4I3EA

Crystal structure of staphylococcal impase - i complexed with products.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
262
structure length
259
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of Staphylococcal IMPase - I complexed with products.
rcsb
source organism Staphylococcus aureus
total genus 67
structure length 259
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i3eA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i3eA02
3BIGA 5A5LA 4AS4A 1QGXA 4QXDA 1FBDA 4HE0A 1RDXA 4HXVA 4GX6A 4I40A 1G0HA 1G0IA 3IFAA 3LUZA 4FBPA 2OWZA 1NV3A 2FBPA 1FPIA 2BJIA 1LEVA 2F3DA 1IMFA 1LBZA 4KXPA 2PCRA 1NV7A 1NV4A 2R8TA 1IMAA 1LBXA 4O7IA 3FBPA 4I3YA 3LV0A 5ET7A 2Y5LA 5ET5A 1YYZA 4PTKA 1FBCA 1D9QA 1NUZA 1NI9A 5ET6A 4GX3A 1FBHA 1DK4A 1NV0A 2QFLA 2WEFA 3B8BA 3KC0A 2GQ1A 1YXIA 4GWUA 4GWYA 1BK4A 5IZ3A 1DBZA 2CZHA 5EQ8A 2Q8MA 3RPLA 2FVZA 5T3JA 4GBVA 1K9YA 2QVUA 1LBVA 1RDYA 1IMBA 2Y5KA 1NV5A 1FSAA 4G61A 1INPA 1NUWA 2FIXA 3QMFA 4MJOA 2WBBA 1SPIA 1FBGA 1XI6A 3A29A 1KZ8A 1KA1A 2HHMA 4I3EA 1FPDA 2WBDA 1EYJA 1K9ZA 4GBWA 1NV1A 4H46A 1Q9DA 1NV6A 1NV2A 2CZIA 3BIHA 1FJ6A 4GWXA 3KC1A 5EYGA 3IFCA 4GWZA 1DCUA 1FPBA 2FIEA 1IMEA 3KBZA 4N81A 1FPLA 1IMDA 5DW8A 1FBFA 2F3BA 5LDZA 1AWBA 5IZ1A 2P3NA 5EQ7A 3RYDA 1FJ9A 2DDKA 4GWWA 1FPFA 1EYKA 1FPEA 1CNQA 4H45A 4GWSA 1FBEA 1FPKA 1FBPA 1LBWA 4IR8A 2QVVA 3D1RA 4HE1A 4HE2A 5EQAA 3ROJA 2P3VA 2VT5A 1FPGA 1KA0A 2CZKA 2JJKA 5ET8A 5EYHA 1NUXA 5F24A 1YZ0A 1JP4A 5EQ9A 2Q74A 5ESYA 5J16A 4GX4A 2FHYA 5IZ3B 3T0JA 2OX3A 1NUYA 1FRPA 2QVRA 5I3SA 5FBPA 1FPJA 3RPLB 1IMCA 1RDZA 1VDWA 1FTAA 4AS5A 1LBYA 1EYIA
chains in the Genus database with same CATH superfamily
3EN3A 1RDXA 4GX6A 4U4SA 2UVJA 1LAFE 4FBPA 3B6TA 1B52A 4PE5B 4YB6A 2VD2A 1N84A 5L8DA 3TDJA 1EZ9A 3D4CA 4YB7A 4C1TA 3HHGA 1LCFA 3FGSA 4F19A 5CI5A 1UTHA 1FBHA 3KOSA 2XX7A 4GWUA 3O28A 1IEJA 2KLFA 1JEVA 1IMBA 3MP6A 1Z7NE 4P47A 5KCJA 1LBCA 2REJA 5CM6A 1IXHA 2WBDA 1N0TA 3FVNA 4ZE9A 1HSEA 2QS4A 4JWYA 4HS7A 4MEVA 3KC1A 2FA7A 3MBPA 4R6KA 1IXIA 4OEUA 3TCHA 2XD3A 3C32A 4FECA 4DIGA 1MY2A 2L5VA 5A5XA 4AB6A 2O7UA 1MS7A 4Q5TA 3FJ7A 3U1OA 5H8NA 3RN8A 1H44A 3K01A 1FTOA 1S50A 1EZOA 1UIVA 4ND9A 2W7YA 1M5FA 2OX3A 3KN8A 2VPOA 1QUKA 3CG3A 4XXUA 2QPQA 4RJZA 1RYXA 2VOZA 2GFEA 2YJPA 4HE0A 5I59A 2GHAA 4F3BA 3PPPA 1N04A 3LUZA 5KZTA 3FASA 2F3DA 2F5XA 3IX1A 2E0SA 3M3LA 1DSNA 2ABHA 4O7IA 3FBPA 4PFYA 2Z8DA 2QJEA 1URDA 1RYOA 4MIJA 4IO4A 4R6YA 1HSJA 3B8BA 4GWYA 3EF7A 3OEKA 3IOTA 2DS9A 4UABA 4G8NA 2V93A 2ZNUA 3B6WA 1MQGA 4YICA 2PFZA 3H6TA 3P7IA 3T66A 2QMWA 1GTKA 3AXFA 1BTJA 2H9BA 3V5AA 2HAVA 2WX9A 2PX1A 2O68A 4O7MA 2F6PA 4YKIA 1NV2A 3IFCA 2V3QA 3N26A 2NXOA 5DVIA 3GBBA 3BKIB 1AWBA 2XWIA 5IZZA 4DZ1A 4F1YA 1FPFA 1SW1A 5I56B 3KOTA 3GLBA 4GWSA 1TWYA 2WKYA 3EHUA 5EQAA 4OMBA 3BFTA 1MY0A 2ANJA 1KA0A 5K2XA 4QSDA 5JK4A 4KHZE 3HPIA 5IZ3B 4C1UA 1FRPA 2ZMBA 1MXYA 4LZ7A 5HBCA 1B3GA 3TTRA 4LONB 2Y7WA 3W9VA 4MNIA 4JSOA 4YMAA 3IJOB 1MPBA 1NV4A 3OSQA 2YLNA 2R8TA 4OFOA 5CBRA 3I5OA 3VE1B 1IMAA 3CRBA 1MQIA 1FBCA 1LAXA 2XXHA 1D9QA 1LCTA 3RT8A 3VV5A 4LZ5A 1CE2A 4GX3A 3MSTA 1OQHA 1UQWA 2OZZA 1PB9A 1YXIA 2ESNA 2XWVA 4P56A 3IO4A 5CRYA 1LB9A 2V3TA 4BDMA 1Y4TA 1NV5A 3CFZA 4PF6A 2H25A 3TUSA 1BIYA 4OFLA 3QUFA 3VLVA 2I49A 4G68C 3CSGA 3G3GA 4LN5A 1Y3QA 2Q2CA 3Q28A 2QS2A 5EYFA 2P3VA 4YKPA 3QYTA 2GHBA 4QFPA 4KD5A 3SERA 1JP4A 3CSBA 5J16A 3ZKKA 1LFHA 3T0JA 2HQ0A 3T22A 4WEDA 1IMCA 1B05A 3H3GA 2B3BA 4DCYA 2DWHA 2DOJA 1R9LA 4AS5A 3PD8A 4GQOA 2Y7PA 4I1DA 3O6IA 4EQBA 2B4MA 2BJIA 1EH3A 2UYFA 4FATA 5I56A 1Y20A 3L6HA 1FTKA 3SKPA 3IOUA 2DWAA 2HPGA 1GVCA 2I6EA 4NF4B 3KJ7A 1B1HA 4OHNA 1Y1ZA 3F11A 5H8QB 1SD3A 5ITOA 5ICTA 4NTLA 1SDXA 4KFQA 5IZ3A 1Y3NA 2R6GE 4LUBA 1WODA 1PEBA 5DVJA 4H0WA 4NF0A 2OJTA 4QBAA 3KN7A 1RDYA 4KQPA 4N17A 4EDPA 3LSWA 3HFUA 4PF8A 4L17A 1XI6A 3K4UA 4EXLA 2GH9A 4Q8RA 4GBWA 4DXUA 3V83A 4MFIA 3HSTA 3Q29A 3DP6A 4H67A 2A5TB 2F34A 2Q88A 2DE3A 1SYHA 3S9LC 2P3NA 5EQ7A 1B4ZA 5KDTB 1O63A 3TQWA 2OPDA 2ZYNA 4ONYA 4NF8B 2VP1A 1MQHA 1MY1A 4PFTA 4BDLA 3QK6A 3G3IA 4X04A 3TZAA 4XIGQ 3K02A 1OLCA 4FEDA 3RUMA 4FIMA 1IXCA 1EYIA 5A5LA 3PTYA 5CBSA 2LAOA 4BDOA 3HO7A 1FBDA 1G0HA 4H5FA 1I6BA 2YPNA 1NMUA 1LBZA 4KXPA 1B9JA 3FJGA 2I3VA 3UIFA 3O66A 4I3YA 3ILTB 2Q89A 4JVDA 