5F24A

Crystal structure of dual specific impase/nadp phosphatase bound with d-inositol-1-phosphate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
264
structure length
260
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 74
structure length 260
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5f24A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5f24A02
4GBVA 2VT5A 1NUWA 4HXVA 3BIGA 1LEVA 1SPIA 4HE2A 2QFLA 2F3DA 4GX3A 1EYKA 2CZIA 5EQAA 1K9ZA 1NV7A 1NUYA 1RDZA 2QVVA 3FBPA 4I3EA 2WEFA 2FIXA 3BIHA 2CZKA 5IZ1A 2Q8MA 1NV4A 1LBYA 1KZ8A 4GWYA 3RPLB 1FPKA 1RDYA 2WBBA 1FPIA 2Y5KA 3LUZA 2Q74A 1IMAA 1JP4A 5T3JA 1FPLA 1FBFA 2BJIA 4H46A 5EQ8A 1Q9DA 4G61A 4HE0A 1G0IA 2QVRA 1FJ6A 2OX3A 4MJOA 4GWXA 1FBPA 3KC0A 5EYGA 2GQ1A 1NV3A 1IMCA 4GBWA 1KA0A 1NI9A 1FBCA 3RPLA 1DBZA 5F24A 4I40A 1FTAA 1DCUA 4H45A 1FBDA 2WBDA 2FBPA 4PTKA 3KC1A 1NUXA 5EQ7A 1FBGA 1NUZA 2Y5LA 3IFAA 3IFCA 1NV0A 2FVZA 1IMBA 3T0JA 3QMFA 1LBWA 1INPA 5DW8A 5ET5A 1IMEA 5LDZA 4O7IA 1NV6A 5IZ3B 1IMFA 4I3YA 1VDWA 5ET7A 2JJKA 1CNQA 4IR8A 3ROJA 1NV2A 5ET6A 3B8BA 1DK4A 2CZHA 1FRPA 2OWZA 4GWUA 4FBPA 1YYZA 1RDXA 3LV0A 1FPEA 1LBZA 4GX4A 4QXDA 5ESYA 1EYJA 5A5LA 4GX6A 2F3BA 1IMDA 1XI6A 4AS5A 1D9QA 1LBXA 5IZ3A 5ET8A 2HHMA 3RYDA 2PCRA 1FJ9A 1LBVA 1NV1A 5EQ9A 3A29A 3D1RA 5EYHA 1K9YA 3KBZA 4GWWA 1FPGA 5FBPA 1G0HA 2R8TA 1KA1A 1NV5A 1FPBA 1YZ0A 2P3NA 1FSAA 2P3VA 4GWSA 5I3SA 1EYIA 1FBHA 2QVUA 1QGXA 1FPJA 4HE1A 2FHYA 5J16A 4KXPA 2FIEA 1FPFA 1AWBA 2DDKA 4GWZA 1BK4A 1FPDA 4N81A 1FBEA 4AS4A 1YXIA
chains in the Genus database with same CATH superfamily
3S4UA 3MVZA 4PAKA 3RPWA 3I3VA 3MZ9A 2XXXA 4DLDA 5I2NB 1Y3NA 3L6HA 4PE5B 4PFYA 3HSTA 1K9ZA 5IZ1A 3O29A 2HPGA 1FQFA 1RDYA 2WBBA 2XXQA 2Q89A 4X8RA 4F31B 3T93B 1ATGA 1G0IA 4M1VA 5KZTA 1JVXA 4LN5A 1SI0A 1I6AA 2ZNTA 5EYGA 3FASA 4G2ZA 2MKZA 1LCFA 1IMCA 4G68B 1BIYA 1A8FA 3MP1A 5F7VA 2V4CA 3M3KA 2FBPA 3FATA 4KR5A 3T0JA 3LSXA 3OO9A 4X1BA 3ODBA 3N6TA 4EF2A 4ELPA 2XXYA 3ROJA 2OK2A 2V84A 1B40A 1P1OA 1FPEA 4QFNA 4M4GA 2F3BA 1XI6A 1NV1A 3Q28A 1PBQA 2VD2A 5L8DA 1ZTYA 3OEMA 1YXIA 1XHYA 3OSQA 4PFIA 2ONSA 2QFLA 1EYKA 1MXXA 3OO8A 2OPEA 4GOTA 4JSOA 4POXA 4QFKA 1GR2A 2DP8A 4I3EA 2HZLA 1VFEA 2V93A 1IQ7A 5I56B 4NAPA 3PPRA 1FQAA 4Q0CA 1B1HA 3ONMA 4GIZA 4HW8A 4JDFA 2ZNUA 1FJ6A 1B58A 4F1YA 5CMMA 4FORA 5H8HA 1ZIUA 5CM6A 2LAOA 4F29A 3UIFA 1D9YA 3GBAA 4ZEDA 4F22A 3SETA 1P1WA 3H3GA 1EZPA 4L17A 3CFLA 3S9NC 3DP8A 1NV6A 2X7PA 4LATA 1JNFA 3HHFA 4U4SA 1P1UA 3EQ1A 4R9FA 2RF1A 4F39A 4GWUA 3MJNA 4H5GA 4WEDA 3IJOB 5CMCA 4YKIA 1DPPA 4AS5A 4KYDA 1LBXA 3KOTA 1FQCA 3D4CA 3W9VA 3PMWA 1RYOA 4OHNA 1G0HA 5JTYA 1Y20A 1FSAA 4IY6A 1B3EA 1MY4A 3K1PA 1DMBA 1B4HA 4ESXA 3U65A 2CEXA 4HE1A 1TFDA 2DDKA 4PAIA 1QUIA 5BWJA 3PMVA 2XXVA 4NQ8A 3H4ZA 2HEUA 1MXZA 2FIXA 1O7TA 4LZ5A 1NKXA 3KOSA 2X26A 4JVIA 3H6TA 4JVDA 5T3JA 2HQ0A 3C32A 3BFTA 1UTHB 3MUQA 4KFQA 1MPCA 3K1NA 3T96B 2DOJA 2QS4A 2QVRA 1MPDA 1IEJA 4H0WA 2B4LA 4ELOA 3QIMA 3K6WA 2XWIA 2REJA 3KN3A 1FBGA 2L5VA 4RJZA 4C1TA 2I49A 2I48A 4OQOA 2XWOA 1VDWA 2JJKA 5AA3A 4HTGA 4U23A 1UTBA 2DE3A 4G8NA 3K2DA 4GXAA 3FIRA 2O51A 1M5BA 2DVZA 2UYEA 3CIJA 3H03A 2XD3A 5K2YA 1ZMGA 1LSTA 4P9KA 1ZBMA 5CI5A 5TPAB 3K6VA 3H06B 2RC8A 1M5EA 3M3FA 4WKMA 3VE1B 3LC8A 4R74A 1I69A 1WODA 4H5FA 2HXWA 2PFYA 4MLQA 3S2VA 2IA4A 3TCGA 1OLCA 1SPIA 4N17A 3FD3A 3MSTA 4C0RA 3JYRA 4ND9A 3IAZA 4IO7A 1VR5A 2WEFA 3C9HA 3MPKA 5I58A 3RTWB 4PDDA 4N4UA 4N13A 5K2XA 1B05A 3VLVA 1SW2A 4MAGA 1B7ZA 4X48A 4MFIA 3SEXA 2B3FA 4DCYA 3MZ1A 1TWYA 2Q9TA 3GBBA 3PPNA 2RC9A 2GHAA 3KC0A 4BLAA 3IB0A 2HAUA 1LBBA 4K3FA 5DVFA 4Q8RA 1UIUA 3W15C 4IO5A 3M8UA 4YMBA 1JW1A 3FV1A 5EQ7A 4PETA 5CRYA 3CG1A 4PDHA 3G3HA 3PPOA 2F35A 1S50A 4WXJA 3ZKKA 4FECA 2QMXA 2RC7A 3T66A 3O6GA 1R9QA 1CNQA 3KN8A 1Q1KA 4O3BA 4PFUA 4ZZAA 3TMGA 1R6ZA 3LV0A 4N6KA 3SEUA 4E0XA 3O2AA 3PUVE 4ZEFA 1PEBA 1D9VA 1H43A 2ZNSA 5TP9B 4QFLA 3LSFB 4HCWA 2VD3A 1USYH 1URSA 3D4GA 3FGSA 4NMYA 4PBHA 3KBRA 2P3VA 1GVCA 2F36A 3QYTA 4ECFA 1B0LA 3HO7A 2F7AA 1IIWA 3TTLA 2XXTA 2XD2A 2XX7A 5I2KA 5AA4A 4FE8A 1N04A 4EF1A 1MM6A 1PDAA 5F1QA 2QVVA 3PU5A 3SESA 4OWDA 2QL3A 3UK4A 3VDFA 3UN6A 3V89B 5EQ8A 3B7DA 5KDTB 4MJOA 2DQVA 1IXIA 2V25A 2AL4A 1SW4A 2O84X 4LVQA 3RPLA 4F3PA 2Z23A 4P0GA 2H4IA 1IZ1A 1NUXA 