A 4RPNA 3SETA 2F78A 2OCUA 2PBWA 4FBPA 4N13A 1QUJA 1MXYA 4ESXA 3SEUA 5ET5A 3FD3A 3PPRA 5DEXA 1FBEA 1YZ0A 3KSXA 3O66A 4RXLA 2UYFA 4XKQA 4RYAA 3K01A 5ITOA 5I84A 1MQIA 4HE2A 2FBPA 4PFUA 2CZLA 2I3VA 2PFZA 1LBZA 4FECA 1ELJA 4N81A 2F6PA 4LZ8A 4FAJA 1ANFA 2PCRA 1BIYA 1GTKA 3KFMA 4POWA 4R6YA 2IA4A 5I2KB 2CZHA 4C1UA 1QGXA 3C35A 4ELRA 3PGFA 4U4XA 1H43A 3MC2A 3M3LA 2XWKA 3ODBA 2DWIA 2QL3A 5H8SA 5EQ8A 2DDKA 1GR2A 4H65A 1M5DA 1A8EA 3VE1B 5M2VA 1FQAA 4I3YA 2A5TB 3G3HA 2DVCA 1LSTA 3MWBA 3OENA 3RLFE 4ZE9A 2QSXA 4OVPA 4GL8A 3T9HB 1B46A 4F39A 2ZZXA 1FPJA 3OMBA 3PPNA 2THIA 5B70A 4HTGA 4IO6A 1R9QA 1LFHA 4LP2B 4EQ9A 3CG3A 2Q8MA 3MZ9A 4N8GA 1B2HA 2W7YA 1FTKA 4BDRA 1XVYA 3C34A 2VD2A 3FZVA 1H3DA 4BDQA 4AS4A 4N91A 4QSEA 4YICA 4FATA 5EYGA 3IOTA 3IK6B 4XKRA 5CMCA 1WVJA 1LAFE 1OQHA 2I0BA 4GWXA 3IORA 4DXBA 2ONSA 1NV3A 3CG1A 4LZ7A 3FUZA 2XWOA 3LSFB 1R6ZA 4PF8A 1FRPA 1SW4A 1M5BA 1US4A 2FNCA 4KPTA 4KYEA 1XI6A 3SDFA 1T0KA 4YB7A 4F3PA 4ESWA 4G2ZA 5A5XA 1SD3A 4F3SA 1R9LA 4YB6A 3PUYE 4C1TA 4RNSA 2KLFA 4ND9A 1A55A 4DDDA 2KR0A 2REJA 4MCOA 4JVDA 2H98A 2RC9A 4ZE8A 2VHAA 3IB1A 1QKBA 1SI1A 4MBPA 4F31B 3VV5A 2ZXTA 1GVCA 5A5XB 2Q2CA 1Y3QA 3IB0A 1B9JA 2I0CA 1IXCA 1SW5A 1SW2A 3V8XB 1ZTYA 2PT2A 2JJKA 2O1MA 4NF6B 3N26A 2G93A 4G77A 1JNFA 3C32A 2X26A 3UGWA 4NF5A 4E0WA 1FJ6A 4YB5A 1P99A 3DLNA 5ISUA 2AIXA 2WKYA 2XD2A 3CFZA 4GX6A 3B50A 4GX3A 3H7MA 5FHNA 1IUDA 3QAXA 5I56B 4PE5B 5K2XA 2A5TA 4M4GA 1RYXA 1LAHE 5H8NB 3ROJA 3Q25A 4PFYA 4GWYA 4DI3D 2DVZA 3TTLA 4L17A 1B05A 3HO7A 4X48A 2Y7RA 3NOHA 4PFTA 4ZEKA 3F11A 1MQGA 4LA9A 4R2BA 3IX1A 3PD9A 1N3XA 2I49A 3QUFA 4O7IA 1FPEA 4FJPA 4GLIA 4MX6A 3SEWA 4GQOA 1IMDA 2QRYA 2XXIA 5A5LA 2GHBA 3O6HA 4MAGA 1MS7A 4FE8A 2YPNA 1SPIA 1UQWA 2F97A 2QMWA 3KN3A 2CMOA 1B3LA 4X8RA 1S50A 1LCTA 3TTKA 1P1UA 1XOCA 1QVSA 5I2NA 1QKAA 2ZZWA 1OMPA 3L6HA 2MKZA 3MAMA 5DVJA 4Q8RA 5ET7A 3SERA 1B0HA 2NXOA 3FJGA 1ZU0A 3PMWA 2DXYA 5JK4A 3PV0E 1QUKA 2OBGA 1RDXA 4ZZEA 1TFAA 4GFRA 5H8QB 2QVUA 2P1SA 2UVGA 4F2QA 2ZMBA 2QS4A 1Z7NE 4H45A 4P1EA 3V89B 4HE0A 2F34A 3IB2A 3E3KA 1N3WA 2HHMA 1JW1A 3PMXA 4F1YA 1FTMA 1PBQA 3FIRA 3PU5A 4MLVA 1FCKA 3ILTB 4U1ZA 1DTZA 5AA4A 1VFEA 4JB7A 1MRPA 1MXUA 5CMKA 1DMBA 3LC8A 4YKKA 3VXBA 3ILUB 2Z8DA 3H6UA 4FEDA 1EYKA 1I69A 3W15C 4HE1A 3OO9A 1TXFA 3T0JA 1NI9A 3PPPA 2QS1A 2RINA 4R73A 3TQLA 3R7XA 2D21A 3MPKA 4PAKA 1FW0A 1G0IA 1JP4A 2XXWA 4N4UA 4MMPA 1MY4A 2F7AA 2H5YA 1B3EA 3LUYA 4GVOA 4U4SA 3KJTA 1FJ9A 1NKXA 4LVQA 2V3TA 4PE3A 3FXRA 3T9XB 2PT1A 4EQ7A 4KHZE 3FASA 3O6IA 4ISUA 4RK9A 4NHBA 2WBBA 1INPA 3G3JA 1Y3NA 2Q2AA 3KN8A 3S2VA 1PBPA 3OEMA 3KOTA 1MM6A 4BLAA 3IFAA 4EXKA 3LR1A 4PDHA 2I4CA 2O51A 5IKBA 2O7UA 1IIWA 1XS5A 1H45A 3U72A 5ELVA 4OVRA 2ZYMA 4MHFA 1DOTA 1EZOA 2QMXA 3FVKA 4N6PA 3K1NA 4GIZA 4ZEBA 2QPQA 2XXXA 3T9UA 4YMAA 2YLNA 4GXSB 2Z23A 4Q0CA 5FTIA 4M1VA 3HSTA 1AH5A 4YU0A 3Q28A 1J1NA 3TZAA 4LN5A 4AB6A 3S9LC 2WX9A 5I5PA 1B1XA 1TT1A 5ICQA 3EPEA 3PD8A 3G3FA 5AA4B 4KYDA 5IGAA 1CE2A 3IO4A 3TFLA 4ELPA 2WYKA 3KBZA 4I8CA 3K6VA 5ET6A 3IJOB 5F7VA 4F18A 4I1DA 3RTFB 2BJJX 2E1SA 3PUVE 4H6DA 4ZEIA 4G8MA 3K00A 2V93A 4WXJA 2VOZA 3PUWE 4JSDA 4NEDA 3U65A 1XHYA 3R6UA 1JVYA 3VXCA 2CEXA 4XKNA 4BDMA 1AOVA 5L9OA 4H0WA 3MPLA 4LZ5A 3T93B 3K0VA 4QFKA 1LFGA 1FQBA 3H6WA 3U92A 1B6HA 4ZDMA 2XX7A 1FPBA 4HS7A 4XF5A 3GBBA 2HAUA 2QVVA 1MG1A 5I57A 4OWDA 2DWHA 3LV0A 4GWUA 1IZ1A 5FHOA 3VVEA 3MVXA 2O7IA 4OTEA 2IEEA 4X1DA 1YPNA 5KZTA 1IITA 1SI0A 1LB8A 4KYSA 3EHTA 3SESA 3TKDA 1B5JA 4RK2A 1H76A 4NX1A 3M8UA 3PPQA 4I9DA 3IR1A 4U2RA 5DW8A 4QSCA 5CRYA 1VDWA 4DIGA 1RDZA 4OFLA 1VSOA 1FBCA 4O3CA 1LBBA 4N6KA 2XXHA 2AYSA 4LQ2A 2OX3A 2ALUA 3OOAA 4HXVA 4NF8B 3BIHA 1YYZA 1URGA 2G29A 4YKJA 4ELQA 5DT6A
