4I3EA

Crystal structure of staphylococcal impase - i complexed with products.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
262
structure length
259
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of Staphylococcal IMPase - I complexed with products.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 67
structure length 259
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i3eA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i3eA02
1YYZA 2FIEA 1FPKA 4AS4A 1FSAA 4HE0A 5J16A 1XI6A 5ET6A 3RYDA 5IZ1A 2CZKA 4AS5A 4G61A 5A5LA 1Q9DA 3D1RA 2QVVA 5ET7A 2P3VA 2OWZA 5DW8A 2VT5A 5LDZA 1NI9A 1DK4A 4H46A 3LUZA 4N81A 1FTAA 1RDXA 1AWBA 2R8TA 1NUZA 2FIXA 1LEVA 2F3DA 3KC0A 2OX3A 4GWSA 4GX6A 4GWUA 4HXVA 5T3JA 1LBZA 5F24A 1NV3A 3IFCA 5EQ7A 3B8BA 4H45A 1G0HA 2CZHA 3IFAA 4QXDA 4I40A 5EQ8A 1RDYA 5ET5A 1LBWA 2WBDA 1FPIA 1NUYA 1EYIA 1FJ9A 1K9ZA 1FBHA 4GX4A 5EYHA 2BJIA 1FBFA 3A29A 2Q8MA 5EQ9A 2WEFA 5EQAA 2QVRA 1VDWA 2Y5LA 1K9YA 1D9QA 3QMFA 1CNQA 1YZ0A 1FPGA 1LBYA 1SPIA 1NV7A 1KA1A 2FBPA 3RPLA 5ET8A 1FBEA 4KXPA 4HE1A 5I3SA 5ESYA 1NUXA 1QGXA 1FRPA 1NV5A 1NV6A 1IMDA 2WBBA 3KBZA 4I3YA 1NV1A 1LBXA 4MJOA 2QFLA 1JP4A 1FPJA 1RDZA 1FPEA 1FPLA 2FVZA 4O7IA 1YXIA 4HE2A 1LBVA 3ROJA 1INPA 1FJ6A 2Q74A 2CZIA 1EYJA 1IMEA 1FBGA 1FBDA 1FPBA 2FHYA 1FPDA 1DBZA 5IZ3A 4PTKA 2JJKA 3RPLB 4GBWA 1FPFA 2DDKA 4IR8A 2Y5KA 1IMCA 1NV0A 4GX3A 1BK4A 1FBCA 4I3EA 3BIHA 1FBPA 3LV0A 2PCRA 1DCUA 3BIGA 4GWYA 2P3NA 3FBPA 1NV4A 2F3BA 2QVUA 4GWZA 3KC1A 1G0IA 2GQ1A 5IZ3B 1EYKA 4GWWA 1NUWA 1NV2A 4GBVA 1IMAA 3T0JA 2HHMA 5FBPA 1KZ8A 5EYGA 1KA0A 4GWXA 1IMBA 4FBPA 1IMFA
chains in the Genus database with same CATH superfamily