1B3LA 1N76A 4MCOA 1SYHA 3E4RA 3U94A 3TUSA 3CHGA 4EQ7A 5DW8A 2ZZVA 3SKPA 1ZKBA 2ZMBA 1XT8A 1Y1MA 4PCDA 5KCJA 3C34A 3E3KA 4GX4A 1YYZA 1EZOA 1TXFA 3WAEA 1FCKA 3EHUA 1IMDA 2ZYKA 1AIVA 5ET8A 1II5A 3IO4A 4OVRA 3RLFE 1OQHA 3A29A 3FJGA 4KCDA 2AIXA 3GXAA 2P3NA 4OVJA 3C35A 4GWSA 1Y4CA 3G3FA 1YPNA 1IUDA 1CE2A 3MVXA 4KD5A 4OXVA 3PPPA 3BIGA 1MY1A 4HE2A 3U93A 3CSBA 1B5JA 5EQAA 3H6UA 1RDZA 2XXRA 4YB7A 1AH5A 1LFGA 5I59A 1Y3PA 2D5WA 4Z0IA 1FQEA 5HBCA 3QAXA 1FPLA 5I5PA 4G61A 2ZYOA 3B6TA 2XXHA 5I57B 1LB8A 1SD3A 3U72A 2B3BA 4TOZA 3G3KA 3IOWA 1H44A 2GHBA 4HS7A 2XXIA 1ANFA 4TLLB 2QS1A 2THIA 4OFOA 4I40A 2DXYA 4X9TA 4ELRA 1YAEA 3W9WA 1FW0A 5FTIA 3EHTA 3QMFA 5IM2A 2H25A 2UYFA 4R2BA 2QRYA 5LDZA 1OVTA 1B46A 2PFZA 4LZ7A 4R73A 3ZS6A 3ZSFA 1B3GA 2ABHA 4NEDA 3MWBA 4O3CA 1B51A 1IXGA 3SEYA 1MXUA 1H45A 1LBZA 4DXCA 4ZECA 2ESNA 2Z8EA 3FXQA 5DVIA 4FEBA 4BDQA 1K9YA 2DXRA 3FJ7A 5H8QA 2R8TA 3Q25A 2V3QA 3S9MC 3TTNA 4ZDMA 4F2OA 1NFTA 3AXFA 2I3WA 3V8XB 1B3FA 1S7YA 2WX9A 2QJEA 2F5XA 2RCAA 5A5XB 1DPEA 1AMFA 1USYE 1N3XA 4N07A 5DEXA 2NWJA 4XKQA 1PBPA 3IOVA 1NNKA 1IMAA 2ONKE 3HN0A 4DXUA 1UTBB 3K0VA 4O3AA 3QUJA 2BJIA 4QSDA 4HE0A 4OMBA 2HCAA 1MY2A 1HSLA 4OEUA 5ISUA 5H8FB 3KEIA 4PC9A 4I9DA 1YCJA 4GBWA 1N0TA 3I5OA 3TCHA 1WDNA 1US4A 5L9OA 4NF0A 2DSFA 3A3CA 4NGUA 3IFAA 4AB5A 5I7IA 2O1LA 4QRZA 4U2RA 4GVOA 3EPEA 4BDLA 1O64A 3JZJA 1A8EA 3LR1A 2XHDA 4QBAA 3N26A 4H1XA 3SZPA 2XWVA 4PAFA 5IZ3A 2O7IA 3KJTA 2OWTA 4OFLA 2Y7PA 4GLIA 4OVPA 1KA1A 1B5IA 2OZZA 5L9SA 4KHZE 1QUKA 2DE2A 4KXPA 1AWBA 4FEDA 3RGYA 2ZYMA 2A5TA 1MQGA 2Y84A 2I0CA 4LA9A 1NH7A 3HV1A 4QSEA 4GWOA 2CZKA 1MDQA 1NV4A 4GWYA 4OVSA 1SDXA 1LAFE 4AB6A 3FVGA 5I2NA 2F8DA 2VP1A 3RNNA 4MIJA 1J1NA 3RQTA 3FVOA 4R72A 5EYFA 1M5CA 1DBZA 5F24A 4RA1A 4H45A 4YICA 3KC1A 5AA1A 2Q8JA 1EU8A 1QKAA 1YTVA 4P8BA 4NF8B 4YMAA 4U4XA 4G68A 1NL5A 4O7IA 2DWHA 4P1LA 5I2KB 5AA4B 5ET7A 4G8HA 4G68C 4OTEA 1A40A 3UP9A 1QJMA 1DK4A 1Y1ZA 3VLWA 5A5LA 5ITPA 1AOVA 5EHMA 4R6KA 3SEVA 1EZ9A 2PT1A 1B1XA 2HHMA 1VE4A 3D1RA 3TTKA 5FBPA 4RXLA 5JK4A 1QUJA 1B52A 5I3SA 2QS2A 1TFAA 3UA8A 4PQJA 4NTLA 1F9BA 3FXBA 4YB5A 1PB7A 5FHOA 3UORA 4NG7A 3EHSA 1MH4A 5ESYA 1EYJA 4AS4A 1JW5A 3O9PA 4XKPA 4RYAA 3ECRA 3QK6A 3IK6B 4OVTA 3R6UA 2XXWA 2RINA 2R71A 3U92A 2CZIA 5AA2B 2QMWA 1N7WA 2QS3A 4PFWA 3TQLA 4TQUQ 1LBCA 1NV7A 4ZE8A 2Q8MA 1KZ8A 3FVKA 1DSNA 1A99A 3LUZA 2Q2AA 1FBFA 2PMSA 4P1EA 2Y7RA 5JEIA 4N8GA 3FUZA 3P7IA 1NV3A 1B2HA 4MNIA 5I56A 2NXOA 1Z7NE 1FBDA 2CZLA 2WBDA 4OETA 3LBSA 4DDDA 1POTA 3S9LC 3I6VA 2W7YA 4XF5A 1IMBA 1HSEA 3C36A 3T22A 2I58A 5ICQA 4GFRA 2F78A 1WVJA 4H6DA 4DZ1A 4U1OA 3LSWA 3G3JA 1I6BA 3VVDA 1B9JA 3B8BA 2O69A 2CZHA 4NF4B 5I59B 4YAHX 2O1MA 1XS5A 5H8NB 2XX8A 5EQ9A 4G8MA 4AQ4A 4F1VA 1QKBA 1Z7ME 2VPOA 3PGFA 4N8YA 1NV5A 3FZVA 4WEPA 5AE4A 3R26A 2QVUA 4JWYA 4EXLA 1FPJA 4BDRA 4IO4A 4LQ2A 3KN7A 1GTKA 1A7LA 1MXYA 1P1NA 2XXPA 4Q30B 4NX1A 5I84A 3TDJA 1M5DA 2Y7WA 2R9JA 1FPKA 1A55A 3VVFA 2DWAA 3ILUB 3TTMA 3G3GA 4IB2A 1FBPA 1SYIA 3B50A 4GXSB 1BP5A 4JWOA 1S9TA 1B5HA 1LGBC 2V3TA 1FQBA 1FTAA 2PX1A 1UTHA 1NUZA 2X7QA 3R7XA 3VLUA 1H76A 2XA5A 1OLAA 2DWIA 2E0SA 4JVCA 1XC1A 4IR8A 3HPIA 1NV2A 4U21A 3PD9A 4POWA 1P99A 1IXHA 3K6XA 3N94A 1FTKA 3KZGA 5IZZA 4BDOA 2UVGA 3MW0A 5CBSA 2PCRA 5CMBA 4F3BA 1FPGA 4QFPA 3B6QA 3MQ9A 3WAFA 1GGGA 5IAIA 4XKRA 3T9XB 3T9UA 4N81A 4GWZA 5B70A 1BK4A 1Q9DA 1FBEA 2HXRA 4JB7A 1MY0A 5TPAA 2IEEA 3RT6B 1LEVA 3CFXA 4LQ5A 3E78A 1Y9UA 3IR1A 4GX3A 2H99A 2E1SA 1XVYA 3ISPA 2OCUA 2VPNA 5H8HB 2I0BA 4I8CA 5AA2D 1QVSA 2H9BA 4ESWA 3MP6A 3QUFA 3T9HB 3K02A 2Q74A 1NNFA 1US5A 2HZKA 3V83A 3HCQA 2KLFA 2REGA 3N6UA 5IKBA 1VFDA 1ZU0A 4KCCA 2RCBA 2ALUA 4MNCA 5DTBA 3VFJA 1LB9A 1MQDA 4RY1A 3PUWE 4OA4A 4ZEKA 4DCXA 3A09A 3O28A 1ELJA 1LAXA 4PTKA 1A54A 4PE3A 2YJPA 4U22A 2OPDA 1LFIA 4N6PA 3RTFB 1MS7A 3USDA 2XXUA 3IOTA 3IB1A 1R1NA 3TCFA 2P0SA 2F7BA 4NN3A 3TODA 4GQOA 5ET6A 1B3HA 5JTYB 4O7MA 1FRPA 1URGA 4JXIA 3EN3A 2FNCA 1NMUA 3K01A 4NF6A 4UABA 2GFEA 2GH9A 3K1MA 2PBWA 4H65A 4C1UA 3G7WA 4KPTA 2Q88A 2ZZWA 4Z7EA 4N15A 4ZEIA 3C31A 4JSDA 3QXMA 4F19A 2FHYA 5J16A 4XXUA 4LONB 3O97A 2VT5A 5TP9A 2WYPA 1RYXA 2F3DA 4YU0A 4EDPA 4NHBA 3CFZA 4Q5TA 4RPOA 1JEUA 2Y7KA 3TPAA 4XFEA 1JW4A 3E9XA 4IO3A 1MXVA 4OFJA 4EXKA 4H46A 1NNTA 4F2QA 2OX3A 3KSXA 1D4NA 