5F24A

Crystal structure of dual specific impase/nadp phosphatase bound with d-inositol-1-phosphate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
260
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 74
structure length 260
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5f24A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5f24A02
3B8BA 3LV0A 1FPLA 1NUWA 1IMEA 2QFLA 1D9QA 1FTAA 4GWZA 2FIXA 4GX3A 1DCUA 1EYKA 2WBBA 1NV3A 1NUYA 1DBZA 1LEVA 5EQAA 5ET7A 5IZ3A 4PTKA 4HE0A 1BK4A 5IZ1A 5LDZA 3QMFA 2BJIA 2VT5A 4HE1A 4N81A 2GQ1A 4O7IA 3D1RA 3RYDA 1NV2A 4GX4A 3T0JA 5I3SA 2P3NA 5DW8A 1FPGA 1FPIA 1IMCA 1RDYA 1AWBA 2QVRA 2CZHA 5IZ3B 1G0HA 1G0IA 1DK4A 5A5LA 2Y5LA 1IMBA 1NV6A 2F3DA 1IMDA 1EYIA 1NV1A 4GBWA 1FBGA 1NV0A 2F3BA 1K9ZA 1FJ6A 1CNQA 1NUXA 4GWWA 1FSAA 4KXPA 4I3EA 4MJOA 5ET5A 1YZ0A 1LBVA 4H46A 1Q9DA 5T3JA 4GWXA 2Y5KA 1NI9A 4HE2A 2OWZA 2OX3A 1XI6A 2HHMA 3IFCA 4FBPA 2Q74A 4GX6A 5FBPA 1KZ8A 2PCRA 2FVZA 1QGXA 1KA1A 4QXDA 5EQ8A 4GWUA 2QVUA 4AS5A 2FIEA 1FRPA 1FPJA 1KA0A 5EQ9A 1INPA 1FBFA 2JJKA 1FPEA 2Q8MA 3A29A 1NV4A 1LBYA 4H45A 1RDZA 1RDXA 4AS4A 4GWYA 2CZKA 4I40A 4G61A 1FBCA 2QVVA 1FBPA 3KC0A 2CZIA 2DDKA 1YYZA 1LBXA 4GBVA 4HXVA 3BIGA 5ET8A 5EQ7A 1VDWA 1FBDA 1IMAA 5EYGA 3FBPA 1YXIA 1FPKA 3LUZA 1NV7A 1SPIA 2WEFA 1FPFA 1NUZA 2WBDA 1FPDA 1FBEA 2R8TA 1LBWA 3IFAA 5EYHA 1IMFA 1K9YA 3RPLA 5ESYA 5J16A 4IR8A 2FBPA 3ROJA 2P3VA 3KC1A 4GWSA 1FBHA 1LBZA 1EYJA 1NV5A 1JP4A 1FPBA 2FHYA 5ET6A 1FJ9A 4I3YA 3BIHA 5F24A 3KBZA 3RPLB
chains in the Genus database with same CATH superfamily
2RCBA 3ZKKA 1LAFE 1FPLA 3E78A 3MZ9A 3A3CA 2DWJA 1QULA 4WEDA 3PD9A 3G3JA 2X26A 3G7WA 5IZ1A 3M3LA 5LDZA 4BDMA 1FQFA 1ZLQA 4AB6A 1LLSA 1H76A 2XXXA 4XTCQ 4ELQA 2F36A 3H03A 1S9TA 2I4CA 2GHAA 2V84A 3I3VA 3TODA 5FHMA 2OWTA 3KBRA 1Y4CA 1O7TA 3M3KA 4R6YA 1MS7A 2OCUA 5EHMA 4NMYA 4JSOA 1B3HA 2XWKA 4LUBA 3OELA 1B7UA 4PC9A 1TFAA 2GHBA 1DSNA 4OVJA 2Z8FA 3KGCA 4QXDA 5BUUA 1OVBA 1DPEA 1EU8A 1KA0A 1FPJA 2XXRA 2F34A 3BBRA 4OEUA 4OZ9A 2R71A 2O69A 4AS4A 5JEIA 3K2DA 2I48A 5AA2B 4I8CA 5EYGA 4M4GA 3LUZA 1DOTA 1PBPA 4U1ZA 3PU5A 1USYE 4RA1A 2XA5A 4OYVA 2H25A 2RC7A 1UIVA 1EYJA 3UIFA 4YB7A 4OVRA 2DVCA 4KFQA 1IIWA 1ZJLA 2F35A 3TEPA 5DT6A 3TCFA 3ECRA 4FEDA 4E0WA 1B40A 2HAVA 5FTIA 1AIVA 3CFLA 4NF8A 3D4GA 3MAMA 3ODBA 4N81A 3RYDA 3TTRA 2P3NA 2DWHA 2V25A 4NF0A 3M8UA 3U92A 3T9XB 2O1LA 2F6PA 2MKZA 3CRBA 3QAXA 5F7VA 5LTCA 4YMAA 3W15C 1MM6A 4QHQA 1S7YA 4GWXA 2I3VA 2ZNTA 2H4IA 3K6XA 2R6GE 2HHMA 4JXIA 2THIA 3V8XB 4F29A 3C31A 4N6PA 1N0TA 1JVYA 1KA1A 3BFTA 2O7UA 3K6VA 4QSCA 4F1UA 4MAGA 1UQWA 5AA1A 3OEMA 4GVOA 3VE1B 1OMPA 1WVJA 1NNTA 4GXAA 2DDKA 3SEYA 2Z23A 1ELJA 1UTBB 4GBVA 2B4MA 5KZTA 5DVFA 5ET8A 1A55A 4ECFA 5ELVA 1NMUA 5DVIA 3HHGA 1TFDA 2Z8DA 4ELOA 3EHSA 1SW4A 2I3WA 2Y7IA 5CI5A 5AA2A 2AIXA 1JVXA 3LC8A 5ESYA 5KCJA 2UYFA 1N3XA 4Q0CA 3FZVA 4P1EA 2GFEA 3TFLA 3EKIA 4XKNA 2HCAA 2VPOA 1PDAA 3VDFA 5DYHA 5TPAB 2L5VA 4NTLA 5FHNA 2I4BA 3MP1A 3E79A 2HZKA 5EYFA 3C4MA 4JVIA 4PFUA 1IXHA 4DI4B 1DCUA 3LSFB 1B3LA 4RK9A 2UVIA 2DWAA 3CIJA 1GVCA 3C32A 3MPLA 4OHNA 3N5LA 2DE2A 3CVGA 4X48A 4PAKA 4OWDA 1MQGA 5FHOA 1FBGA 4GIZA 3D4CA 1HSLA 2WKYA 1YZ0A 2FYIA 2ONKE 2ANJA 2Y7RA 4HE2A 2OX3A 1URDA 4EF1A 3K0VA 5I5PA 2XXIA 1FQBA 1NNKA 4NWCA 3V83A 2XHDA 2KR0A 1QUKA 3VXCA 1EH3A 2PMSA 3CSBA 3SEUA 4N6KA 1FBPA 3ILTB 3GXAA 1LAXA 4F3SA 3TTKA 3H6UA 4XFEA 5DTBA 4FATA 5CRYA 1UTBA 1SI0A 2F7AA 3GYYA 1URGA 2P3VA 5ITPA 5L9SA 2Y7WA 3MBPA 4GD5A 1ZBMA 2Q89A 5F24A 1M5DA 4MX6A 3T1BA 1FTAA 2I0BA 5TPAA 1POTA 3SZPA 2HFBA 4HE1A 5H8NA 5ICTA 2GQ1A 3TKDA 4M1VA 3KOSA 1FPGA 4UA8A 4DCYA 1AWBA 3FJGA 2UVJA 4IGRA 3WAEA 5ET5A 3G3KA 3A3UA 3O9PA 4LP2B 1TXFA 2NVUB 5T3JA 5CMKA 3QYTA 1NI9A 4KR5A 2Q74A 3KEIA 3U93A 4DE8A 4PAFA 1UTHB 2OZZA 4JBZA 5K2XA 4DXBA 3WAFA 4R2FA 3OO9A 1FBFA 1GGGA 2QJEA 4Q5TA 2QL3A 4P56A 4I1DA 3T66A 1I6BA 4LZ7A 1RDZA 3CSGA 2DP8A 1MG1A 1JW1A 5CBSA 3TELA 4HXVA 1LB9A 1LBCA 2I58A 2HAUA 3VV5A 3KOTA 1DPPA 5JTYB 3GLBA 3IB1A 1YCJA 1JEUA 3ROJA 3SEXA 2OPEA 3MPKA 4ZE8A 3TDJA 1FPBA 4NF6B 4H8JA 5K2YA 3UORA 4OESA 1FCKA 4PBHA 3MP6A 5H8HB 1T0KA 4EQ9A 3S9NC 1LAHE 1USYH 4IO6A 3LV0A 2XD2A 1AL3A 4PCDA 3OENA 2WBBA 4MMPA 1NV3A 2A5TB 4OQOA 5IZ3A 3ONMA 4PTKA 3KFMA 3H3GA 3G3HA 1AMFA 4H65A 