2Y5LA 3IK6B 1YYZA 2QMXA 3WAEA 1DTGA 1XVYA 4PETA 2Y84A 4RY1A 3FATA 1JW5A 3CHGA 3USDA 4OEVA 2DWIA 1GV8A 1PB7A 1K9YA 3VVDA 4LQ2A 1XS5A 2WYPA 4OANA 4G61A 2ZNSA 3V8XB 3H6WA 2RC7A 1BP5A 3SZPA 1FBGA 2THIA 3MQ9A 4OENA 4O94A 4H46A 5EHSA 1B7HA 4GWXA 1US5A 1XHYA 1FPLA 1IMDA 3EQ1A 4NF4A 3TFLA 2QS1A 5H8QA 1SW5A 5L9MA 1FBEA 1LBWA 4HE1A 5ISUA 2FNCA 2XX9A 1D9VA 2O1MA 5EYHA 4GXSB 3ILUB 3VFJA 4YB5A 3OMBA 1ZLQA 3VLUA 2B65A 3UORA 4ELPA 3UN6A 4YZZA 3RPLB 1AIVA 2Z22A 5I57B 4OZ9A 2DP8A 5DW8A 3IORA 2HCAA 4H65A 2RCBA 4ZEKA 2A5TA 3FXQA 4KYEA 3O97A 2O51A 1A55A 4WEPA 5FHNA 3PUYE 3RT6B 2PFYA 5KDTA 3PPNA 1JVYA 3A09A 2XXWA 3TAJA 3PUVE 4NF8A 3EPEA 3RLFE 3KBRA 3OO6A 4GL8A 2QRYA 3TTKA 4OWDA 2QL3A 3B50A 2FYIA 2KQZA 3MVZA 4LQ5A 1DBZA 1TXFA 2H4IA 3Q26A 1US4A 1B58A 2HAUA 4ZE8A 3N6TA 2RF1A 1S7YA 3K0VA 4MJOA 1P99A 1VSOA 3O6HA 2O6AA 3PPOA 2XXIA 2HHMA 2ZNTA 5IKBA 3ZKLA 4QFKA 3MPKA 3BIHA 3HN0A 3U93A 1SQYA 4F3GA 4H5GA 4GWZA 2O1LA 2I48A 4N13A 4N81A 4X1BA 3T9XB 2F3BA 4EUOA 3H06B 5IZ1A 4H8JA 3TTNA 3BFUA 4N6PA 1FBPA 3T1BA 4DXCA 5TU0A 4OVPA 1POY1 4KYDA 4O3BA 4IO3A 3TTMA 3K1NA 2OWSA 2RC9A 4OTEA 4IY6A 3S9NC 1FPIA 2AL4A 4R73A 1H45A 3W9WA 2F7AA 4DDDA 2H98A 3SESA 4F1UA 3LUYA 5ICQA 2O69A 4PBHA 1M5DA 1NH7A 4QF9A 4NAPA 3UP9A 2ZYOA 1IMFA 1USYH 2UVIA 1H3DA 5L9SA 1Y3PA 1LBXA 3G7WA 5CMKA 4EF1A 4ZECA 1B0LA 4PE3A 4XKRA 4QRZA 3RY3A 1MDP1 4QFOA 3MVXA 4NGUA 1PDAA 1MXVA 4YKJA 2PMSA 3RPLA 1SW2A 5I57A 1VR5A 2OBGA 4F2OA 1ZJLA 1UTBB 2CEXA 2F7BA 2X26A 4JDFA 1B40A 3H6VA 1NV1A 4OVTA 1MPDA 4PAFA 1NV6A 1O64A 3VXCA 5DVFA 2PT2A 1RKMA 3KFMA 4MLQA 3Q27A 1FTLA 3KN3A 4X1DA 1R6ZA 1TT1A 5DTBA 2ZZXA 1IZ1A 4H45A 1A8FA 4G4PA 1OIBA 4M4GA 4X8RA 4RK9A 2VT5A 4OESA 2F6GA 1B3FA 2JJKA 4TOZA 5ET8A 3IO6A 4NN3A 4ZEDA 3C35A 4OVQA 4RNSA 3DP8A 1D3KA 4P1EA 1OLAA 1MXXA 4KCCA 5BUUA 4IB2A 2DE2A 2XXRA 1SW4A 1NV3A 4OVJA 2FBPA 2F36A 4NQ8A 4G68B 4F3SA 4ZZEA 2BJJX 3C4MA 3OO8A 5BWJA 3LBSA 2A5SA 3QSLA 4PDHA 4DXBA 3K6VA 2OK2A 1II5A 3CFLA 4MHFA 4N4UA 4F31B 3WAFA 3MAMA 1NUZA 2DYXA 3CIJA 1FW0A 5TPAA 4GOTA 1B32A 3FVGA 3G3FA 4R74A 2O84X 3PUZE 3CR9A 3KG2A 2B3FA 1DPEA 4GBVA 3ECRA 4OXVA 4X48A 4IO5A 4NEDA 4EXKA 4MLVA 3E4RA 4MAGA 1AMFA 4OERA 1KZ8A 1OQGA 2P1SA 4ESWA 1TFDA 4XEQA 3O2AA 1NKXA 5H8HB 2ONKE 3OENA 1LAGE 2I3WA 3UK4A 4R9GA 3JYRA 3S2VA 4Z7EA 3SEYA 1B3HA 3FD3A 4NF5B 5I2NB 3BBRA 1EYKA 3ZSFA 3HCQA 5AA1A 4E0XA 3TELA 1QJMA 3FIRA 2RKMA 3KJTA 3ROJA 3C9HA 4IGRA 3TEPA 4G77A 1M5BA 1MG1A 3IB0A 1MXWA 1USYE 2HXRA 5ESYA 1LSTA 4OVSA 1UTBA 3E78A 1NNPA 1POTA 4BDQA 3GZGA 4C0RA 3FVOA 1VDWA 1FTAA 2XXYA 4TQUQ 1FQEA 4QSCA 4QHQA 2DWJA 3H4ZA 3IB1A 4IGTA 2XWKA 2F35A 3E13X 3D4GA 2PCRA 1SI0A 5ET7A 3K1PA 2I58A 3FUZA 1XOCA 1IUDA 1QUIA 3M8UA 1N7WA 4XKNA 3PD9A 4ZEBA 3EKIA 3PGFA 3R6UA 4JBZA 5F7VA 2FVZA 1P1OA 3K00A 2QVUA 1LBVA 3K2DA 2V3UA 4EQ7A 3I6VA 5H8FB 1B5IA 1MQJA 2WBBA 2XX8A 4LVQA 3GYYA 4NHBA 3T9HB 2Y7IA 4M1VA 3A3CA 4G68A 1EYJA 4YU0A 3C34A 3CFXA 3IR1A 3V89B 4RXLA 1PC3A 3U65A 1XC1A 2PBWA 2XXVA 3E9XA 2OPEA 3GXAA 2ONRA 2V25A 3T9VA 4MMPA 4IR8A 1H76A 5FTHA 3OELA 1JVXA 2I4BA 3K6WA 4F22A 4GD5A 1IXGA 4NG7A 2DXRA 3O9PA 1Q1KA 4GL0A 4FE8A 3OSRA 5I58B 3TPAA 3KSXA 5J1DA 3LSLA 1IQ7A 4JWOA 5H8HA 4H6DA 1MH4A 3SETA 3S4UA 5I7IA 3GBAA 3OXNA 2XXPA 1NNTA 4QFLA 4NF5A 3U94A 3G3HA 5I2NA 3KGCA 5ITPA 4ZEIA 2G93A 1FQAA 4I62A 1I6QA 1QULA 3LV0A 2OWTA 2RINA 2CZLA 5ET5A 1ZBMA 3T9UA 1A8EA 4PTKA 1M5EA 4TLMB 4FAJA 3SEWA 1ZMGA 2Z23A 2Y7RA 1T0KA 4GWOA 5DEXB 1AL3A 1EU8A 2AYSA 1B7UA 3FXUA 3SEXA 4F3PA 1B51A 3DLNA 1MH3A 4P3LA 3EHSA 2Y7KA 1Q35A 4I3EA 3LR1A 3HHFA 5LOMA 3H6UA 2CZIA 1YTVA 4XTCQ 1KWHA 4ECFA 4NF6B 3T93B 2HXWA 1PBQA 3ZS6A 2DDKA 2R9JA 4GWWA 3MZ1A 2HEUA 3R26A 4PCDA 4G8HA 2CEYA 3D1RA 4HE2A 3KEIA 1N3WA 4K3FA 5F24A 1PBPA 5EQ9A 4PFRA 4GX4A 4PP0A 4H8IA 5H8FA 3M3KA 4N6KA 1FPJA 4G2ZA 4PAIA 1P1NA 2OCUA 2VHAA 1JQFA 4I9DA 4PFIA 4QXDA 4WKMA 3SEUA 3LSFB 4RPOA 1QW0A 1NNFA 3H03A 5AA2D 3MP1A 1Y4CA 1QKAA 5I84A 5AA2B 2X7QA 3OD7A 4U21A 4BDRA 4LATA 2DVZA 4KI0E 3PUWE 1JW4A 4DI3D 1NFTA 3G3KA 3U8QA 3UGWA 1MQDA 3DP4A 1YCJA 3Q25A 3MW0A 2HZLA 4OETA 1XVXA 1P1UA 5I5PA 5I58A 1QKBA 1ZKBA 3SEVA 4E0WA 5TP9B 3L6GA 3TODA 4UACA 4DI4B 3RPWA 4OFJA 1FPDA 1P1WA 4PBQA 4PGPA 1FJ6A 3C31A 3KBZA 1F9BA 5ELVA 1EZPA 4UA8A 4JSDA 4R72A 1FTJA 3K6UA 1JNFA 1MM6A 4JWXA 4N91A 3RQTA 