2O7UA 4KYSA 5DYHA 4X04A 2P2AA 4FAJA 2FYIA 2Z22A 4MX6A 4YKPA 3O6IA 1JQFA 3U1OA 5KDTA 2P1SA 2DWJA 1JVYA 2XX9A 5BUUA 4BDNA 2PYYA 1B6HA 4I3YA 4THIA 3E13X 4KI0E 2NVUB 1LAGE 4PFTA 4N91A 2UVHA 2G29A 5DT6A 3O66A 3C33A 4UA8A 3DP4A 3VVEA 5FHNA 4IGRA 4YKJA 2H5YA 3KFMA 4MEVA 2YPNA 1SW5A 5ELVA 1LBVA 4DIGA 1UQWA 3GYYA 2NUVA 1OMPA 3BKIB 2KQZA 1FBHA 4DXBA 2I6EA 1B0HA 3H7MA 5I58B 1FPDA 3MAMA 3LSLA 4OYVA 3L6GA 1PB8A 2RKMA 4R75A 3TELA 1POY1 3TQWA 1MDP1 4RPNA 4G77A 2VHAA 3ILTB 1FPIA 1DOTA 1LCTA 5ITOA 2XXKA 2A5SA 2F6PA 1NH8A 3KSJA 3OOAA 4I62A 1AL3A 2UVJA 5FHMA 4H67A 4OANA 1T0KA 4ELQA 3BBRA 1RKMA 3KJ7A 2GQ1A 4OEVA 3OO6A 3O6HA 4NF5A 3OEKA 4OESA 3MVWA 3FV2A 1XOCA 1DCUA 3IL1B 2DVCA 3TTRA 5FTHA 4I1DA 5I57A 2Y5LA 1BLFA 4F3SA 1PC3A 4MF3A 1INPA 2I3VA 4JWXA 1IMFA 2WYKA 4MBPA 3DP6A 3NOHA 3DM0A 4ZEBA 4PP0A 2XWKA 3S9EA 2O6AA 1MH3A 1L5TA 4QFOA 3RYDA 1B7UA 1URDA 2VOZA 3PTYA 4OERA 4RK2A 4ZZEA 1GV8A 2BJJX 1BTJA 5CBRA 2F97A 1MY3A 4YB6A 3G3IA 4MH5A 1Q35A 4MLVA 1FTLA 4DI3D 1VSOA 4IGTA 3KBZA 1SBPA 3V5AA 3OSRA 3IORA 4HXVA 3HFUA 2UVIA 3SEWA 1NNPA 4PF8A 1P1QA 2YLNA 1N7XA 4MMPA 5LTCA 1B32A 3M3LA 4U1ZA 2Z8DA 4PFBA 1DTZA 4NWCA 3BIHA 4FATA 1LBYA 1H3DA 3RPLB 5TU0A 5HPQA 5M2VA 1TT1A 1BKAA 5L9MA 2Y5KA 3PMXA 1JP4A 3SDFA 2D21A 1JETA 3PD8A 1N3WA 3Q29A 4PBQA 1FTMA 4MHFA 5LOMA 4N6DA 5A5XA 4O8MA 4ZE9A 3PUXE 2B65A 1LAHE 1KA0A 1EH3A 1FBCA 4P56A 3K00A 5H8SA 5KCJB 4IO6A 2DS9A 1UIVA 2UXAA 3CR9A 1MQJA 3MBPA 5H8FA 4H8JA 1IITA 2M8CA 4E0WA 1IMEA 3PPQA 2VGQA 1HSJA 3DLNA 3MZBA 2CEYA 2H98A 4P47A 1IXCA 3TZAA 4P0IA 1MQHA 2F7CA 2CMOA 3CRBA 2OWZA 4KQPA 4FBPA 1RDXA 4QXDA 3E79A 1QW0A 4P11A 3H6WA 5CC2A 4BDMA 2Y7IA 4GD5A 1R9LA 1FTJA 1PB9A 3A3UA 3OO7A 3MP8A 1B4ZA 4H8IA 4GRKA 2WKYA 4PFRA 1YZ0A 2FA7A 3F11A 4DI4B 3GLBA 3KG2A 3T1BA 4FIMA 1FTOA 3IO6A 3VXCA 1QGXA 3IOUA 5DVJA 2FIEA 3OENA 3TFLA 4UACA 4GBVA 1O63A 3CSGA 2QPQA 1QULA 4XIGQ 3IX1A 2DE4A 1SW1A 1LFHA 1OQGA 2ZYNA 3SERA 3UGWA 2R6GE 1KWHA 1NUYA 4GF8A 2V3UA 3JV9A 3QSLA 4LUBA 4ZS9A 3HHGA 3RN8A 3VV5A 2OBGA 3KGCA 1LLSA 4PGPA 4NF6B 1OIBA 2G93A 2NOOA 4GWXA 3K6UA 3IJXB 4EQBA 1NI9A 3OMBA 4FJPA 1B7HA 2ZXTA 4OZ9A 3U8QA 3IFCA 2OJTA 3FJMA 3PV0E 5ET5A 2DYXA 3EF7A 4F1UA 1Y4TA 2PT2A 2GRVA 4QSCA 2AYSA 2QSXA 5IGAA 3RT8A 4QHQA 5H8QB 3PUZE 1SVXB 4LZ8A 1D3KA 4GX6A 3BFUA 4NF8A 4O94A 2OLBA 3OXNA 1OVBA 2ZZXA 4EQ9A 4R2FA 1N84A 5EYHA 3N5LA 1CB6A 3TYHA 4GL0A 3OD7A 2F6GA 4XTCQ 4EUOA 2AL5A 3Q27A 4PGNA 2HFBA 4OENA 3CI8A 3DELB 5J1DA 4G4PA 5DEXB 3TEPA 3VXBA 4IO2A 4P3LA 1MM7A 4XKNA 4IY5A 1ZJLA 3EKIA 3TAJA 3OELA 1NUWA 4HCYA 4RK9A 3MPLA 2ONRA 3PUYE 3FXUA 5B7DA 4GL8A 3K4UA 3FBPA 1Y3QA 2F34A 4X1DA 1MRPA 4ISUA 2HAVA 1XVXA 2D3IA 3CG3A 4R6HA 1MG1A 3B6WA 2OWSA 4NE4A 3GZGA 4F18A 1SQYA 4QF9A 5AA2A 1FQDA 4ONYA 1MQIA 2I4BA 2Q2CA 3FVNA 5CMKA 4LP2B 4RNSA 2B4MA 1NV0A 2FVZA 1JEVA 1I6QA 3CVGA 1LBWA 3MVYA 1DTGA 3MC2A 5EHSA 3H6VA 5IZ3B 4NWDA 3FXRA 2ANJA 3THIA 4XEQA 3T9VA 3LUYA 1MXWA 1MPBA 4F3GA 2KR0A 3RY3A 1SI1A 1ZLQA 2PVUA 3IB2A 4OVQA 3RUMA 4JBZA 2I4CA 5HM4B 1D9QA 4R6YA 4PF6A 2O68A 3MYUA 1FJ9A 4YKKA 4MNPA 4GWWA 4R9GA 3ZKLA 4TLMB 5ICTA 1FPBA 3C4MA 4NF5B 2A5TB 4NF4A 1EYIA 4KYEA 1M5FA 4YZZA 2Z8FA 4DE8A 3Q26A 1FPFA 3TKDA 5H8NA
chains in the Genus database with same CATH topology
4PAKA 4OVTA 2CZIA 1K9ZA 1NV7A 2QVVA 5IZ1A 2Q8MA 1KZ8A 2HPGA 1RDYA 2WBBA 1FPIA 3LUZA 2XXKA 4X8RA 1FBFA 4P1EA 5EQ8A 1G0IA 4M1VA 4N8GA 4OANA 4LN5A 4MJOA 5EYGA 2GQ1A 1NV3A 2MKZA 4MNIA 1IMCA 3RPLA 1DCUA 1FBDA 2V4CA 2WBDA 2FBPA 1NUXA 4XF5A 2Y5LA 4MCOA 1IMBA 3T0JA 3CHGA 1INPA 5DW8A 2ZZVA 1IMFA 2WYKA 3ROJA 4PCDA 3B8BA 2CZHA 4GX4A 1YYZA 3NOHA 1FPEA 2XWKA 2F3BA 1IMDA 1XI6A 5ET8A 3RYDA 4OVRA 1NV1A 5EQ9A 3A29A 4F1VA 2VPOA 3PTYA 4N8YA 1NV5A 2P3NA 4GWSA 2QVUA 4DI3D 1FPJA 3KBZA 1YXIA 4PFIA 4HXVA 3HFUA 3BIGA 4HE2A 2QFLA 4NX1A 4PF8A 1EYKA 5EQAA 4MMPA 5LTCA 4PFBA 1RDZA 4I3EA 2HZLA 3BIHA 1LBYA 3RPLB 1FPKA 2Y5KA 4NAPA 1JP4A 1FPLA 5I5PA 4G61A 4PBQA 1FJ6A 4MHFA 4N6DA 4O8MA 1FBPA 3B50A 5CM6A 1KA0A 1FBCA 4P56A 4I40A 1FTAA 4X9TA 3W9WA 1NUZA 3QMFA 5IM2A 2XA5A 1IMEA 5LDZA 4JVCA 1NV6A 2PFZA 4IR8A 2CEYA 4P47A 1NV2A 4GWUA 2OWZA 4FBPA 1RDXA 4QXDA 1LBZA 3E79A 4AS5A 5IZZA 1LBXA 3W9VA 2PCRA 1K9YA 1FPGA 1G0HA 2R8TA 2V3QA 4PFRA 1YZ0A 4DI4B 1FSAA 3T1BA 1QGXA 3U65A 2CEXA 4HE1A 2FIEA 2DDKA 