4K3FA 1NV2A 4GX4A 1R6ZA 2M8CA 4OERA 1A7LA 4DXUA 2OPDA 5AA3A 2VPNA 1NV0A 4IY6A 1K9ZA 2UVHA 4I3EA 1FQEA 3CR9A 3UGWA 1P1NA 4MLVA 3T22A 3MP8A 3Q26A 3RQTA 4RNSA 1MQJA 3Q25A 5IM2A 4GWUA 1DMBA 2F6GA 4Q8RA 3SETA 3SEWA 3HO7A 4FJPA 2I6EA 3FXUA 2Q8MA 4ISUA 1UTHA 2Q2CA 1FQCA 1LBYA 2V4CA 2CZKA 4BDLA 1FBCA 3BKIB 3UA8A 4P1LA 3FJ7A 2Q9TA 4ONYA 4O3CA 3IAZA 1LAGE 4C0RA 2ZYKA 1Y4TA 3KSXA 1YAEA 4GOTA 1HSEA 5H8QB 5JTYA 1LFGA 2GRVA 4IGTA 3VXBA 2XXQA 4N13A 3R7XA 4YKKA 4GWZA 1FTJA 2Q88A 4NF6A 4GX3A 2X7QA 1YPNA 5H8HA 2DXRA 2XX9A 1SQYA 3TZAA 4X1DA 4N8GA 4JWYA 1ATGA 3BFUA 1B1XA 4LA9A 3QXMA 5A5LA 1DK4A 2Y5LA 2F3DA 4NF8B 2P0SA 4GBWA 3EQ1A 4RY1A 3QUFA 3HCQA 3QUJA 1FSAA 4OETA 3FXQA 4LQ2A 2VP1A 4U4SA 3AXFA 4X1BA 5DVJA 4BDQA 1KZ8A 3VVFA 3VLUA 1MY2A 3IOUA 1IEJA 5EQ8A 2ESNA 3CHGA 2PT2A 1II5A 1MXVA 5I84A 3IO6A 3RTWB 4N8YA 2QS3A 2D5WA 3A09A 4LATA 4P0GA 1OLCA 3PTYA 4F1YA 4P8BA 4TLMB 4OTEA 1I69A 1GR2A 3LUYA 4H67A 4R6KA 3H7MA 1NUZA 3PUWE 4R73A 2XXPA 3MWBA 3RNNA 3UN6A 2ZMBA 3EN3A 4IO7A 5ET6A 4ESWA 5KCJB 2NWJA 3LSXA 5H8QA 1A99A 5HPQA 3SEVA 2KQZA 3H6TA 1BK4A 1VSOA 3PMVA 3HSTA 3T93B 4PDDA 5AA2D 2BJIA 4BDOA 2CMOA 3C35A 4ZEKA 5I58B 2QPQA 1Y9UA 2D3IA 4DDDA 4H1XA 3RPWA 4YKPA 1GV8A 2DS9A 1P1WA 4DZ1A 2F3BA 1FJ6A 1CNQA 1P1QA 1SYHA 4G8NA 2O84X 1CE2A 4H5FA 3K01A 3RTFB 1Q9DA 1B32A 3O29A 4EXLA 2H98A 3G3IA 1IXCA 1BKAA 2QRYA 3U1OA 4XEQA 4ZS9A 1N84A 1FRPA 3S9MC 3CI8A 3DP4A 3TQLA 4P9KA 4MIJA 3KC0A 3C33A 1LBXA 3TQWA 1MXXA 4JVDA 1NV7A 1MXWA 2ZYMA 1FBEA 4U22A 3N6UA 1IITA 1SBPA 2YJPA 5F1QA 2DSFA 2R9JA 3KBZA 3B6TA 1QKAA 4Z7EA 1EZPA 1IUDA 4EQ7A 1D9QA 2NXOA 1JW5A 3O28A 4PE5B 1DBZA 1A54A 1LEVA 1HSJA 4MEVA 3DM0A 1ZMGA 2HEUA 3TAJA 4QRZA 3RT8A 1MQHA 4DIGA 1A40A 3K02A 4TLLB 4G8HA 1M5FA 3FXRA 1EZOA 1IMDA 3LSWA 1EYIA 4I9DA 3QIMA 5H8NB 2G93A 1WODA 4NF5B 5IAIA 5I58A 3H6VA 5LOMA 2CEXA 2ONSA 2D21A 4O3AA 4OENA 4QFNA 4NEDA 5IZZA 4IO3A 4RYAA 3CFZA 5L9MA 4ZEFA 4PE3A 3EPEA 4N4UA 3TCGA 4P47A 3PUXE 4U2RA 3K1NA 4NGUA 4HW8A 4ZEIA 2DYXA 1XS5A 1FPEA 1PB7A 1MM7A 1VFDA 4PAIA 1NV4A 5ISUA 1RDXA 4GWYA 2W7YA 3MW0A 2QS1A 3T96B 4KQPA 4C1TA 4YKJA 3QK6A 3IB2A 1IZ1A 2WX9A 4XKPA 4YKIA 2VHAA 3RN8A 1PB9A 3LR1A 1ANFA 2NUVA 3RPLA 5DEXA 1XT8A 1B5HA 3DP6A 4MH5A 4HCWA 4KYDA 4N15A 4WEPA 3JV9A 4OVTA 3BIHA 1Y1MA 2PFYA 3PUYE 4O94A 1WDNA 1MY3A 1D3KA 4EF2A 3IJXB 4DI3D 2FIXA 1NUYA 3HN0A 5A5XB 4G68A 5CMBA 3EHUA 2YPNA 3MYUA 1B2HA 3USDA 1VR5A 4YB6A 4RPNA 3D1RA 1OIBA 1SW2A 3VLVA 2QMXA 4JWXA 1PC3A 2XXUA 4C1UA 5IZ3B 1H3DA 3IL1B 4GFRA 2RC8A 3VLWA 1Q35A 5B70A 3IO4A 2OBGA 4NF5A 4FBPA 1ZU0A 3QSLA 1JETA 5CMCA 2X7PA 3SDFA 2HZLA 2ZYNA 1QGXA 4N17A 4POXA 1POY1 1FQAA 4AS5A 4UABA 5HM4B 1SW1A 4OA4A 4G8MA 1H45A 2BJJX 3OO8A 5TU0A 2ZXTA 3ZSFA 3DELB 2AYSA 3MQ9A 4HTGA 1KWHA 3HV1A 2ZNUA 2Y7KA 3JYRA 3OSQA 1SD3A 1JNFA 5EQ7A 4NWDA 4TOZA 4F2OA 4GQOA 5J1DA 1LFIA 4EQBA 3IFAA 2H9BA 3OO6A 1Q1KA 1MY4A 2ZZXA 3PUZE 4GWSA 1ZKBA 1NV5A 3IORA 2HPGA 3MVYA 3R6UA 4ZE9A 4PF8A 2F7BA 4ND9A 3FVKA 1OQHA 3Q29A 5BWJA 2HXWA 4G4PA 4NX1A 3TCHA 5H8FA 2VT5A 1O63A 3T0JA 4H5GA 5A5XA 5DW8A 2WYPA 4FECA 1NH8A 4Q30B 2QVRA 5I59B 1IMBA 4ZECA 3I5OA 3O66A 3OD7A 3OMBA 4MNCA 3SERA 3S9EA 2XXYA 3MC2A 3IJOB 3MUQA 2DVZA 4PFBA 2HQ0A 1MXYA 5JK4A 5I7IA 3HHFA 4NF4B 1XI6A 3KN7A 2V93A 1XVXA 4HCYA 3B7DA 4OFOA 3Q28A 2QSXA 2O6AA 1INPA 3CG1A 3TTLA 3O2AA 2VGQA 4YB5A 3E9XA 4F18A 4BDRA 1FQDA 4G68C 4JB7A 4P0IA 3PUVE 4G61A 3B50A 4THIA 3TMGA 3BIGA 2B3BA 3F11A 1EZ9A 2WEFA 4EXKA 1Y20A 4KCDA 3PMXA 3LBSA 5I2KA 1LBWA 4R2BA 4KI0E 2AL4A 5AA4B 4U21A 1IQ7A 4EUOA 3O97A 3KC1A 2I49A 3EHTA 2A5SA 1VFEA 2QMWA 4I3YA 4U4XA 1XVYA 2DE4A 1MDQA 3MVXA 1B3FA 4DXCA 4PFYA 3LSLA 3RLFE 1N3WA 3PGFA 4DCXA 2E1SA 1B4ZA 4O7IA 1D9YA 1LSTA 1NL5A 3KJTA 2V3TA 2RC9A 2P2AA 3FATA 4IB2A 5CMMA 2E0SA 4RPOA 1US5A 1VE4A 4O3BA 2Z22A 4QSEA 4GLIA 4MHFA 2F78A 5I59A 1B05A 1MRPA 1OLAA 1P99A 4G77A 4R6HA 4MLQA 3T9UA 2PX1A 3MVWA 4MF3A 4H46A 4H6DA 4AB5A 1OVTA 2OWZA 4KD5A 3KJ7A 4PP0A 3PMWA 4YZZA 2QVUA 4NF4A 1Y3NA 2PYYA 3GZGA 4ZZEA 1P1OA 1RKMA 4PETA 1MQIA 4I62A 4H45A 4FEBA 2QVVA 2RINA 3E3KA 2F97A 4RJZA 2XWVA 1MH4A 2ONRA 3I6VA 1H44A 2DE3A 3FUZA 5CM6A 2XXKA 2PT1A 3N26A 1FPDA 3PPRA 4QFOA 4ESXA 1F9BA 3FJMA 3O6HA 3IR1A 2FBPA 4R9FA 3FD3A 2B4LA 3THIA 3SESA 2AL5A 3U8QA 3TUSA 4X04A 3VFJA 3C36A 4QFKA 