4R2FA 2P0SA 4LZ8A 5DEXA 4YMBA 1N3XA 4Q30B 4KYSA 1SVXB 3TCGA 1S9TA 3VVEA 4F18A 1B1XA 4MCOA 4NWDA 4GF8A 2QVRA 5I3SA 4IY5A 4U1OA 4ELOA 1SYIA 4PFUA 4PFWA 3MZ9A 2F7CA 2QVVA 2IA4A 2DSFA 3K1MA 1QGXA 1XT8A 4HXVA 4MH5A 4OYVA 5EHMA 4NF6A 3JV9A 4XFEA 1LEVA 2I4CA 5TPAB 1DMBA 4PGNA 2ONSA 3N94A 2D21A 1Y9UA 3MUQA 4JXIA 4O3CA 2UVHA 3U72A 4ZDMA 1DK4A 4O3AA 2QFLA 1LLSA 3IOVA 1FQCA 1LAHE 4KPTA 3U92A 4G8MA 2OLBA 3CVGA 2HZKA 4MX6A 1B6HA 3QUJA 4O8MA 3G3JA 5L9OA 3LC8A 4ZZAA 1ATGA 1SPIA 2REGA 4PDDA 1URGA 1KA1A 2E1SA 4YKKA 2PT1A 5AA2A 5AA4B 3PU5A 1FPBA 2B4LA 2FIEA 2DQVA 3ONMA 3TKDA 1GGGA 3S9EA 3RYDA 2RC8A 3FV2A 4R2BA 4LA9A 3MPLA 5M2VA 5HPQA 4HCWA 3UA8A 4U2RA 4DCXA 4MF3A 1B3EA 4FEBA 1B46A 4GFRA 4ZEFA 5AA3A 1B2HA 2ZXTA 2UVGA 4LP2B 2H99A 2G29A 3MVWA 5TP9A 5FHMA 4WXJA 1JEUA 1MDQA 3E3KA 4AB5A 2ZYMA 2DVCA 4OVRA 2DE4A 2IEEA 5JTYB 2XWOA 5LTCA 4KR5A 1A7LA 4I40A 1G0IA 4AQ4A 5AE4A 2NOOA 4IO2A 5FTIA 1MY3A 4NE4A 1NV7A 1H43A 1B0HA 4BDNA 1A40A 2R71A 4R75A 5ET6A 3VVFA 4EQ9A 3RNNA 1O7TA 1B4HA 3MVYA 2Q8MA 5CMCA 2UYEA 5B7DA 1LBBA 4U23A 3W15C 2Y5KA 1INPA 1WVJA 1ELJA 3TQLA 3A29A 3I3VA 2XXUA 3IOWA 1K9ZA 3LSXA 2Z8FA 4QSEA 4P9KA 1IMEA 5CMMA 2M8CA 5LDZA 1CB6A 1FQDA 4HTGA 2P2AA 2ZZWA 1TFAA 2Z8EA 1LFIA 1DTZA 3N6UA 3T96B 4PFBA 3MYUA 3QAXA 3PMXA 3ODBA 4DLDA 3JZJA 4JVIA 4RPNA 1IIWA 3O29A 2D5WA 2XHDA 5CMBA 2XD2A 4PAKA 3VXBA 2QS3A 2F78A 3H7MA 3KZGA 4Q0CA 5FBPA 4OQOA 1ANFA 1LBYA 3BIGA 4JVCA 2KR0A 4AS4A 4P8BA 4F39A 1R1NA 5AA4A 3THIA 1B5HA 5IM2A 3RTWB 3IFAA 5K2YA 5HM4B 4PC9A 2OWZA 2QSXA 4EF2A 3A3UA 3C33A 1FCKA 3PPRA 5I2KB 3CI8A 4XKQA 2XA5A 2CMOA 4HW8A 1NV0A 3KC0A 1BK4A 3B7DA 3OO7A 3OOAA 1LGBC 1J1NA 1I6AA 4PQJA 4RA1A 4ELRA 5JEIA 5JTYA 1IITA 5F1QA 3VLWA 2Q8JA 2WYKA 4POWA 3FVKA 4FJPA 4BLAA 1WDNA 4N07A 2I0CA 1JETA 2X7PA 1DCUA 2AL5A 3M3FA 1MRPA 3S9MC 2NUVA 3NOHA 1I69A 2XXXA 4ESXA 1B7ZA 3TMGA 1FPEA 1OVTA 1FPKA 2ZYKA 4IO6A 3IL1B 4GXAA 2PVUA 2CZKA 3FXBA 3PMVA 1NUXA 1YZ0A 1QVSA 4U1ZA 4QFNA 1B5JA 2VGQA 1NL5A 1RDZA 3MP8A 3QIMA 3PPQA 1YPNA 3B6QA 1ZTYA 3OEMA 4ISUA 3FZVA 1M5CA 4I8CA 4GVOA 4N6DA 1MXZA 4RK2A 1SBPA 1MPCA 3IB2A 4KCDA 1N76A 3MWBA 4GLIA 1NI9A 1Y1MA 1FTMA 4GRKA 2XXQA 2V4CA 5B70A 2CZHA 4Z0IA 2V84A 2VD3A 4U22A 1B3LA 3C36A 1N7XA 4NMYA 3FJMA 3IAZA 5CC2A 5DT6A 2VPNA 1FSAA 1A99A 2I0BA 4TLLB 3QMFA 4F1VA 2FIXA 2AIXA 4F29A 4P1LA 1P1QA 1NNKA 1Q9DA 1VE4A 1Z7ME 4POXA 3RGYA 5EYGA 5I2KA 1ZIUA 1FBFA 2UXAA 3MJNA 3MZBA 2Q2AA 4HCYA 3TTLA 1QUJA 3DELB 1CNQA 1VFEA 4FORA 3PV0E 4THIA 1SI1A 4MBPA 4ELQA 1L5TA 2F8DA 1UIUA 1UTHB 2Q74A 4XF5A 2FHYA 3FXRA 1NUYA 1ZU0A 3EHTA 1URSA 1LFGA 4NX1A 2XXTA 4F2QA 3HV1A 4RYAA 2RCAA 4MNPA 1OMPA 1LB8A 5KCJB 3VDFA 3MC2A 1MY4A 2D3IA 1AOVA 2Q9TA 4OA4A 5IAIA 1OVBA 3KSJA 4GIZA 4IO7A 2ZZVA 3ISPA 3K6XA 3IJXB 4NWCA 1MM7A 3TYHA 1HSLA 4R9FA 3O6GA 1JW1A 3PUXE 4P0IA 5A5XB 2DXYA 1BKAA 1D4NA 1NH8A 1FQFA 1DOTA 4XKPA 2WEFA 5H8NB 2GQ1A 2HFBA 3SDFA 5EQ8A 5T3JA 3DM0A 2NWJA 4P0GA 4JB7A 3CG1A 2H5YA 4P11A 4X9TA 2O7IA 1NUWA 2GRVA 5FHOA 4U4XA 4YAHX 1A54A 5DYHA 3QXMA 1MXUA 3TCFA 1DPPA 2XXKA 1AH5A 5I59B 2PYYA 2ALUA 1FJ9A 4ZS9A 3RTFB 3R7XA 1D9YA 2MKZA 4R6HA 1R9QA 2NVUB 4N8YA 1VFDA 3FV1A 5IGAA 3PMWA 1FPGA 1GR2A 4DE8A 1BLFA 1FQBA 4H1XA 1PB8A 4N15A 4MNCA 4N8GA 3E79A 2F97A 3OO9A 5H8SA 3N5LA 1YAEA
chains in the Genus database with same CATH topology
5A5LA 3PTYA 2XWOA 5LTCA 1FBDA 1RDXA 4GX6A 2XWKA 4I40A 1G0HA 1G0IA 4FBPA 1LBZA 4KXPA 2PCRA 1NV7A 4I3YA 4JVDA 5ET7A 2Y5LA 1YYZA 4F19A 4PETA 5ET6A 1FBHA 4GWUA 3EKIA 3CHGA 2Q8MA 2FVZA 1K9YA 2QVUA 1LBVA 2WYPA 1IMBA 2Y5KA 4OANA 4G61A 1INPA 4P47A 2WBBA 3GYYA 3SZPA 4NHBA 1FBGA 3A29A 5CM6A 4M1VA 2WBDA 1EYJA 1K9ZA 4O94A 4H46A 4MEVA 4GWXA 3KC1A 4P9KA 1IMEA 1FPLA 1IMDA 5LDZA 3U65A 2L5VA 2ZZWA 4MMPA 1FBEA 1LBWA 4IR8A 4HE1A 4PFBA 3MYUA 4JVIA 5EYHA 4NG7A 4PAKA 2OX3A 5FBPA 4YZZA 3RPLB 2VPOA 2QPQA 1LBYA 5J1DA 5DW8A 3BIGA 4JVCA 2KR0A 4AS4A 4P8BA 4HE0A 5IM2A 5I7IA 3IFAA 3LUZA 4PC9A 2OWZA 2PFYA 2F3DA 2F5XA 4O7IA 3FBPA 3LV0A 5ET5A 4PTKA 2XA5A 4MIJA 3B50A 2KQZA 1NV0A 3B8BA 3KC0A 4GWYA 1BK4A 1DBZA 4UABA 4MJOA 4YICA 2PFZA 4P3LA 2WYKA 2HHMA 4I3EA 2WX9A 4O7MA 1NV2A 2CZIA 3BIHA 3IFCA 2V3QA 4GWZA 1DCUA 4N81A 3NOHA 2F3BA 1AWBA 2XWIA 5IZ1A 5IZZA 2DDKA 4GWWA 1FPFA 1FPEA 4GWSA 1FPKA 1FBPA 3T1BA 4PCDA 2CEYA 3D1RA 4HE2A 5EQAA 4OVPA 