5F24A

Crystal structure of dual specific impase/nadp phosphatase bound with d-inositol-1-phosphate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
260
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 74
structure length 260
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5f24A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5f24A02
2PCRA 2WBBA 2BJIA 4GWXA 1DK4A 4HXVA 3LV0A 5T3JA 3BIGA 1INPA 5ET8A 4GX6A 3T0JA 1QGXA 5IZ1A 1DCUA 2CZHA 1FPIA 1NV3A 4I3EA 1NV1A 1NV2A 4QXDA 1FPGA 1NUYA 5F24A 1K9YA 3RPLA 1VDWA 5EYGA 1RDXA 2JJKA 4AS4A 4FBPA 2QVUA 2FHYA 1NV5A 4O7IA 5IZ3B 1FBGA 4H46A 1EYIA 3RPLB 1FPJA 4PTKA 5EYHA 1KA1A 1RDYA 5A5LA 3FBPA 1NV6A 1FRPA 2QVVA 1FBHA 1FPLA 4G61A 5LDZA 2QFLA 3ROJA 3LUZA 5J16A 1EYJA 2FIXA 1NUZA 4GWUA 1SPIA 2OX3A 4HE1A 1FSAA 1DBZA 1AWBA 1LEVA 1FTAA 1BK4A 1FPBA 5EQAA 1LBYA 1KZ8A 3IFAA 5DW8A 4GBWA 2F3BA 4I3YA 2CZKA 1CNQA 1IMAA 1LBZA 1NI9A 2CZIA 4GWYA 5ESYA 5EQ7A 1FPEA 1LBVA 3KC1A 1XI6A 1IMCA 1FBFA 2FVZA 3KC0A 1IMEA 1NUXA 1Q9DA 2WBDA 4GX3A 1FBEA 4IR8A 1YXIA 3A29A 1FBPA 2Y5LA 1K9ZA 3B8BA 4HE2A 1RDZA 2HHMA 5ET7A 1IMFA 1LBWA 5ET5A 1FPFA 5ET6A 1FJ9A 2DDKA 2Y5KA 1IMBA 4HE0A 3D1RA 4GWWA 1FBDA 2GQ1A 1NUWA 4GWSA 2P3VA 2Q74A 1G0IA 2F3DA 1JP4A 2VT5A 1FJ6A 1NV4A 4MJOA 5FBPA 2R8TA 4I40A 1YZ0A 2OWZA 4H45A 4GWZA 4AS5A 3KBZA 3QMFA 2Q8MA 1NV0A 2QVRA 5EQ8A 1LBXA 1D9QA 1FBCA 4GX4A 5EQ9A 5IZ3A 2WEFA 1YYZA 3BIHA 3RYDA 3IFCA 4KXPA 1EYKA 2P3NA 1G0HA 1IMDA 1FPDA 2FIEA 1KA0A 2FBPA 1NV7A 4N81A 4GBVA 1FPKA 5I3SA
chains in the Genus database with same CATH superfamily
3Q25A 3RTWB 1B6HA 4KQPA 3LV0A 4OFOA 2H9BA 5IZ1A 2RCBA 4BDNA 3KEIA 1OMPA 2XX7A 4MMPA 1P1NA 4GD5A 3MUQA 2THIA 1SW5A 4AS4A 1TXFA 2H98A 3U92A 3TTNA 3KSJA 2P0SA 2KR0A 1I6AA 2I4CA 4ZDMA 3OO8A 1LAHE 4XTCQ 2DSFA 5IZ3B 1MY1A 1UTBB 3VLUA 5FHOA 2CEXA 3T96B 2QFLA 3IOTA 5KDTB 1FTOA 3NOHA 3TUSA 4OVSA 1FTAA 3L6HA 4XEQA 3U93A 1HSLA 1UTHA 1QULA 2DP8A 1LBZA 5F1QA 4GIZA 1IMCA 2QRYA 1NUXA 2WBDA 1VFEA 3DM0A 4R2BA 4P11A 2WX9A 1DOTA 4FORA 3H4ZA 4YZZA 2Y5KA 1IMBA 4XKRA 3BBRA 4R6KA 3GZGA 2GQ1A 1FTJA 1P1QA 5HPQA 2XWKA 1URGA 2F6PA 4XXUA 4U4XA 4LQ2A 4F22A 4MJOA 1LAFE 5L8DA 2R8TA 1B3LA 3HN0A 4QSCA 3ISPA 5DEXA 5I56B 1Y3QA 3PPOA 4IGRA 2XX9A 3PMVA 3T93B 3TELA 1QKBA 5I5PA 2DE4A 4QSDA 1XT8A 2HZKA 4F29A 4F31B 1DK4A 5CMCA 4X04A 2B65A 5AA2B 4LZ7A 4JSDA 3N6TA 5H8QA 2AYSA 3CVGA 1LAXA 1AH5A 2HFBA 4OFLA 3W15C 4RK9A 1T0KA 1NV5A 1MQIA 1EZOA 3MPLA 5EYHA 2ANJA 2FA7A 4BDQA 2WKYA 2R6GE 2H5YA 4NE4A 3S9MC 2XXTA 3PMWA 1FSAA 1N84A 1MY3A 4F3SA 5I58B 2UVJA 4JVCA 5AA4B 1LSTA 5L9OA 4GFRA 3SEUA 2RF1A 2NVUB 3MSTA 4O3CA 3CSGA 1Q9DA 2F5XA 3H03A 3K02A 1NNPA 3T1BA 2O1LA 2Z22A 1B3GA 2VD3A 1LFIA 4NWDA 3K1PA 3QYTA 1ZJLA 1G0IA 3S4UA 1MM6A 4GWOA 3T9UA 3VXBA 2Z23A 2OWZA 3OO9A 3KBZA 5EQ8A 3PUZE 5I2KB 2ZNTA 1LB8A 3C35A 2WYKA 1EZ9A 4IY6A 3FGSA 3HPIA 2CEYA 4X9TA 4POWA 3TPAA 1B5HA 2HAUA 1HSJA 3C32A 3JYRA 4GXSB 4P8BA 2F35A 4HCWA 1A7LA 5M2VA 4PF6A 1Y1MA 1RYOA 2CZLA 5KCJA 2Q8JA 2F78A 3IJXB 4KYDA 3C33A 2MKZA 4LVQA 4ECFA 4R9FA 5I59B 4YMAA 4LZ8A 3LC8A 4QF9A 1PBPA 1XC1A 5H8HB 1O64A 2OWTA 1EYJA 1JEUA 2XHDA 3PUVE 2FIXA 3TTKA 3RQTA 4HW8A 4FEBA 1FQCA 1MXUA 1S50A 5DW8A 3H6UA 2XXHA 4G4PA 4EQ7A 3G3HA 2QMWA 1A99A 5FBPA 2HEUA 3RLFE 5I57B 2DYXA 1JW4A 4MFIA 2I3WA 1QJMA 3LSXA 4P1EA 1P1OA 1OQHA 4KYSA 1UIVA 1MXYA 1RDZA 1FQAA 3M8UA 2DDKA 1ANFA 4PGNA 4H5FA 4H67A 1JQFA 2OPDA 3IR1A 2VP1A 2W7YA 2VT5A 1Q1KA 1M5DA 4PC9A 4XKNA 5IAIA 3PUWE 4ZE9A 3OSQA 1NV0A 1FBCA 2QS3A 4DLDA 1YYZA 3V83A 3E79A 5ITPA 1KA0A 2AL5A 5I3SA 4K3FA 2DVZA 1MQGA 3FD3A 2BJIA 3TCGA 4PBHA 2HZLA 5L9SA 3HO7A 1DCUA 4OMBA 2G29A 3K00A 4EF2A 1NNFA 4ELRA 1QKAA 1FQFA 3MPKA 5CM6A 5F24A 5EYGA 4R2FA 4LATA 3MP6A 1XOCA 1RDYA 5A5LA 3FBPA 1ZBMA 4ZEBA 5LDZA 4G61A 4GLIA 1MQJA 2OX3A 2PX1A 3PMXA 3FVGA 3I6VA 2DE3A 4AB5A 4I9DA 4X8RA 3O9PA 5FHMA 1CNQA 3JV9A 2CZIA 2G93A 4NF8B 4IR8A 4NTLA 3OMBA 4GL8A 2XWIA 1MS7A 1FJ9A 4OA4A 2XWVA 1B3HA 3FUZA 3DP8A 4HCYA 3CHGA 1NKXA 3KZGA 5BWJA 3D1RA 1OVBA 2Y84A 2DWIA 3MQ9A 2V84A 3FXQA 3EN3A 5CMMA 1A55A 4GVOA 4Q5TA 3ZSFA 2F7BA 2OLBA 2Q8MA 2B3BA 5B7DA 4R72A 5AA1A 4PFBA 4GBVA 4Z0IA 4PETA 2XXKA 4OZ9A 3ONMA 1MY2A 4JBZA 2X26A 4GX6A 3T0JA 4O8MA 3EF7A 5JEIA 1Y4CA 3RT8A 4NQ8A 1N7XA 4QXDA 3VVFA 5I2NA 4MAGA 