2Y7PA 3OOAA 2FNCA 3RGYA 4BLAA 5AA4A 1QVSA 1ZTYA 4F3GA 1R1NA 3OXNA 4JDFA 3M3FA 4XF5A 1NFTA 4F19A 4FAJA 4XKQA 1XHYA 1FTMA 3HFUA 3H06B 2QS4A 4JVCA 5EHSA 4BDNA 1N04A 5IGAA 3O6IA 1B7HA 4PGNA 1G0HA 1G0IA 2O1MA 3MSTA 3MZ1A 2B3FA 4GWOA 5FTHA 3GBAA 1B0LA 4GWWA 4U23A 4KCCA 1AH5A 2XXVA 1A8FA 2DWIA 2DXYA 3O6GA 4OVQA 4WXJA 4FIMA 2UVGA 3FVNA 5TP9A 2KLFA 2QS2A 3E4RA 4IO5A 1QUJA 2XWOA 2RF1A 3RY3A 2UXAA 4OFJA 2B65A 3K00A 1DTGA 1B0HA 1B6HA 1FTLA 2CZIA 4UACA 3JZJA 4GL8A 4XXUA 4LN5A 3FBPA 1YXIA 1MY1A 4MNPA 2WBDA 2R8TA 2ZYOA 2XX8A 4GRKA 1B9JA 1RYOA 1JP4A 1TWYA 3PPNA 4QFPA 2O51A 3RPLB 2VD3A 4PQJA 2CEYA 4MFIA 5DEXB 4Z0IA 1B7ZA 1IMEA 1YTVA 1JEVA 4E0XA 1MPBA 1QKBA 4OMBA 3EF7A 3L6HA 1LBBA 4PGPA 3QMFA 1ZIUA 3PPOA 4IO4A 1NKXA 2YLNA 1RDYA 2CZHA 1B46A 4G68B 3OEKA 1NV6A 1LCFA 3ILUB 4U1OA 4F1VA 2PVUA 4PFRA 4X9TA 4POWA 4QFLA 1IXGA 1H43A 2XWIA 3T9HB 3IOTA 3RT6B 4ZDMA 1B3GA 4YMBA 1TT1A 4WKMA 3IK6B 2PBWA 2PCRA 1LGBC 2IA4A 2Z8EA 2OWSA 3IB0A 2PFZA 3H4ZA 4YICA 4PFIA 1GTKA 2JJKA 3OO7A 4FORA 2DQVA 1FTKA 4I40A 3DLNA 3ZS6A 3C9HA 4MBPA 5I57B 2ZNSA 4JSDA 5KDTB 1US4A 4F3BA 1S50A 4P11A 1IMAA 4FE8A 4YAHX 5I56B 1URSA 2GH9A 2OK2A 5CC2A 4X8RA 3MJNA 1B1HA 4ZEDA 2REJA 3IOVA 4NE4A 2XXWA 3G3FA 3PPQA 1MH3A 4KYSA 4DLDA 2QFLA 2Q8JA 4QSDA 3S4UA 3B6WA 5EQAA 4OFLA 1MPCA 2RCAA 3SKPA 5M2VA 3PV0E 5I3SA 2H99A 3FVOA 2OJTA 3IOWA 1Y3QA 1NV1A 5IKBA 5H8FB 1XC1A 3H6WA 2H5YA 4R75A 3G3GA 1BIYA 2XX7A 2CZLA 3R26A 1NNPA 3KG2A 4F3PA 4KPTA 1QW0A 4PBQA 2RKMA 1B51A 1R9QA 5ICQA 3N6TA 1PEBA 4KHZE 3UP9A 5B7DA 2ZZVA 4O8MA 1M5CA 3MZBA 1Y3PA 1B5IA 1N7XA 4LVQA 3K1MA 3V89B 1CB6A 3ISPA 4MCOA 4H8IA 3P7IA 4R74A 1PBQA 4HS7A 1VDWA 5ITOA 1FPKA 3TTNA 3FASA 4ELPA 4F22A 5I57A 4QF9A 5KDTA 4ELRA 4IR8A 1QJMA 2LAOA 4KYEA 3W9VA 4ZZAA 1MQDA 5I56A 5I2KB 5L8DA 1IXIA 5J16A 4NG7A 4TQUQ 5CBRA 2I0CA 5I2NB 1Z7ME 4RK2A 4NQ8A 3B6QA 5HBCA 5ET7A 4PF6A 3U65A 4F2QA 4N07A 3HPIA 3IX1A 4RXLA 2FA7A 1B4HA 3W9WA 2OLBA 1MPDA 4PFTA 3RUMA 1A8EA 1NUXA 2V3UA 3ZKLA 1FTOA 1FW0A 4N6DA 3FXBA 3FVGA 2IEEA 1LBVA 1DTZA 1MXZA 4ZEBA 3PPPA 4P3LA 2O68A 4OANA 2Y5KA 4OXVA 3IFCA 3MVZA 3C34A 4GX6A 4PDHA 3DP8A 2FVZA 2ABHA 2FIEA 1NNFA 3GBBA 3KN3A 1P1UA 4F39A 2F8DA 1SVXB 1MY0A 1I6QA 3UK4A 4GF8A 2XD3A 2VD2A 3OSRA 5H8SA 4NN3A 2NOOA 1FBDA 1Y1ZA 4XIGQ 3FV1A 2G29A 4AQ4A 1SYIA 1FPFA 3E13X 3KSJA 2WYKA 1B52A 5EYHA 1IMFA 3PD8A 2P1SA 1LFHA 2ALUA 3KZGA 3TTMA 1B5JA 4PFWA 3L6GA 1BTJA 1RYXA 1LBZA 2Y84A 2FHYA 2XXTA 4MNIA 2O7IA 3Q27A 3FGSA 3B8BA 1NUWA 4EDPA 3KN8A 1LB8A 1MDP1 1LCTA 3VVDA 1Z7NE 1EYKA 4NAPA 4HE0A 3NOHA 2XXHA 4OVSA 4LZ8A 5I2NA 1AOVA 3TPAA 3CFXA 4F31B 4H0WA 3FV2A 1FPIA 4G2ZA 1J1NA 1IMCA 2DOJA 4N91A 1R9LA 1BLFA 3CG3A 3N94A 2F7CA 1SW5A 5AE4A 1D9VA 4OEVA 4O7MA 4KXPA 2REGA 4MJOA 1QUIA 3V5AA 4LQ5A 4GXSB 4JWOA 4R72A 3TYHA 1SI1A 1UIUA 4OVPA 1N76A 4LZ5A 1NH7A 2UYEA 3K1PA 3K6UA 1N7WA 1XOCA 4GL0A 5FBPA 4XKRA 2HXRA 4NHBA 4QBAA 1B3EA 2ZZWA 1O64A 2VOZA 5EQ9A 1JW4A 5TP9B 1OQGA 3A29A 4L17A 3U72A 3FIRA 4LONB 4YU0A 1YYZA 1L5TA 3U94A 5L9OA 1M5EA 2V3QA 1JQFA 2F5XA 3S9LC 3S2VA 1SPIA 1B58A 3T9VA 3K6WA 1MXUA 1SDXA 1K9YA 3VVEA 1PB8A 3K4UA 4R9GA 1M5BA 1D4NA 1FBHA 4IO2A 1BP5A 2A5TA 1I6AA 1FJ9A 2Q2AA 4IY5A
chains in the Genus database with same CATH topology
2CEYA 3LV0A 1FPLA 3E78A 1IMEA 4PCDA 4DI3D 2FIXA 2WBBA 4MMPA 1NV3A 1NUYA 5IZ3A 4PTKA 5IZ1A 5LDZA 4PGPA 3QMFA 3MYUA 3D1RA 1NV2A 4GX4A 1RDYA 5IZ3B 2CZHA 1NV6A 2VPNA 4F1VA 1NV0A 1K9ZA 4PFRA 4X9TA 4I3EA 2XWIA 2XWKA 4PC9A 4FBPA 2HZLA 2PCRA 1QGXA 4QXDA 4N17A 5IM2A 4GWUA 4AS5A 4UABA 1KA0A 1FPJA 4OA4A 2PFZA 4YICA 4PFIA 2JJKA 2Q8MA 1LBYA 4AS4A 2V4CA 2CZKA 4I40A 1FBCA 4P1LA 5EQ7A 1IMAA 5EYGA 2Q9TA 3LUZA 5J1DA 3IFAA 2XA5A 2ZZXA 4GWSA 1EYJA 1NV5A 4X8RA 4OVRA 2HPGA 4PF8A 2QFLA 4GWZA 4GX3A 5EQAA 4NX1A 4N8GA 2VT5A 4N81A 3RYDA 3T0JA 5I3SA 2P3NA 5DW8A 2WYPA 4NF0A 2QVRA 5A5LA 1DK4A 2MKZA 2Y5LA 1IMBA 2F3DA 1NV1A 5LTCA 4GBWA 4MNCA 1FSAA 4PFBA 2DVZA 5JK4A 4GWXA 5I7IA 1XI6A 2HHMA 1KZ8A 4PBQA 1KA1A 4HCYA 5EQ8A 3CHGA 4O8MA 2ZZVA 1INPA 4F1UA 4MAGA 4F18A 4N8YA 4G61A 3B50A 2DDKA 3ISPA 4MCOA 3PTYA 4GBVA 4P8BA 2B4MA 3BIGA 5ET8A 1VDWA 1FPKA 2WEFA 1NUZA 1LBWA 5ESYA 4IR8A 3KC1A 4P1EA 5ET6A 3W9VA 3EKIA 2VPOA 4I3YA 2DE4A 2L5VA 5J16A 4NG7A 3E79A 2HZKA 4JVIA 4DI4B 1DCUA 4NQ8A 2KQZA 5ET7A 4PF6A 3U65A 