1KA0A 2CZKA 3FXBA 1NUXA 5F24A 1YZ0A 5EQ9A 5JK4A 4PFRA 4GX4A 5IZ3B 4N6KA 1FRPA 1FPJA 1RDZA 4PAIA 1FPIA 3W9WA 4PFIA 4F1UA 4QXDA 4PBHA 3W9VA 4MNIA 4NAPA 1IMFA 1NV4A 2R8TA 4N6DA 1IMAA 1LBXA 2DVZA 1FBCA 4DI3D 4PE3A 1D9QA 1NI9A 4GX3A 4NGUA 3MSTA 2HZLA 2V4CA 1YXIA 2DE4A 2XWVA 4P56A 2CZHA 3RPLA 5I5PA 2VPNA 1NV5A 1FSAA 3QMFA 4F1VA 2FIXA 4PF6A 2CEXA 4DI4B 4P1LA 1FPDA 4PBQA 1NV1A 4OVTA 4PGPA 1Q9DA 4PAFA 1NV6A 1FJ6A 5EYGA 3KBZA 4LN5A 1FBFA 4HCYA 2ZZXA 1CNQA 4H45A 4X8RA 4N91A 2P3VA 2VT5A 2JJKA 5ET8A 4NN3A 1JP4A 2Q74A 4XF5A 5J16A 4F18A 2FHYA 4MCOA 3T0JA 4OVQA 1NUYA 2QVRA 5I3SA 1IMCA 4NX1A 4AS5A 2QVVA 4P1EA 4MNPA 1QGXA 4HXVA 2DE2A 2B4MA 1NV3A 2Q9TA 2FBPA 4OA4A 4NQ8A 4XFEA 2BJIA 1LEVA 4PDHA 2ZZVA 3ISPA 4PGNA 4MHFA 2HPGA 4N4UA 1NUZA 1DK4A 2WEFA 2QFLA 2GQ1A 5IZ3A 5EQ8A 4NF0A 5T3JA 4GBVA 2HZKA 4MX6A 4QBAA 1RDYA 4X9TA 4N17A 4O8MA 1NUWA 3HFUA 4PF8A 1SPIA 4PDDA 4MAGA 1XI6A 1KZ8A 1KA1A 4GBWA 4XEQA 2XXKA 1FPBA 2B4LA 2FIEA 2DE3A 3RYDA 2P3NA 5EQ7A 1FJ9A 2MKZA 1EYKA 4HCWA 4N8YA 3ROJA 5IGAA 1FPGA 4X04A 2HXRA 5ESYA 4OVSA 3E78A 4N15A 4MNCA 4N8GA 3E79A 1VDWA 1FTAA 4OVRA 1EYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIG A;  5A5L A;  4AS4 A;  1QGX A;  4QXD A;  1FBD A;  4HE0 A;  1RDX A;  4HXV A;  4GX6 A;  4I40 A;  1G0H A;  1G0I A;  3IFA A;  3LUZ A;  4FBP A;  2OWZ A;  1NV3 A;  2FBP A;  1FPI A;  2BJI A;  1LEV A;  2F3D A;  1IMF A;  1LBZ A;  4KXP A;  2PCR A;  1NV7 A;  1NV4 A;  2R8T A;  1IMA A;  1LBX A;  4O7I A;  3FBP A;  4I3Y A;  3LV0 A;  5ET7 A;  2Y5L A;  5ET5 A;  1YYZ A;  4PTK A;  1FBC A;  1D9Q A;  1NUZ A;  1NI9 A;  5ET6 A;  4GX3 A;  1FBH A;  1DK4 A;  1NV0 A;  2QFL A;  2WEF A;  3B8B A;  3KC0 A;  2GQ1 A;  1YXI A;  4GWU A;  4GWY A;  1BK4 A;  5IZ3 A;  1DBZ A;  2CZH A;  5EQ8 A;  2Q8M A;  3RPL A;  2FVZ A;  5T3J A;  4GBV A;  1K9Y A;  2QVU A;  1LBV A;  1RDY A;  1IMB A;  2Y5K A;  1NV5 A;  1FSA A;  4G61 A;  1INP A;  1NUW A;  2FIX A;  3QMF A;  4MJO A;  2WBB A;  1SPI A;  1FBG A;  1XI6 A;  3A29 A;  1KZ8 A;  1KA1 A;  2HHM A;  4I3E A;  1FPD A;  2WBD A;  1EYJ A;  1K9Z A;  4GBW A;  1NV1 A;  4H46 A;  1Q9D A;  1NV6 A;  1NV2 A;  2CZI A;  3BIH A;  1FJ6 A;  4GWX A;  3KC1 A;  5EYG A;  3IFC A;  4GWZ A;  1DCU A;  1FPB A;  2FIE A;  1IME A;  3KBZ A;  4N81 A;  1FPL A;  1IMD A;  5DW8 A;  1FBF A;  2F3B A;  5LDZ A;  1AWB A;  5IZ1 A;  2P3N A;  5EQ7 A;  3RYD A;  1FJ9 A;  2DDK A;  4GWW A;  1FPF A;  1EYK A;  1FPE A;  1CNQ A;  4H45 A;  4GWS A;  1FBE A;  1FPK A;  1FBP A;  1LBW A;  4IR8 A;  2QVV A;  3D1R A;  4HE1 A;  4HE2 A;  5EQA A;  3ROJ A;  2P3V A;  2VT5 A;  1FPG A;  1KA0 A;  2CZK A;  2JJK A;  5ET8 A;  5EYH A;  1NUX A;  5F24 A;  1YZ0 A;  1JP4 A;  5EQ9 A;  2Q74 A;  5ESY A;  5J16 A;  4GX4 A;  2FHY A;  5IZ3 B;  3T0J A;  2OX3 A;  1NUY A;  1FRP A;  2QVR A;  5I3S A;  5FBP A;  1FPJ A;  3RPL B;  1IMC A;  1RDZ A;  1VDW A;  1FTA A;  4AS5 A;  1LBY A;  1EYI A; 
#chains in the Genus database with same CATH topology
 3EN3 A;  1RDX A;  4GX6 A;  4U4S A;  2UVJ A;  1LAF E;  4FBP A;  3B6T A;  1B52 A;  4PE5 B;  4YB6 A;  2VD2 A;  1N84 A;  5L8D A;  3TDJ A;  1EZ9 A;  3D4C A;  4YB7 A;  4C1T A;  3HHG A;  1LCF A;  3FGS A;  4F19 A;  5CI5 A;  1UTH A;  1FBH A;  3KOS A;  2XX7 A;  4GWU A;  3O28 A;  1IEJ A;  2KLF A;  1JEV A;  1IMB A;  3MP6 A;  1Z7N E;  4P47 A;  5KCJ A;  1LBC A;  2REJ A;  5CM6 A;  1IXH A;  2WBD A;  1N0T A;  3FVN A;  4ZE9 A;  1HSE A;  2QS4 A;  4JWY A;  4HS7 A;  4MEV A;  3KC1 A;  2FA7 A;  3MBP A;  4R6K A;  1IXI A;  4OEU A;  3TCH A;  2XD3 A;  3C32 A;  4FEC A;  4DIG A;  1MY2 A;  2L5V A;  5A5X A;  4AB6 A;  2O7U A;  1MS7 A;  4Q5T A;  3FJ7 A;  3U1O A;  5H8N A;  3RN8 A;  1H44 A;  3K01 A;  1FTO A;  1S50 A;  1EZO A;  1UIV A;  4ND9 A;  2W7Y A;  1M5F A;  2OX3 A;  3KN8 A;  2VPO A;  1QUK A;  3CG3 A;  4XXU A;  2QPQ A;  4RJZ A;  1RYX A;  2VOZ A;  2GFE A;  2YJP A;  4HE0 A;  5I59 A;  2GHA A;  4F3B A;  3PPP A;  1N04 A;  3LUZ A;  5KZT A;  3FAS A;  2F3D A;  2F5X A;  3IX1 A;  2E0S A;  3M3L A;  1DSN A;  2ABH A;  4O7I A;  3FBP A;  4PFY A;  2Z8D A;  2QJE A;  1URD A;  1RYO A;  4MIJ A;  4IO4 A;  4R6Y A;  1HSJ A;  3B8B A;  4GWY A;  3EF7 A;  3OEK A;  3IOT A;  2DS9 A;  4UAB A;  4G8N A;  2V93 A;  2ZNU A;  3B6W A;  1MQG A;  4YIC A;  2PFZ A;  3H6T A;  3P7I A;  