chains in the Genus database with same CATH topology
3E79A 2BJIA 2XA5A 4OVPA 4P56A 4YZZA 1Q9DA 4X8RA 3U65A 4PCDA 4NG7A 1RDYA 2B4LA 3MYUA 1FJ9A 2ZZXA 1FPJA 3T1BA 4PGNA 2VT5A 4P8BA 4DI4B 1KZ8A 4F19A 1LBYA 2P3VA 3W9WA 4PE3A 2CEXA 2KQZA 4X9TA 4JVIA 3E78A 4GBVA 2VPOA 1G0HA 3RYDA 2CZKA 4X04A 2Q8MA 1NUWA 2WEFA 2V3QA 4PF6A 2ZZWA 5EQ9A 3ISPA 4MNIA 4NQ8A 2R8TA 4N15A 2PFYA 4N8GA 4P9KA 1FTAA 1NUYA 1NV1A 5EYHA 2MKZA 2V4CA 2VPNA 3BIGA 2Q9TA 4OANA 1KA0A 4PFBA 3KC1A 4NHBA 4P47A 1NV4A 2WBBA 1INPA 1IMBA 5ET7A 1KA1A 1FPFA 5LDZA 4OVTA 5CM6A 2JJKA 4F1UA 2F5XA 2FIXA 4FBPA 4GBWA 4AS4A 4O94A 5I7IA 2QVRA 4N17A 4PFRA 4XFEA 4N91A 1D9QA 3EKIA 1NV0A 2FHYA 1FPBA 3W9VA 4OVQA 2FIEA 1FPLA 5ET5A 5ET8A 3FBPA 1K9YA 3IFAA 4HCYA 4MIJA 4NF0A 3D1RA 4PDHA 1EYJA 4GWWA 2P3NA 5EYGA 2HZKA 4MEVA 1IMEA 3QMFA 2QVVA 5T3JA 1DCUA 3RPLB 4NGUA 3A29A 1FBEA 4PFIA 1NV7A 1YZ0A 1RDXA 1FJ6A 4KXPA 4UABA 3LV0A 1NUXA 1NV6A 3B8BA 5IZ3A 4OVRA 4PAIA 1FPKA 4MHFA 4GWUA 4O8MA 2Y5KA 3GYYA 4IR8A 2WBDA 2QVUA 3FXBA 3PTYA 5ESYA 4HE2A 2FBPA 5IM2A 1FPGA 4I40A 5J16A 1FBHA 1IMFA 4PTKA 3CHGA 3MSTA 1YXIA 4H45A 1FBPA 2PFZA 1LBZA 4P1EA 2L5VA 4MNCA 4GWXA 1FPDA 2QPQA 4AS5A 2F3BA 4HE0A 4GX6A 4N81A 5I3SA 3B50A 4GX3A 1NV5A 2PCRA 1NV3A 2F3DA 4G61A 1EYIA 1FBGA 1LEVA 4PBHA 4MNPA 4OA4A 2HHMA 2XWOA 4PC9A 2OWZA 4PF8A 2Q74A 1LBWA 1FRPA 3LUZA 4GWZA 4M1VA 4N8YA 2CEYA 4P3LA 5IZZA 4NX1A 5EQ7A 3KC0A 3ROJA 1FBFA 4GWYA 4LN5A 4DI3D 1FPIA 2DVZA 4PDDA 2CZHA 1FBDA 3SZPA 1K9ZA 1QGXA 2DE2A 5IZ3B 5DW8A 2WX9A 5I5PA 2Y5LA 2B4MA 1NUZA 2XWIA 3NOHA 5LTCA 2HXRA 4P1LA 4H46A 1XI6A 1VDWA 1LBVA 5IZ1A 1RDZA 4NAPA 2XWKA 5IGAA 4YICA 1EYKA 4N6DA 4PAFA 4HCWA 1FBCA 4HE1A 2WYKA 3KBZA 1FPEA 4GWSA 1NV2A 4MJOA 4O7IA 2DDKA 5EQ8A 3T0JA 5ET6A 1DBZA 1NI9A 2QFLA 4O7MA 4QXDA 5EQAA 2HPGA 5FBPA 5F24A 4N6KA 4MX6A 4F18A 1IMCA 2XWVA 4F1VA 1CNQA 4PETA 1LBXA 4GX4A 2OX3A 2DE3A 3IFCA 4HXVA 1IMDA 4QBAA 4XF5A 2ZZVA 1DK4A 4I3YA 4PAKA 5A5LA 1G0IA 2GQ1A 2DE4A 1JP4A 2FVZA 4MAGA 4PBQA 4I3EA 4XEQA 5JK4A 3BIHA 2WYPA 4PGPA 1YYZA 4JVCA 1IMAA 1SPIA 3RPLA 2KR0A 4N4UA 4MCOA 1FSAA 2HZLA 4JVDA 2CZIA 4MMPA 4NN3A 3HFUA 4OVSA 5J1DA 1BK4A 1AWBA 2XXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJI A;  1Q9D A;  1RDY A;  1FJ9 A;  1FPJ A;  2VT5 A;  1KZ8 A;  1LBY A;  2P3V A;  4GBV A;  1G0H A;  3RYD A;  2CZK A;  2Q8M A;  1NUW A;  2WEF A;  5EQ9 A;  2R8T A;  1FTA A;  1NUY A;  1NV1 A;  5EYH A;  3BIG A;  1KA0 A;  3KC1 A;  1NV4 A;  2WBB A;  1INP A;  1IMB A;  5ET7 A;  1KA1 A;  1FPF A;  5LDZ A;  2JJK A;  2FIX A;  4FBP A;  4GBW A;  4AS4 A;  2QVR A;  1D9Q A;  1NV0 A;  2FHY A;  1FPB A;  2FIE A;  1FPL A;  5ET5 A;  5ET8 A;  3FBP A;  1K9Y A;  3IFA A;  3D1R A;  1EYJ A;  4GWW A;  2P3N A;  5EYG A;  1IME A;  3QMF A;  2QVV A;  5T3J A;  1DCU A;  3RPL B;  3A29 A;  1FBE A;  1NV7 A;  1YZ0 A;  1RDX