4GWZA 4N81A 1BK4A 1Q9DA 4PAIA 1FBEA 2HXRA 4GBVA 2QPQA 2WX9A 1LEVA 3E78A 4GX3A 2DE4A 2F5XA 4NQ8A 3ISPA 2VPNA 1NUYA 2FIXA 4JVIA 4JVDA 5T3JA 2Q74A 1IMAA 2HZKA 2BJIA 4HE0A 2QVRA 4PGPA 4GWXA 2B4LA 4MNCA 4PC9A 4GBWA 1NI9A 4OA4A 2XWIA 4NF0A 4PTKA 4PE3A 4NGUA 1FBGA 3IFAA 3IFCA 2L5VA 5I7IA 5ET5A 4F1UA 2XWOA 1VDWA 4NN3A 2JJKA 5IGAA 5ET6A 4O7MA 1FRPA 2DE3A 4GX6A 4QBAA 3SZPA 4O94A 2DVZA 4UABA 2XWVA 4PAFA 5IZ3A 2ZZXA 4P9KA 5EYHA 2ZZWA 4OVPA 1KA1A 4N15A 4PGNA 5J1DA 2DE2A 4F19A 2FHYA 2PFYA 4P3LA 5J16A 4KXPA 1AWBA 2VT5A 3EKIA 1NUWA 4HCYA 1SPIA 4N17A 2WYPA 3MSTA 2F3DA 4NHBA 3FBPA 2WEFA 2CZKA 1NV4A 4GWYA 4XFEA 4PDDA 4N4UA 4OVSA 4MAGA 4H46A 4F18A 2OX3A 2Q9TA 4MIJA 3KC0A 4X04A 1DBZA 5F24A 4H45A 4YICA 4MX6A 3KC1A 2B4MA 5EQ7A 4PETA 1NV0A 2FVZA 4PDHA 1LBWA 4P8BA 4O7IA 4P1LA 5IZ3B 4I3YA 5ET7A 1CNQA 4XEQA 4N91A 1DK4A 3LV0A 2KR0A 5A5LA 4N6KA 4OVQA 1D9QA 4MEVA 4PF6A 2HHMA 3MYUA 1FJ9A 1LBVA 3D1RA 4MNPA 4GWWA 5FBPA 4HCWA 4PBHA 5JK4A 3GYYA 1FPBA 5I3SA 2P3VA 1EYIA 4YZZA 2KQZA 1FBHA 3FXBA 4NG7A 1FPFA 1FPDA 5ESYA 1EYJA 4AS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBV A;  2VT5 A;  1NUW A;  4HXV A;  3BIG A;  1LEV A;  1SPI A;  4HE2 A;  2QFL A;  2F3D A;  4GX3 A;  1EYK A;  2CZI A;  5EQA A;  1K9Z A;  1NV7 A;  1NUY A;  1RDZ A;  2QVV A;  3FBP A;  4I3E A;  2WEF A;  2FIX A;  3BIH A;  2CZK A;  5IZ1 A;  2Q8M A;  1NV4 A;  1LBY A;  1KZ8 A;  4GWY A;  3RPL B;  1FPK A;  1RDY A;  2WBB A;  1FPI A;  2Y5K A;  3LUZ A;  2Q74 A;  1IMA A;  1JP4 A;  5T3J A;  1FPL A;  1FBF A;  2BJI A;  4H46 A;  5EQ8 A;  1Q9D A;  4G61 A;  4HE0 A;  1G0I A;  2QVR A;  1FJ6 A;  2OX3 A;  4MJO A;  4GWX A;  1FBP A;  3KC0 A;  5EYG A;  2GQ1 A;  1NV3 A;  1IMC A;  4GBW A;  1KA0 A;  1NI9 A;  1FBC A;  3RPL A;  1DBZ A;  5F24 A;  4I40 A;  1FTA A;  1DCU A;  4H45 A;  1FBD A;  2WBD A;  2FBP A;  4PTK A;  3KC1 A;  1NUX A;  5EQ7 A;  1FBG A;  1NUZ A;  2Y5L A;  3IFA A;  3IFC A;  1NV0 A;  2FVZ A;  1IMB A;  3T0J A;  3QMF A;  1LBW A;  1INP A;  5DW8 A;  5ET5 A;  1IME A;  5LDZ A;  4O7I A;  1NV6 A;  5IZ3 B;  1IMF A;  4I3Y A;  1VDW A;  5ET7 A;  2JJK A;  1CNQ A;  4IR8 A;  3ROJ A;  1NV2 A;  5ET6 A;  3B8B A;  1DK4 A;  2CZH A;  1FRP A;  2OWZ A;  4GWU A;  4FBP A;  1YYZ A;  1RDX A;  3LV0 A;  1FPE A;  1LBZ A;  4GX4 A;  4QXD A;  5ESY A;  1EYJ A;  5A5L A;  4GX6 A;  2F3B A;  1IMD A;  1XI6 A;  4AS5 A;  1D9Q A;  1LBX A;  5IZ3 A;  5ET8 A;  2HHM A;  3RYD A;  2PCR A;  1FJ9 A;  1LBV A;  1NV1 A;  5EQ9 A;  3A29 A;  3D1R A;  5EYH A;  1K9Y A;  3KBZ A;  4GWW A;  1FPG A;  5FBP A;  1G0H A;  2R8T A;  1KA1 A;  1NV5 A;  1FPB A;  1YZ0 A;  2P3N A;  1FSA A;  2P3V A;  4GWS A;  5I3S A;  1EYI A;  1FBH A;  2QVU A;  1QGX A;  1FPJ A;  4HE1 A;  2FHY A;  5J16 A;  4KXP A;  2FIE A;  1FPF A;  1AWB A;  2DDK A;  4GWZ A;  1BK4 A;  1FPD A;  4N81 A;  1FBE A;  4AS4 A;  1YXI A; 
#chains in the Genus database with same CATH topology
 3S4U A;  3MVZ A;  4PAK A;  3RPW A;  3I3V A;  3MZ9 A;  2XXX A;  4DLD A;  5I2N B;  1Y3N A;  3L6H A;  4PE5 B;  4PFY A;  3HST A;  1K9Z A;  5IZ1 A;  3O29 A;  2HPG A;  1FQF A;  1RDY A;  2WBB A;  2XXQ A;  2Q89 A;  4X8R A;  4F31 B;  3T93 B;  1ATG A;  1G0I A;  4M1V A;  5KZT A;  1JVX A;  4LN5 A;  1SI0 A;  1I6A A;  2ZNT A;  5EYG A;  3FAS A;  4G2Z A;  2MKZ A;  1LCF A;  1IMC A;  4G68 B;  1BIY A;  1A8F A;  3MP1 A;  5F7V A;  2V4C A;  3M3K A;  2FBP A;  3FAT A;  4KR5 A;  3T0J A;  3LSX A;  3OO9 A;  4X1B A;  3ODB A;  3N6T A;  4EF2 A;  4ELP A;  2XXY A;  3ROJ A;  2OK2 A;  2V84 A;  1B40 A;  1P1O A;  1FPE A;  4QFN A;  4M4G A;  2F3B A;  1XI6 A;  1NV1 A;  3Q28 A;  1PBQ A;  2VD2 A;  5L8D A;  1ZTY A;  3OEM A;  1YXI A;  1XHY A;  3OSQ A;  4PFI A;  2ONS A;  2QFL A;  1EYK A;  1MXX A;  3OO8 A;  2OPE A;  4GOT A;  4JSO A;  4POX A;  4QFK A;  1GR2 A;  2DP8 A;  4I3E A;  2HZL A;  1VFE A;  2V93 A;  1IQ7 A;  5I56 B;  4NAP A;  3PPR A;  1FQA A;  4Q0C A;  1B1H A;  3ONM A;  4GIZ A;  4HW8 A;  4JDF A;  2ZNU A;  1FJ6 A;  1B58 A;  4F1Y A;  5CMM A;  4FOR A;  5H8H A;  1ZIU A;  5CM6 A;  2LAO A;  4F29 A;  3UIF A;  1D9Y A;  3GBA A;  4ZED A;  4F22 A;  3SET A;  1P1W A;  3H3G A;  1EZP A;  4L17 A;  3CFL A;  3S9N C;  3DP8 A;  1NV6 A;  2X7P A;  4LAT A;  1JNF A;  3HHF A;  4U4S A;  1P1U A;  3EQ1 A;  4R9F A;  2RF1 