1BK4A 4PDDA 2BJIA 4O7IA 3W9WA 2QPQA 2DE2A 4PAKA 1FBGA 2F3BA 1FJ6A 1CNQA 1NUXA 4MHFA 4N6DA 3FXBA 1YZ0A 1LBVA 4H46A 1Q9DA 4P3LA 4OANA 2Y5KA 4HE2A 2OWZA 2OX3A 3IFCA 4GX6A 4PDHA 5I5PA 2FVZA 4XEQA 4YZZA 2QVUA 2FIEA 1FRPA 2KR0A 4PETA 4H45A 4P9KA 4MIJA 4N6KA 2QVVA 1FBPA 3KC0A 2XWVA 4NN3A 1LBXA 2DE3A 1FBDA 4JVDA 4XFEA 5CM6A 2XXKA 1NV7A 1FPFA 1FPDA 2WYKA 1FBEA 5EYHA 1IMFA 3GYYA 2FBPA 2P3VA 2B4LA 1LBZA 2FHYA 4X04A 4MNIA 5F24A 3KBZA 4MX6A 3T1BA 3B8BA 4XF5A 4F19A 1NUWA 1D9QA 1FTAA 1EYKA 1DBZA 1LEVA 3SZPA 4NAPA 4HE0A 3HFUA 3NOHA 4MEVA 4OVSA 4JVCA 4HE1A 2GQ1A 5IGAA 4M1VA 1FPGA 4PGNA 1FPIA 1IMCA 1AWBA 4N91A 1G0HA 1G0IA 1IMDA 3MSTA 1EYIA 4GWWA 4O7MA 4KXPA 4MJOA 5ET5A 2CEXA 4OVPA 4OVQA 5T3JA 1NI9A 5IZZA 2Q74A 5FBPA 2HXRA 4PAFA 4NHBA 4PE3A 4QBAA 2XWOA 2ZZWA 4N4UA 4P47A 5EQ9A 4NGUA 1FBFA 4P56A 1FPEA 3A29A 4PAIA 1NV4A 1RDZA 1RDXA 4GWYA 2CZIA 1YYZA 4HXVA 2V3QA 2F5XA 3FBPA 4LN5A 1YXIA 2WX9A 1SPIA 4MNPA 2WBDA 2R8TA 1K9YA 3RPLA 3ROJA 1FBHA 1JP4A 4HCWA 1FPBA 4N15A 1FJ9A 4OVTA 3BIHA 2PFYA 4PBHA 3RPLB 4O94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8B A;  3LV0 A;  1FPL A;  1NUW A;  1IME A;  2QFL A;  1D9Q A;  1FTA A;  4GWZ A;  2FIX A;  4GX3 A;  1DCU A;  1EYK A;  2WBB A;  1NV3 A;  1NUY A;  1DBZ A;  1LEV A;  5EQA A;  5ET7 A;  5IZ3 A;  4PTK A;  4HE0 A;  1BK4 A;  5IZ1 A;  5LDZ A;  3QMF A;  2BJI A;  2VT5 A;  4HE1 A;  4N81 A;  2GQ1 A;  4O7I A;  3D1R A;  3RYD A;  1NV2 A;  4GX4 A;  3T0J A;  5I3S A;  2P3N A;  5DW8 A;  1FPG A;  1FPI A;  1IMC A;  1RDY A;  1AWB A;  2QVR A;  2CZH A;  5IZ3 B;  1G0H A;  1G0I A;  1DK4 A;  5A5L A;  2Y5L A;  1IMB A;  1NV6 A;  2F3D A;  1IMD A;  1EYI A;  1NV1 A;  4GBW A;  1FBG A;  1NV0 A;  2F3B A;  1K9Z A;  1FJ6 A;  1CNQ A;  1NUX A;  4GWW A;  1FSA A;  4KXP A;  4I3E A;  4MJO A;  5ET5 A;  1YZ0 A;  1LBV A;  4H46 A;  1Q9D A;  5T3J A;  4GWX A;  2Y5K A;  1NI9 A;  4HE2 A;  2OWZ A;  2OX3 A;  1XI6 A;  2HHM A;  3IFC A;  4FBP A;  2Q74 A;  4GX6 A;  5FBP A;  1KZ8 A;  2PCR A;  2FVZ A;  1QGX A;  1KA1 A;  4QXD A;  5EQ8 A;  4GWU A;  2QVU A;  4AS5 A;  2FIE A;  1FRP A;  1FPJ A;  1KA0 A;  5EQ9 A;  1INP A;  1FBF A;  2JJK A;  1FPE A;  2Q8M A;  3A29 A;  1NV4 A;  1LBY A;  4H45 A;  1RDZ A;  1RDX A;  4AS4 A;  4GWY A;  2CZK A;  4I40 A;  4G61 A;  1FBC A;  2QVV A;  1FBP A;  3KC0 A;  2CZI A;  2DDK A;  1YYZ A;  1LBX A;  4GBV A;  4HXV A;  3BIG A;  5ET8 A;  5EQ7 A;  1VDW A;  1FBD A;  1IMA A;  5EYG A;  3FBP A;  1YXI A;  1FPK A;  3LUZ A;  1NV7 A;  1SPI A;  2WEF A;  1FPF A;  1NUZ A;  2WBD A;  1FPD A;  1FBE A;  2R8T A;  1LBW A;  3IFA A;  5EYH A;  1IMF A;  1K9Y A;  3RPL A;  5ESY A;  5J16 A;  4IR8 A;  2FBP A;  3ROJ A;  2P3V A;  3KC1 A;  4GWS A;  1FBH A;  1LBZ A;  1EYJ A;  1NV5 A;  1JP4 A;  1FPB A;  2FHY A;  5ET6 A;  1FJ9 A;  4I3Y A;  3BIH A;  5F24 A;  3KBZ A;  3RPL B; 
#chains in the Genus database with same CATH topology
 2RCB A;  3ZKK A;  1LAF E;  1FPL A;  3E78 A;  3MZ9 A;  3A3C A;  2DWJ A;  1QUL A;  4WED A;  3PD9 A;  3G3J A;  2X26 A;  3G7W A;  5IZ1 A;  3M3L A;  5LDZ A;  4BDM A;  1FQF A;  1ZLQ A;  4AB6 A;  1LLS A;  1H76 A;  2XXX A;  4XTC Q;  4ELQ A;  2F36 A;  3H03 A;  1S9T A;  2I4C A;  2GHA A;  2V84 A;  3I3V A;  3TOD A;  5FHM A;  2OWT A;  3KBR A;  1Y4C A;  1O7T A;  3M3K A;  4R6Y A;  1MS7 A;  2OCU A;  5EHM A;  4NMY A;  4JSO A;  1B3H A;  2XWK A;  4LUB A;  3OEL A;  1B7U A;  4PC9 A;  1TFA A;  2GHB A;  1DSN A;  4OVJ A;  2Z8F A;  3KGC A;  4QXD A;  5BUU A;  1OVB A;  1DPE A;  1EU8 A;  1KA0 A;  1FPJ A;  2XXR A;  2F34 A;  3BBR A;  4OEU A;  4OZ9 A;  2R71 A;  2O69 A;  4AS4 A;  5JEI A;  3K2D A;  2I48 A;  5AA2 B;  4I8C A;  5EYG A;  4M4G A;  3LUZ A;  1DOT A;  1PBP A;  4U1Z A;  3PU5 A;  1USY E;  4RA1 A;  2XA5 A;  4OYV A;  2H25 A;  2RC7 A;  1UIV A;  1EYJ A;  3UIF A;  4YB7 A;  4OVR A;  2DVC A;  4KFQ A;  1IIW A;  1ZJL A;  2F35 A;  3TEP A;  5DT6 A;  3TCF A;  3ECR A;  4FED A;  4E0W A;  1B40 A;  2HAV A;  5FTI A;  1AIV A;  3CFL A;  4NF8 A;  3D4G A;  3MAM A;  3ODB A;  4N81 A;  3RYD A;  3TTR A;  2P3N A;  2DWH A;  2V25 A;  4NF0 A;  3M8U A;  3U92 A;  3T9X B;  2O1L A;  2F6P A;  2MKZ A;  3CRB A;  3QAX A;  5F7V A;  5LTC A;  4YMA A;  3W15 C;  1MM6 A;  4QHQ A;  1S7Y A;  4GWX A;  2I3V A;  2ZNT A;  2H4I A;  3K6X A;  