A;  1FJ6 A;  4KXP A;  3LV0 A;  1NUX A;  1NV6 A;  3B8B A;  5IZ3 A;  1FPK A;  4GWU A;  2Y5K A;  4IR8 A;  2WBD A;  2QVU A;  5ESY A;  4HE2 A;  2FBP A;  1FPG A;  4I40 A;  5J16 A;  1FBH A;  1IMF A;  4PTK A;  1YXI A;  4H45 A;  1FBP A;  1LBZ A;  4GWX A;  1FPD A;  4AS5 A;  2F3B A;  4HE0 A;  4GX6 A;  4N81 A;  5I3S A;  4GX3 A;  1NV5 A;  2PCR A;  1NV3 A;  2F3D A;  4G61 A;  1EYI A;  1FBG A;  1LEV A;  2HHM A;  2OWZ A;  2Q74 A;  1LBW A;  1FRP A;  3LUZ A;  4GWZ A;  5EQ7 A;  3KC0 A;  3ROJ A;  1FBF A;  4GWY A;  1FPI A;  2CZH A;  1FBD A;  1K9Z A;  1QGX A;  5IZ3 B;  5DW8 A;  2Y5L A;  1NUZ A;  4H46 A;  1XI6 A;  1VDW A;  1LBV A;  5IZ1 A;  1RDZ A;  1EYK A;  1FBC A;  4HE1 A;  3KBZ A;  1FPE A;  4GWS A;  1NV2 A;  4MJO A;  4O7I A;  2DDK A;  5EQ8 A;  3T0J A;  5ET6 A;  1DBZ A;  1NI9 A;  2QFL A;  4QXD A;  5EQA A;  5FBP A;  5F24 A;  1IMC A;  1CNQ A;  1LBX A;  4GX4 A;  2OX3 A;  3IFC A;  4HXV A;  1IMD A;  1DK4 A;  4I3Y A;  5A5L A;  1G0I A;  2GQ1 A;  1JP4 A;  2FVZ A;  4I3E A;  3BIH A;  1YYZ A;  1IMA A;  1SPI A;  3RPL A;  1FSA A;  2CZI A;  1BK4 A;  1AWB A; 
#chains in the Genus database with same CATH topology
 1ZMG A;  1MQJ A;  1FQC A;  2H9B A;  3O29 A;  4ELO A;  4F3B A;  1RYO A;  3EHU A;  4GXA A;  2I4B A;  3FXU A;  4DI4 B;  4F19 A;  2QS2 A;  4Z7E A;  2CZK A;  1USY E;  4ZED A;  1II5 A;  2R8T A;  2V4C A;  5DEX B;  1GGG A;  4P47 A;  1KA1 A;  3LBS A;  4GBW A;  1PB7 A;  3DEL B;  3HCQ A;  4MIJ A;  1QJM A;  4RY1 A;  1DCU A;  3RPL B;  3PMV A;  1MXV A;  1URS A;  2ZYN A;  3SEY A;  3TPA A;  4DCY A;  4GOT A;  5ESY A;  1LFI A;  3HN0 A;  1YXI A;  1FBP A;  2X7Q A;  5JEI A;  1SBP A;  3O2A A;  4GRK A;  3IL1 B;  2V84 A;  1FBG A;  1FQE A;  3RGY A;  4PBH A;  5EYF A;  3LUZ A;  1Y9U A;  3V83 A;  5CMB A;  1ZBM A;  2F36 A;  2B65 A;  4GF8 A;  3SEV A;  2XHD A;  1S9T A;  1OVT A;  4EUO A;  2B3F A;  1B7U A;  2HXR A;  4OEV A;  4P1L A;  2DOJ A;  3G3K A;  5L8D A;  2OWS A;  1ZLQ A;  4QXD A;  5TP9 B;  4MFI A;  3QXM A;  1P1N A;  1LLS A;  4NF4 A;  3MJN A;  5I59 B;  4NE4 A;  4I62 A;  1B1H A;  3A09 A;  2HEU A;  4JDF A;  2F7C A;  1RDY A;  1NMU A;  3TTN A;  3QUJ A;  4P8B A;  2ZNS A;  4DZ1 A;  3USD A;  1BKA A;  1O63 A;  1NUY A;  5EYH A;  3VLV A;  1KA0 A;  5LDZ A;  1FPF A;  2GFE A;  1NV0 A;  2O1L A;  3FBP A;  1CB6 A;  4POX A;  5ICT A;  1P1W A;  1MY3 A;  1MY0 A;  3DM0 A;  3VLU A;  2NOO A;  3BKI B;  2E0S A;  2VGQ A;  5KCJ B;  4QSD A;  1UTB B;  5CI5 A;  5K2Y A;  3CHG A;  4RJZ A;  3FAT A;  3MP8 A;  3DP6 A;  2I48 A;  4C0R A;  3SKP A;  3FVN A;  2OWZ A;  1B3G A;  2XX9 A;  4U1O A;  4KCC A;  2DE2 A;  5JTY B;  2Y5L A;  1NUZ A;  2XWI A;  2OPD A;  1D9V A;  5IAI A;  2O69 A;  3TEL A;  4IY6 A;  4JWO A;  5I2N B;  3H6T A;  1H44 A;  1OIB A;  1B51 A;  1Y20 A;  3MZB A;  4IO4 A;  5EHM A;  2Y7W A;  3RPW A;  4GX4 A;  4QBA A;  2PVU A;  4P0I A;  2DS9 A;  4O3B A;  3G7W A;  3IOW A;  3VVF A;  2ZNU A;  3FV1 A;  4JVC A;  2CZI A;  1JET A;  4NN3 A;  4F2O A;  2XXT A;  3GZG A;  2XA5 A;  1LBC A;  3GBA A;  3E13 X;  5I58 A;  3MP6 A;  3K6X A;  4P11 A;  3BBR A;  2H4I A;  4X9T A;  4X04 A;  4YKI A;  2V3Q A;  1OQG A;  4PF6 A;  4LQ5 A;  3RT8 A;  4N15 A;  1NV1 A;  4KD5 A;  2GRV A;  2RCA A;  1VFD A;  2R6G E;  1GV8 A;  2DXR A;  1I6A A;  