3TQLA 1FPKA 1KWHA 5J1DA 5AA4A 3ZKKA 4OVQA 1IXIA 4R2BA 3MW0A 5ET7A 4R73A 3VLUA 3JZJA 1PB7A 4N81A 4IY6A 5H8HB 4P0GA 4FATA 2CZLA 4YB7A 4KPTA 4OVPA 1AMFA 1P1QA 2Q9TA 2FIXA 1B32A 3T9HB 2I49A 1B1HA 4R6YA 5FHOA 4ZEBA 1N3WA 5H8QB 4XKPA 3OEKA 2REJA 5EQ8A 2V25A 3MWBA 4LQ2A 4DLDA 1DPPA 4O8MA 1RYOA 1SBPA 1ZTYA 3DM0A 1FJ9A 4FIMA 2GHBA 1SVXB 2ZNTA 1LBBA 4R9FA 2DQVA 4KCDA 3A3CA 1FTKA 4OVJA 2YPNA 1UTHA 1MM6A 4Z0IA 2I6EA 4XKNA 5A5XA 3U65A 2ABHA 5ITOA 1FPJA 5KZTA 3ILTB 3PUVE 4KR5A 3VVFA 3MC2A 1YPNA 2Q74A 1IMEA 3MBPA 3SESA 2QS2A 3PD9A 2QS4A 3PUZE 4U4SA 1AL3A 4WEPA 2DVZA 5CMCA 2OWTA 2ZZVA 2NWJA 4PE5B 3BIHA 2RINA 3C35A 3TKDA 3H7MA 2F7AA 1M5BA 3LC8A 3EN3A 4FECA 1A99A 1LFGA 4XKRA 2HCAA 2QVUA 3U93A 4MF3A 2H4IA 2ONKE 4X1DA 3K6UA 1YYZA 3IOTA 4F3SA 3QSLA 5AA2D 4R72A 1GGGA 3SDFA 1B0LA 2V84A 2CZKA 3MPKA 3S9EA 1H45A 1FTOA 4YU0A 3FJ7A 1A54A 2R8TA 4QFPA 1EZOA 1XVYA 3I3VA 5T3JA 1DTZA 4RYAA 4ND9A 3T93B 1OMPA 1MY3A 2CZHA 5DEXB 3PV0E 4XEQA 1B7ZA 2WBDA 2OPEA 4P56A 5EQ9A 3OSRA 4MNPA 2GHAA 3PD8A 1MXVA 4NN3A 5BWJA 3EHTA 3TTRA 1IMDA 4OETA 4FJPA 4FEBA 4P11A 2IA4A 1RDZA 3UIFA 2FVZA 1Y1MA 2NUVA 2ONSA 2DS9A 5H8HA 2PYYA 3SEWA 5LTCA 2FHYA 2Q89A 2B3BA 3FD3A 2X26A 5I5PA 3RPLB 1JW4A 3KJTA 3Q25A 5H8QA 4Q0CA 1NV0A 3B50A 4GF8A 1FBPA 4ZEFA 4NEDA 1DPEA 4QFLA 1D3KA 4GWWA 4NF5B 1IMAA 3SERA 4IB2A 3CR9A 2OCUA 3TMGA 3T66A 4PFUA 4QSCA 4GLIA 4XTCQ 5IZ1A 1SW1A 2O1MA 4LATA 3MUQA 1RKMA 1URSA 4WXJA 4BDNA 1R9LA 5DW8A 4DZ1A 1NI9A 3LUZA 4OZ9A 3PUWE 2HAVA 1MPDA 4YKJA 4PFTA 1MXWA 5DVJA 2F34A 1QULA 1Y9UA 3Q28A 3NOHA 4ZECA 4MBPA 5I56B 3K02A 1N7WA 4PFIA 4O7MA 3RY3A 4QFNA 5EHSA 4JWOA 1NNKA 1UTBB 1SW4A 2XXRA 1QJMA 1ZJLA 4PQJA 2OK2A 3B6QA 4POWA 3MP8A 1K9YA 3PPOA 3QMFA 1ZU0A 1B5JA 2IEEA 1YZ0A 2NOOA 3L6HA 4F1VA 3DP6A 4PFBA 1LB9A 4RNSA 1UIVA 3KSJA 1LBXA 3B6WA 4PC9A 2A5TB 2VPOA 5IM2A 3RNNA 1P1NA 1Y3NA 4YMAA 4R75A 4LQ5A 1R9QA 4NF6B 4NX1A 3KG2A 3IO6A 3RT8A 4E0WA 2E0SA 1VSOA 2Y7PA 5FBPA 4NAPA 5CMKA 1B2HA 1I6BA 4GWOA 4F1UA 3OMBA 1MRPA 2FIEA 1CB6A 2V3UA 3IJXB 2RF1A 2XXTA 4HCYA 2XXHA 2XX8A 4JXIA 4TOZA 1JNFA 2VD3A 4OVRA 4GD5A 1Q9DA 3FGSA 4KYEA 1DK4A 1JEUA 4KQPA 5I2NB 1EH3A 4G77A 5IGAA 1S50A 