2R6G E;  2HHM A;  4JXI A;  2THI A;  3V8X B;  4F29 A;  3C31 A;  4N6P A;  1N0T A;  1JVY A;  1KA1 A;  3BFT A;  2O7U A;  3K6V A;  4QSC A;  4F1U A;  4MAG A;  1UQW A;  5AA1 A;  3OEM A;  4GVO A;  3VE1 B;  1OMP A;  1WVJ A;  1NNT A;  4GXA A;  2DDK A;  3SEY A;  2Z23 A;  1ELJ A;  1UTB B;  4GBV A;  2B4M A;  5KZT A;  5DVF A;  5ET8 A;  1A55 A;  4ECF A;  5ELV A;  1NMU A;  5DVI A;  3HHG A;  1TFD A;  2Z8D A;  4ELO A;  3EHS A;  1SW4 A;  2I3W A;  2Y7I A;  5CI5 A;  5AA2 A;  2AIX A;  1JVX A;  3LC8 A;  5ESY A;  5KCJ A;  2UYF A;  1N3X A;  4Q0C A;  3FZV A;  4P1E A;  2GFE A;  3TFL A;  3EKI A;  4XKN A;  2HCA A;  2VPO A;  1PDA A;  3VDF A;  5DYH A;  5TPA B;  2L5V A;  4NTL A;  5FHN A;  2I4B A;  3MP1 A;  3E79 A;  2HZK A;  5EYF A;  3C4M A;  4JVI A;  4PFU A;  1IXH A;  4DI4 B;  1DCU A;  3LSF B;  1B3L A;  4RK9 A;  2UVI A;  2DWA A;  3CIJ A;  1GVC A;  3C32 A;  3MPL A;  4OHN A;  3N5L A;  2DE2 A;  3CVG A;  4X48 A;  4PAK A;  4OWD A;  1MQG A;  5FHO A;  1FBG A;  4GIZ A;  3D4C A;  1HSL A;  2WKY A;  1YZ0 A;  2FYI A;  2ONK E;  2ANJ A;  2Y7R A;  4HE2 A;  2OX3 A;  1URD A;  4EF1 A;  3K0V A;  5I5P A;  2XXI A;  1FQB A;  1NNK A;  4NWC A;  3V83 A;  2XHD A;  2KR0 A;  1QUK A;  3VXC A;  1EH3 A;  2PMS A;  3CSB A;  3SEU A;  4N6K A;  1FBP A;  3ILT B;  3GXA A;  1LAX A;  4F3S A;  3TTK A;  3H6U A;  4XFE A;  5DTB A;  4FAT A;  5CRY A;  1UTB A;  1SI0 A;  2F7A A;  3GYY A;  1URG A;  2P3V A;  5ITP A;  5L9S A;  2Y7W A;  3MBP A;  4GD5 A;  1ZBM A;  2Q89 A;  5F24 A;  1M5D A;  4MX6 A;  3T1B A;  1FTA A;  2I0B A;  5TPA A;  1POT A;  3SZP A;  2HFB A;  4HE1 A;  5H8N A;  5ICT A;  2GQ1 A;  3TKD A;  4M1V A;  3KOS A;  1FPG A;  4UA8 A;  4DCY A;  1AWB A;  3FJG A;  2UVJ A;  4IGR A;  3WAE A;  5ET5 A;  3G3K A;  3A3U A;  3O9P A;  4LP2 B;  1TXF A;  2NVU B;  5T3J A;  5CMK A;  3QYT A;  1NI9 A;  4KR5 A;  2Q74 A;  3KEI A;  3U93 A;  4DE8 A;  4PAF A;  1UTH B;  2OZZ A;  4JBZ A;  5K2X A;  4DXB A;  3WAF A;  4R2F A;  3OO9 A;  1FBF A;  1GGG A;  2QJE A;  4Q5T A;  2QL3 A;  4P56 A;  4I1D A;  3T66 A;  1I6B A;  4LZ7 A;  1RDZ A;  3CSG A;  2DP8 A;  1MG1 A;  1JW1 A;  5CBS A;  3TEL A;  4HXV A;  1LB9 A;  1LBC A;  2I58 A;  2HAU A;  3VV5 A;  3KOT A;  1DPP A;  5JTY B;  3GLB A;  3IB1 A;  1YCJ A;  1JEU A;  3ROJ A;  3SEX A;  2OPE A;  3MPK A;  4ZE8 A;  3TDJ A;  1FPB A;  4NF6 B;  4H8J A;  5K2Y A;  3UOR A;  4OES A;  1FCK A;  4PBH A;  3MP6 A;  5H8H B;  1T0K A;  4EQ9 A;  3S9N C;  1LAH E;  1USY H;  4IO6 A;  3LV0 A;  2XD2 A;  1AL3 A;  4PCD A;  3OEN A;  2WBB A;  4MMP A;  1NV3 A;  2A5T B;  4OQO A;  5IZ3 A;  3ONM A;  4PTK A;  3KFM A;  3H3G A;  3G3H A;  1AMF A;  4H65 A;  4K3F A;  1NV2 A;  4GX4 A;  1R6Z A;  2M8C A;  4OER A;  1A7L A;  4DXU A;  2OPD A;  5AA3 A;  2VPN A;  1NV0 A;  4IY6 A;  1K9Z A;  2UVH A;  4I3E A;  1FQE A;  3CR9 A;  3UGW A;  1P1N A;  4MLV A;  3T22 A;  3MP8 A;  3Q26 A;  3RQT A;  4RNS A;  1MQJ A;  3Q25 A;  5IM2 A;  4GWU A;  1DMB A;  2F6G A;  4Q8R A;  3SET A;  3SEW A;  3HO7 A;  4FJP A;  2I6E A;  3FXU A;  2Q8M A;  4ISU A;  1UTH A;  2Q2C A;  1FQC A;  1LBY A;  2V4C A;  2CZK A;  4BDL A;  1FBC A;  3BKI B;  3UA8 A;  4P1L A;  3FJ7 A;  2Q9T A;  4ONY A;  4O3C A;  3IAZ A;  1LAG E;  4C0R A;  2ZYK A;  1Y4T A;  3KSX A;  1YAE A;  4GOT A;  1HSE A;  5H8Q B;  5JTY A;  1LFG A;  2GRV A;  4IGT A;  3VXB A;  2XXQ A;  4N13 A;  3R7X A;  4YKK A;  4GWZ A;  1FTJ A;  2Q88 A;  4NF6 A;  4GX3 A;  2X7Q A;  1YPN A;  5H8H A;  2DXR A;  2XX9 A;  1SQY A;  3TZA A;  4X1D A;  4N8G A;  4JWY A;  1ATG A;  3BFU A;  1B1X A;  4LA9 A;  3QXM A;  5A5L A;  1DK4 A;  2Y5L A;  2F3D A;  4NF8 B;  2P0S A;  4GBW A;  3EQ1 A;  4RY1 A;  3QUF A;  3HCQ A;  3QUJ A;  1FSA A;  4OET A;  3FXQ A;  4LQ2 A;  2VP1 A;  4U4S A;  3AXF A;  4X1B A;  5DVJ A;  4BDQ A;  1KZ8 A;  3VVF A;  3VLU A;  1MY2 A;  3IOU A;  1IEJ A;  5EQ8 A;  2ESN A;  3CHG A;  2PT2 A;  1II5 A;  1MXV A;  5I84 A;  3IO6 A;  3RTW B;  4N8Y A;  2QS3 A;  2D5W A;  3A09 A;  4LAT A;  4P0G A;  1OLC A;  3PTY A;  4F1Y A;  4P8B A;  4TLM B;  4OTE A;  1I69 A;  1GR2 A;  3LUY A;  4H67 A;  4R6K A;  3H7M A;  1NUZ A;  3PUW E;  4R73 A;  2XXP A;  3MWB A;  3RNN A;  3UN6 A;  2ZMB A;  3EN3 A;  4IO7 A;  5ET6 A;  4ESW A;  5KCJ B;  2NWJ A;  3LSX A;  5H8Q A;  1A99 A;  5HPQ A;  3SEV A;  