3K2D A;  4N17 A;  4XFE A;  5HPQ A;  2XXU A;  1M5E A;  1PC3 A;  4HCY A;  1A54 A;  3PPO A;  4DE8 A;  3T66 A;  3TCF A;  4PFI A;  1B4H A;  4UAB A;  4H67 A;  5IZ3 A;  1NUX A;  3O97 A;  3GYY A;  4RA1 A;  3CSG A;  3C4M A;  1B5I A;  3CVG A;  3K6U A;  1M5F A;  3N94 A;  2PMS A;  2HXW A;  2F3B A;  3WAF A;  3FJM A;  5I3S A;  1BLF A;  5B7D A;  1EYI A;  4NF4 B;  4N8Y A;  1NNT A;  2QJE A;  1Y4C A;  1SDX A;  3SZP A;  4EF1 A;  3AXF A;  3K6W A;  5IZ3 B;  5H8H B;  4DXU A;  4UAC A;  4OFO A;  1URD A;  4KI0 E;  1TWY A;  4YMB A;  2OLB A;  2OWT A;  1IMC A;  3UK4 A;  2I58 A;  1Y4T A;  1ATG A;  1O64 A;  4WED A;  5BUU A;  5I58 B;  4QFL A;  3ZKK A;  2HZL A;  3TTM A;  4WEP A;  3HFU A;  5J1D A;  3B6T A;  4IGR A;  1Q9D A;  2I6E A;  3KGC A;  2HAV A;  4NG7 A;  3T22 A;  1BTJ A;  2B4L A;  5CMM A;  2UVH A;  5H8Q A;  4G68 B;  1PB8 A;  2ZNT A;  3KZG A;  5F1Q A;  3R26 A;  2WEF A;  4P9K A;  4PFB A;  1A7L A;  3BFU A;  1TFD A;  4F29 A;  2FIX A;  1NH8 A;  4Q30 B;  3MW0 A;  3MUQ A;  3OSR A;  4NWD A;  3CR9 A;  4GWW A;  5IZZ A;  4MEV A;  3QMF A;  2XXY A;  4N07 A;  2YJP A;  2DYX A;  1NV6 A;  1USY H;  2P0S A;  3OO6 A;  4O8M A;  4JXI A;  3MVW A;  3CRB A;  1NNF A;  3FXB A;  4G68 A;  4JWY A;  1VE4 A;  1XC1 A;  5DVF A;  2AL5 A;  1US5 A;  4NWC A;  4G61 A;  1LEV A;  3EHS A;  4QHQ A;  5DVI A;  4KFQ A;  2RF1 A;  1FBF A;  1MY2 A;  1MY1 A;  4U22 A;  2V3U A;  2UVJ A;  3DP8 A;  4FEB A;  1NNK A;  2X7P A;  4O3A A;  2ZYK A;  5DTB A;  4TLL B;  2R9J A;  1N76 A;  3RQT A;  3JV9 A;  2DE3 A;  4EXL A;  3VLW A;  1POY 1;  4R9F A;  3Q26 A;  4PBQ A;  3IJX B;  4XEQ A;  2WYP A;  5KDT A;  1FQD A;  1SQY A;  3EQ1 A;  3UOR A;  3U93 A;  4OET A;  2HQ0 A;  4OVS A;  4ONY A;  1O7T A;  1ZKB A;  3E79 A;  4PCD A;  1A99 A;  1NH7 A;  4GWO A;  2M8C A;  1N7X A;  3FJ7 A;  1JQF A;  1KZ8 A;  3TOD A;  3JYR A;  4LUB A;  3SEX A;  1B3F A;  4G8H A;  4U21 A;  2VPN A;  1Y1Z A;  2Q8J A;  1Q35 A;  1IMB A;  2D3I A;  2RKM A;  5FTH A;  5I56 A;  4O94 A;  3V5A A;  3EKI A;  1FPL A;  2ANJ A;  1K9Y A;  4PDD A;  4RPO A;  3C31 A;  3KG2 A;  3O28 A;  3B8B A;  1FTL A;  4PAI A;  1FPK A;  3UIF A;  3GXA A;  3TMG A;  3K02 A;  2DWJ A;  2H25 A;  3H03 A;  4I40 A;  1RKM A;  3E9X A;  4YAH X;  5I57 B;  3RT6 B;  4NF5 B;  4MNC A;  2Q88 A;  1MQD A;  1PEB A;  4R72 A;  3Q27 A;  3LSL A;  4XIG Q;  4PC9 A;  4MNP A;  3T9V A;  3TDJ A;  3LSX A;  3ZS6 A;  3D4G A;  3I6V A;  3QYT A;  4DXC A;  2RC7 A;  5EQ7 A;  1IXI A;  1P1Q A;  5LTC A;  3S4U A;  2UVI A;  1NL5 A;  3KBR A;  5IZ1 A;  3FV2 A;  3OEK A;  1WOD A;  4PP0 A;  1HSJ A;  4JSO A;  3HHG A;  3UA8 A;  3BFT A;  5EQA A;  1XT8 A;  3H3G A;  4AB5 A;  4OES A;  3M3F A;  1IQ7 A;  1OLA A;  1OVB A;  2DQV A;  4TOZ A;  3RPL A;  3DP4 A;  1FSA A;  3K4U A;  1SYI A;  5HBC A;  4K3F A;  4BDL A;  3O9P A;  3MYU A;  3T1B A;  2GHA A;  4GL0 A;  3CSB A;  4H5G A;  4GD5 A;  4MF3 A;  4R9G A;  1B52 A;  3ISP A;  3ZSF A;  4MNI A;  1WDN A;  3BIG A;  1MPB A;  1ZIU A;  5CM6 A;  4JBZ A;  2XXP A;  3TYH A;  1MDP 1;  4OVQ A;  1B3H A;  1N7W A;  4E0X A;  5T3J A;  3FXQ A;  1NFT A;  1NV7 A;  2Y7K A;  1A40 A;  4IR8 A;  4R6H A;  1D9Y A;  4OYV A;  1UTH B;  2XXV A;  2VP1 A;  5TP9 A;  3IO6 A;  2XXR A;  4OVJ A;  1JW5 A;  1R1N A;  3IOU A;  1B40 A;  3I5O