4ISUA 3LUYA 4WXJA 5DVJA 2A5TA 1US5A 4YU0A 2O68A 2Z8DA 3RPWA 4OVPA 2REJA 4DZ1A 4F18A 2VOZA 4GOTA 1FPLA 4OENA 1TWYA 3CFXA 1BP5A 3IOVA 4TLLB 4PFUA 4PE3A 1B5IA 4YB6A 3LR1A 3V5AA 3SEYA 1H76A 4XF5A 3T9XB 1SW2A 2CZKA 3H7MA 4NWCA 4DIGA 2PYYA 4R6HA 2ALUA 3KJ7A 4IO4A 2Y5LA 1HSEA 4YKJA 4HE2A 1B7UA 2AIXA 3GYYA 3TEPA 4JXIA 3OO7A 1B9JA 5ET5A 5ET6A 1GTKA 2P2AA 3U8QA 4JB7A 3PUYE 4QFKA 2I0CA 4JVDA 2F3DA 4UACA 1MH3A 1FJ6A 1YCJA 3MZ1A 4OVTA 3QMFA 4YB7A 1D9QA 4F3GA 1TFDA 1M5CA 1LBCA 5TPAA 3SDFA 3O97A 2R9JA 2PMSA 1DMBA 5FHNA 2I49A 2RKMA 3SEVA 1Q35A 4P9KA 2UVHA 2Q2CA 1FTLA 1INPA 2V4CA 4PE5B 3G3IA 1NV2A 1FPGA 5HM4B 1NUYA 1LAGE 1ZMGA 3F11A 5A5XA 4NF0A 1B1XA 1D3KA 1ZIUA 4PTKA 1MPBA 3FZVA 1NNKA 2XXVA 2XXWA 2V3TA 3KN8A 1SI1A 2ONKE 2VGQA 1I6QA 1NUZA 1SPIA 1B4ZA 2RINA 4KCCA 1US4A 1MH4A 1FPBA 1BTJA 4H1XA 1B1HA 5I84A 4MNIA 4GBWA 2ZNUA 1JW5A 1R6ZA 5AA2D 1ZLQA 2UVIA 1OLCA 3TKDA 1Y9UA 1SDXA 2VPOA 3FIRA 4E0XA 1EH3A 3K0VA 4QFNA 3LSFB 2I58A 2VHAA 3TCHA 3RGYA 2ZZWA 3BFUA 4TQUQ 1FBDA 3PTYA 1NMUA 1POTA 1MM7A 2QL3A 4N8YA 4MBPA 4NF5A 3K6WA 2ZYKA 4UA8A 3MP1A 4YB5A 3QAXA 5H8FB 1B7ZA 1MY4A 3KBRA 2OPEA 5JTYA 4GWZA 4N91A 3RTFB 1XVYA 4P1LA 3IOWA 3MP8A 1OVTA 1YPNA 3VDFA 5FTIA 5H8NA 3K2DA 3C34A 4IO2A 1FPKA 2WBBA 3TCFA 1JVXA 2DVCA 4MLVA 3TODA 3K4UA 2CZHA 4MHFA 4U23A 2Y7WA 1TFAA 1QUJA 4FE8A 5JK4A 4NAPA 3GBBA 5DYHA 4PBQA 3ZS6A 4RA1A 3CRBA 4ZZAA 2DQVA 3EKIA 4ESWA 4H6DA 1Z7NE 3HHGA 5J16A 4BDMA 1M5BA 4NEDA 4RPOA 1R9LA 1B3FA 2X7QA 3PU5A 1MQDA 3Q27A 2GHAA 3O66A 4O3AA 2O6AA 1IMEA 3KSXA 1A8FA 2BJJX 3IO4A 2V3QA 2DWAA 4E0WA 3EHTA 4JVIA 4F3BA 2UYFA 3EQ1A 1LLSA 2B4LA 4MCOA 4N8GA 4IO5A 4MLQA 2H99A 3N6UA 3T66A 3TAJA 4WEDA 3CR9A 4G68B 4Q0CA 1D9VA 1VR5A 4MH5A 4BLAA 2HXRA 1B0LA 3MJNA 4ZEFA 4G8NA 1M5EA 1WDNA 4NF6B 1JNFA 5IZ3A 2Z8FA 2F34A 4LP2B 2QS4A 2P3NA 1G0HA 2E0SA 3IB1A 3K1NA 2F36A 5KDTA 1SBPA 1MXXA 2B4MA 4JWXA 2UVGA 2Q89A 4EQ9A 1B46A 4I3EA 3VVEA 3UP9A 1DPEA 3G3KA 1B51A 4Q30B 3THIA 4X1BA 4OHNA 1USYE 3KOTA 3RUMA 4ELQA 4I62A 4MX6A 3ZKLA 2PFYA 2QVVA 1D4NA 3S9LC 1MXZA 1B4HA 4GWUA 1IEJA 1DTZA 1LEVA 3TQLA 1NI9A 4LZ5A 1EU8A 1GV8A 4RJZA 5B70A 3Q28A 1B52A 5EQ7A 1FPEA 5I56A 3KC0A 1N76A 2HXWA 1YXIA 3VE1B 3R6UA 1IZ1A 5K2XA 3T9HB 4MF3A 5AA2A 2DE2A 4GWWA 4OEUA 3R7XA 4NF4B 3SEWA 4F1YA 2Q74A 3FATA 4FAJA 1A8EA 1PB9A 1NV4A 2RCAA 2ZYOA 3G7WA 1EZPA 2DWHA 4FIMA 2PT2A 4PP0A 4EF1A 5EQ9A 3IJOB 2DOJA 2WEFA 3QUFA 2LAOA 4KXPA 3C9HA 1Y3PA 4POXA 1USYH 1FW0A 1MXWA 1IXCA 4X1DA 2PT1A 2XD3A 4P3LA 1FTMA 4U2RA 3B6WA 3I5OA 4BDLA 5I58A 5DTBA 5AA4A 4QSEA 3MW0A 2XXUA 1DTGA 1NV3A 4YMBA 3TQWA 1N7WA 5ICTA 3FJ7A 4OETA 4FBPA 1H3DA 1GGGA 4YICA 1B5JA 3MZ9A 1B40A 3OD7A 3ODBA 4JWYA 2UYEA 3GLBA 1PB7A 4MNPA 1FBHA 1LCTA 3O6HA 2ABHA 2B3FA 3UGWA 1WODA 3R26A 1FQEA 3PV0E 3PUXE 3D4CA 2D3IA 3FVNA 3TTMA 3DP4A 3P7IA 1ZKBA 1OIBA 4OEVA 4DI4B 4EQBA 5I2KA 2FVZA 3VVDA 4F1VA 4F3PA 2I6EA 2HHMA 1ZU0A 4H8JA 2F7AA 2ESNA 3PGFA 3S9NC 1LCFA 3W9VA 2QS1A 1UQWA 1OQGA 3QK6A 2NXOA 5J1DA 4PAFA 1O63A 4HTGA 1MDP1 3MZBA 4PFYA 1QVSA 4G2ZA 1BLFA 4XFEA 4KPTA 2Y7IA 3G3FA 3LSWA 4NHBA 4F19A 4GX4A 2XXRA 1H43A 2OJTA 3OENA 5TP9B 3M3KA 1PDAA 5I59A 4OVQA 1JVYA 2OWSA 2XWOA 5H8HA 2DS9A 4G8MA 4M4GA 4DXUA 5EHSA 4C0RA 1FPIA 2XX8A 4F39A 3MVYA 3PD8A 3UORA 3OXNA 3N5LA 3RPLA 4IO3A 1TT1A 4QHQA 5I57A 2VD2A 3C36A 2OK2A 2QVUA 4PFTA 3VXCA 4H0WA 2FHYA 3B7DA 3IL1B 4OYVA 1PB8A 4Q8RA 4EUOA 1FRPA 3SETA 2ONSA 2PVUA 2M8CA 1XS5A 3U65A 4HE1A 1B58A 3TTLA 1DBZA 4PF8A 3LBSA 4YKKA 5DVFA 3HFUA 1ELJA 3K01A 5IKBA 1B2HA 3ZKKA 5CC2A 1SD3A 3OELA 4QRZA 4NN3A 1XI6A 1FBFA 3K6XA 4GX3A 4RYAA 2I48A 5TU0A 3G3JA 1K9ZA 2OZZA 1I69A 5ET7A 1XHYA 4RPNA 3I3VA 4KYEA 4GXAA 1IXGA 3TTRA 1JP4A 1UTHB 3MVWA 2QPQA 3CIJA 4EXLA 3ILUB 2QVRA 5ISUA 1R9QA 5H8SA 3KGCA 4MIJA 4LQ5A 4ELPA 1BKAA 3E3KA 4KCDA 1MY0A 1S7YA 2F7CA 1YTVA 3EHSA 4DI3D 4GWXA 1P1WA 3S2VA 1NH8A 4KFQA 3O6IA 4PGPA 2O1MA 1F9BA 3VV5A 2O69A 3UA8A 1Z7ME 4NF8A 1VE4A 2H25A 3M3LA 4ELOA 1PBQA 3T9VA 3DELB 1MG1A 1MXVA 4OVRA 2QS2A 1II5A 4WEPA 5DEXB 1KA1A 2QSXA 2IA4A 3Q29A 4TLMB 3ROJA 5CMBA 1OLAA 3E9XA 1QW0A 1LFGA 3CFZA 3U72A 5EQAA 1N04A 5H8QB 4ZECA 2F3BA 4PCDA 3FVOA 1NNTA 1AMFA 4THIA 4ZEIA 2ZYMA 1FBEA 3H6TA 3E4RA 5KZTA 3AXFA 2F97A 5F7VA 3IORA 1MRPA 1SYHA 2DXRA 3MC2A 3OOAA 4L17A 1B0HA 1SQYA 1NFTA 1FQDA 