A;  4F39 A;  4GWU A;  3MJN A;  4H5G A;  4WED A;  3IJO B;  5CMC A;  4YKI A;  1DPP A;  4AS5 A;  4KYD A;  1LBX A;  3KOT A;  1FQC A;  3D4C A;  3W9V A;  3PMW A;  1RYO A;  4OHN A;  1G0H A;  5JTY A;  1Y20 A;  1FSA A;  4IY6 A;  1B3E A;  1MY4 A;  3K1P A;  1DMB A;  1B4H A;  4ESX A;  3U65 A;  2CEX A;  4HE1 A;  1TFD A;  2DDK A;  4PAI A;  1QUI A;  5BWJ A;  3PMV A;  2XXV A;  4NQ8 A;  3H4Z A;  2HEU A;  1MXZ A;  2FIX A;  1O7T A;  4LZ5 A;  1NKX A;  3KOS A;  2X26 A;  4JVI A;  3H6T A;  4JVD A;  5T3J A;  2HQ0 A;  3C32 A;  3BFT A;  1UTH B;  3MUQ A;  4KFQ A;  1MPC A;  3K1N A;  3T96 B;  2DOJ A;  2QS4 A;  2QVR A;  1MPD A;  1IEJ A;  4H0W A;  2B4L A;  4ELO A;  3QIM A;  3K6W A;  2XWI A;  2REJ A;  3KN3 A;  1FBG A;  2L5V A;  4RJZ A;  4C1T A;  2I49 A;  2I48 A;  4OQO A;  2XWO A;  1VDW A;  2JJK A;  5AA3 A;  4HTG A;  4U23 A;  1UTB A;  2DE3 A;  4G8N A;  3K2D A;  4GXA A;  3FIR A;  2O51 A;  1M5B A;  2DVZ A;  2UYE A;  3CIJ A;  3H03 A;  2XD3 A;  5K2Y A;  1ZMG A;  1LST A;  4P9K A;  1ZBM A;  5CI5 A;  5TPA B;  3K6V A;  3H06 B;  2RC8 A;  1M5E A;  3M3F A;  4WKM A;  3VE1 B;  3LC8 A;  4R74 A;  1I69 A;  1WOD A;  4H5F A;  2HXW A;  2PFY A;  4MLQ A;  3S2V A;  2IA4 A;  3TCG A;  1OLC A;  1SPI A;  4N17 A;  3FD3 A;  3MST A;  4C0R A;  3JYR A;  4ND9 A;  3IAZ A;  4IO7 A;  1VR5 A;  2WEF A;  3C9H A;  3MPK A;  5I58 A;  3RTW B;  4PDD A;  4N4U A;  4N13 A;  5K2X A;  1B05 A;  3VLV A;  1SW2 A;  4MAG A;  1B7Z A;  4X48 A;  4MFI A;  3SEX A;  2B3F A;  4DCY A;  3MZ1 A;  1TWY A;  2Q9T A;  3GBB A;  3PPN A;  2RC9 A;  2GHA A;  3KC0 A;  4BLA A;  3IB0 A;  2HAU A;  1LBB A;  4K3F A;  5DVF A;  4Q8R A;  1UIU A;  3W15 C;  4IO5 A;  3M8U A;  4YMB A;  1JW1 A;  3FV1 A;  5EQ7 A;  4PET A;  5CRY A;  3CG1 A;  4PDH A;  3G3H A;  3PPO A;  2F35 A;  1S50 A;  4WXJ A;  3ZKK A;  4FEC A;  2QMX A;  2RC7 A;  3T66 A;  3O6G A;  1R9Q A;  1CNQ A;  3KN8 A;  1Q1K A;  4O3B A;  4PFU A;  4ZZA A;  3TMG A;  1R6Z A;  3LV0 A;  4N6K A;  3SEU A;  4E0X A;  3O2A A;  3PUV E;  4ZEF A;  1PEB A;  1D9V A;  1H43 A;  2ZNS A;  5TP9 B;  4QFL A;  3LSF B;  4HCW A;  2VD3 A;  1USY H;  1URS A;  3D4G A;  3FGS A;  4NMY A;  4PBH A;  3KBR A;  2P3V A;  1GVC A;  2F36 A;  3QYT A;  4ECF A;  1B0L A;  3HO7 A;  2F7A A;  1IIW A;  3TTL A;  2XXT A;  2XD2 A;  2XX7 A;  5I2K A;  5AA4 A;  4FE8 A;  1N04 A;  4EF1 A;  1MM6 A;  1PDA A;  5F1Q A;  2QVV A;  3PU5 A;  3SES A;  4OWD A;  2QL3 A;  3UK4 A;  3VDF A;  3UN6 A;  3V89 B;  5EQ8 A;  3B7D A;  5KDT B;  4MJO A;  2DQV A;  1IXI A;  2V25 A;  2AL4 A;  1SW4 A;  2O84 X;  4LVQ A;  3RPL A;  4F3P A;  2Z23 A;  4P0G A;  2H4I A;  1IZ1 A;  1NUX A;  1B3L A;  1N76 A;  4MCO A;  1SYH A;  3E4R A;  3U94 A;  3TUS A;  3CHG A;  4EQ7 A;  5DW8 A;  2ZZV A;  3SKP A;  1ZKB A;  2ZMB A;  1XT8 A;  1Y1M A;  4PCD A;  5KCJ A;  3C34 A;  3E3K A;  4GX4 A;  1YYZ A;  1EZO A;  1TXF A;  3WAE A;  1FCK A;  3EHU A;  1IMD A;  2ZYK A;  1AIV A;  5ET8 A;  1II5 A;  3IO4 A;  4OVR A;  3RLF E;  1OQH A;  3A29 A;  3FJG A;  4KCD A;  2AIX A;  3GXA A;  2P3N A;  4OVJ A;  3C35 A;  4GWS A;  1Y4C A;  3G3F A;  1YPN A;  1IUD A;  1CE2 A;  3MVX A;  4KD5 A;  4OXV A;  3PPP A;  3BIG A;  1MY1 A;  4HE2 A;  3U93 A;  3CSB A;  1B5J A;  5EQA A;  3H6U A;  1RDZ A;  2XXR A;  4YB7 A;  1AH5 A;  1LFG A;  5I59 A;  1Y3P A;  2D5W A;  4Z0I A;  1FQE A;  5HBC A;  3QAX A;  1FPL A;  5I5P A;  4G61 A;  2ZYO A;  3B6T A;  2XXH A;  5I57 B;  1LB8 A;  1SD3 A;  3U72 A;  2B3B A;  4TOZ A;  3G3K A;  3IOW A;  1H44 A;  2GHB A;  4HS7 A;  2XXI A;  1ANF A;  4TLL B;  2QS1 A;  2THI A;  4OFO A;  4I40 A;  2DXY A;  4X9T A;  4ELR A;  1YAE A;  3W9W A;  1FW0 A;  5FTI A;  3EHT A;  3QMF A;  5IM2 A;  2H25 A;  2UYF A;  4R2B A;  2QRY A;  5LDZ A;  1OVT A;  1B46 A;  2PFZ A;  4LZ7 A;  4R73 A;  3ZS6 A;  3ZSF A;  1B3G A;  2ABH A;  4NED A;  3MWB A;  4O3C A;  1B51 A;  1IXG A;  3SEY A;  1MXU A;  1H45 A;  1LBZ A;  4DXC A;  4ZEC A;  2ESN A;  2Z8E A;  3FXQ A;  5DVI A;  4FEB A;  4BDQ A;  1K9Y A;  2DXR A;  3FJ7 A;  5H8Q A;  2R8T A;  3Q25 A;  2V3Q A;  3S9M C;  3TTN A;  4ZDM A;  4F2O A;  1NFT A;  3AXF A;  2I3W A;  3V8X B;  1B3F A;  1S7Y A;  2WX9 A;  2QJE A;  2F5X A;  2RCA A;  5A5X B;  1DPE A;  1AMF A;  1USY E;  1N3X A;  4N07 A;  5DEX A;  2NWJ A;  4XKQ A;  1PBP A;  3IOV A;  