3SEXA 4GWSA 3DP4A 3MPLA 3H4ZA 1TFAA 5I7IA 3MVZA 4H45A 1G0HA 4XXUA 1MXYA 3RTWB 1FQDA 1B4ZA 4IO7A 3IK6B 4EXKA 4NF5A 4N6KA 1BTJA 1LBYA 3ZS6A 4MMPA 4Z7EA 3UA8A 1QGXA 1MH4A 3S2VA 1NV5A 1A8FA 4YB6A 3TPAA 5KCJB 4GL8A 2ZXTA 4QRZA 4QSEA 4BDMA 2PT1A 3JYRA 4IO4A 5L9OA 3G3HA 3O9PA 3RQTA 1ZLQA 2XXXA 5I56A 4G2ZA 3TQWA 5ICQA 5LOMA 2B4MA 4PFWA 1B7HA 1UTBA 2VD2A 5H8NB 1FBCA 2B65A 3IB0A 2F7BA 2YJPA 4ELQA 3IO4A 2RCAA 4HW8A 1MQHA 3QAXA 3FIRA 1M5DA 2PFZA 5L9SA 3PUXE 2A5TA 4XKQA 5H8FB 5BUUA 3TDJA 4AS5A 2QS3A 1US5A 3DLNA 5A5LA 3D1RA 3P7IA 3PTYA 2ZYKA 3C33A 3M8UA 3TCFA 5ICTA 4EF1A 2QSXA 3FXBA 4EDPA 4QBAA 5F1QA 1OLAA 3CG3A 4THIA 3UK4A 3Q27A 1HSLA 4NF6A 5FTHA 4N15A 5TPAB 4PBHA 3MZ1A 5B7DA 1WODA 2O69A 4GVOA 2Q8MA 5EYHA 1FBFA 4F2QA 5I84A 4NWDA 2HAUA 3W9VA 3VVDA 1KA1A 3VXBA 5ET8A 3BFUA 4OEUA 2UYEA 3SEYA 1B0HA 3WAFA 2F78A 1GV8A 4PF6A 1MH3A 1USYE 4O7IA 2Z8EA 3AXFA 1FJ6A 4PF8A 3KFMA 1B3FA 1FBGA 5I2NA 2I4BA 2D3IA 3G3JA 1MDQA 1PB9A 1TXFA 3K1PA 1Z7ME 1I6AA 4OMBA 3CG1A 4EQ7A 2O68A 3CFXA 1LGBC 4N6PA 1Y4TA 3KN8A 2DXYA 2P3NA 2HFBA 5CMMA 4OVSA 3T0JA 1N0TA 4BDQA 4H1XA 5I58B 1GVCA 5KCJA 1FCKA 3PMVA 2XWIA 4AS4A 3HCQA 3HV1A 3MQ9A 1XI6A 3ODBA 2HQ0A 3K0VA 4MEVA 2QVVA 2OWZA 5DVIA 2XX7A 3CHGA 4G68C 3T9VA 1A7LA 3IAZA 1FTMA 1RDXA 2XWKA 1OQGA 1B3GA 4OFLA 2Q8JA 1N04A 4PFYA 4GX6A 4HXVA 3QXMA 5JTYB 4MX6A 5H8NA 3TCGA 4HTGA 4I40A 2UVHA 3V5AA 1Y4CA 3ILUB 4LN5A 3VLWA 1AOVA 1LBWA 1FPIA 1IEJA 3MAMA 4GX4A 5CBSA 1N76A 4RJZA 3K1MA 3S4UA 1OVBA 3CVGA 1A55A 4DE8A 3CSBA 3CI8A 3MVXA 5H8FA 3QUFA 1URDA 4N6DA 1IITA 4QFKA 1YTVA 2QRYA 5TP9A 4F31B 5CI5A 1NNFA 1FPDA 1MQDA 2CMOA 4ZDMA 3U92A 1QW0A 2CEXA 3THIA 2HXRA 2O7UA 3U8QA 2YLNA 1FPFA 4MHFA 3M3KA 1LFHA 4IGRA 3FV2A 3T9XB 4GFRA 2F36A 4JVDA 3FXRA 3LV0A 3OSQA 4AB6A 3O29A 5K2YA 4JWXA 1IXCA 1NV2A 3N94A 5EYGA 2CZIA 3LSFB 1IMFA 1B5IA 1S9TA 3O2AA 1N84A 1B05A 3BKIB 1YCJA 3OO8A 5F7VA 4G61A 3EF7A 2R6GE 3EQ1A 1LEVA 1D9YA 