2E1SA 1S9TA 1SVXB 4EDPA 3MVXA 4GRKA 4G77A 3RNNA 4TOZA 4N07A 1AL3A 2Q88A 1D9YA 2Y7PA 4OWDA 3QUJA 1IQ7A 3FJGA 2Q9TA 3RYDA 3MWBA 4ZEDA 2Y7KA 4AQ4A 5T3JA 4WKMA 3U1OA 4N6KA 4U1OA 3ECRA 3U94A 3TDJA 3MVZA 1K9YA 5AE4A 4NGUA 2L5VA 4X48A 1QUKA 4IO6A 5CBSA 2Y7RA 4GL0A 1IITA 1MPDA 3CG3A 4LN5A 3SKPA 3LUZA 3S9EA 3T22A 1BK4A 2XXXA 4H8IA 1P1UA 3IFAA 5LTCA 5IGAA 3KFMA 1IMAA 4FATA 1XVXA 4F2QA 2R71A 5KCJB 3V8XB 3KC1A 2HCAA 2O7IA 2ZYNA 3RT6B 3A29A 3QXMA 3BKIB 4ONYA 3C4MA 2DWJA 4U22A 4P0IA 4HE0A 4OERA 2KQZA 4FJPA 4PQJA 4GWSA 2XXQA 2P3VA 4BDOA 1PC3A 3H06B 2H4IA 2RC8A 4G68C 4AB6A 4ZS9A 4YKIA 4I40A 1QUIA 3LSLA 2WYPA 4M1VA 3Q26A 1YAEA 1CE2A 2GFEA 3BIHA 1SW4A 3IFCA 3HV1A 4PDDA 2XXIA 1FPDA 2FIEA 5BUUA 1NV7A 1B7HA 3A3CA 3K1MA 5ITOA 3KG2A 2NOOA 3WAEA 4O3BA 3FJMA 3USDA 3BIGA 5ET8A 3DP6A 4NG7A 2QJEA 1Y20A 3WAFA 1M5FA 1UTBA 1N3XA 4U21A 2O7UA 1URSA 1KWHA 1LFHA 1FBGA 1EYIA 2PBWA 1NV6A 2D5WA 3E78A 4P47A 4ZEKA 2A5SA 4DCXA 4MEVA 4OANA 1FQBA 4DXCA 3IAZA 2P1SA 4EXKA 3EPEA 1JETA 1KZ8A 5H8FA 3B50A 4YAHX 4PAKA 1JW1A 5CBRA 1AIVA 3GXAA 1CB6A 2ZZXA 4N13A 4OFJA 2UXAA 3OSRA 4BDRA 1H45A 2CMOA 4ESXA 3PD9A 1LBWA 4G8HA 4N15A 2ONRA 2V93A 4JSOA 4XKQA 4F2OA 2DXYA 5K2YA 3O28A 1DSNA 3B6QA 1Y1ZA 1A54A 1JEVA 3HSTA 4QBAA 4H45A 5LOMA 3B6TA 1FTKA 4JWOA 3K6UA 3OO6A 1EYKA 4ZZEA 2FBPA 4N81A 4P0GA 1AOVA 2ZXTA 2OCUA 4R73A 4N17A 3FASA 4U1ZA 1URDA 4OQOA 1VSOA 4OTEA 1H44A 4LONB 1QGXA 3IX1A 1NV1A 1LB9A 5IM2A 1NL5A 2IEEA 4LUBA 1RDXA 2JJKA 4C1UA 4LA9A 4KD5A 1WVJA 3HCQA 2RC7A 2V25A 4O7IA 3BFTA 4IY5A 3RPLB 4N4UA 1N0TA 4R6YA 2HQ0A 4PFWA 4O7MA 3GBAA 4G68A 4KI0E 2O51A 1ZTYA 1J1NA 3MAMA 2I3VA 3MBPA 4H65A 2Q2AA 3IOUA 5I2NB 4NF6A 3IB2A 4XKPA 1VFDA 1B3EA 4R75A 3CFLA 2A5TB 3M3FA 1FBPA 1IIWA 3H3GA 3EHUA 2KLFA 2GRVA 1POY1 1MDQA 2OBGA 1R1NA 3UN6A 3DLNA 5CI5A 4FEDA 3FV2A 3PPQA 5L9MA 4KR5A 3SERA 2I4BA 2F8DA 2FNCA 4RY1A 3G3GA 4RK2A 3KN7A 1YZ0A 4DCYA 2NWJA 2GHBA 1NH7A 2D21A 3OEKA 3O6GA 2XXYA 4PFRA 4HXVA 2XXPA 2AL4A 1N3WA 4QFOA 4ZE8A 1BIYA 3A3UA 1GVCA 3FVKA 4IO7A 2V3UA 1GR2A 1O7TA 2VPNA 4ND9A 4N6DA 5TPAB 4IB2A 1B32A 2I0BA 3N26A 4NF4A 2ZMBA 3CI8A 1AWBA 4FECA 4Z7EA 4P56A 1LBYA 1B05A 1RKMA 3E13X 3V89B 4XIGQ 4C1TA 3IB0A 4GWYA 5ESYA 1LBVA 2XD2A 3KOSA 5A5XB 4OVJA 1IUDA 3IO6A 3B8BA 3RN8A 4NX1A 4RNSA 5FTHA 4YKPA 4MNCA 1FPFA 4H5GA 2YPNA 3CG1A 4I1DA 3SESA 1FCKA 3TYHA 3PPPA 3A09A 3FXRA 3SZPA 3QSLA 3VFJA 2X7PA 1SI0A 3TFLA 3VLWA 2YJPA 4PDHA 3KN3A 3FXBA 1P99A 1ATGA 4GQOA 3N94A 3TZAA 1IXIA 1LBXA 4OESA 3D4GA 3FXUA 4I8CA 4PAIA 5ICQA 4QFPA 4O94A 2RC9A 1IMDA 3FV1A 4DXBA 2F6GA 3W9WA 2HPGA 3PPNA 2GH9A 3O2AA 1RYXA 2PCRA 1MPCA 1I6BA 2NUVA 4DDDA 1MQHA 5EHMA 4OXVA 1LGBC 3L6GA 4NMYA 3UIFA 1PEBA 3UK4A 3TMGA 4NF5B 3C31A 3ILTB 5HBCA 3HHFA 1LBBA 3JZJA 1L5TA 1DPPA 1VDWA 5JTYB 2REGA 3VLVA 4HS7A 2YLNA 1Y3NA 4U4SA 4H46A 1FPJA 5H8NB 3K6VA 1Y4TA 3H6WA 1A40A 4UABA 5CMKA 5AA3A 4KHZE 5DVIA 2HAVA 2XA5A 5EYFA 3RY3A 4DE8A 1IXHA 5CRYA 4JDFA 4I3YA 2O84X 2FYIA 4F1UA 5I7IA 4R74A 5TP9A 5ELVA 1IMFA 4QFLA 3KJTA 2QMXA 4GF8A 3SEXA 2ZZVA 1SW1A 3IK6B 3O29A 4R9GA 2Z8EA 1NUWA 3QIMA 4N6PA 1SYIA 4IGTA 2PFZA 3H6VA 5IZZA 3CSBA 3MYUA 4AS5A 4RXLA 1UIUA 2ZNSA 5DT6A 3PPRA 4PFIA 3OEMA
chains in the Genus database with same CATH topology
4P3LA 3LV0A 3BIGA 5ET8A 4GX6A 3T0JA 4O8MA 5IZ1A 1NV3A 4NQ8A 4NG7A 4QXDA 4MMPA 4MAGA 4AS4A 4FBPA 2KR0A 4YICA 5IZ3B 1FBGA 1EYIA 2CEXA 1NV6A 4OVPA 4F18A 4MNPA 1FBHA 1FPLA 3E78A 4P47A 2QFLA 4MEVA 4OANA 3NOHA 4OVSA 4PE3A 1FTAA 4XEQA 1KZ8A 4XF5A 2CZKA 3B50A 1LBZA 4PAKA 4DI4B 2ZZXA 1IMCA 2FVZA 1NUXA 2WBDA 4F1VA 2Y5LA 4HE2A 2WX9A 3GYYA 2HHMA 1LBWA 5ET5A 5ET6A 4YZZA 4N15A 2Y5KA 1IMBA 3W9VA 2GQ1A 5J1DA 4PAFA 2XWKA 4JVDA 2F3DA 1FJ6A 4MJOA 4OVTA 2R8TA 4XFEA 4QBAA 4H45A 3QMFA 4NHBA 4F19A 3ISPA 1D9QA 4GX4A 1EYKA 4OVQA 2FBPA 4N81A 5I5PA 2DE4A 2XWOA 4N17A 2HZKA 1DK4A 4P9KA 4X04A 2V4CA 1INPA 1QGXA 1FPIA 1NV1A 1NV2A 5IM2A 1FPGA 1NUYA 3RPLA 1RDXA 2JJKA 2QVUA 4NF0A 2FHYA 1NV5A 4O7IA 3RPLB 4N4UA 4PTKA 5EYHA 1FRPA 4O7MA 3U65A 1NUZA 1SPIA 4HE1A 1FSAA 1DBZA 4PF8A 4JVCA 1FPBA 3HFUA 4MNIA 4GBWA 3MSTA 4NN3A 1XI6A 1FBFA 1Q9DA 4GX3A 2F5XA 2VPOA 3T1BA 1FBPA 1K9ZA 5ET7A 2ZZWA 1FBDA 3PTYA 4N8YA 1G0IA 1JP4A 2QPQA 1YZ0A 2OWZA 4GWZA 4N91A 3KBZA 2QVRA 5EQ8A 4P1LA 2WYKA 4MIJA 2CEYA 4X9TA 1FPKA 2WBBA 