2KQZ A;  3H6T A;  1BK4 A;  1VSO A;  3PMV A;  3HST A;  3T93 B;  4PDD A;  5AA2 D;  2BJI A;  4BDO A;  2CMO A;  3C35 A;  4ZEK A;  5I58 B;  2QPQ A;  1Y9U A;  2D3I A;  4DDD A;  4H1X A;  3RPW A;  4YKP A;  1GV8 A;  2DS9 A;  1P1W A;  4DZ1 A;  2F3B A;  1FJ6 A;  1CNQ A;  1P1Q A;  1SYH A;  4G8N A;  2O84 X;  1CE2 A;  4H5F A;  3K01 A;  3RTF B;  1Q9D A;  1B32 A;  3O29 A;  4EXL A;  2H98 A;  3G3I A;  1IXC A;  1BKA A;  2QRY A;  3U1O A;  4XEQ A;  4ZS9 A;  1N84 A;  1FRP A;  3S9M C;  3CI8 A;  3DP4 A;  3TQL A;  4P9K A;  4MIJ A;  3KC0 A;  3C33 A;  1LBX A;  3TQW A;  1MXX A;  4JVD A;  1NV7 A;  1MXW A;  2ZYM A;  1FBE A;  4U22 A;  3N6U A;  1IIT A;  1SBP A;  2YJP A;  5F1Q A;  2DSF A;  2R9J A;  3KBZ A;  3B6T A;  1QKA A;  4Z7E A;  1EZP A;  1IUD A;  4EQ7 A;  1D9Q A;  2NXO A;  1JW5 A;  3O28 A;  4PE5 B;  1DBZ A;  1A54 A;  1LEV A;  1HSJ A;  4MEV A;  3DM0 A;  1ZMG A;  2HEU A;  3TAJ A;  4QRZ A;  3RT8 A;  1MQH A;  4DIG A;  1A40 A;  3K02 A;  4TLL B;  4G8H A;  1M5F A;  3FXR A;  1EZO A;  1IMD A;  3LSW A;  1EYI A;  4I9D A;  3QIM A;  5H8N B;  2G93 A;  1WOD A;  4NF5 B;  5IAI A;  5I58 A;  3H6V A;  5LOM A;  2CEX A;  2ONS A;  2D21 A;  4O3A A;  4OEN A;  4QFN A;  4NED A;  5IZZ A;  4IO3 A;  4RYA A;  3CFZ A;  5L9M A;  4ZEF A;  4PE3 A;  3EPE A;  4N4U A;  3TCG A;  4P47 A;  3PUX E;  4U2R A;  3K1N A;  4NGU A;  4HW8 A;  4ZEI A;  2DYX A;  1XS5 A;  1FPE A;  1PB7 A;  1MM7 A;  1VFD A;  4PAI A;  1NV4 A;  5ISU A;  1RDX A;  4GWY A;  2W7Y A;  3MW0 A;  2QS1 A;  3T96 B;  4KQP A;  4C1T A;  4YKJ A;  3QK6 A;  3IB2 A;  1IZ1 A;  2WX9 A;  4XKP A;  4YKI A;  2VHA A;  3RN8 A;  1PB9 A;  3LR1 A;  1ANF A;  2NUV A;  3RPL A;  5DEX A;  1XT8 A;  1B5H A;  3DP6 A;  4MH5 A;  4HCW A;  4KYD A;  4N15 A;  4WEP A;  3JV9 A;  4OVT A;  3BIH A;  1Y1M A;  2PFY A;  3PUY E;  4O94 A;  1WDN A;  1MY3 A;  1D3K A;  4EF2 A;  3IJX B;  4DI3 D;  2FIX A;  1NUY A;  3HN0 A;  5A5X B;  4G68 A;  5CMB A;  3EHU A;  2YPN A;  3MYU A;  1B2H A;  3USD A;  1VR5 A;  4YB6 A;  4RPN A;  3D1R A;  1OIB A;  1SW2 A;  3VLV A;  2QMX A;  4JWX A;  1PC3 A;  2XXU A;  4C1U A;  5IZ3 B;  1H3D A;  3IL1 B;  4GFR A;  2RC8 A;  3VLW A;  1Q35 A;  5B70 A;  3IO4 A;  2OBG A;  4NF5 A;  4FBP A;  1ZU0 A;  3QSL A;  1JET A;  5CMC A;  2X7P A;  3SDF A;  2HZL A;  2ZYN A;  1QGX A;  4N17 A;  4POX A;  1POY 1;  1FQA A;  4AS5 A;  4UAB A;  5HM4 B;  1SW1 A;  4OA4 A;  4G8M A;  1H45 A;  2BJJ X;  3OO8 A;  5TU0 A;  2ZXT A;  3ZSF A;  3DEL B;  2AYS A;  3MQ9 A;  4HTG A;  1KWH A;  3HV1 A;  2ZNU A;  2Y7K A;  3JYR A;  3OSQ A;  1SD3 A;  1JNF A;  5EQ7 A;  4NWD A;  4TOZ A;  4F2O A;  4GQO A;  5J1D A;  1LFI A;  4EQB A;  3IFA A;  2H9B A;  3OO6 A;  1Q1K A;  1MY4 A;  2ZZX A;  3PUZ E;  4GWS A;  1ZKB A;  1NV5 A;  3IOR A;  2HPG A;  3MVY A;  3R6U A;  4ZE9 A;  4PF8 A;  2F7B A;  4ND9 A;  3FVK A;  1OQH A;  3Q29 A;  5BWJ A;  2HXW A;  4G4P A;  4NX1 A;  3TCH A;  5H8F A;  2VT5 A;  1O63 A;  3T0J A;  4H5G A;  5A5X A;  5DW8 A;  2WYP A;  4FEC A;  1NH8 A;  4Q30 B;  2QVR A;  5I59 B;  1IMB A;  4ZEC A;  3I5O A;  3O66 A;  3OD7 A;  3OMB A;  4MNC A;  3SER A;  3S9E A;  2XXY A;  3MC2 A;  3IJO B;  3MUQ A;  2DVZ A;  4PFB A;  2HQ0 A;  1MXY A;  5JK4 A;  5I7I A;  3HHF A;  4NF4 B;  1XI6 A;  3KN7 A;  2V93 A;  1XVX A;  4HCY A;  3B7D A;  4OFO A;  3Q28 A;  2QSX A;  2O6A A;  1INP A;  3CG1 A;  3TTL A;  3O2A A;  2VGQ A;  4YB5 A;  3E9X A;  4F18 A;  4BDR A;  1FQD A;  4G68 C;  4JB7 A;  4P0I A;  3PUV E;  4G61 A;  3B50 A;  4THI A;  3TMG A;  3BIG A;  2B3B A;  3F11 A;  1EZ9 A;  2WEF A;  4EXK A;  1Y20 A;  4KCD A;  3PMX A;  3LBS A;  5I2K A;  1LBW A;  4R2B A;  4KI0 E;  2AL4 A;  5AA4 B;  4U21 A;  1IQ7 A;  4EUO A;  3O97 A;  3KC1 A;  2I49 A;  3EHT A;  2A5S A;  1VFE A;  2QMW A;  4I3Y A;  4U4X A;  1XVY A;  2DE4 A;  1MDQ A;  3MVX A;  1B3F A;  4DXC A;  4PFY A;  3LSL A;  3RLF E;  1N3W A;  3PGF A;  4DCX A;  2E1S A;  1B4Z A;  4O7I A;  1D9Y A;  1LST A;  1NL5 A;  3KJT A;  2V3T A;  2RC9 A;  2P2A A;  3FAT A;  4IB2 A;  5CMM A;  2E0S A;  4RPO A;  1US5 A;  1VE4 A;  4O3B A;  2Z22 A;  4QSE A;  4GLI A;  4MHF A;  2F78 A;  5I59 A;  1B05 A;  1MRP A;  1OLA A;  1P99 A;  4G77 A;  4R6H A;  4MLQ A;  3T9U A;  2PX1 A;  3MVW A;  4MF3 A;  4H46 A;  4H6D A;  4AB5 A;  1OVT A;  2OWZ A;  4KD5 A;  3KJ7 