A;  1N0T A;  4Z0I A;  2Q74 A;  1AL3 A;  3UN6 A;  4DCX A;  1B32 A;  1DSN A;  3HV1 A;  3ECR A;  4IO2 A;  1FTO A;  3RNN A;  4ZEC A;  4X1B A;  3KN7 A;  3S9E A;  3FVO A;  1LAX A;  1XVX A;  4N6D A;  2Z8F A;  4GWS A;  4MJO A;  1NV2 A;  2HPG A;  4H8I A;  5F24 A;  2REG A;  3TCH A;  5AE4 A;  1KWH A;  2A5S A;  4OHN A;  2GQ1 A;  2DE4 A;  5TPA A;  2FVZ A;  2ZYO A;  4PGP A;  1HSE A;  2Y84 A;  1AWB A;  3U1O A;  1LB9 A;  1EZ9 A;  3VDF A;  1F9B A;  1MPC A;  1YCJ A;  4PFW A;  4XKP A;  5I59 A;  4ZS9 A;  2KQZ A;  3KJ7 A;  3OO8 A;  3OO7 A;  2OJT A;  2O6A A;  2PFY A;  3PUZ E;  2F35 A;  1I6B A;  5I7I A;  4PFR A;  2DSF A;  3QIM A;  2LAO A;  4NF0 A;  1B58 A;  1DPE A;  1SW1 A;  2H99 A;  3A29 A;  3G3G A;  3MQ9 A;  1Y3P A;  4QFN A;  1NNP A;  2I3W A;  3ONM A;  3H6V A;  4QFP A;  5J16 A;  1EH3 A;  3E4R A;  1FPD A;  4YKP A;  1LGB C;  1B7H A;  1IEJ A;  3U8Q A;  3VFJ A;  3GLB A;  2R71 A;  1LBW A;  4GWZ A;  3L6G A;  4Q5T A;  1QUL A;  4MH5 A;  5L9M A;  3KC0 A;  1SYH A;  5AA2 A;  2ABH A;  2B4M A;  4OEN A;  1MPD A;  2AL4 A;  1JW4 A;  2F8D A;  3PUX E;  2OZZ A;  3MVY A;  3M3K A;  4OER A;  5CC2 A;  1D3K A;  3N5L A;  2O68 A;  1AIV A;  3EN3 A;  4KCD A;  1DBZ A;  4O7M A;  2QFL A;  3TUS A;  1CNQ A;  4PET A;  1LBX A;  3KOS A;  5H8N A;  4U23 A;  4NMY A;  1QW0 A;  2DP8 A;  3H06 B;  2ONK E;  3N6U A;  1UTH A;  2QS3 A;  4LAT A;  2NVU B;  1FQF A;  3Q29 A;  2D5W A;  1EU8 A;  4KR5 A;  3KEI A;  2OK2 A;  2XXQ A;  3W9W A;  1B4Z A;  3B7D A;  4ZEF A;  3E78 A;  2VPO A;  1G0H A;  5LOM A;  1NUW A;  3UP9 A;  3O6G A;  2RCB A;  2Q9T A;  2PX1 A;  1MXW A;  4OXV A;  1Q1K A;  1EZP A;  2DWA A;  5ET8 A;  4ZZA A;  3D1R A;  4R74 A;  5H8H A;  1D4N A;  4NGU A;  4PQJ A;  5JTY A;  2Y7P A;  2NWJ A;  2Y5K A;  1UIU A;  2F7B A;  5CBR A;  3U94 A;  1OLC A;  2WBD A;  2HFB A;  4H1X A;  3OD7 A;  3PTY A;  1FBH A;  4PTK A;  2HCA A;  5TU0 A;  1ZJL A;  4OEU A;  1B0L A;  4OQO A;  2F3D A;  5HM4 B;  2FYI A;  1MM7 A;  3C36 A;  4NF8 A;  3IAZ A;  3K1P A;  3HHF A;  1MXX A;  3FGS A;  4IO3 A;  1FBD A;  1K9Z A;  4F3G A;  5BWJ A;  3FVG A;  4OZ9 A;  3KSJ A;  1LBV A;  1L5T A;  5CBS A;  3K1M A;  3TQW A;  2XX8 A;  4PAF A;  4HCW A;  1B7Z A;  3OSQ A;  3C33 A;  3D4C A;  5FHM A;  1IXG A;  1YAE A;  4XTC Q;  4R6K A;  2XWV A;  4FIM A;  4ECF A;  4I3E A;  3JZJ A;  1IMA A;  5H8F A;  3VVD A;  1AMF A;  4IY5 A;  2BJI A;  1N84 A;  4FOR A;  3MZ1 A;  5TPA B;  4R75 A;  4AQ4 A;  3OEL A;  4JVI A;  4QF9 A;  4TQU Q;  4NF6 A;  3TCG A;  3RN8 A;  1FTA A;  1POT A;  2F6G A;  1JVX A;  4IB2 A;  4OAN A;  1SVX B;  4P0G A;  3I3V A;  5AA2 B;  4F1U A;  2F5X A;  3T96 B;  2QVR A;  1D9Q A;  1M5C A;  1FTJ A;  3W9V A;  3CI8 A;  1YTV A;  1EYJ A;  2HZK A;  4BDN A;  2XD3 A;  4KXP A;  2GH9 A;  4BDO A;  2PYY A;  3TEP A;  4NTL A;  4OMB A;  2B3B A;  2NUV A;  1JEV A;  2UYE A;  5IM2 A;  4EQB A;  1FPG A;  3TTR A;  1MQH A;  1UTB A;  1JEU A;  4EF2 A;  2V25 A;  4QFO A;  4HW8 A;  5DYH A;  4H5F A;  3MBP A;  3MVZ A;  1DPP A;  2FA7 A;  4H46 A;  1PB9 A;  3EF7 A;  3WAE A;  4WKM A;  4NAP A;  1MXZ A;  3CFL A;  3G3I A;  4JWX A;  4QRZ A;  3B6W A;  2ONR A;  3A3C A;  2P2A A;  4XXU A;  3A3U A;  4F1V A;  1UIV A;  1MH3 A;  5AA1 A;  3ZKL A;  1Y1M A;  1DK4 A;  2Q89 A;  1Z7M E;  4EDP A;  