4DI3D 4PFRA 4GWXA 4HXVA 4PGPA 4P8BA 2CZHA 4HCWA 4MHFA 4PF6A 5JK4A 4NAPA 4OVRA 4PBQA 2MKZA 2VPNA 3EKIA 4N6DA 1KA1A 3ROJA 5J16A 1EYJA 2FIXA 1AWBA 5EQAA 1LBYA 4P56A 5DW8A 2F3BA 4PCDA 4GWYA 5ESYA 1LBVA 5FBPA 1IMEA 1FBEA 2V3QA 3B8BA 4P1EA 4NX1A 4JVIA 1RDZA 4MNCA 1FPFA 2DDKA 2B4LA 4MCOA 4N8GA 4PGNA 3SZPA 2VT5A 4PDHA 2HXRA 4PC9A 3FXBA 1NV0A 1LBXA 1FBCA 5IZ3A 2Q9TA 4PAIA 1YYZA 3RYDA 3E79A 2P3NA 4O94A 1G0HA 1IMDA 1KA0A 3W9WA 2HPGA 5I3SA 2DVZA 2PCRA 2BJIA 4PBHA 2HZLA 5T3JA 2B4MA 1DCUA 4I3EA 4N6KA 5CM6A 5F24A 1K9YA 4NGUA 1VDWA 5EYGA 2L5VA 4H46A 1FPJA 4MX6A 1RDYA 5A5LA 3FBPA 2PFYA 2QVVA 4LN5A 5LDZA 4G61A 4UABA 3LUZA 4GWUA 2OX3A 2XA5A 1LEVA 1BK4A 3IFAA 5LTCA 2DE3A 5IGAA 4X8RA 4I3YA 1CNQA 1IMAA 1NI9A 2CZIA 5EQ7A 1FPEA 3KC1A 4F1UA 5I7IA 3KC0A 4IR8A 1YXIA 3A29A 2XWIA 1IMFA 1FJ9A 4OA4A 2XWVA 2ZZVA 4HE0A 4HCYA 2DE2A 3CHGA 2KQZA 3D1RA 4GWWA 1NUWA 4GWSA 2P3VA 2Q74A 2PFZA 5IZZA 1NV4A 4I40A 3MYUA 2WYPA 4AS5A 4M1VA 2Q8MA 5EQ9A 2WEFA 3BIHA 3IFCA 4PDDA 4KXPA 1FPDA 2FIEA 4PFBA 4PFIA 1NV7A 4GBVA 4PETA 2XXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCR A;  2WBB A;  2BJI A;  4GWX A;  1DK4 A;  4HXV A;  3LV0 A;  5T3J A;  3BIG A;  1INP A;  5ET8 A;  4GX6 A;  3T0J A;  1QGX A;  5IZ1 A;  1DCU A;  2CZH A;  1FPI A;  1NV3 A;  4I3E A;  1NV1 A;  1NV2 A;  4QXD A;  1FPG A;  1NUY A;  5F24 A;  1K9Y A;  3RPL A;  1VDW A;  5EYG A;  1RDX A;  2JJK A;  4AS4 A;  4FBP A;  2QVU A;  2FHY A;  1NV5 A;  4O7I A;  5IZ3 B;  1FBG A;  4H46 A;  1EYI A;  3RPL B;  1FPJ A;  4PTK A;  5EYH A;  1KA1 A;  1RDY A;  5A5L A;  3FBP A;  1NV6 A;  1FRP A;  2QVV A;  1FBH A;  1FPL A;  4G61 A;  5LDZ A;  2QFL A;  3ROJ A;  3LUZ A;  5J16 A;  1EYJ A;  2FIX A;  1NUZ A;  4GWU A;  1SPI A;  2OX3 A;  4HE1 A;  1FSA A;  1DBZ A;  1AWB A;  1LEV A;  1FTA A;  1BK4 A;  1FPB A;  5EQA A;  1LBY A;  1KZ8 A;  3IFA A;  5DW8 A;  4GBW A;  2F3B A;  4I3Y A;  2CZK A;  1CNQ A;  1IMA A;  1LBZ A;  1NI9 A;  2CZI A;  4GWY A;  5ESY A;  5EQ7 A;  1FPE A;  1LBV A;  3KC1 A;  1XI6 A;  1IMC A;  1FBF A;  2FVZ A;  3KC0 A;  1IME A;  1NUX A;  1Q9D A;  2WBD A;  4GX3 A;  1FBE A;  4IR8 A;  1YXI A;  3A29 A;  1FBP A;  2Y5L A;  1K9Z A;  3B8B A;  4HE2 A;  1RDZ A;  2HHM A;  5ET7 A;  1IMF A;  1LBW A;  5ET5 A;  1FPF A;  5ET6 A;  1FJ9 A;  2DDK A;  2Y5K A;  1IMB A;  4HE0 A;  3D1R A;  4GWW A;  1FBD A;  2GQ1 A;  1NUW A;  4GWS A;  2P3V A;  2Q74 A;  1G0I A;  2F3D A;  1JP4 A;  2VT5 A;  1FJ6 A;  1NV4 A;  4MJO A;  5FBP A;  2R8T A;  4I40 A;  1YZ0 A;  2OWZ A;  4H45 A;  4GWZ A;  4AS5 A;  3KBZ A;  3QMF A;  2Q8M A;  1NV0 A;  2QVR A;  5EQ8 A;  1LBX A;  1D9Q A;  1FBC A;  4GX4 A;  5EQ9 A;  5IZ3 A;  2WEF A;  1YYZ A;  3BIH A;  3RYD A;  3IFC A;  4KXP A;  1EYK A;  2P3N A;  1G0H A;  1IMD A;  1FPD A;  2FIE A;  1KA0 A;  2FBP A;  1NV7 A;  4N81 A;  4GBV A;  1FPK A;  5I3S A; 
#chains in the Genus database with same CATH topology
 3Q25 A;  3RTW B;  1B6H A;  4KQP A;  3LV0 A;  4OFO A;  2H9B A;  5IZ1 A;  2RCB A;  4BDN A;  3KEI A;  1OMP A;  2XX7 A;  4MMP A;  1P1N A;  4GD5 A;  3MUQ A;  2THI A;  1SW5 A;  4AS4 A;  1TXF A;  2H98 A;  3U92 A;  3TTN A;  3KSJ A;  2P0S A;  2KR0 A;  1I6A A;  2I4C A;  4ZDM A;  3OO8 A;  1LAH E;  4XTC Q;  2DSF A;  5IZ3 B;  1MY1 A;  1UTB B;  3VLU A;  5FHO A;  2CEX A;  3T96 B;  2QFL A;  3IOT A;  5KDT B;  1FTO A;  3NOH A;  3TUS A;  4OVS A;  1FTA A;  3L6H A;  4XEQ A;  3U93 A;  1HSL A;  1UTH A;  1QUL A;  2DP8 A;  1LBZ A;  5F1Q A;  4GIZ A;  1IMC A;  2QRY A;  1NUX A;  2WBD A;  1VFE A;  3DM0 A;  4R2B A;  4P11 A;  2WX9 A;  1DOT A;  4FOR A;  3H4Z A;  4YZZ A;  2Y5K A;  1IMB A;  4XKR A;  3BBR A;  4R6K A;  3GZG A;  2GQ1 A;  1FTJ A;  1P1Q A;  5HPQ A;  2XWK A;  1URG A;  2F6P A;  4XXU A;  4U4X A;  4LQ2 A;  4F22 A;  4MJO A;  1LAF E;  5L8D A;  2R8T A;  1B3L A;  3HN0 A;  4QSC A;  3ISP A;  5DEX A;  5I56 B;  1Y3Q A;  3PPO A;  4IGR A;  2XX9 A;  3PMV A;  3T93 B;  3TEL A;  1QKB A;  5I5P A;  2DE4 A;  4QSD A;  1XT8 A;  2HZK A;  4F29 A;  4F31 B;  1DK4 A;  5CMC A;  4X04 A;  2B65 A;  5AA2 B;  4LZ7 A;  4JSD A;  3N6T A;  5H8Q A;  2AYS A;  3CVG A;  1LAX A;  1AH5 A;  2HFB A;  4OFL A;  3W15 C;  4RK9 A;  1T0K A;  1NV5 A;  1MQI A;  1EZO A;  3MPL A;  5EYH A;  2ANJ A;  2FA7 A;  4BDQ A;  2WKY A;  2R6G E;  2H5Y A;  