1NNK A;  1IMA A;  2ONK E;  3HN0 A;  4DXU A;  1UTB B;  3K0V A;  4O3A A;  3QUJ A;  2BJI A;  4QSD A;  4HE0 A;  4OMB A;  2HCA A;  1MY2 A;  1HSL A;  4OEU A;  5ISU A;  5H8F B;  3KEI A;  4PC9 A;  4I9D A;  1YCJ A;  4GBW A;  1N0T A;  3I5O A;  3TCH A;  1WDN A;  1US4 A;  5L9O A;  4NF0 A;  2DSF A;  3A3C A;  4NGU A;  3IFA A;  4AB5 A;  5I7I A;  2O1L A;  4QRZ A;  4U2R A;  4GVO A;  3EPE A;  4BDL A;  1O64 A;  3JZJ A;  1A8E A;  3LR1 A;  2XHD A;  4QBA A;  3N26 A;  4H1X A;  3SZP A;  2XWV A;  4PAF A;  5IZ3 A;  2O7I A;  3KJT A;  2OWT A;  4OFL A;  2Y7P A;  4GLI A;  4OVP A;  1KA1 A;  1B5I A;  2OZZ A;  5L9S A;  4KHZ E;  1QUK A;  2DE2 A;  4KXP A;  1AWB A;  4FED A;  3RGY A;  2ZYM A;  2A5T A;  1MQG A;  2Y84 A;  2I0C A;  4LA9 A;  1NH7 A;  3HV1 A;  4QSE A;  4GWO A;  2CZK A;  1MDQ A;  1NV4 A;  4GWY A;  4OVS A;  1SDX A;  1LAF E;  4AB6 A;  3FVG A;  5I2N A;  2F8D A;  2VP1 A;  3RNN A;  4MIJ A;  1J1N A;  3RQT A;  3FVO A;  4R72 A;  5EYF A;  1M5C A;  1DBZ A;  5F24 A;  4RA1 A;  4H45 A;  4YIC A;  3KC1 A;  5AA1 A;  2Q8J A;  1EU8 A;  1QKA A;  1YTV A;  4P8B A;  4NF8 B;  4YMA A;  4U4X A;  4G68 A;  1NL5 A;  4O7I A;  2DWH A;  4P1L A;  5I2K B;  5AA4 B;  5ET7 A;  4G8H A;  4G68 C;  4OTE A;  1A40 A;  3UP9 A;  1QJM A;  1DK4 A;  1Y1Z A;  3VLW A;  5A5L A;  5ITP A;  1AOV A;  5EHM A;  4R6K A;  3SEV A;  1EZ9 A;  2PT1 A;  1B1X A;  2HHM A;  1VE4 A;  3D1R A;  3TTK A;  5FBP A;  4RXL A;  5JK4 A;  1QUJ A;  1B52 A;  5I3S A;  2QS2 A;  1TFA A;  3UA8 A;  4PQJ A;  4NTL A;  1F9B A;  3FXB A;  4YB5 A;  1PB7 A;  5FHO A;  3UOR A;  4NG7 A;  3EHS A;  1MH4 A;  5ESY A;  1EYJ A;  4AS4 A;  1JW5 A;  3O9P A;  4XKP A;  4RYA A;  3ECR A;  3QK6 A;  3IK6 B;  4OVT A;  3R6U A;  2XXW A;  2RIN A;  2R71 A;  3U92 A;  2CZI A;  5AA2 B;  2QMW A;  1N7W A;  2QS3 A;  4PFW A;  3TQL A;  4TQU Q;  1LBC A;  1NV7 A;  4ZE8 A;  2Q8M A;  1KZ8 A;  3FVK A;  1DSN A;  1A99 A;  3LUZ A;  2Q2A A;  1FBF A;  2PMS A;  4P1E A;  2Y7R A;  5JEI A;  4N8G A;  3FUZ A;  3P7I A;  1NV3 A;  1B2H A;  4MNI A;  5I56 A;  2NXO A;  1Z7N E;  1FBD A;  2CZL A;  2WBD A;  4OET A;  3LBS A;  4DDD A;  1POT A;  3S9L C;  3I6V A;  2W7Y A;  4XF5 A;  1IMB A;  1HSE A;  3C36 A;  3T22 A;  2I58 A;  5ICQ A;  4GFR A;  2F78 A;  1WVJ A;  4H6D A;  4DZ1 A;  4U1O A;  3LSW A;  3G3J A;  1I6B A;  3VVD A;  1B9J A;  3B8B A;  2O69 A;  2CZH A;  4NF4 B;  5I59 B;  4YAH X;  2O1M A;  1XS5 A;  5H8N B;  2XX8 A;  5EQ9 A;  4G8M A;  4AQ4 A;  4F1V A;  1QKB A;  1Z7M E;  2VPO A;  3PGF A;  4N8Y A;  1NV5 A;  3FZV A;  4WEP A;  5AE4 A;  3R26 A;  2QVU A;  4JWY A;  4EXL A;  1FPJ A;  4BDR A;  4IO4 A;  4LQ2 A;  3KN7 A;  1GTK A;  1A7L A;  1MXY A;  1P1N A;  2XXP A;  4Q30 B;  4NX1 A;  5I84 A;  3TDJ A;  1M5D A;  2Y7W A;  2R9J A;  1FPK A;  1A55 A;  3VVF A;  2DWA A;  3ILU B;  3TTM A;  3G3G A;  4IB2 A;  1FBP A;  1SYI A;  3B50 A;  4GXS B;  1BP5 A;  4JWO A;  1S9T A;  1B5H A;  1LGB C;  2V3T A;  1FQB A;  1FTA A;  2PX1 A;  1UTH A;  1NUZ A;  2X7Q A;  3R7X A;  3VLU A;  1H76 A;  2XA5 A;  1OLA A;  2DWI A;  2E0S A;  4JVC A;  1XC1 A;  4IR8 A;  3HPI A;  1NV2 A;  4U21 A;  3PD9 A;  4POW A;  1P99 A;  1IXH A;  3K6X A;  3N94 A;  1FTK A;  3KZG A;  5IZZ A;  4BDO A;  2UVG A;  3MW0 A;  5CBS A;  2PCR A;  5CMB A;  4F3B A;  1FPG A;  4QFP A;  3B6Q A;  3MQ9 A;  3WAF A;  1GGG A;  5IAI A;  4XKR A;  3T9X B;  3T9U A;  4N81 A;  4GWZ A;  5B70 A;  1BK4 A;  1Q9D A;  1FBE A;  2HXR A;  4JB7 A;  1MY0 A;  5TPA A;  2IEE A;  3RT6 B;  1LEV A;  3CFX A;  4LQ5 A;  3E78 A;  1Y9U A;  3IR1 A;  4GX3 A;  2H99 A;  2E1S A;  1XVY A;  3ISP A;  2OCU A;  2VPN A;  5H8H B;  2I0B A;  4I8C A;  5AA2 D;  1QVS A;  2H9B A;  4ESW A;  3MP6 A;  3QUF A;  3T9H B;  3K02 A;  2Q74 A;  1NNF A;  1US5 A;  2HZK A;  3V83 A;  3HCQ A;  2KLF A;  2REG A;  3N6U A;  5IKB A;  1VFD A;  1ZU0 A;  4KCC A;  2RCB A;  2ALU A;  4MNC A;  5DTB A;  3VFJ A;  1LB9 A;  1MQD A;  4RY1 A;  3PUW E;  4OA4 A;  4ZEK A;  4DCX A;  3A09 A;  3O28 A;  1ELJ A;  1LAX A;  4PTK A;  1A54 A;  4PE3 A;  2YJP A;  4U22 A;  2OPD A;  1LFI A;  4N6P A;  3RTF B;  1MS7 A;  3USD A;  2XXU A;  3IOT A;  3IB1 A;  1R1N A;  3TCF A;  2P0S A;  2F7B A;  4NN3 A;  3TOD A;  4GQO A;  5ET6 A;  1B3H A;  5JTY B;  4O7M A;  1FRP A;  1URG A;  4JXI A;  3EN3 A;  2FNC A;  1NMU