4OFJ A;  1BP5 A;  5AA3 A;  2XXK A;  1I6Q A;  3CIJ A;  5H8F B;  4F22 A;  5KDT B;  4PGN A;  2VT5 A;  3B6Q A;  1LBY A;  2P3V A;  4GBV A;  3CFX A;  3H4Z A;  4R2F A;  5EQ9 A;  4NQ8 A;  3IOV A;  2Z22 A;  2O84 X;  1NV4 A;  4OVT A;  3P7I A;  2RC8 A;  2FHY A;  2OPE A;  2FIE A;  3TAJ A;  2P3N A;  3RTW B;  1IME A;  1MH4 A;  1MDQ A;  1QUI A;  3OXN A;  4TLM B;  5ITP A;  4UA8 A;  3C9H A;  4IGT A;  1IMF A;  3MP1 A;  3MST A;  2L5V A;  3THI A;  4AS5 A;  1A8F A;  2Y7I A;  2ESN A;  1NV5 A;  5KCJ A;  4OA4 A;  1B5H A;  2UXA A;  4P3L A;  2CEY A;  3QSL A;  3QK6 A;  4G68 C;  5L9S A;  1LAG E;  1VR5 A;  1FPI A;  3RY3 A;  3RUM A;  4IO7 A;  1HSL A;  3S9N C;  5I2K A;  1DTG A;  5FBP A;  2Z8E A;  3IFC A;  3HPI A;  5AA2 D;  2ZZV A;  5EHS A;  4THI A;  1P1O A;  4G8N A;  3N6T A;  2VD3 A;  4H8J A;  4DLD A;  1BK4 A;  4LON B;  1IXH A;  4G4P A;  4IO5 A;  4MLQ A;  4P56 A;  4YZZ A;  3LSW A;  1N04 A;  3RYD A;  1PDA A;  1S7Y A;  3S9M C;  4KQP A;  1LCF A;  3KC1 A;  4RPN A;  3SET A;  2F78 A;  2OCU A;  2PBW A;  4FBP A;  4N13 A;  1QUJ A;  1MXY A;  4ESX A;  3SEU A;  5ET5 A;  3FD3 A;  3PPR A;  5DEX A;  1FBE A;  1YZ0 A;  3KSX A;  3O66 A;  4RXL A;  2UYF A;  4XKQ A;  4RYA A;  3K01 A;  5ITO A;  5I84 A;  1MQI A;  4HE2 A;  2FBP A;  4PFU A;  2CZL A;  2I3V A;  2PFZ A;  1LBZ A;  4FEC A;  1ELJ A;  4N81 A;  2F6P A;  4LZ8 A;  4FAJ A;  1ANF A;  2PCR A;  1BIY A;  1GTK A;  3KFM A;  4POW A;  4R6Y A;  2IA4 A;  5I2K B;  2CZH A;  4C1U A;  1QGX A;  3C35 A;  4ELR A;  3PGF A;  4U4X A;  1H43 A;  3MC2 A;  3M3L A;  2XWK A;  3ODB A;  2DWI A;  2QL3 A;  5H8S A;  5EQ8 A;  2DDK A;  1GR2 A;  4H65 A;  1M5D A;  1A8E A;  3VE1 B;  5M2V A;  1FQA A;  4I3Y A;  2A5T B;  3G3H A;  2DVC A;  1LST A;  3MWB A;  3OEN A;  3RLF E;  4ZE9 A;  2QSX A;  4OVP A;  4GL8 A;  3T9H B;  1B46 A;  4F39 A;  2ZZX A;  1FPJ A;  3OMB A;  3PPN A;  2THI A;  5B70 A;  4HTG A;  4IO6 A;  1R9Q A;  1LFH A;  4LP2 B;  4EQ9 A;  3CG3 A;  2Q8M A;  3MZ9 A;  4N8G A;  1B2H A;  2W7Y A;  1FTK A;  4BDR A;  1XVY A;  3C34 A;  2VD2 A;  3FZV A;  1H3D A;  4BDQ A;  4AS4 A;  4N91 A;  4QSE A;  4YIC A;  4FAT A;  5EYG A;  3IOT A;  3IK6 B;  4XKR A;  5CMC A;  1WVJ A;  1LAF E;  1OQH A;  2I0B A;  4GWX A;  3IOR A;  4DXB A;  2ONS A;  1NV3 A;  3CG1 A;  4LZ7 A;  3FUZ A;  2XWO A;  3LSF B;  1R6Z A;  4PF8 A;  1FRP A;  1SW4 A;  1M5B A;  1US4 A;  2FNC A;  4KPT A;  4KYE A;  1XI6 A;  3SDF A;  1T0K A;  4YB7 A;  4F3P A;  4ESW A;  4G2Z A;  5A5X A;  1SD3 A;  4F3S A;  1R9L A;  4YB6 A;  3PUY E;  4C1T A;  4RNS A;  2KLF A;  4ND9 A;  1A55 A;  4DDD A;  2KR0 A;  2REJ A;  4MCO A;  4JVD A;  2H98 A;  2RC9 A;  4ZE8 A;  2VHA A;  3IB1 A;  1QKB A;  1SI1 A;  4MBP A;  4F31 B;  3VV5 A;  2ZXT A;  1GVC A;  5A5X B;  2Q2C A;  1Y3Q A;  3IB0 A;  1B9J A;  2I0C A;  1IXC A;  1SW5 A;  1SW2 A;  3V8X B;  1ZTY A;  2PT2 A;  2JJK A;  2O1M A;  4NF6 B;  3N26 A;  2G93 A;  4G77 A;  1JNF A;  3C32 A;  2X26 A;  3UGW A;  4NF5 A;  4E0W A;  1FJ6 A;  4YB5 A;  1P99 A;  3DLN A;  5ISU A;  2AIX A;  2WKY A;  2XD2 A;  3CFZ A;  4GX6 A;  3B50 A;  4GX3 A;  3H7M A;  5FHN A;  1IUD A;  3QAX A;  5I56 B;  4PE5 B;  5K2X A;  2A5T A;  4M4G A;  1RYX A;  1LAH E;  5H8N B;  3ROJ A;  3Q25 A;  4PFY A;  4GWY A;  4DI3 D;  2DVZ A;  3TTL A;  4L17 