4NE4 A;  3S9M C;  2XXT A;  3PMW A;  1FSA A;  1N84 A;  1MY3 A;  4F3S A;  5I58 B;  2UVJ A;  4JVC A;  5AA4 B;  1LST A;  5L9O A;  4GFR A;  3SEU A;  2RF1 A;  2NVU B;  3MST A;  4O3C A;  3CSG A;  1Q9D A;  2F5X A;  3H03 A;  3K02 A;  1NNP A;  3T1B A;  2O1L A;  2Z22 A;  1B3G A;  2VD3 A;  1LFI A;  4NWD A;  3K1P A;  3QYT A;  1ZJL A;  1G0I A;  3S4U A;  1MM6 A;  4GWO A;  3T9U A;  3VXB A;  2Z23 A;  2OWZ A;  3OO9 A;  3KBZ A;  5EQ8 A;  3PUZ E;  5I2K B;  2ZNT A;  1LB8 A;  3C35 A;  2WYK A;  1EZ9 A;  4IY6 A;  3FGS A;  3HPI A;  2CEY A;  4X9T A;  4POW A;  3TPA A;  1B5H A;  2HAU A;  1HSJ A;  3C32 A;  3JYR A;  4GXS B;  4P8B A;  2F35 A;  4HCW A;  1A7L A;  5M2V A;  4PF6 A;  1Y1M A;  1RYO A;  2CZL A;  5KCJ A;  2Q8J A;  2F78 A;  3IJX B;  4KYD A;  3C33 A;  2MKZ A;  4LVQ A;  4ECF A;  4R9F A;  5I59 B;  4YMA A;  4LZ8 A;  3LC8 A;  4QF9 A;  1PBP A;  1XC1 A;  5H8H B;  1O64 A;  2OWT A;  1EYJ A;  1JEU A;  2XHD A;  3PUV E;  2FIX A;  3TTK A;  3RQT A;  4HW8 A;  4FEB A;  1FQC A;  1MXU A;  1S50 A;  5DW8 A;  3H6U A;  2XXH A;  4G4P A;  4EQ7 A;  3G3H A;  2QMW A;  1A99 A;  5FBP A;  2HEU A;  3RLF E;  5I57 B;  2DYX A;  1JW4 A;  4MFI A;  2I3W A;  1QJM A;  3LSX A;  4P1E A;  1P1O A;  1OQH A;  4KYS A;  1UIV A;  1MXY A;  1RDZ A;  1FQA A;  3M8U A;  2DDK A;  1ANF A;  4PGN A;  4H5F A;  4H67 A;  1JQF A;  2OPD A;  3IR1 A;  2VP1 A;  2W7Y A;  2VT5 A;  1Q1K A;  1M5D A;  4PC9 A;  4XKN A;  5IAI A;  3PUW E;  4ZE9 A;  3OSQ A;  1NV0 A;  1FBC A;  2QS3 A;  4DLD A;  1YYZ A;  3V83 A;  3E79 A;  5ITP A;  1KA0 A;  2AL5 A;  5I3S A;  4K3F A;  2DVZ A;  1MQG A;  3FD3 A;  2BJI A;  3TCG A;  4PBH A;  2HZL A;  5L9S A;  3HO7 A;  1DCU A;  4OMB A;  2G29 A;  3K00 A;  4EF2 A;  1NNF A;  4ELR A;  1QKA A;  1FQF A;  3MPK A;  5CM6 A;  5F24 A;  5EYG A;  4R2F A;  4LAT A;  3MP6 A;  1XOC A;  1RDY A;  5A5L A;  3FBP A;  1ZBM A;  4ZEB A;  5LDZ A;  4G61 A;  4GLI A;  1MQJ A;  2OX3 A;  2PX1 A;  3PMX A;  3FVG A;  3I6V A;  2DE3 A;  4AB5 A;  4I9D A;  4X8R A;  3O9P A;  5FHM A;  1CNQ A;  3JV9 A;  2CZI A;  2G93 A;  4NF8 B;  4IR8 A;  4NTL A;  3OMB A;  4GL8 A;  2XWI A;  1MS7 A;  1FJ9 A;  4OA4 A;  2XWV A;  1B3H A;  3FUZ A;  3DP8 A;  4HCY A;  3CHG A;  1NKX A;  3KZG A;  5BWJ A;  3D1R A;  1OVB A;  2Y84 A;  2DWI A;  3MQ9 A;  2V84 A;  3FXQ A;  3EN3 A;  5CMM A;  1A55 A;  4GVO A;  4Q5T A;  3ZSF A;  2F7B A;  2OLB A;  2Q8M A;  2B3B A;  5B7D A;  4R72 A;  5AA1 A;  4PFB A;  4GBV A;  4Z0I A;  4PET A;  2XXK A;  4OZ9 A;  3ONM A;  1MY2 A;  4JBZ A;  2X26 A;  4GX6 A;  3T0J A;  4O8M A;  3EF7 A;  5JEI A;  1Y4C A;  3RT8 A;  4NQ8 A;  1N7X A;  4QXD A;  3VVF A;  5I2N A;  4MAG A;  4ISU A;  3LUY A;  4WXJ A;  5DVJ A;  2A5T A;  1US5 A;  4YU0 A;  2O68 A;  2Z8D A;  3RPW A;  4OVP A;  2REJ A;  4DZ1 A;  4F18 A;  2VOZ A;  4GOT A;  1FPL A;  4OEN A;  1TWY A;  3CFX A;  1BP5 A;  3IOV A;  4TLL B;  4PFU A;  4PE3 A;  1B5I A;  4YB6 A;  3LR1 A;  3V5A A;  3SEY A;  1H76 A;  4XF5 A;  3T9X B;  1SW2 A;  2CZK A;  3H7M A;  4NWC A;  4DIG A;  2PYY A;  4R6H A;  2ALU A;  3KJ7 A;  4IO4 A;  2Y5L A;  1HSE A;  4YKJ A;  4HE2 A;  1B7U A;  2AIX A;  3GYY A;  3TEP A;  4JXI A;  3OO7 A;  1B9J A;  5ET5 A;  5ET6 A;  1GTK A;  2P2A A;  3U8Q A;  4JB7 A;  3PUY E;  4QFK A;  2I0C A;  4JVD A;  2F3D A;  4UAC A;  1MH3 A;  1FJ6 A;  1YCJ A;  3MZ1 A;  4OVT A;  3QMF A;  4YB7 A;  1D9Q A;  4F3G A;  1TFD A;  1M5C A;  1LBC A;  5TPA A;  3SDF A;  3O97 A;  2R9J A;  2PMS A;  1DMB A;  5FHN A;  2I49 A;  2RKM A;  3SEV A;  1Q35 A;  4P9K A;  2UVH A;  2Q2C A;  1FTL A;  1INP A;  2V4C A;  4PE5 B;  3G3I A;  1NV2 A;  1FPG A;  5HM4 B;  1NUY A;  1LAG E;  1ZMG A;  3F11 A;  5A5X A;  4NF0 A;  1B1X A;  1D3K A;  1ZIU A;  4PTK A;  1MPB A;  3FZV A;  1NNK A;  2XXV A;  2XXW A;  2V3T A;  3KN8 A;  1SI1 A;  2ONK E;  2VGQ A;  1I6Q A;  1NUZ A;  1SPI A;  1B4Z A;  2RIN A;  4KCC A;  1US4 A;  1MH4 A;  1FPB A;  1BTJ A;  4H1X A;  1B1H A;  5I84 A;  4MNI A;  4GBW A;  2ZNU A;  1JW5 A;  1R6Z A;  5AA2 D;  1ZLQ A;  2UVI A;  1OLC A;  3TKD A;  1Y9U A;  1SDX A;  2VPO A;  3FIR A;  4E0X A;  1EH3 A;  3K0V A;  4QFN A;  3LSF B;  2I58 A;  2VHA A;  3TCH A;  3RGY A;  2ZZW A;  3BFU A;  4TQU Q;  1FBD A;  3PTY A;  1NMU A;  1POT A;  1MM7 A;  2QL3 A;  4N8Y A;  4MBP A;  4NF5 A;  3K6W A;  