3T66 A;  2QMW A;  1GTK A;  3AXF A;  1BTJ A;  2H9B A;  3V5A A;  2HAV A;  2WX9 A;  2PX1 A;  2O68 A;  4O7M A;  2F6P A;  4YKI A;  1NV2 A;  3IFC A;  2V3Q A;  3N26 A;  2NXO A;  5DVI A;  3GBB A;  3BKI B;  1AWB A;  2XWI A;  5IZZ A;  4DZ1 A;  4F1Y A;  1FPF A;  1SW1 A;  5I56 B;  3KOT A;  3GLB A;  4GWS A;  1TWY A;  2WKY A;  3EHU A;  5EQA A;  4OMB A;  3BFT A;  1MY0 A;  2ANJ A;  1KA0 A;  5K2X A;  4QSD A;  5JK4 A;  4KHZ E;  3HPI A;  5IZ3 B;  4C1U A;  1FRP A;  2ZMB A;  1MXY A;  4LZ7 A;  5HBC A;  1B3G A;  3TTR A;  4LON B;  2Y7W A;  3W9V A;  4MNI A;  4JSO A;  4YMA A;  3IJO B;  1MPB A;  1NV4 A;  3OSQ A;  2YLN A;  2R8T A;  4OFO A;  5CBR A;  3I5O A;  3VE1 B;  1IMA A;  3CRB A;  1MQI A;  1FBC A;  1LAX A;  2XXH A;  1D9Q A;  1LCT A;  3RT8 A;  3VV5 A;  4LZ5 A;  1CE2 A;  4GX3 A;  3MST A;  1OQH A;  1UQW A;  2OZZ A;  1PB9 A;  1YXI A;  2ESN A;  2XWV A;  4P56 A;  3IO4 A;  5CRY A;  1LB9 A;  2V3T A;  4BDM A;  1Y4T A;  1NV5 A;  3CFZ A;  4PF6 A;  2H25 A;  3TUS A;  1BIY A;  4OFL A;  3QUF A;  3VLV A;  2I49 A;  4G68 C;  3CSG A;  3G3G A;  4LN5 A;  1Y3Q A;  2Q2C A;  3Q28 A;  2QS2 A;  5EYF A;  2P3V A;  4YKP A;  3QYT A;  2GHB A;  4QFP A;  4KD5 A;  3SER A;  1JP4 A;  3CSB A;  5J16 A;  3ZKK A;  1LFH A;  3T0J A;  2HQ0 A;  3T22 A;  4WED A;  1IMC A;  1B05 A;  3H3G A;  2B3B A;  4DCY A;  2DWH A;  2DOJ A;  1R9L A;  4AS5 A;  3PD8 A;  4GQO A;  2Y7P A;  4I1D A;  3O6I A;  4EQB A;  2B4M A;  2BJI A;  1EH3 A;  2UYF A;  4FAT A;  5I56 A;  1Y20 A;  3L6H A;  1FTK A;  3SKP A;  3IOU A;  2DWA A;  2HPG A;  1GVC A;  2I6E A;  4NF4 B;  3KJ7 A;  1B1H A;  4OHN A;  1Y1Z A;  3F11 A;  5H8Q B;  1SD3 A;  5ITO A;  5ICT A;  4NTL A;  1SDX A;  4KFQ A;  5IZ3 A;  1Y3N A;  2R6G E;  4LUB A;  1WOD A;  1PEB A;  5DVJ A;  4H0W A;  4NF0 A;  2OJT A;  4QBA A;  3KN7 A;  1RDY A;  4KQP A;  4N17 A;  4EDP A;  3LSW A;  3HFU A;  4PF8 A;  4L17 A;  1XI6 A;  3K4U A;  4EXL A;  2GH9 A;  4Q8R A;  4GBW A;  4DXU A;  3V83 A;  4MFI A;  3HST A;  3Q29 A;  3DP6 A;  4H67 A;  2A5T B;  2F34 A;  2Q88 A;  2DE3 A;  1SYH A;  3S9L C;  2P3N A;  5EQ7 A;  1B4Z A;  5KDT B;  1O63 A;  3TQW A;  2OPD A;  2ZYN A;  4ONY A;  4NF8 B;  2VP1 A;  1MQH A;  1MY1 A;  4PFT A;  4BDL A;  3QK6 A;  3G3I A;  4X04 A;  3TZA A;  4XIG Q;  3K02 A;  1OLC A;  4FED A;  3RUM A;  4FIM A;  1IXC A;  1EYI A;  5A5L A;  3PTY A;  5CBS A;  2LAO A;  4BDO A;  3HO7 A;  1FBD A;  1G0H A;  4H5F A;  1I6B A;  2YPN A;  1NMU A;  1LBZ A;  4KXP A;  1B9J A;  3FJG A;  2I3V A;  3UIF A;  3O66 A;  4I3Y A;  3ILT B;  2Q89 A;  4JVD A;  2Y5L A;  3IK6 B;  1YYZ A;  2QMX A;  3WAE A;  1DTG A;  1XVY A;  4PET A;  2Y84 A;  4RY1 A;  3FAT A;  1JW5 A;  3CHG A;  3USD A;  4OEV A;  2DWI A;  1GV8 A;  1PB7 A;  1K9Y A;  3VVD A;  4LQ2 A;  1XS5 A;  2WYP A;  4OAN A;  4G61 A;  2ZNS A;  3V8X B;  3H6W A;  2RC7 A;  1BP5 A;  3SZP A;  1FBG A;  2THI A;  3MQ9 A;  4OEN A;  4O94 A;  4H46 A;  5EHS A;  1B7H A;  4GWX A;  1US5 A;  1XHY A;  1FPL A;  1IMD A;  3EQ1 A;  4NF4 A;  3TFL A;  2QS1 A;  5H8Q A;  1SW5 A;  5L9M A;  1FBE A;  1LBW A;  4HE1 A;  5ISU A;  2FNC A;  2XX9 A;  1D9V A;  2O1M A;  5EYH A;  4GXS B;  3ILU B;  3VFJ A;  4YB5 A;  3OMB A;  1ZLQ A;  3VLU A;  2B65 A;  3UOR A;  4ELP A;  3UN6 A;  4YZZ A;  3RPL B;  1AIV A;  2Z22 A;  5I57 B;  4OZ9 A;  2DP8 A;  5DW8 A;  3IOR A;  2HCA A;  4H65 A;  2RCB A;  4ZEK A;  2A5T A;  3FXQ A;  4KYE A;  3O97 A;  2O51 A;  1A55 A;  4WEP A;  5FHN A;  3PUY E;  3RT6 B;  2PFY A;  5KDT A;  3PPN A;  1JVY A;  3A09 A;  2XXW A;  3TAJ A;  3PUV E;  4NF8 A;  3EPE A;  3RLF E;  3KBR A;  3OO6 A;  4GL8 A;  2QRY A;  3TTK A;  4OWD A;  2QL3 A;  3B50 A;  2FYI A;  2KQZ A;  3MVZ A;  4LQ5 A;  1DBZ A;  1TXF A;  2H4I A;  3Q26 A;  1US4 A;  1B58 A;  2HAU A;  4ZE8 A;  3N6T A;  2RF1 A;  1S7Y A;  3K0V A;  4MJO A;  1P99 A;  1VSO A;  3O6H A;  2O6A A;  3PPO A;  2XXI A;  2HHM A;  2ZNT A;  5IKB A;  3ZKL A;  4QFK A;  3MPK A;  3BIH A;  3HN0 A;  3U93 A;  1SQY A;  4F3G A;  4H5G A;  4GWZ A;  2O1L A;  2I48 A;  4N13 A;  4N81 A;  4X1B A;  3T9X B;  2F3B A;  4EUO A;  3H06 B;  5IZ1 A;  4H8J A;  3TTN A;  3BFU A;  4N6P A;  1FBP A;  3T1B A;  4DXC A;  5TU0 A;  4OVP A;  1POY 1;  4KYD A;  4O3B A;  4IO3 A;  3TTM A;  3K1N A;  2OWS A;  2RC9 A;  4OTE A;  4IY6 A;  3S9N C;  1FPI A;  2AL4 