3O6GA 2D21A 4ONYA 3HHFA 3EKIA 3N6TA 4KHZE 4FAJA 3BBRA 2V93A 4GRKA 2O6AA 2F8DA 5ESYA 3MZ9A 1SW2A 1NUXA 4KD5A 4X8RA 4X04A 2VGQA 5I2KB 3HPIA 1INPA 2V3TA 1OLCA 3K1NA 2ALUA 2X7QA 2XXWA 2OZZA 2UYFA 1MG1A 2Y7KA 4PAFA 1POTA 5DT6A 4GBWA 4IY5A 4IR8A 1TWYA 3K4UA 4PETA 1ANFA 4I3EA 2XWVA 4P8BA 1NNPA 5TU0A 2CEYA 1DCUA 4GQOA 2O7IA 4YKKA 3FV1A 4P0IA 5IZ3B 3UORA 4NF8B 4GWXA 1JW1A 4YKIA 4Q5TA 4H67A 2I0BA 1MS7A 3FVOA 3N5LA 5ET6A 3RYDA 2Q2AA 4XFEA 1PBPA 3HO7A 4ESWA 4LA9A 3VVEA 1B6HA 3T9UA 2BJJX 4U2RA 1B3LA 1XOCA 1B3HA 3FASA 1NH8A 2I48A 2I3VA 1NUZA 3QUJA 2OX3A 5EQ7A 4F39A 3UP9A 2G93A 3IFAA 3V89B 3IOWA 3E79A 3PUYE 1MXUA 1EYIA 1IQ7A 4F3BA 4ELPA 2ANJA 2W7YA 1N7XA 4TLMB 4N07A 1DSNA 1QUKA 1D9QA 3FXUA 1NV7A 1H44A 2O51A 2DE2A 1USYH 4GIZA 5JEIA 4TLLB 3KN3A 3HSTA 4DXCA 1EYJA 1IIWA 4K3FA 1LLSA 4OFOA 2WYKA 4F22A 3HN0A 5EHMA 3TODA 2H25A 4PTKA 2P2AA 2UXAA 3T96B 1VFDA 1GTKA 2ZNSA 4R2FA 5IZZA 2ZZWA 4U4XA 4MFIA 2PBWA 2Z23A 1O63A 3RGYA 1LBCA 2FNCA 1NV4A 4GWZA 1G0IA 1B51A 1EYKA 3FVNA 4DI4B 4RPOA 3M3FA 1NFTA 1FTJA 3GBAA 2FYIA 5DEXA 5I2KA 4H0WA 2R71A 3TTMA 4HE0A 4LUBA 4F19A 3H06B 3IJOB 2HPGA 3I5OA 2P3VA 2UVIA 4M4GA 2QJEA 4GL0A 3B8BA 2QS1A 3M3LA 1LAGE 4GOTA 1ZBMA 4BDOA 1K9ZA 3A29A 1N3XA 4ECFA 3OXNA 5EQAA 1VDWA 1PC3A 3SKPA 4NF8A 1FPGA 2DXRA 1NL5A 3RPLA 3MSTA 1QUJA 4RA1A 3C36A 3GBBA 3H6WA 3CFLA 1A8EA 4N8YA 1JP4A 1OIBA 2KLFA 1YXIA 4F3PA 1BIYA 2QMXA 4LONB 2ZZXA 1D9VA 1B58A 1LCFA 5I59B 2FA7A 3K6WA 1JVXA 4H8IA 4GX3A 1FTLA 1BK4A 4N17A 2R9JA 4U1ZA 2PCRA 1LAFE 1Z7NE 4U22A 1Q1KA 1NKXA 3U94A 2AIXA 3EPEA 4YZZA 4BLAA 2F3BA 2WKYA 1NUWA 2I58A 4TQUQ 2XXUA 1DMBA 2KQZA 3H6UA 3O66A 4LVQA 4OQOA 1F9BA 3V8XB 3O6HA 2REGA 2PX1A 4P9KA 1B5HA 3GLBA 4OHNA 2DWHA 3IOUA 3MVWA 4MIJA 1LSTA 4NE4A 3K2DA 2VT5A 3VDFA 4C0RA 2H5YA 1HSJA 4PGPA 1AWBA 3OO9A 4G8NA 3TCHA 3I6VA 2DE3A 3TEPA 3R6UA 3CIJA 2F7CA 3W15C 1FQBA 4DDDA 1HSEA 3S9NC 2O84X 2BJIA 2WEFA 2QVRA 1EU8A 1II5A 