2ZYK A;  4UA8 A;  3MP1 A;  4YB5 A;  3QAX A;  5H8F B;  1B7Z A;  1MY4 A;  3KBR A;  2OPE A;  5JTY A;  4GWZ A;  4N91 A;  3RTF B;  1XVY A;  4P1L A;  3IOW A;  3MP8 A;  1OVT A;  1YPN A;  3VDF A;  5FTI A;  5H8N A;  3K2D A;  3C34 A;  4IO2 A;  1FPK A;  2WBB A;  3TCF A;  1JVX A;  2DVC A;  4MLV A;  3TOD A;  3K4U A;  2CZH A;  4MHF A;  4U23 A;  2Y7W A;  1TFA A;  1QUJ A;  4FE8 A;  5JK4 A;  4NAP A;  3GBB A;  5DYH A;  4PBQ A;  3ZS6 A;  4RA1 A;  3CRB A;  4ZZA A;  2DQV A;  3EKI A;  4ESW A;  4H6D A;  1Z7N E;  3HHG A;  5J16 A;  4BDM A;  1M5B A;  4NED A;  4RPO A;  1R9L A;  1B3F A;  2X7Q A;  3PU5 A;  1MQD A;  3Q27 A;  2GHA A;  3O66 A;  4O3A A;  2O6A A;  1IME A;  3KSX A;  1A8F A;  2BJJ X;  3IO4 A;  2V3Q A;  2DWA A;  4E0W A;  3EHT A;  4JVI A;  4F3B A;  2UYF A;  3EQ1 A;  1LLS A;  2B4L A;  4MCO A;  4N8G A;  4IO5 A;  4MLQ A;  2H99 A;  3N6U A;  3T66 A;  3TAJ A;  4WED A;  3CR9 A;  4G68 B;  4Q0C A;  1D9V A;  1VR5 A;  4MH5 A;  4BLA A;  2HXR A;  1B0L A;  3MJN A;  4ZEF A;  4G8N A;  1M5E A;  1WDN A;  4NF6 B;  1JNF A;  5IZ3 A;  2Z8F A;  2F34 A;  4LP2 B;  2QS4 A;  2P3N A;  1G0H A;  2E0S A;  3IB1 A;  3K1N A;  2F36 A;  5KDT A;  1SBP A;  1MXX A;  2B4M A;  4JWX A;  2UVG A;  2Q89 A;  4EQ9 A;  1B46 A;  4I3E A;  3VVE A;  3UP9 A;  1DPE A;  3G3K A;  1B51 A;  4Q30 B;  3THI A;  4X1B A;  4OHN A;  1USY E;  3KOT A;  3RUM A;  4ELQ A;  4I62 A;  4MX6 A;  3ZKL A;  2PFY A;  2QVV A;  1D4N A;  3S9L C;  1MXZ A;  1B4H A;  4GWU A;  1IEJ A;  1DTZ A;  1LEV A;  3TQL A;  1NI9 A;  4LZ5 A;  1EU8 A;  1GV8 A;  4RJZ A;  5B70 A;  3Q28 A;  1B52 A;  5EQ7 A;  1FPE A;  5I56 A;  3KC0 A;  1N76 A;  2HXW A;  1YXI A;  3VE1 B;  3R6U A;  1IZ1 A;  5K2X A;  3T9H B;  4MF3 A;  5AA2 A;  2DE2 A;  4GWW A;  4OEU A;  3R7X A;  4NF4 B;  3SEW A;  4F1Y A;  2Q74 A;  3FAT A;  4FAJ A;  1A8E A;  1PB9 A;  1NV4 A;  2RCA A;  2ZYO A;  3G7W A;  1EZP A;  2DWH A;  4FIM A;  2PT2 A;  4PP0 A;  4EF1 A;  5EQ9 A;  3IJO B;  2DOJ A;  2WEF A;  3QUF A;  2LAO A;  4KXP A;  3C9H A;  1Y3P A;  4POX A;  1USY H;  1FW0 A;  1MXW A;  1IXC A;  4X1D A;  2PT1 A;  2XD3 A;  4P3L A;  1FTM A;  4U2R A;  3B6W A;  3I5O A;  4BDL A;  5I58 A;  5DTB A;  5AA4 A;  4QSE A;  3MW0 A;  2XXU A;  1DTG A;  1NV3 A;  4YMB A;  3TQW A;  1N7W A;  5ICT A;  3FJ7 A;  4OET A;  4FBP A;  1H3D A;  1GGG A;  4YIC A;  1B5J A;  3MZ9 A;  1B40 A;  3OD7 A;  3ODB A;  4JWY A;  2UYE A;  3GLB A;  1PB7 A;  4MNP A;  1FBH A;  1LCT A;  3O6H A;  2ABH A;  2B3F A;  3UGW A;  1WOD A;  3R26 A;  1FQE A;  3PV0 E;  3PUX E;  3D4C A;  2D3I A;  3FVN A;  3TTM A;  3DP4 A;  3P7I A;  1ZKB A;  1OIB A;  4OEV A;  4DI4 B;  4EQB A;  5I2K A;  2FVZ A;  3VVD A;  4F1V A;  4F3P A;  2I6E A;  2HHM A;  1ZU0 A;  4H8J A;  2F7A A;  2ESN A;  3PGF A;  3S9N C;  1LCF A;  3W9V A;  2QS1 A;  1UQW A;  1OQG A;  3QK6 A;  2NXO A;  5J1D A;  4PAF A;  1O63 A;  4HTG A;  1MDP 1;  3MZB A;  4PFY A;  1QVS A;  4G2Z A;  1BLF A;  4XFE A;  4KPT A;  2Y7I A;  3G3F A;  3LSW A;  4NHB A;  4F19 A;  4GX4 A;  2XXR A;  1H43 A;  2OJT A;  3OEN A;  5TP9 B;  3M3K A;  1PDA A;  5I59 A;  4OVQ A;  1JVY A;  2OWS A;  2XWO A;  5H8H A;  2DS9 A;  4G8M A;  4M4G A;  4DXU A;  5EHS A;  4C0R A;  1FPI A;  2XX8 A;  4F39 A;  3MVY A;  3PD8 A;  3UOR A;  3OXN A;  3N5L A;  3RPL A;  4IO3 A;  1TT1 A;  4QHQ A;  5I57 A;  2VD2 A;  3C36 A;  2OK2 A;  2QVU A;  4PFT A;  3VXC A;  4H0W A;  2FHY A;  3B7D A;  3IL1 B;  4OYV A;  1PB8 A;  4Q8R A;  4EUO A;  1FRP A;  3SET A;  2ONS A;  2PVU A;  2M8C A;  1XS5 A;  3U65 A;  4HE1 A;  1B58 A;  3TTL A;  1DBZ A;  4PF8 A;  3LBS A;  4YKK A;  5DVF A;  3HFU A;  1ELJ A;  3K01 A;  5IKB A;  1B2H A;  3ZKK A;  5CC2 A;  1SD3 A;  3OEL A;  4QRZ A;  4NN3 A;  1XI6 A;  1FBF A;  3K6X A;  4GX3 A;  4RYA A;  2I48 A;  5TU0 A;  3G3J A;  1K9Z A;  2OZZ A;  1I69 A;  5ET7 A;  1XHY A;  4RPN A;  3I3V A;  4KYE A;  4GXA A;  1IXG A;  3TTR A;  1JP4 A;  1UTH B;  3MVW A;  2QPQ A;  3CIJ A;  4EXL A;  3ILU B;  2QVR A;  5ISU A;  1R9Q A;  5H8S A;  3KGC A;  4MIJ A;  4LQ5 A;  4ELP A;  1BKA A;  3E3K A;  4KCD A;  1MY0 A;  1S7Y A;  2F7C A;  1YTV A;  3EHS A;  4DI3 D;  4GWX A;  1P1W A;  3S2V A;  1NH8 A;  4KFQ A;  3O6I A;  4PGP A;  2O1M A;  1F9B A;  3VV5 A;  2O69 A;  3UA8 A;  1Z7M E;  4NF8 A;  1VE4 A;  2H25 A;  3M3L A;  