A;  1B05 A;  3HO7 A;  4X48 A;  2Y7R A;  3NOH A;  4PFT A;  4ZEK A;  3F11 A;  1MQG A;  4LA9 A;  4R2B A;  3IX1 A;  3PD9 A;  1N3X A;  2I49 A;  3QUF A;  4O7I A;  1FPE A;  4FJP A;  4GLI A;  4MX6 A;  3SEW A;  4GQO A;  1IMD A;  2QRY A;  2XXI A;  5A5L A;  2GHB A;  3O6H A;  4MAG A;  1MS7 A;  4FE8 A;  2YPN A;  1SPI A;  1UQW A;  2F97 A;  2QMW A;  3KN3 A;  2CMO A;  1B3L A;  4X8R A;  1S50 A;  1LCT A;  3TTK A;  1P1U A;  1XOC A;  1QVS A;  5I2N A;  1QKA A;  2ZZW A;  1OMP A;  3L6H A;  2MKZ A;  3MAM A;  5DVJ A;  4Q8R A;  5ET7 A;  3SER A;  1B0H A;  2NXO A;  3FJG A;  1ZU0 A;  3PMW A;  2DXY A;  5JK4 A;  3PV0 E;  1QUK A;  2OBG A;  1RDX A;  4ZZE A;  1TFA A;  4GFR A;  5H8Q B;  2QVU A;  2P1S A;  2UVG A;  4F2Q A;  2ZMB A;  2QS4 A;  1Z7N E;  4H45 A;  4P1E A;  3V89 B;  4HE0 A;  2F34 A;  3IB2 A;  3E3K A;  1N3W A;  2HHM A;  1JW1 A;  3PMX A;  4F1Y A;  1FTM A;  1PBQ A;  3FIR A;  3PU5 A;  4MLV A;  1FCK A;  3ILT B;  4U1Z A;  1DTZ A;  5AA4 A;  1VFE A;  4JB7 A;  1MRP A;  1MXU A;  5CMK A;  1DMB A;  3LC8 A;  4YKK A;  3VXB A;  3ILU B;  2Z8D A;  3H6U A;  4FED A;  1EYK A;  1I69 A;  3W15 C;  4HE1 A;  3OO9 A;  1TXF A;  3T0J A;  1NI9 A;  3PPP A;  2QS1 A;  2RIN A;  4R73 A;  3TQL A;  3R7X A;  2D21 A;  3MPK A;  4PAK A;  1FW0 A;  1G0I A;  1JP4 A;  2XXW A;  4N4U A;  4MMP A;  1MY4 A;  2F7A A;  2H5Y A;  1B3E A;  3LUY A;  4GVO A;  4U4S A;  3KJT A;  1FJ9 A;  1NKX A;  4LVQ A;  2V3T A;  4PE3 A;  3FXR A;  3T9X B;  2PT1 A;  4EQ7 A;  4KHZ E;  3FAS A;  3O6I A;  4ISU A;  4RK9 A;  4NHB A;  2WBB A;  1INP A;  3G3J A;  1Y3N A;  2Q2A A;  3KN8 A;  3S2V A;  1PBP A;  3OEM A;  3KOT A;  1MM6 A;  4BLA A;  3IFA A;  4EXK A;  3LR1 A;  4PDH A;  2I4C A;  2O51 A;  5IKB A;  2O7U A;  1IIW A;  1XS5 A;  1H45 A;  3U72 A;  5ELV A;  4OVR A;  2ZYM A;  4MHF A;  1DOT A;  1EZO A;  2QMX A;  3FVK A;  4N6P A;  3K1N A;  4GIZ A;  4ZEB A;  2QPQ A;  2XXX A;  3T9U A;  4YMA A;  2YLN A;  4GXS B;  2Z23 A;  4Q0C A;  5FTI A;  4M1V A;  3HST A;  1AH5 A;  4YU0 A;  3Q28 A;  1J1N A;  3TZA A;  4LN5 A;  4AB6 A;  3S9L C;  2WX9 A;  5I5P A;  1B1X A;  1TT1 A;  5ICQ A;  3EPE A;  3PD8 A;  3G3F A;  5AA4 B;  4KYD A;  5IGA A;  1CE2 A;  3IO4 A;  3TFL A;  4ELP A;  2WYK A;  3KBZ A;  4I8C A;  3K6V A;  5ET6 A;  3IJO B;  5F7V A;  4F18 A;  4I1D A;  3RTF B;  2BJJ X;  2E1S A;  3PUV E;  4H6D A;  4ZEI A;  4G8M A;  3K00 A;  2V93 A;  4WXJ A;  2VOZ A;  3PUW E;  4JSD A;  4NED A;  3U65 A;  1XHY A;  3R6U A;  1JVY A;  3VXC A;  2CEX A;  4XKN A;  4BDM A;  1AOV A;  5L9O A;  4H0W A;  3MPL A;  4LZ5 A;  3T93 B;  3K0V A;  4QFK A;  1LFG A;  1FQB A;  3H6W A;  3U92 A;  1B6H A;  4ZDM A;  2XX7 A;  1FPB A;  4HS7 A;  4XF5 A;  3GBB A;  2HAU A;  2QVV A;  1MG1 A;  5I57 A;  4OWD A;  2DWH A;  3LV0 A;  4GWU A;  1IZ1 A;  5FHO A;  3VVE A;  3MVX A;  2O7I A;  4OTE A;  2IEE A;  4X1D A;  1YPN A;  5KZT A;  1IIT A;  1SI0 A;  1LB8 A;  4KYS A;  3EHT A;  3SES A;  3TKD A;  1B5J A;  4RK2 A;  1H76 A;  4NX1 A;  3M8U A;  3PPQ A;  4I9D A;  3IR1 A;  4U2R A;  5DW8 A;  4QSC A;  5CRY A;  1VDW A;  4DIG A;  1RDZ A;  4OFL A;  1VSO A;  1FBC A;  4O3C A;  1LBB A;  4N6K A;  2XXH A;  2AYS A;  4LQ2 A;  2OX3 A;  2ALU A;  3OOA A;  4HXV A;  4NF8 B;  3BIH A;  1YYZ A;  1URG A;  2G29 A;  4YKJ A;  4ELQ A;  5DT6 A; 