A;  4R73 A;  1H45 A;  3W9W A;  2F7A A;  4DDD A;  2H98 A;  3SES A;  4F1U A;  3LUY A;  5ICQ A;  2O69 A;  4PBH A;  1M5D A;  1NH7 A;  4QF9 A;  4NAP A;  3UP9 A;  2ZYO A;  1IMF A;  1USY H;  2UVI A;  1H3D A;  5L9S A;  1Y3P A;  1LBX A;  3G7W A;  5CMK A;  4EF1 A;  4ZEC A;  1B0L A;  4PE3 A;  4XKR A;  4QRZ A;  3RY3 A;  1MDP 1;  4QFO A;  3MVX A;  4NGU A;  1PDA A;  1MXV A;  4YKJ A;  2PMS A;  3RPL A;  1SW2 A;  5I57 A;  1VR5 A;  2OBG A;  4F2O A;  1ZJL A;  1UTB B;  2CEX A;  2F7B A;  2X26 A;  4JDF A;  1B40 A;  3H6V A;  1NV1 A;  4OVT A;  1MPD A;  4PAF A;  1NV6 A;  1O64 A;  3VXC A;  5DVF A;  2PT2 A;  1RKM A;  3KFM A;  4MLQ A;  3Q27 A;  1FTL A;  3KN3 A;  4X1D A;  1R6Z A;  1TT1 A;  5DTB A;  2ZZX A;  1IZ1 A;  4H45 A;  1A8F A;  4G4P A;  1OIB A;  4M4G A;  4X8R A;  4RK9 A;  2VT5 A;  4OES A;  2F6G A;  1B3F A;  2JJK A;  4TOZ A;  5ET8 A;  3IO6 A;  4NN3 A;  4ZED A;  3C35 A;  4OVQ A;  4RNS A;  3DP8 A;  1D3K A;  4P1E A;  1OLA A;  1MXX A;  4KCC A;  5BUU A;  4IB2 A;  2DE2 A;  2XXR A;  1SW4 A;  1NV3 A;  4OVJ A;  2FBP A;  2F36 A;  4NQ8 A;  4G68 B;  4F3S A;  4ZZE A;  2BJJ X;  3C4M A;  3OO8 A;  5BWJ A;  3LBS A;  2A5S A;  3QSL A;  4PDH A;  4DXB A;  3K6V A;  2OK2 A;  1II5 A;  3CFL A;  4MHF A;  4N4U A;  4F31 B;  3WAF A;  3MAM A;  1NUZ A;  2DYX A;  3CIJ A;  1FW0 A;  5TPA A;  4GOT A;  1B32 A;  3FVG A;  3G3F A;  4R74 A;  2O84 X;  3PUZ E;  3CR9 A;  3KG2 A;  2B3F A;  1DPE A;  4GBV A;  3ECR A;  4OXV A;  4X48 A;  4IO5 A;  4NED A;  4EXK A;  4MLV A;  3E4R A;  4MAG A;  1AMF A;  4OER A;  1KZ8 A;  1OQG A;  2P1S A;  4ESW A;  1TFD A;  4XEQ A;  3O2A A;  1NKX A;  5H8H B;  2ONK E;  3OEN A;  1LAG E;  2I3W A;  3UK4 A;  4R9G A;  3JYR A;  3S2V A;  4Z7E A;  3SEY A;  1B3H A;  3FD3 A;  4NF5 B;  5I2N B;  3BBR A;  1EYK A;  3ZSF A;  3HCQ A;  5AA1 A;  4E0X A;  3TEL A;  1QJM A;  3FIR A;  2RKM A;  3KJT A;  3ROJ A;  3C9H A;  4IGR A;  3TEP A;  4G77 A;  1M5B A;  1MG1 A;  3IB0 A;  1MXW A;  1USY E;  2HXR A;  5ESY A;  1LST A;  4OVS A;  1UTB A;  3E78 A;  1NNP A;  1POT A;  4BDQ A;  3GZG A;  4C0R A;  3FVO A;  1VDW A;  1FTA A;  2XXY A;  4TQU Q;  1FQE A;  4QSC A;  4QHQ A;  2DWJ A;  3H4Z A;  3IB1 A;  4IGT A;  2XWK A;  2F35 A;  3E13 X;  3D4G A;  2PCR A;  1SI0 A;  5ET7 A;  3K1P A;  2I58 A;  3FUZ A;  1XOC A;  1IUD A;  1QUI A;  3M8U A;  1N7W A;  4XKN A;  3PD9 A;  4ZEB A;  3EKI A;  3PGF A;  3R6U A;  4JBZ A;  5F7V A;  2FVZ A;  1P1O A;  3K00 A;  2QVU A;  1LBV A;  3K2D A;  2V3U A;  4EQ7 A;  3I6V A;  5H8F B;  1B5I A;  1MQJ A;  2WBB A;  2XX8 A;  4LVQ A;  3GYY A;  4NHB A;  3T9H B;  2Y7I A;  4M1V A;  3A3C A;  4G68 A;  1EYJ A;  4YU0 A;  3C34 A;  3CFX A;  3IR1 A;  3V89 B;  4RXL A;  1PC3 A;  3U65 A;  1XC1 A;  2PBW A;  2XXV A;  3E9X A;  2OPE A;  3GXA A;  2ONR A;  2V25 A;  3T9V A;  4MMP A;  4IR8 A;  1H76 A;  5FTH A;  3OEL A;  1JVX A;  2I4B A;  3K6W A;  4F22 A;  4GD5 A;  1IXG A;  4NG7 A;  2DXR A;  3O9P A;  1Q1K A;  4GL0 A;  4FE8 A;  3OSR A;  5I58 B;  3TPA A;  3KSX A;  5J1D A;  3LSL A;  1IQ7 A;  4JWO A;  5H8H A;  4H6D A;  1MH4 A;  3SET A;  3S4U A;  5I7I A;  3GBA A;  3OXN A;  2XXP A;  1NNT A;  4QFL A;  4NF5 A;  3U94 A;  3G3H A;  5I2N A;  3KGC A;  5ITP A;  4ZEI A;  2G93 A;  1FQA A;  4I62 A;  1I6Q A;  1QUL A;  3LV0 A;  2OWT A;  2RIN A;  2CZL A;  5ET5 A;  1ZBM A;  3T9U A;  1A8E A;  4PTK A;  1M5E A;  4TLM B;  4FAJ A;  3SEW A;  1ZMG A;  2Z23 A;  2Y7R A;  1T0K A;  4GWO A;  5DEX B;  1AL3 A;  1EU8 A;  2AYS A;  1B7U A;  3FXU A;  3SEX A;  4F3P A;  1B51 A;  3DLN A;  1MH3 A;  4P3L A;  3EHS A;  2Y7K A;  1Q35 A;  4I3E A;  3LR1 A;  3HHF A;  5LOM A;  3H6U A;  2CZI A;  1YTV A;  4XTC Q;  1KWH A;  4ECF A;  4NF6 B;  3T93 B;  2HXW A;  1PBQ A;  3ZS6 A;  2DDK A;  2R9J A;  4GWW A;  3MZ1 A;  2HEU A;  3R26 A;  4PCD A;  4G8H A;  2CEY A;  3D1R A;  4HE2 A;  3KEI A;  1N3W A;  4K3F A;  5F24 A;  1PBP A;  5EQ9 A;  4PFR A;  4GX4 A;  4PP0 A;  4H8I A;  5H8F A;  3M3K A;  4N6K A;  1FPJ A;  4G2Z A;  4PAI A;  1P1N A;  2OCU A;  2VHA A;  1JQF A;  4I9D A;  4PFI A;  4QXD A;  4WKM A;  3SEU A;  3LSF B;  4RPO A;  1QW0 A;  1NNF A;  3H03 A;  5AA2 D;  3MP1 A;  1Y4C A;  1QKA A;  5I84 A;  5AA2 B;  2X7Q A;  3OD7 A;  4U21 A;  4BDR A;  4LAT A;  2DVZ A;  4KI0 E;  3PUW E;  1JW4 A;  4DI3 D;  1NFT A;  3G3K A;  3U8Q