A;  4PP0 A;  3PMW A;  4YZZ A;  2QVU A;  4NF4 A;  1Y3N A;  2PYY A;  3GZG A;  4ZZE A;  1P1O A;  1RKM A;  4PET A;  1MQI A;  4I62 A;  4H45 A;  4FEB A;  2QVV A;  2RIN A;  3E3K A;  2F97 A;  4RJZ A;  2XWV A;  1MH4 A;  2ONR A;  3I6V A;  1H44 A;  2DE3 A;  3FUZ A;  5CM6 A;  2XXK A;  2PT1 A;  3N26 A;  1FPD A;  3PPR A;  4QFO A;  4ESX A;  1F9B A;  3FJM A;  3O6H A;  3IR1 A;  2FBP A;  4R9F A;  3FD3 A;  2B4L A;  3THI A;  3SES A;  2AL5 A;  3U8Q A;  3TUS A;  4X04 A;  3VFJ A;  3C36 A;  4QFK A;  2Y7P A;  3OOA A;  2FNC A;  3RGY A;  4BLA A;  5AA4 A;  1QVS A;  1ZTY A;  4F3G A;  1R1N A;  3OXN A;  4JDF A;  3M3F A;  4XF5 A;  1NFT A;  4F19 A;  4FAJ A;  4XKQ A;  1XHY A;  1FTM A;  3HFU A;  3H06 B;  2QS4 A;  4JVC A;  5EHS A;  4BDN A;  1N04 A;  5IGA A;  3O6I A;  1B7H A;  4PGN A;  1G0H A;  1G0I A;  2O1M A;  3MST A;  3MZ1 A;  2B3F A;  4GWO A;  5FTH A;  3GBA A;  1B0L A;  4GWW A;  4U23 A;  4KCC A;  1AH5 A;  2XXV A;  1A8F A;  2DWI A;  2DXY A;  3O6G A;  4OVQ A;  4WXJ A;  4FIM A;  2UVG A;  3FVN A;  5TP9 A;  2KLF A;  2QS2 A;  3E4R A;  4IO5 A;  1QUJ A;  2XWO A;  2RF1 A;  3RY3 A;  2UXA A;  4OFJ A;  2B65 A;  3K00 A;  1DTG A;  1B0H A;  1B6H A;  1FTL A;  2CZI A;  4UAC A;  3JZJ A;  4GL8 A;  4XXU A;  4LN5 A;  3FBP A;  1YXI A;  1MY1 A;  4MNP A;  2WBD A;  2R8T A;  2ZYO A;  2XX8 A;  4GRK A;  1B9J A;  1RYO A;  1JP4 A;  1TWY A;  3PPN A;  4QFP A;  2O51 A;  3RPL B;  2VD3 A;  4PQJ A;  2CEY A;  4MFI A;  5DEX B;  4Z0I A;  1B7Z A;  1IME A;  1YTV A;  1JEV A;  4E0X A;  1MPB A;  1QKB A;  4OMB A;  3EF7 A;  3L6H A;  1LBB A;  4PGP A;  3QMF A;  1ZIU A;  3PPO A;  4IO4 A;  1NKX A;  2YLN A;  1RDY A;  2CZH A;  1B46 A;  4G68 B;  3OEK A;  1NV6 A;  1LCF A;  3ILU B;  4U1O A;  4F1V A;  2PVU A;  4PFR A;  4X9T A;  4POW A;  4QFL A;  1IXG A;  1H43 A;  2XWI A;  3T9H B;  3IOT A;  3RT6 B;  4ZDM A;  1B3G A;  4YMB A;  1TT1 A;  4WKM A;  3IK6 B;  2PBW A;  2PCR A;  1LGB C;  2IA4 A;  2Z8E A;  2OWS A;  3IB0 A;  2PFZ A;  3H4Z A;  4YIC A;  4PFI A;  1GTK A;  2JJK A;  3OO7 A;  4FOR A;  2DQV A;  1FTK A;  4I40 A;  3DLN A;  3ZS6 A;  3C9H A;  4MBP A;  5I57 B;  2ZNS A;  4JSD A;  5KDT B;  1US4 A;  4F3B A;  1S50 A;  4P11 A;  1IMA A;  4FE8 A;  4YAH X;  5I56 B;  1URS A;  2GH9 A;  2OK2 A;  5CC2 A;  4X8R A;  3MJN A;  1B1H A;  4ZED A;  2REJ A;  3IOV A;  4NE4 A;  2XXW A;  3G3F A;  3PPQ A;  1MH3 A;  4KYS A;  4DLD A;  2QFL A;  2Q8J A;  4QSD A;  3S4U A;  3B6W A;  5EQA A;  4OFL A;  1MPC A;  2RCA A;  3SKP A;  5M2V A;  3PV0 E;  5I3S A;  2H99 A;  3FVO A;  2OJT A;  3IOW A;  1Y3Q A;  1NV1 A;  5IKB A;  5H8F B;  1XC1 A;  3H6W A;  2H5Y A;  4R75 A;  3G3G A;  1BIY A;  2XX7 A;  2CZL A;  3R26 A;  1NNP A;  3KG2 A;  4F3P A;  4KPT A;  1QW0 A;  4PBQ A;  2RKM A;  1B51 A;  1R9Q A;  5ICQ A;  3N6T A;  1PEB A;  4KHZ E;  3UP9 A;  5B7D A;  2ZZV A;  4O8M A;  1M5C A;  3MZB A;  1Y3P A;  1B5I A;  1N7X A;  4LVQ A;  3K1M A;  3V89 B;  1CB6 A;  3ISP A;  4MCO A;  4H8I A;  3P7I A;  4R74 A;  1PBQ A;  4HS7 A;  1VDW A;  5ITO A;  1FPK A;  3TTN A;  3FAS A;  4ELP A;  4F22 A;  5I57 A;  4QF9 A;  5KDT A;  4ELR A;  4IR8 A;  1QJM A;  2LAO A;  4KYE A;  3W9V A;  4ZZA A;  1MQD A;  5I56 A;  5I2K B;  5L8D A;  1IXI A;  5J16 A;  4NG7 A;  4TQU Q;  5CBR A;  2I0C A;  5I2N B;  1Z7M E;  4RK2 A;  4NQ8 A;  3B6Q A;  5HBC A;  5ET7 A;  4PF6 A;  3U65 A;  4F2Q A;  4N07 A;  3HPI A;  3IX1 A;  4RXL A;  2FA7 A;  1B4H A;  3W9W A;  2OLB A;  1MPD A;  4PFT A;  3RUM A;  1A8E A;  1NUX A;  2V3U A;  3ZKL A;  1FTO A;  1FW0 A;  4N6D A;  3FXB A;  3FVG A;  2IEE A;  1LBV A;  1DTZ A;  1MXZ A;  4ZEB A;  3PPP A;  4P3L A;  2O68 A;  4OAN A;  2Y5K A;  4OXV A;  3IFC A;  3MVZ A;  3C34 A;  4GX6 A;  4PDH A;  3DP8 A;  2FVZ A;  2ABH A;  2FIE A;  1NNF A;  3GBB A;  3KN3 A;  1P1U A;  4F39 A;  2F8D A;  1SVX B;  1MY0 A;  1I6Q A;  3UK4 A;  4GF8 A;  2XD3 A;  2VD2 A;  3OSR A;  5H8S A;  4NN3 A;  2NOO A;  1FBD A;  1Y1Z A;  4XIG Q;  3FV1 A;  2G29 A;  4AQ4 A;  1SYI A;  1FPF A;  3E13 X;  3KSJ A;  2WYK A;  1B52 A;  5EYH A;  1IMF A;  3PD8 A;  2P1S A;  1LFH A;  2ALU A;  3KZG A;  3TTM A;  1B5J A;  4PFW A;  3L6G A;  1BTJ A;  1RYX A;  1LBZ A;  2Y84 A;  2FHY A;  2XXT A;  4MNI A;  2O7I A;  3Q27 A;  3FGS A;  3B8B A;  1NUW A;  4EDP A;  3KN8 A;  1LB8 A;  1MDP 