2L5VA 1GR2A 2ZYNA 1LFIA 1FBEA 4HE1A 3TZAA 4U23A 3FJMA 1NV1A 4R74A 3MP6A 1JW5A 4N8GA 1FPEA 3MP1A 2OWSA 2OJTA 2LAOA 2XXVA 1PDAA 1SYHA 1DBZA 1P1UA 3IX1A 4Q30B 3VFJA 3PMXA 3N26A 4RK2A 2UVGA 4OYVA 1QUIA 2AL4A 2G29A 2M8CA 4MNCA 3E9XA 3Q29A 2F35A 4GWYA 2VHAA 4EXLA 2GH9A 1OQHA 4PFRA 3TELA 4PE3A 4NF4B 4IO6A 3U72A 4H5GA 1KA0A 4P3LA 1IMBA 1DTGA 3Q26A 3T22A 1FSAA 1NNTA 4UACA 3IORA 3JV9A 2DWAA 3PMWA 4KFQA 4C1TA 4H8JA 4MCOA 5LDZA 1JVYA 1B1XA 3DELB 3RPWA 5FTIA 4DCXA 4XF5A 5I59A 4UA8A 4OANA 3KN7A 1M5FA 4GWUA 1MXZA 4NGUA 4YAHX 3LBSA 1FQFA 2NVUB 4F3GA 4OEVA 1UQWA 5KDTB 3TYHA 3K6XA 4NMYA 2Y5LA 3G3GA 5L9MA 3RT6B 1CNQA 2O1LA 1SPIA 1MDP1 2RKMA 2ZMBA 4X9TA 4R6HA 3EHUA 1SI0A 1Q35A 3H3GA 1LBVA 5CRYA 4IO5A 3O97A 2QL3A 4U1OA 4O94A 2GFEA 2RC7A 3K6VA 1FBDA 4PDHA 1B3EA 1B4HA 3H6VA 3VE1B 3O6IA 2QPQA 2DE4A 3MZBA 1ELJA 2HZLA 1P99A 4G8HA 1R6ZA 2RC9A 3OD7A 1IMCA 2DVCA 4JB7A 1P1OA 3BIGA 3QK6A 2A5SA 3SETA 1IXGA 4FBPA 3R26A 1M5EA 4ZEDA 3OELA 1B7UA 5TPAA 1XC1A 1H3DA 3FUZA 1BP5A 3G7WA 4PAKA 4LZ5A 1XVXA 1MPBA 3ECRA 1I69A 3MVYA 1FQEA 4MH5A 2Z8FA 3KSXA 4YKPA 2B3FA 1URGA 3C31A 1WVJA 2H99A 2V4CA 2XXPA 4OXVA 4N13A 2UVJA 5ET5A 3H03A 1Y3QA 4FE8A 1FBHA 3TAJA 4NF4A 4EUOA 1B46A 3OOAA 4OESA 3TTKA 4AQ4A 3D4GA 1BKAA 1NV6A 2HEUA 4I3YA 2I3WA 5IAIA 2VP1A 1IZ1A 3E4RA 1FQCA 1O7TA 1UIUA 2XX9A 4HE2A 4LZ8A 1SYIA 1POY1 1M5CA 4P47A 2DP8A 3KBRA 1R1NA 3C4MA 5B70A 5AA1A 5I58A 4ELRA 4ELOA 4ZE9A 3PPNA 4G68B 3KJ7A 1MM7A 3FVGA 1NMUA 2ONRA 5KDTA 4OA4A 5K2XA 4EQ9A 1EZPA 4HS7A 3C34A 4PAIA 2DOJA 5HPQA 5CMBA 2WYPA 2KR0A 2F97A 5JTYA 4PDDA 1PEBA 3G3KA 3RLFE 2PMSA 3ZKLA 4YICA 4OFJA 3IR1A 1BLFA 2DYXA 4IO2A 4MNIA 2P0SA 3UGWA 3KEIA 1IUDA 4BDRA 3EHSA 4H46A 4NTLA 1Y1ZA 4ZEIA 4F18A 3KGCA 1XHYA 4NWCA 3A09A 4F1YA 4DXUA 1P1WA 3O28A 3S9MC 2ZNUA 3L6GA 4QXDA 1QVSA 4JVCA 3K01A 1NUYA 3VV5A 1QKBA 3S9LC 1FW0A 4XIGQ 3PGFA 3ZSFA 3FATA 3C9HA 1YAEA 3LSLA 5M2VA 4KXPA 4ZS9A 4H5FA 4OERA 