A;  3UGW A;  1MQD A;  3DP4 A;  1YCJ A;  3Q25 A;  3MW0 A;  2HZL A;  4OET A;  1XVX A;  1P1U A;  5I5P A;  5I58 A;  1QKB A;  1ZKB A;  3SEV A;  4E0W A;  5TP9 B;  3L6G A;  3TOD A;  4UAC A;  4DI4 B;  3RPW A;  4OFJ A;  1FPD A;  1P1W A;  4PBQ A;  4PGP A;  1FJ6 A;  3C31 A;  3KBZ A;  1F9B A;  5ELV A;  1EZP A;  4UA8 A;  4JSD A;  4R72 A;  1FTJ A;  3K6U A;  1JNF A;  1MM6 A;  4JWX A;  4N91 A;  3RQT A;  4R2F A;  2P0S A;  4LZ8 A;  5DEX A;  4YMB A;  1N3X A;  4Q30 B;  4KYS A;  1SVX B;  3TCG A;  1S9T A;  3VVE A;  4F18 A;  1B1X A;  4MCO A;  4NWD A;  4GF8 A;  2QVR A;  5I3S A;  4IY5 A;  4U1O A;  4ELO A;  1SYI A;  4PFU A;  4PFW A;  3MZ9 A;  2F7C A;  2QVV A;  2IA4 A;  2DSF A;  3K1M A;  1QGX A;  1XT8 A;  4HXV A;  4MH5 A;  4OYV A;  5EHM A;  4NF6 A;  3JV9 A;  4XFE A;  1LEV A;  2I4C A;  5TPA B;  1DMB A;  4PGN A;  2ONS A;  3N94 A;  2D21 A;  1Y9U A;  3MUQ A;  4JXI A;  4O3C A;  2UVH A;  3U72 A;  4ZDM A;  1DK4 A;  4O3A A;  2QFL A;  1LLS A;  3IOV A;  1FQC A;  1LAH E;  4KPT A;  3U92 A;  4G8M A;  2OLB A;  3CVG A;  2HZK A;  4MX6 A;  1B6H A;  3QUJ A;  4O8M A;  3G3J A;  5L9O A;  3LC8 A;  4ZZA A;  1ATG A;  1SPI A;  2REG A;  4PDD A;  1URG A;  1KA1 A;  2E1S A;  4YKK A;  2PT1 A;  5AA2 A;  5AA4 B;  3PU5 A;  1FPB A;  2B4L A;  2FIE A;  2DQV A;  3ONM A;  3TKD A;  1GGG A;  3S9E A;  3RYD A;  2RC8 A;  3FV2 A;  4R2B A;  4LA9 A;  3MPL A;  5M2V A;  5HPQ A;  4HCW A;  3UA8 A;  4U2R A;  4DCX A;  4MF3 A;  1B3E A;  4FEB A;  1B46 A;  4GFR A;  4ZEF A;  5AA3 A;  1B2H A;  2ZXT A;  2UVG A;  4LP2 B;  2H99 A;  2G29 A;  3MVW A;  5TP9 A;  5FHM A;  4WXJ A;  1JEU A;  1MDQ A;  3E3K A;  4AB5 A;  2ZYM A;  2DVC A;  4OVR A;  2DE4 A;  2IEE A;  5JTY B;  2XWO A;  5LTC A;  4KR5 A;  1A7L A;  4I40 A;  1G0I A;  4AQ4 A;  5AE4 A;  2NOO A;  4IO2 A;  5FTI A;  1MY3 A;  4NE4 A;  1NV7 A;  1H43 A;  1B0H A;  4BDN A;  1A40 A;  2R71 A;  4R75 A;  5ET6 A;  3VVF A;  4EQ9 A;  3RNN A;  1O7T A;  1B4H A;  3MVY A;  2Q8M A;  5CMC A;  2UYE A;  5B7D A;  1LBB A;  4U23 A;  3W15 C;  2Y5K A;  1INP A;  1WVJ A;  1ELJ A;  3TQL A;  3A29 A;  3I3V A;  2XXU A;  3IOW A;  1K9Z A;  3LSX A;  2Z8F A;  4QSE A;  4P9K A;  1IME A;  5CMM A;  2M8C A;  5LDZ A;  1CB6 A;  1FQD A;  4HTG A;  2P2A A;  2ZZW A;  1TFA A;  2Z8E A;  1LFI A;  1DTZ A;  3N6U A;  3T96 B;  4PFB A;  3MYU A;  3QAX A;  3PMX A;  3ODB A;  4DLD A;  3JZJ A;  4JVI A;  4RPN A;  1IIW A;  3O29 A;  2D5W A;  2XHD A;  5CMB A;  2XD2 A;  4PAK A;  3VXB A;  2QS3 A;  2F78 A;  3H7M A;  3KZG A;  4Q0C A;  5FBP A;  4OQO A;  1ANF A;  1LBY A;  3BIG A;  4JVC A;  2KR0 A;  4AS4 A;  4P8B A;  4F39 A;  1R1N A;  5AA4 A;  3THI A;  1B5H A;  5IM2 A;  3RTW B;  3IFA A;  5K2Y A;  5HM4 B;  4PC9 A;  2OWZ A;  2QSX A;  4EF2 A;  3A3U A;  3C33 A;  1FCK A;  3PPR A;  5I2K B;  3CI8 A;  4XKQ A;  2XA5 A;  2CMO A;  4HW8 A;  1NV0 A;  3KC0 A;  1BK4 A;  3B7D A;  3OO7 A;  3OOA A;  1LGB C;  1J1N A;  1I6A A;  4PQJ A;  4RA1 A;  4ELR A;  5JEI A;  5JTY A;  1IIT A;  5F1Q A;  3VLW A;  2Q8J A;  2WYK A;  4POW A;  3FVK A;  4FJP A;  4BLA A;  1WDN A;  4N07 A;  2I0C A;  1JET A;  2X7P A;  1DCU A;  2AL5 A;  3M3F A;  1MRP A;  3S9M C;  2NUV A;  3NOH A;  1I69 A;  2XXX A;  4ESX A;  1B7Z A;  3TMG A;  1FPE A;  1OVT A;  1FPK A;  2ZYK A;  4IO6 A;  3IL1 B;  4GXA A;  2PVU A;  2CZK A;  3FXB A;  3PMV A;  1NUX A;  1YZ0 A;  1QVS A;  4U1Z A;  4QFN A;  1B5J A;  2VGQ A;  1NL5 A;  1RDZ A;  3MP8 A;  3QIM A;  3PPQ A;  1YPN A;  3B6Q A;  1ZTY A;  3OEM A;  4ISU A;  3FZV A;  1M5C A;  4I8C A;  4GVO A;  4N6D A;  1MXZ A;  4RK2 A;  1SBP A;  1MPC A;  3IB2 A;  4KCD A;  1N76 A;  3MWB A;  4GLI A;  1NI9 A;  1Y1M A;  1FTM A;  4GRK A;  2XXQ A;  2V4C A;  5B70 A;  2CZH A;  4Z0I A;  2V84 A;  2VD3 A;  4U22 A;  1B3L A;  3C36 A;  1N7X A;  4NMY A;  3FJM A;  3IAZ A;  5CC2 A;  5DT6 A;  2VPN A;  1FSA A;  1A99 A;  2I0B A;  4TLL B;  3QMF A;  4F1V A;  2FIX A;  2AIX A;  4F29 A;  4P1L A;  1P1Q A;  1NNK A;  1Q9D A;  1VE4 A;  1Z7M E;  4POX A;  3RGY A;  5EYG A;  5I2K A;  1ZIU A;  1FBF A;  2UXA A;  3MJN A;  3MZB A;  2Q2A A;  4HCY A;  3TTL A;  1QUJ A;  3DEL B;  1CNQ A;  1VFE A;  4FOR A;  3PV0 E;  4THI A;  1SI1 A;  4MBP A;  4ELQ A;  1L5T A;  2F8D A;  1UIU A;  1UTH B;  2Q74 A;  4XF5 A;  2FHY A;  3FXR A;  1NUY A;  1ZU0 A;  3EHT A;  