4ELO A;  1PBQ A;  3T9V A;  3DEL B;  1MG1 A;  1MXV A;  4OVR A;  2QS2 A;  1II5 A;  4WEP A;  5DEX B;  1KA1 A;  2QSX A;  2IA4 A;  3Q29 A;  4TLM B;  3ROJ A;  5CMB A;  1OLA A;  3E9X A;  1QW0 A;  1LFG A;  3CFZ A;  3U72 A;  5EQA A;  1N04 A;  5H8Q B;  4ZEC A;  2F3B A;  4PCD A;  3FVO A;  1NNT A;  1AMF A;  4THI A;  4ZEI A;  2ZYM A;  1FBE A;  3H6T A;  3E4R A;  5KZT A;  3AXF A;  2F97 A;  5F7V A;  3IOR A;  1MRP A;  1SYH A;  2DXR A;  3MC2 A;  3OOA A;  4L17 A;  1B0H A;  1SQY A;  1NFT A;  1FQD A;  2E1S A;  1S9T A;  1SVX B;  4EDP A;  3MVX A;  4GRK A;  4G77 A;  3RNN A;  4TOZ A;  4N07 A;  1AL3 A;  2Q88 A;  1D9Y A;  2Y7P A;  4OWD A;  3QUJ A;  1IQ7 A;  3FJG A;  2Q9T A;  3RYD A;  3MWB A;  4ZED A;  2Y7K A;  4AQ4 A;  5T3J A;  4WKM A;  3U1O A;  4N6K A;  4U1O A;  3ECR A;  3U94 A;  3TDJ A;  3MVZ A;  1K9Y A;  5AE4 A;  4NGU A;  2L5V A;  4X48 A;  1QUK A;  4IO6 A;  5CBS A;  2Y7R A;  4GL0 A;  1IIT A;  1MPD A;  3CG3 A;  4LN5 A;  3SKP A;  3LUZ A;  3S9E A;  3T22 A;  1BK4 A;  2XXX A;  4H8I A;  1P1U A;  3IFA A;  5LTC A;  5IGA A;  3KFM A;  1IMA A;  4FAT A;  1XVX A;  4F2Q A;  2R71 A;  5KCJ B;  3V8X B;  3KC1 A;  2HCA A;  2O7I A;  2ZYN A;  3RT6 B;  3A29 A;  3QXM A;  3BKI B;  4ONY A;  3C4M A;  2DWJ A;  4U22 A;  4P0I A;  4HE0 A;  4OER A;  2KQZ A;  4FJP A;  4PQJ A;  4GWS A;  2XXQ A;  2P3V A;  4BDO A;  1PC3 A;  3H06 B;  2H4I A;  2RC8 A;  4G68 C;  4AB6 A;  4ZS9 A;  4YKI A;  4I40 A;  1QUI A;  3LSL A;  2WYP A;  4M1V A;  3Q26 A;  1YAE A;  1CE2 A;  2GFE A;  3BIH A;  1SW4 A;  3IFC A;  3HV1 A;  4PDD A;  2XXI A;  1FPD A;  2FIE A;  5BUU A;  1NV7 A;  1B7H A;  3A3C A;  3K1M A;  5ITO A;  3KG2 A;  2NOO A;  3WAE A;  4O3B A;  3FJM A;  3USD A;  3BIG A;  5ET8 A;  3DP6 A;  4NG7 A;  2QJE A;  1Y20 A;  3WAF A;  1M5F A;  1UTB A;  1N3X A;  4U21 A;  2O7U A;  1URS A;  1KWH A;  1LFH A;  1FBG A;  1EYI A;  2PBW A;  1NV6 A;  2D5W A;  3E78 A;  4P47 A;  4ZEK A;  2A5S A;  4DCX A;  4MEV A;  4OAN A;  1FQB A;  4DXC A;  3IAZ A;  2P1S A;  4EXK A;  3EPE A;  1JET A;  1KZ8 A;  5H8F A;  3B50 A;  4YAH X;  4PAK A;  1JW1 A;  5CBR A;  1AIV A;  3GXA A;  1CB6 A;  2ZZX A;  4N13 A;  4OFJ A;  2UXA A;  3OSR A;  4BDR A;  1H45 A;  2CMO A;  4ESX A;  3PD9 A;  1LBW A;  4G8H A;  4N15 A;  2ONR A;  2V93 A;  4JSO A;  4XKQ A;  4F2O A;  2DXY A;  5K2Y A;  3O28 A;  1DSN A;  3B6Q A;  1Y1Z A;  1A54 A;  1JEV A;  3HST A;  4QBA A;  4H45 A;  5LOM A;  3B6T A;  1FTK A;  4JWO A;  3K6U A;  3OO6 A;  1EYK A;  4ZZE A;  2FBP A;  4N81 A;  4P0G A;  1AOV A;  2ZXT A;  2OCU A;  4R73 A;  4N17 A;  3FAS A;  4U1Z A;  1URD A;  4OQO A;  1VSO A;  4OTE A;  1H44 A;  4LON B;  1QGX A;  3IX1 A;  1NV1 A;  1LB9 A;  5IM2 A;  1NL5 A;  2IEE A;  4LUB A;  1RDX A;  2JJK A;  4C1U A;  4LA9 A;  4KD5 A;  1WVJ A;  3HCQ A;  2RC7 A;  2V25 A;  4O7I A;  3BFT A;  4IY5 A;  3RPL B;  4N4U A;  1N0T A;  4R6Y A;  2HQ0 A;  4PFW A;  4O7M A;  3GBA A;  4G68 A;  4KI0 E;  2O51 A;  1ZTY A;  1J1N A;  3MAM A;  2I3V A;  3MBP A;  4H65 A;  2Q2A A;  3IOU A;  5I2N B;  4NF6 A;  3IB2 A;  4XKP A;  1VFD A;  1B3E A;  4R75 A;  3CFL A;  2A5T B;  3M3F A;  1FBP A;  1IIW A;  3H3G A;  3EHU A;  2KLF A;  2GRV A;  1POY 1;  1MDQ A;  2OBG A;  1R1N A;  3UN6 A;  3DLN A;  5CI5 A;  4FED A;  3FV2 A;  3PPQ A;  5L9M A;  4KR5 A;  3SER A;  2I4B A;  2F8D A;  2FNC A;  4RY1 A;  3G3G A;  4RK2 A;  3KN7 A;  1YZ0 A;  4DCY A;  2NWJ A;  2GHB A;  1NH7 A;  2D21 A;  3OEK A;  3O6G A;  2XXY A;  4PFR A;  4HXV A;  2XXP A;  2AL4 A;  1N3W A;  4QFO A;  4ZE8 A;  1BIY A;  3A3U A;  1GVC A;  3FVK A;  4IO7 A;  2V3U A;  1GR2 A;  1O7T A;  2VPN A;  4ND9 A;  4N6D A;  5TPA B;  4IB2 A;  1B32 A;  2I0B A;  3N26 A;  4NF4 A;  2ZMB A;  3CI8 A;  1AWB A;  4FEC A;  4Z7E A;  4P56 A;  1LBY A;  1B05 A;  1RKM A;  3E13 X;  3V89 B;  4XIG Q;  4C1T A;  3IB0 A;  4GWY A;  5ESY A;  1LBV A;  2XD2 A;  3KOS A;  5A5X B;  4OVJ A;  1IUD A;  3IO6 A;  3B8B A;  3RN8 A;  4NX1 A;  4RNS A;  5FTH A;  4YKP A;  4MNC A;  1FPF A;  4H5G A;  2YPN A;  3CG1 A;  4I1D A;  3SES A;  1FCK A;  3TYH A;  3PPP A;  3A09 A;  3FXR A;  3SZP A;  3QSL A;  3VFJ A;  2X7P A;  1SI0 A;  3TFL A;  3VLW A;  2YJP A;  4PDH A;  3KN3 A;  3FXB A;  1P99 A;  1ATG A;  4GQO A;  3N94 A;  3TZA A;  1IXI A;  1LBX A;  4OES A;  3D4G A;  3FXU A;  4I8C