A;  3K01 A;  4NF6 A;  4UAB A;  2GFE A;  2GH9 A;  3K1M A;  2PBW A;  4H65 A;  4C1U A;  3G7W A;  4KPT A;  2Q88 A;  2ZZW A;  4Z7E A;  4N15 A;  4ZEI A;  3C31 A;  4JSD A;  3QXM A;  4F19 A;  2FHY A;  5J16 A;  4XXU A;  4LON B;  3O97 A;  2VT5 A;  5TP9 A;  2WYP A;  1RYX A;  2F3D A;  4YU0 A;  4EDP A;  4NHB A;  3CFZ A;  4Q5T A;  4RPO A;  1JEU A;  2Y7K A;  3TPA A;  4XFE A;  1JW4 A;  3E9X A;  4IO3 A;  1MXV A;  4OFJ A;  4EXK A;  4H46 A;  1NNT A;  4F2Q A;  2OX3 A;  3KSX A;  1D4N A;  2O7U A;  4KYS A;  5DYH A;  4X04 A;  2P2A A;  4FAJ A;  2FYI A;  2Z22 A;  4MX6 A;  4YKP A;  3O6I A;  1JQF A;  3U1O A;  5KDT A;  2P1S A;  2DWJ A;  1JVY A;  2XX9 A;  5BUU A;  4BDN A;  2PYY A;  1B6H A;  4I3Y A;  4THI A;  3E13 X;  4KI0 E;  2NVU B;  1LAG E;  4PFT A;  4N91 A;  2UVH A;  2G29 A;  5DT6 A;  3O66 A;  3C33 A;  4UA8 A;  3DP4 A;  3VVE A;  5FHN A;  4IGR A;  4YKJ A;  2H5Y A;  3KFM A;  4MEV A;  2YPN A;  1SW5 A;  5ELV A;  1LBV A;  4DIG A;  1UQW A;  3GYY A;  2NUV A;  1OMP A;  3BKI B;  2KQZ A;  1FBH A;  4DXB A;  2I6E A;  1B0H A;  3H7M A;  5I58 B;  1FPD A;  3MAM A;  3LSL A;  4OYV A;  3L6G A;  1PB8 A;  2RKM A;  4R75 A;  3TEL A;  1POY 1;  3TQW A;  1MDP 1;  4RPN A;  4G77 A;  2VHA A;  3ILT B;  1FPI A;  1DOT A;  1LCT A;  5ITO A;  2XXK A;  2A5S A;  2F6P A;  1NH8 A;  3KSJ A;  3OOA A;  4I62 A;  1AL3 A;  2UVJ A;  5FHM A;  4H67 A;  4OAN A;  1T0K A;  4ELQ A;  3BBR A;  1RKM A;  3KJ7 A;  2GQ1 A;  4OEV A;  3OO6 A;  3O6H A;  4NF5 A;  3OEK A;  4OES A;  3MVW A;  3FV2 A;  1XOC A;  1DCU A;  3IL1 B;  2DVC A;  3TTR A;  5FTH A;  4I1D A;  5I57 A;  2Y5L A;  1BLF A;  4F3S A;  1PC3 A;  4MF3 A;  1INP A;  2I3V A;  4JWX A;  1IMF A;  2WYK A;  4MBP A;  3DP6 A;  3NOH A;  3DM0 A;  4ZEB A;  4PP0 A;  2XWK A;  3S9E A;  2O6A A;  1MH3 A;  1L5T A;  4QFO A;  3RYD A;  1B7U A;  1URD A;  2VOZ A;  3PTY A;  4OER A;  4RK2 A;  4ZZE A;  1GV8 A;  2BJJ X;  1BTJ A;  5CBR A;  2F97 A;  1MY3 A;  4YB6 A;  3G3I A;  4MH5 A;  1Q35 A;  4MLV A;  1FTL A;  4DI3 D;  1VSO A;  4IGT A;  3KBZ A;  1SBP A;  3V5A A;  3OSR A;  3IOR A;  4HXV A;  3HFU A;  2UVI A;  3SEW A;  1NNP A;  4PF8 A;  1P1Q A;  2YLN A;  1N7X A;  4MMP A;  5LTC A;  1B32 A;  3M3L A;  4U1Z A;  2Z8D A;  4PFB A;  1DTZ A;  4NWC A;  3BIH A;  4FAT A;  1LBY A;  1H3D A;  3RPL B;  5TU0 A;  5HPQ A;  5M2V A;  1TT1 A;  1BKA A;  5L9M A;  2Y5K A;  3PMX A;  1JP4 A;  3SDF A;  2D21 A;  1JET A;  3PD8 A;  1N3W A;  3Q29 A;  4PBQ A;  1FTM A;  4MHF A;  5LOM A;  4N6D A;  5A5X A;  4O8M A;  4ZE9 A;  3PUX E;  2B65 A;  1LAH E;  1KA0 A;  1EH3 A;  1FBC A;  4P56 A;  3K00 A;  5H8S A;  5KCJ B;  4IO6 A;  2DS9 A;  1UIV A;  2UXA A;  3CR9 A;  1MQJ A;  3MBP A;  5H8F A;  4H8J A;  1IIT A;  2M8C A;  4E0W A;  1IME A;  3PPQ A;  2VGQ A;  1HSJ A;  3DLN A;  3MZB A;  2CEY A;  2H98 A;  4P47 A;  1IXC A;  3TZA A;  4P0I A;  1MQH A;  2F7C A;  2CMO A;  3CRB A;  2OWZ A;  4KQP A;  4FBP A;  1RDX A;  4QXD A;  3E79 A;  1QW0 A;  4P11 A;  3H6W A;  5CC2 A;  4BDM A;  2Y7I A;  4GD5 A;  1R9L A;  1FTJ A;  1PB9 A;  3A3U A;  3OO7 A;  3MP8 A;  1B4Z A;  4H8I A;  4GRK A;  2WKY A;  4PFR A;  1YZ0 A;  2FA7 A;  3F11 A;  4DI4 B;  3GLB A;  3KG2 A;  3T1B A;  4FIM A;  1FTO A;  3IO6 A;  3VXC A;  1QGX A;  3IOU A;  5DVJ A;  2FIE A;  3OEN A;  3TFL A;  4UAC A;  4GBV A;  1O63 A;  3CSG A;  2QPQ A;  1QUL A;  4XIG Q;  3IX1 A;  2DE4 A;  1SW1 A;  1LFH A;  1OQG A;  2ZYN A;  3SER A;  3UGW A;  2R6G E;  1KWH A;  1NUY A;  4GF8 A;  2V3U A;  3JV9 A;  3QSL A;  4LUB A;  4ZS9 A;  3HHG A;  3RN8 A;  3VV5 A;  2OBG A;  3KGC A;  1LLS A;  4PGP A;  4NF6 B;  1OIB A;  2G93 A;  2NOO A;  4GWX A;  3K6U A;  3IJX B;  4EQB A;  1NI9 A;  3OMB A;  4FJP A;  1B7H A;  2ZXT A;  4OZ9 A;  3U8Q A;  3IFC A;  2OJT A;  3FJM A;  3PV0 E;  5ET5 A;  2DYX A;  3EF7 A;  4F1U A;  1Y4T A;  2PT2 A;  2GRV A;  4QSC A;  2AYS A;  2QSX A;  5IGA A;  3RT8 A;  4QHQ A;  5H8Q B;  3PUZ E;  1SVX B;  4LZ8 A;  1D3K A;  4GX6 A;  3BFU A;  4NF8 A;  4O94 A;  2OLB A;  3OXN A;  1OVB A;  2ZZX A;  4EQ9 A;  4R2F A;  1N84 A;  5EYH A;  3N5L A;  1CB6 A;  3TYH A;  4GL0 A;  3OD7 A;  2F6G A;  4XTC Q;  4EUO A;  2AL5 A;  3Q27 A;  4PGN A;  2HFB A;  4OEN A;  3CI8 A;  3DEL B;  5J1D A;  4G4P A;  5DEX B;  3TEP A;  3VXB A;  4IO2 A;  4P3L A;  1MM7 A;  4XKN A;  