1URS A;  1LFG A;  4NX1 A;  2XXT A;  4F2Q A;  3HV1 A;  4RYA A;  2RCA A;  4MNP A;  1OMP A;  1LB8 A;  5KCJ B;  3VDF A;  3MC2 A;  1MY4 A;  2D3I A;  1AOV A;  2Q9T A;  4OA4 A;  5IAI A;  1OVB A;  3KSJ A;  4GIZ A;  4IO7 A;  2ZZV A;  3ISP A;  3K6X A;  3IJX B;  4NWC A;  1MM7 A;  3TYH A;  1HSL A;  4R9F A;  3O6G A;  1JW1 A;  3PUX E;  4P0I A;  5A5X B;  2DXY A;  1BKA A;  1D4N A;  1NH8 A;  1FQF A;  1DOT A;  4XKP A;  2WEF A;  5H8N B;  2GQ1 A;  2HFB A;  3SDF A;  5EQ8 A;  5T3J A;  3DM0 A;  2NWJ A;  4P0G A;  4JB7 A;  3CG1 A;  2H5Y A;  4P11 A;  4X9T A;  2O7I A;  1NUW A;  2GRV A;  5FHO A;  4U4X A;  4YAH X;  1A54 A;  5DYH A;  3QXM A;  1MXU A;  3TCF A;  1DPP A;  2XXK A;  1AH5 A;  5I59 B;  2PYY A;  2ALU A;  1FJ9 A;  4ZS9 A;  3RTF B;  3R7X A;  1D9Y A;  2MKZ A;  4R6H A;  1R9Q A;  2NVU B;  4N8Y A;  1VFD A;  3FV1 A;  5IGA A;  3PMW A;  1FPG A;  1GR2 A;  4DE8 A;  1BLF A;  1FQB A;  4H1X A;  1PB8 A;  4N15 A;  4MNC A;  4N8G A;  3E79 A;  2F97 A;  3OO9 A;  5H8S A;  3N5L A;  1YAE A; 
#chains in the Genus database with same CATH homology
 5A5L A;  3PTY A;  2XWO A;  5LTC A;  1FBD A;  1RDX A;  4GX6 A;  2XWK A;  4I40 A;  1G0H A;  1G0I A;  4FBP A;  1LBZ A;  4KXP A;  2PCR A;  1NV7 A;  4I3Y A;  4JVD A;  5ET7 A;  2Y5L A;  1YYZ A;  4F19 A;  4PET A;  5ET6 A;  1FBH A;  4GWU A;  3EKI A;  3CHG A;  2Q8M A;  2FVZ A;  1K9Y A;  2QVU A;  1LBV A;  2WYP A;  1IMB A;  2Y5K A;  4OAN A;  4G61 A;  1INP A;  4P47 A;  2WBB A;  3GYY A;  3SZP A;  4NHB A;  1FBG A;  3A29 A;  5CM6 A;  4M1V A;  2WBD A;  1EYJ A;  1K9Z A;  4O94 A;  4H46 A;  4MEV A;  4GWX A;  3KC1 A;  4P9K A;  1IME A;  1FPL A;  1IMD A;  5LDZ A;  3U65 A;  2L5V A;  2ZZW A;  4MMP A;  1FBE A;  1LBW A;  4IR8 A;  4HE1 A;  4PFB A;  3MYU A;  4JVI A;  5EYH A;  4NG7 A;  4PAK A;  2OX3 A;  5FBP A;  4YZZ A;  3RPL B;  2VPO A;  2QPQ A;  1LBY A;  5J1D A;  5DW8 A;  3BIG A;  4JVC A;  2KR0 A;  4AS4 A;  4P8B A;  4HE0 A;  5IM2 A;  5I7I A;  3IFA A;  3LUZ A;  4PC9 A;  2OWZ A;  2PFY A;  2F3D A;  2F5X A;  4O7I A;  3FBP A;  3LV0 A;  5ET5 A;  4PTK A;  2XA5 A;  4MIJ A;  3B50 A;  2KQZ A;  1NV0 A;  3B8B A;  3KC0 A;  4GWY A;  1BK4 A;  1DBZ A;  4UAB A;  4MJO A;  4YIC A;  2PFZ A;  4P3L A;  2WYK A;  2HHM A;  4I3E A;  2WX9 A;  4O7M A;  1NV2 A;  2CZI A;  3BIH A;  3IFC A;  2V3Q A;  4GWZ A;  1DCU A;  4N81 A;  3NOH A;  2F3B A;  1AWB A;  2XWI A;  5IZ1 A;  5IZZ A;  2DDK A;  4GWW A;  1FPF A;  1FPE A;  4GWS A;  1FPK A;  1FBP A;  3T1B A;  4PCD A;  2CEY A;  3D1R A;  4HE2 A;  5EQA A;  4OVP A;  1KA0 A;  2CZK A;  3FXB A;  1NUX A;  5F24 A;  1YZ0 A;  5EQ9 A;  5JK4 A;  4PFR A;  4GX4 A;  5IZ3 B;  4N6K A;  1FRP A;  1FPJ A;  1RDZ A;  4PAI A;  1FPI A;  3W9W A;  4PFI A;  4F1U A;  4QXD A;  4PBH A;  3W9V A;  4MNI A;  4NAP A;  1IMF A;  1NV4 A;  2R8T A;  4N6D A;  1IMA A;  1LBX A;  2DVZ A;  1FBC A;  4DI3 D;  4PE3 A;  1D9Q A;  1NI9 A;  4GX3 A;  4NGU A;  3MST A;  2HZL A;  2V4C A;  1YXI A;  2DE4 A;  2XWV A;  4P56 A;  2CZH A;  3RPL A;  5I5P A;  2VPN A;  1NV5 A;  1FSA A;  3QMF A;  4F1V A;  2FIX A;  4PF6 A;  2CEX A;  4DI4 B;  4P1L A;  1FPD A;  4PBQ A;  1NV1 A;  4OVT A;  4PGP A;  1Q9D A;  4PAF A;  1NV6 A;  1FJ6 A;  5EYG A;  3KBZ A;  4LN5 A;  1FBF A;  4HCY A;  2ZZX A;  1CNQ A;  4H45 A;  4X8R A;  4N91 A;  2P3V A;  2VT5 A;  2JJK A;  5ET8 A;  4NN3 A;  1JP4 A;  2Q74 A;  4XF5 A;  5J16 A;  4F18 A;  2FHY A;  4MCO A;  3T0J A;  4OVQ A;  1NUY A;  2QVR A;  5I3S A;  1IMC A;  4NX1 A;  4AS5 A;  2QVV A;  4P1E A;  4MNP A;  1QGX A;  4HXV A;  2DE2 A;  2B4M A;  1NV3 A;  2Q9T A;  2FBP A;  4OA4 A;  4NQ8 A;  4XFE A;  2BJI A;  1LEV A;  4PDH A;  2ZZV A;  3ISP A;  4PGN A;  4MHF A;  2HPG A;  4N4U A;  1NUZ A;  1DK4 A;  2WEF A;  2QFL A;  2GQ1 A;  5IZ3 A;  5EQ8 A;  4NF0 A;  5T3J A;  4GBV A;  2HZK A;  4MX6 A;  4QBA A;  1RDY A;  4X9T A;  4N17 A;  4O8M A;  1NUW A;  3HFU A;  4PF8 A;  1SPI A;  4PDD A;  4MAG A;  1XI6 A;  1KZ8 A;  1KA1 A;  4GBW A;  4XEQ A;  2XXK A;  1FPB A;  2B4L A;  2FIE A;  2DE3 A;  3RYD A;  2P3N A;  5EQ7 A;  1FJ9 A;  2MKZ A;  1EYK A;  4HCW A;  4N8Y A;  3ROJ A;  5IGA A;  1FPG A;  4X04 A;  2HXR A;  5ESY A;  4OVS A;  3E78 A;  4N15 A;  4MNC A;  4N8G A;  3E79 A;  1VDW A;  1FTA A;  4OVR A;  1EYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...