1;  1LCT A;  3VVD A;  1Z7N E;  1EYK A;  4NAP A;  4HE0 A;  3NOH A;  2XXH A;  4OVS A;  4LZ8 A;  5I2N A;  1AOV A;  3TPA A;  3CFX A;  4F31 B;  4H0W A;  3FV2 A;  1FPI A;  4G2Z A;  1J1N A;  1IMC A;  2DOJ A;  4N91 A;  1R9L A;  1BLF A;  3CG3 A;  3N94 A;  2F7C A;  1SW5 A;  5AE4 A;  1D9V A;  4OEV A;  4O7M A;  4KXP A;  2REG A;  4MJO A;  1QUI A;  3V5A A;  4LQ5 A;  4GXS B;  4JWO A;  4R72 A;  3TYH A;  1SI1 A;  1UIU A;  4OVP A;  1N76 A;  4LZ5 A;  1NH7 A;  2UYE A;  3K1P A;  3K6U A;  1N7W A;  1XOC A;  4GL0 A;  5FBP A;  4XKR A;  2HXR A;  4NHB A;  4QBA A;  1B3E A;  2ZZW A;  1O64 A;  2VOZ A;  5EQ9 A;  1JW4 A;  5TP9 B;  1OQG A;  3A29 A;  4L17 A;  3U72 A;  3FIR A;  4LON B;  4YU0 A;  1YYZ A;  1L5T A;  3U94 A;  5L9O A;  1M5E A;  2V3Q A;  1JQF A;  2F5X A;  3S9L C;  3S2V A;  1SPI A;  1B58 A;  3T9V A;  3K6W A;  1MXU A;  1SDX A;  1K9Y A;  3VVE A;  1PB8 A;  3K4U A;  4R9G A;  1M5B A;  1D4N A;  1FBH A;  4IO2 A;  1BP5 A;  2A5T A;  1I6A A;  1FJ9 A;  2Q2A A;  4IY5 A; 
#chains in the Genus database with same CATH homology
 2CEY A;  3LV0 A;  1FPL A;  3E78 A;  1IME A;  4PCD A;  4DI3 D;  2FIX A;  2WBB A;  4MMP A;  1NV3 A;  1NUY A;  5IZ3 A;  4PTK A;  5IZ1 A;  5LDZ A;  4PGP A;  3QMF A;  3MYU A;  3D1R A;  1NV2 A;  4GX4 A;  1RDY A;  5IZ3 B;  2CZH A;  1NV6 A;  2VPN A;  4F1V A;  1NV0 A;  1K9Z A;  4PFR A;  4X9T A;  4I3E A;  2XWI A;  2XWK A;  4PC9 A;  4FBP A;  2HZL A;  2PCR A;  1QGX A;  4QXD A;  4N17 A;  5IM2 A;  4GWU A;  4AS5 A;  4UAB A;  1KA0 A;  1FPJ A;  4OA4 A;  2PFZ A;  4YIC A;  4PFI A;  2JJK A;  2Q8M A;  1LBY A;  4AS4 A;  2V4C A;  2CZK A;  4I40 A;  1FBC A;  4P1L A;  5EQ7 A;  1IMA A;  5EYG A;  2Q9T A;  3LUZ A;  5J1D A;  3IFA A;  2XA5 A;  2ZZX A;  4GWS A;  1EYJ A;  1NV5 A;  4X8R A;  4OVR A;  2HPG A;  4PF8 A;  2QFL A;  4GWZ A;  4GX3 A;  5EQA A;  4NX1 A;  4N8G A;  2VT5 A;  4N81 A;  3RYD A;  3T0J A;  5I3S A;  2P3N A;  5DW8 A;  2WYP A;  4NF0 A;  2QVR A;  5A5L A;  1DK4 A;  2MKZ A;  2Y5L A;  1IMB A;  2F3D A;  1NV1 A;  5LTC A;  4GBW A;  4MNC A;  1FSA A;  4PFB A;  2DVZ A;  5JK4 A;  4GWX A;  5I7I A;  1XI6 A;  2HHM A;  1KZ8 A;  4PBQ A;  1KA1 A;  4HCY A;  5EQ8 A;  3CHG A;  4O8M A;  2ZZV A;  1INP A;  4F1U A;  4MAG A;  4F18 A;  4N8Y A;  4G61 A;  3B50 A;  2DDK A;  3ISP A;  4MCO A;  3PTY A;  4GBV A;  4P8B A;  2B4M A;  3BIG A;  5ET8 A;  1VDW A;  1FPK A;  2WEF A;  1NUZ A;  1LBW A;  5ESY A;  4IR8 A;  3KC1 A;  4P1E A;  5ET6 A;  3W9V A;  3EKI A;  2VPO A;  4I3Y A;  2DE4 A;  2L5V A;  5J16 A;  4NG7 A;  3E79 A;  2HZK A;  4JVI A;  4DI4 B;  1DCU A;  4NQ8 A;  2KQZ A;  5ET7 A;  4PF6 A;  3U65 A;  1BK4 A;  4PDD A;  2BJI A;  4O7I A;  3W9W A;  2QPQ A;  2DE2 A;  4PAK A;  1FBG A;  2F3B A;  1FJ6 A;  1CNQ A;  1NUX A;  4MHF A;  4N6D A;  3FXB A;  1YZ0 A;  1LBV A;  4H46 A;  1Q9D A;  4P3L A;  4OAN A;  2Y5K A;  4HE2 A;  2OWZ A;  2OX3 A;  3IFC A;  4GX6 A;  4PDH A;  5I5P A;  2FVZ A;  4XEQ A;  4YZZ A;  2QVU A;  2FIE A;  1FRP A;  2KR0 A;  4PET A;  4H45 A;  4P9K A;  4MIJ A;  4N6K A;  2QVV A;  1FBP A;  3KC0 A;  2XWV A;  4NN3 A;  1LBX A;  2DE3 A;  1FBD A;  4JVD A;  4XFE A;  5CM6 A;  2XXK A;  1NV7 A;  1FPF A;  1FPD A;  2WYK A;  1FBE A;  5EYH A;  1IMF A;  3GYY A;  2FBP A;  2P3V A;  2B4L A;  1LBZ A;  2FHY A;  4X04 A;  4MNI A;  5F24 A;  3KBZ A;  4MX6 A;  3T1B A;  3B8B A;  4XF5 A;  4F19 A;  1NUW A;  1D9Q A;  1FTA A;  1EYK A;  1DBZ A;  1LEV A;  3SZP A;  4NAP A;  4HE0 A;  3HFU A;  3NOH A;  4MEV A;  4OVS A;  4JVC A;  4HE1 A;  2GQ1 A;  5IGA A;  4M1V A;  1FPG A;  4PGN A;  1FPI A;  1IMC A;  1AWB A;  4N91 A;  1G0H A;  1G0I A;  1IMD A;  3MST A;  1EYI A;  4GWW A;  4O7M A;  4KXP A;  4MJO A;  5ET5 A;  2CEX A;  4OVP A;  4OVQ A;  5T3J A;  1NI9 A;  5IZZ A;  2Q74 A;  5FBP A;  2HXR A;  4PAF A;  4NHB A;  4PE3 A;  4QBA A;  2XWO A;  2ZZW A;  4N4U A;  4P47 A;  5EQ9 A;  4NGU A;  1FBF A;  4P56 A;  1FPE A;  3A29 A;  4PAI A;  1NV4 A;  1RDZ A;  1RDX A;  4GWY A;  2CZI A;  1YYZ A;  4HXV A;  2V3Q A;  2F5X A;  3FBP A;  4LN5 A;  1YXI A;  2WX9 A;  1SPI A;  4MNP A;  2WBD A;  2R8T A;  1K9Y A;  3RPL A;  3ROJ A;  1FBH A;  1JP4 A;  4HCW A;  1FPB A;  4N15 A;  1FJ9 A;  4OVT A;  3BIH A;  2PFY A;  4PBH A;  3RPL B;  4O94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...