#chains in the Genus database with same CATH homology
 3E79 A;  2BJI A;  2XA5 A;  4OVP A;  4P56 A;  4YZZ A;  1Q9D A;  4X8R A;  3U65 A;  4PCD A;  4NG7 A;  1RDY A;  2B4L A;  3MYU A;  1FJ9 A;  2ZZX A;  1FPJ A;  3T1B A;  4PGN A;  2VT5 A;  4P8B A;  4DI4 B;  1KZ8 A;  4F19 A;  1LBY A;  2P3V A;  3W9W A;  4PE3 A;  2CEX A;  2KQZ A;  4X9T A;  4JVI A;  3E78 A;  4GBV A;  2VPO A;  1G0H A;  3RYD A;  2CZK A;  4X04 A;  2Q8M A;  1NUW A;  2WEF A;  2V3Q A;  4PF6 A;  2ZZW A;  5EQ9 A;  3ISP A;  4MNI A;  4NQ8 A;  2R8T A;  4N15 A;  2PFY A;  4N8G A;  4P9K A;  1FTA A;  1NUY A;  1NV1 A;  5EYH A;  2MKZ A;  2V4C A;  2VPN A;  3BIG A;  2Q9T A;  4OAN A;  1KA0 A;  4PFB A;  3KC1 A;  4NHB A;  4P47 A;  1NV4 A;  2WBB A;  1INP A;  1IMB A;  5ET7 A;  1KA1 A;  1FPF A;  5LDZ A;  4OVT A;  5CM6 A;  2JJK A;  4F1U A;  2F5X A;  2FIX A;  4FBP A;  4GBW A;  4AS4 A;  4O94 A;  5I7I A;  2QVR A;  4N17 A;  4PFR A;  4XFE A;  4N91 A;  1D9Q A;  3EKI A;  1NV0 A;  2FHY A;  1FPB A;  3W9V A;  4OVQ A;  2FIE A;  1FPL A;  5ET5 A;  5ET8 A;  3FBP A;  1K9Y A;  3IFA A;  4HCY A;  4MIJ A;  4NF0 A;  3D1R A;  4PDH A;  1EYJ A;  4GWW A;  2P3N A;  5EYG A;  2HZK A;  4MEV A;  1IME A;  3QMF A;  2QVV A;  5T3J A;  1DCU A;  3RPL B;  4NGU A;  3A29 A;  1FBE A;  4PFI A;  1NV7 A;  1YZ0 A;  1RDX A;  1FJ6 A;  4KXP A;  4UAB A;  3LV0 A;  1NUX A;  1NV6 A;  3B8B A;  5IZ3 A;  4OVR A;  4PAI A;  1FPK A;  4MHF A;  4GWU A;  4O8M A;  2Y5K A;  3GYY A;  4IR8 A;  2WBD A;  2QVU A;  3FXB A;  3PTY A;  5ESY A;  4HE2 A;  2FBP A;  5IM2 A;  1FPG A;  4I40 A;  5J16 A;  1FBH A;  1IMF A;  4PTK A;  3CHG A;  3MST A;  1YXI A;  4H45 A;  1FBP A;  2PFZ A;  1LBZ A;  4P1E A;  2L5V A;  4MNC A;  4GWX A;  1FPD A;  2QPQ A;  4AS5 A;  2F3B A;  4HE0 A;  4GX6 A;  4N81 A;  5I3S A;  3B50 A;  4GX3 A;  1NV5 A;  2PCR A;  1NV3 A;  2F3D A;  4G61 A;  1EYI A;  1FBG A;  1LEV A;  4PBH A;  4MNP A;  4OA4 A;  2HHM A;  2XWO A;  4PC9 A;  2OWZ A;  4PF8 A;  2Q74 A;  1LBW A;  1FRP A;  3LUZ A;  4GWZ A;  4M1V A;  4N8Y A;  2CEY A;  4P3L A;  5IZZ A;  4NX1 A;  5EQ7 A;  3KC0 A;  3ROJ A;  1FBF A;  4GWY A;  4LN5 A;  4DI3 D;  1FPI A;  2DVZ A;  4PDD A;  2CZH A;  1FBD A;  3SZP A;  1K9Z A;  1QGX A;  2DE2 A;  5IZ3 B;  5DW8 A;  2WX9 A;  5I5P A;  2Y5L A;  2B4M A;  1NUZ A;  2XWI A;  3NOH A;  5LTC A;  2HXR A;  4P1L A;  4H46 A;  1XI6 A;  1VDW A;  1LBV A;  5IZ1 A;  1RDZ A;  4NAP A;  2XWK A;  5IGA A;  4YIC A;  1EYK A;  4N6D A;  4PAF A;  4HCW A;  1FBC A;  4HE1 A;  2WYK A;  3KBZ A;  1FPE A;  4GWS A;  1NV2 A;  4MJO A;  4O7I A;  2DDK A;  5EQ8 A;  3T0J A;  5ET6 A;  1DBZ A;  1NI9 A;  2QFL A;  4O7M A;  4QXD A;  5EQA A;  2HPG A;  5FBP A;  5F24 A;  4N6K A;  4MX6 A;  4F18 A;  1IMC A;  2XWV A;  4F1V A;  1CNQ A;  4PET A;  1LBX A;  4GX4 A;  2OX3 A;  2DE3 A;  3IFC A;  4HXV A;  1IMD A;  4QBA A;  4XF5 A;  2ZZV A;  1DK4 A;  4I3Y A;  4PAK A;  5A5L A;  1G0I A;  2GQ1 A;  2DE4 A;  1JP4 A;  2FVZ A;  4MAG A;  4PBQ A;  4I3E A;  4XEQ A;  5JK4 A;  3BIH A;  2WYP A;  4PGP A;  1YYZ A;  4JVC A;  1IMA A;  1SPI A;  3RPL A;  2KR0 A;  4N4U A;  4MCO A;  1FSA A;  2HZL A;  4JVD A;  2CZI A;  4MMP A;  4NN3 A;  3HFU A;  4OVS A;  5J1D A;  1BK4 A;  1AWB A;  2XXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...