4IY5 A;  1ZJL A;  3EKI A;  3TAJ A;  3OEL A;  1NUW A;  4HCY A;  4RK9 A;  3MPL A;  2ONR A;  3PUY E;  3FXU A;  5B7D A;  4GL8 A;  3K4U A;  3FBP A;  1Y3Q A;  2F34 A;  4X1D A;  1MRP A;  4ISU A;  2HAV A;  1XVX A;  2D3I A;  3CG3 A;  4R6H A;  1MG1 A;  3B6W A;  2OWS A;  4NE4 A;  3GZG A;  4F18 A;  1SQY A;  4QF9 A;  5AA2 A;  1FQD A;  4ONY A;  1MQI A;  2I4B A;  2Q2C A;  3FVN A;  5CMK A;  4LP2 B;  4RNS A;  2B4M A;  1NV0 A;  2FVZ A;  1JEV A;  1I6Q A;  3CVG A;  1LBW A;  3MVY A;  1DTG A;  3MC2 A;  5EHS A;  3H6V A;  5IZ3 B;  4NWD A;  3FXR A;  2ANJ A;  3THI A;  4XEQ A;  3T9V A;  3LUY A;  1MXW A;  1MPB A;  4F3G A;  2KR0 A;  3RY3 A;  1SI1 A;  1ZLQ A;  2PVU A;  3IB2 A;  4OVQ A;  3RUM A;  4JBZ A;  2I4C A;  5HM4 B;  1D9Q A;  4R6Y A;  4PF6 A;  2O68 A;  3MYU A;  1FJ9 A;  4YKK A;  4MNP A;  4GWW A;  4R9G A;  3ZKL A;  4TLM B;  5ICT A;  1FPB A;  3C4M A;  4NF5 B;  2A5T B;  4NF4 A;  1EYI A;  4KYE A;  1M5F A;  4YZZ A;  2Z8F A;  4DE8 A;  3Q26 A;  1FPF A;  3TKD A;  5H8N A; 
#chains in the Genus database with same CATH homology
 4PAK A;  4OVT A;  2CZI A;  1K9Z A;  1NV7 A;  2QVV A;  5IZ1 A;  2Q8M A;  1KZ8 A;  2HPG A;  1RDY A;  2WBB A;  1FPI A;  3LUZ A;  2XXK A;  4X8R A;  1FBF A;  4P1E A;  5EQ8 A;  1G0I A;  4M1V A;  4N8G A;  4OAN A;  4LN5 A;  4MJO A;  5EYG A;  2GQ1 A;  1NV3 A;  2MKZ A;  4MNI A;  1IMC A;  3RPL A;  1DCU A;  1FBD A;  2V4C A;  2WBD A;  2FBP A;  1NUX A;  4XF5 A;  2Y5L A;  4MCO A;  1IMB A;  3T0J A;  3CHG A;  1INP A;  5DW8 A;  2ZZV A;  1IMF A;  2WYK A;  3ROJ A;  4PCD A;  3B8B A;  2CZH A;  4GX4 A;  1YYZ A;  3NOH A;  1FPE A;  2XWK A;  2F3B A;  1IMD A;  1XI6 A;  5ET8 A;  3RYD A;  4OVR A;  1NV1 A;  5EQ9 A;  3A29 A;  4F1V A;  2VPO A;  3PTY A;  4N8Y A;  1NV5 A;  2P3N A;  4GWS A;  2QVU A;  4DI3 D;  1FPJ A;  3KBZ A;  1YXI A;  4PFI A;  4HXV A;  3HFU A;  3BIG A;  4HE2 A;  2QFL A;  4NX1 A;  4PF8 A;  1EYK A;  5EQA A;  4MMP A;  5LTC A;  4PFB A;  1RDZ A;  4I3E A;  2HZL A;  3BIH A;  1LBY A;  3RPL B;  1FPK A;  2Y5K A;  4NAP A;  1JP4 A;  1FPL A;  5I5P A;  4G61 A;  4PBQ A;  1FJ6 A;  4MHF A;  4N6D A;  4O8M A;  1FBP A;  3B50 A;  5CM6 A;  1KA0 A;  1FBC A;  4P56 A;  4I40 A;  1FTA A;  4X9T A;  3W9W A;  1NUZ A;  3QMF A;  5IM2 A;  2XA5 A;  1IME A;  5LDZ A;  4JVC A;  1NV6 A;  2PFZ A;  4IR8 A;  2CEY A;  4P47 A;  1NV2 A;  4GWU A;  2OWZ A;  4FBP A;  1RDX A;  4QXD A;  1LBZ A;  3E79 A;  4AS5 A;  5IZZ A;  1LBX A;  3W9V A;  2PCR A;  1K9Y A;  1FPG A;  1G0H A;  2R8T A;  2V3Q A;  4PFR A;  1YZ0 A;  4DI4 B;  1FSA A;  3T1B A;  1QGX A;  3U65 A;  2CEX A;  4HE1 A;  2FIE A;  2DDK A;  4GWZ A;  4N81 A;  1BK4 A;  1Q9D A;  4PAI A;  1FBE A;  2HXR A;  4GBV A;  2QPQ A;  2WX9 A;  1LEV A;  3E78 A;  4GX3 A;  2DE4 A;  2F5X A;  4NQ8 A;  3ISP A;  2VPN A;  1NUY A;  2FIX A;  4JVI A;  4JVD A;  5T3J A;  2Q74 A;  1IMA A;  2HZK A;  2BJI A;  4HE0 A;  2QVR A;  4PGP A;  4GWX A;  2B4L A;  4MNC A;  4PC9 A;  4GBW A;  1NI9 A;  4OA4 A;  2XWI A;  4NF0 A;  4PTK A;  4PE3 A;  4NGU A;  1FBG A;  3IFA A;  3IFC A;  2L5V A;  5I7I A;  5ET5 A;  4F1U A;  2XWO A;  1VDW A;  4NN3 A;  2JJK A;  5IGA A;  5ET6 A;  4O7M A;  1FRP A;  2DE3 A;  4GX6 A;  4QBA A;  3SZP A;  4O94 A;  2DVZ A;  4UAB A;  2XWV A;  4PAF A;  5IZ3 A;  2ZZX A;  4P9K A;  5EYH A;  2ZZW A;  4OVP A;  1KA1 A;  4N15 A;  4PGN A;  5J1D A;  2DE2 A;  4F19 A;  2FHY A;  2PFY A;  4P3L A;  5J16 A;  4KXP A;  1AWB A;  2VT5 A;  3EKI A;  1NUW A;  4HCY A;  1SPI A;  4N17 A;  2WYP A;  3MST A;  2F3D A;  4NHB A;  3FBP A;  2WEF A;  2CZK A;  1NV4 A;  4GWY A;  4XFE A;  4PDD A;  4N4U A;  4OVS A;  4MAG A;  4H46 A;  4F18 A;  2OX3 A;  2Q9T A;  4MIJ A;  3KC0 A;  4X04 A;  1DBZ A;  5F24 A;  4H45 A;  4YIC A;  4MX6 A;  3KC1 A;  2B4M A;  5EQ7 A;  4PET A;  1NV0 A;  2FVZ A;  4PDH A;  1LBW A;  4P8B A;  4O7I A;  4P1L A;  5IZ3 B;  4I3Y A;  5ET7 A;  1CNQ A;  4XEQ A;  4N91 A;  1DK4 A;  3LV0 A;  2KR0 A;  5A5L A;  4N6K A;  4OVQ A;  1D9Q A;  4MEV A;  4PF6 A;  2HHM A;  3MYU A;  1FJ9 A;  1LBV A;  3D1R A;  4MNP A;  4GWW A;  5FBP A;  4HCW A;  4PBH A;  5JK4 A;  3GYY A;  1FPB A;  5I3S A;  2P3V A;  1EYI A;  4YZZ A;  2KQZ A;  1FBH A;  3FXB A;  4NG7 A;  1FPF A;  1FPD A;  5ESY A;  1EYJ A;  4AS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...