A;  4PAI A;  5ICQ A;  4QFP A;  4O94 A;  2RC9 A;  1IMD A;  3FV1 A;  4DXB A;  2F6G A;  3W9W A;  2HPG A;  3PPN A;  2GH9 A;  3O2A A;  1RYX A;  2PCR A;  1MPC A;  1I6B A;  2NUV A;  4DDD A;  1MQH A;  5EHM A;  4OXV A;  1LGB C;  3L6G A;  4NMY A;  3UIF A;  1PEB A;  3UK4 A;  3TMG A;  4NF5 B;  3C31 A;  3ILT B;  5HBC A;  3HHF A;  1LBB A;  3JZJ A;  1L5T A;  1DPP A;  1VDW A;  5JTY B;  2REG A;  3VLV A;  4HS7 A;  2YLN A;  1Y3N A;  4U4S A;  4H46 A;  1FPJ A;  5H8N B;  3K6V A;  1Y4T A;  3H6W A;  1A40 A;  4UAB A;  5CMK A;  5AA3 A;  4KHZ E;  5DVI A;  2HAV A;  2XA5 A;  5EYF A;  3RY3 A;  4DE8 A;  1IXH A;  5CRY A;  4JDF A;  4I3Y A;  2O84 X;  2FYI A;  4F1U A;  5I7I A;  4R74 A;  5TP9 A;  5ELV A;  1IMF A;  4QFL A;  3KJT A;  2QMX A;  4GF8 A;  3SEX A;  2ZZV A;  1SW1 A;  3IK6 B;  3O29 A;  4R9G A;  2Z8E A;  1NUW A;  3QIM A;  4N6P A;  1SYI A;  4IGT A;  2PFZ A;  3H6V A;  5IZZ A;  3CSB A;  3MYU A;  4AS5 A;  4RXL A;  1UIU A;  2ZNS A;  5DT6 A;  3PPR A;  4PFI A;  3OEM A; 
#chains in the Genus database with same CATH homology
 4P3L A;  3LV0 A;  3BIG A;  5ET8 A;  4GX6 A;  3T0J A;  4O8M A;  5IZ1 A;  1NV3 A;  4NQ8 A;  4NG7 A;  4QXD A;  4MMP A;  4MAG A;  4AS4 A;  4FBP A;  2KR0 A;  4YIC A;  5IZ3 B;  1FBG A;  1EYI A;  2CEX A;  1NV6 A;  4OVP A;  4F18 A;  4MNP A;  1FBH A;  1FPL A;  3E78 A;  4P47 A;  2QFL A;  4MEV A;  4OAN A;  3NOH A;  4OVS A;  4PE3 A;  1FTA A;  4XEQ A;  1KZ8 A;  4XF5 A;  2CZK A;  3B50 A;  1LBZ A;  4PAK A;  4DI4 B;  2ZZX A;  1IMC A;  2FVZ A;  1NUX A;  2WBD A;  4F1V A;  2Y5L A;  4HE2 A;  2WX9 A;  3GYY A;  2HHM A;  1LBW A;  5ET5 A;  5ET6 A;  4YZZ A;  4N15 A;  2Y5K A;  1IMB A;  3W9V A;  2GQ1 A;  5J1D A;  4PAF A;  2XWK A;  4JVD A;  2F3D A;  1FJ6 A;  4MJO A;  4OVT A;  2R8T A;  4XFE A;  4QBA A;  4H45 A;  3QMF A;  4NHB A;  4F19 A;  3ISP A;  1D9Q A;  4GX4 A;  1EYK A;  4OVQ A;  2FBP A;  4N81 A;  5I5P A;  2DE4 A;  2XWO A;  4N17 A;  2HZK A;  1DK4 A;  4P9K A;  4X04 A;  2V4C A;  1INP A;  1QGX A;  1FPI A;  1NV1 A;  1NV2 A;  5IM2 A;  1FPG A;  1NUY A;  3RPL A;  1RDX A;  2JJK A;  2QVU A;  4NF0 A;  2FHY A;  1NV5 A;  4O7I A;  3RPL B;  4N4U A;  4PTK A;  5EYH A;  1FRP A;  4O7M A;  3U65 A;  1NUZ A;  1SPI A;  4HE1 A;  1FSA A;  1DBZ A;  4PF8 A;  4JVC A;  1FPB A;  3HFU A;  4MNI A;  4GBW A;  3MST A;  4NN3 A;  1XI6 A;  1FBF A;  1Q9D A;  4GX3 A;  2F5X A;  2VPO A;  3T1B A;  1FBP A;  1K9Z A;  5ET7 A;  2ZZW A;  1FBD A;  3PTY A;  4N8Y A;  1G0I A;  1JP4 A;  2QPQ A;  1YZ0 A;  2OWZ A;  4GWZ A;  4N91 A;  3KBZ A;  2QVR A;  5EQ8 A;  4P1L A;  2WYK A;  4MIJ A;  2CEY A;  4X9T A;  1FPK A;  2WBB A;  4DI3 D;  4PFR A;  4GWX A;  4HXV A;  4PGP A;  4P8B A;  2CZH A;  4HCW A;  4MHF A;  4PF6 A;  5JK4 A;  4NAP A;  4OVR A;  4PBQ A;  2MKZ A;  2VPN A;  3EKI A;  4N6D A;  1KA1 A;  3ROJ A;  5J16 A;  1EYJ A;  2FIX A;  1AWB A;  5EQA A;  1LBY A;  4P56 A;  5DW8 A;  2F3B A;  4PCD A;  4GWY A;  5ESY A;  1LBV A;  5FBP A;  1IME A;  1FBE A;  2V3Q A;  3B8B A;  4P1E A;  4NX1 A;  4JVI A;  1RDZ A;  4MNC A;  1FPF A;  2DDK A;  2B4L A;  4MCO A;  4N8G A;  4PGN A;  3SZP A;  2VT5 A;  4PDH A;  2HXR A;  4PC9 A;  3FXB A;  1NV0 A;  1LBX A;  1FBC A;  5IZ3 A;  2Q9T A;  4PAI A;  1YYZ A;  3RYD A;  3E79 A;  2P3N A;  4O94 A;  1G0H A;  1IMD A;  1KA0 A;  3W9W A;  2HPG A;  5I3S A;  2DVZ A;  2PCR A;  2BJI A;  4PBH A;  2HZL A;  5T3J A;  2B4M A;  1DCU A;  4I3E A;  4N6K A;  5CM6 A;  5F24 A;  1K9Y A;  4NGU A;  1VDW A;  5EYG A;  2L5V A;  4H46 A;  1FPJ A;  4MX6 A;  1RDY A;  5A5L A;  3FBP A;  2PFY A;  2QVV A;  4LN5 A;  5LDZ A;  4G61 A;  4UAB A;  3LUZ A;  4GWU A;  2OX3 A;  2XA5 A;  1LEV A;  1BK4 A;  3IFA A;  5LTC A;  2DE3 A;  5IGA A;  4X8R A;  4I3Y A;  1CNQ A;  1IMA A;  1NI9 A;  2CZI A;  5EQ7 A;  1FPE A;  3KC1 A;  4F1U A;  5I7I A;  3KC0 A;  4IR8 A;  1YXI A;  3A29 A;  2XWI A;  1IMF A;  1FJ9 A;  4OA4 A;  2XWV A;  2ZZV A;  4HE0 A;  4HCY A;  2DE2 A;  3CHG A;  2KQZ A;  3D1R A;  4GWW A;  1NUW A;  4GWS A;  2P3V A;  2Q74 A;  2PFZ A;  5IZZ A;  1NV4 A;  4I40 A;  3MYU A;  2WYP A;  4AS5 A;  4M1V A;  2Q8M A;  5EQ9 A;  2WEF A;  3BIH A;  3IFC A;  4PDD A;  4KXP A;  1FPD A;  2FIE A;  4PFB A;  4PFI A;  1NV7 A;  4GBV A;  4PET A;  2XXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...