4O3AA 1RYXA 2DWIA 3T1BA 3OENA 5I57B 1XS5A 1FPLA 2XD3A 2F6GA 3ROJA 4M1VA 1FPBA 1DOTA 4MAGA 4OWDA 2AYSA 4WKMA 1TT1A 2JJKA 4H65A 4KYSA 3W9WA 5IKBA 1A40A 2RCBA 3R7XA 2Q88A 3OO7A 1B40A 3FBPA 4RK9A 1MQIA 4GXAA 3N6UA 2PFYA 2HHMA 1SDXA 1Y3PA 3HHGA 4JSDA 5AA2B 3WAEA 3MYUA 3PPPA 1MQGA 3TTLA 2XXYA 3KOTA 3K00A 4N91A 4O3BA 4QHQA 2OPDA 1IXHA 4I8CA 3LSWA 4DCYA 5AA3A 5EYFA 3IB1A 2F3DA 4ZEKA 3KC0A 4G68A 1LBZA 3E78A 1AIVA 2MKZA 3IFCA 1H76A 2Q2CA 4EF2A 1I6QA 5ITPA 3V83A 4OTEA 2Y7RA 2V3QA 1JETA 3H6TA 2GRVA 2HXWA 2AL5A 4QF9A 2FBPA 4QFOA 1S7YA 5L8DA 3SEVA 1FRPA 3KBZA 1O64A 2ZYOA 2QFLA 3ISPA 3CRBA 3BFTA 3QIMA 4KCCA 3U1OA 3D4CA 3E3KA 4X48A 5IZ3A 4NQ8A 4ISUA 1JEVA 2ZYMA 4N4UA 4IGTA 1JQFA 3RUMA 4ESXA 3LR1A 1SQYA 2I4CA 1VFEA 4L17A 4KI0E 5H8SA 5ELVA 1MXXA 3USDA 2XXQA 2D5WA 3FZVA 4RXLA 4DXBA 4F2OA 4FEDA 3UN6A 2E1SA 4UABA 3TUSA 1H43A 3KOSA 4I62A 5HBCA 1KZ8A 2H98A 4HCWA 3OEMA 2PVUA 4LZ7A 5I57A 1MPCA 3CSGA 2XWOA 3B7DA 1PBQA 4PCDA 1L5TA 2THIA 4JVIA 2ESNA 1D4NA 4Q8RA 5DTBA 1TFDA 1VE4A 3GXAA 4POXA 4I9DA 3QYTA 2XXKA 5F24A 1NV3A 4KYDA 2Y7IA 1XT8A 4H6DA 2F5XA 1RDYA 2VPNA 4EQBA 4ZE8A 1FQAA 4JDFA 1LAXA 2B4LA 5AA2A 3TFLA 3CFZA 4ZZAA 2P1SA 5FHMA 2WBBA 2NXOA 3FJGA 5AE4A 3PPRA 5AA4B 3IB2A 1MQJA 5HM4B 4BDLA 3F11A 2XA5A 1MY0A 2WX9A 4U21A 1ZKBA 3LSXA 2OLBA 5DVFA 4P1EA 3VLVA 5CBRA 2XHDA 2DWJA 4G8MA 4QSDA 4E0XA 4O3CA 2Y5KA 3GZGA 4DIGA 4C1UA 2QMWA 3IOVA 2XXIA 4I1DA 1CE2A 1B9JA 3A3UA 2HZKA 1ZMGA 5TP9B 1SI1A 1AH5A 2GQ1A 2RC8A 1B52A 1MY2A 3IL1B 3G3FA 4R9GA 4OENA 1UTHB 5J16A 4PGNA 4JSOA 5A5XB 1WDNA 3HFUA 1T0KA 3OO6A 2OBGA 1FTAA 2Y84A 4OVTA 1LCTA 4RPNA 1LAHE 1VR5A 4X1BA 2Y7WA 5DYHA 3SEUA 4JWYA 4R6KA 3G3IA 1J1NA 3KZGA 3DP8A 3ONMA 3MJNA 3TTNA 1OVTA 2VOZA 2XD2A 4ZZEA 3B6TA 4MLVA 3RTFB 5ISUA 3PPQA 2H9BA 4AB5A 1LB8A 4NG7A 1Y20A 4GXSB 5I3SA 1MY4A 4PP0A 3FXQA 1US4A 5JK4A 4MJOA 3FVKA 3RN8A 4NHBA 4G4PA 1PB8A 3PU5A 4MLQA 2F6PA 2Z22A 5CC2A 3C32A 1QKAA 3LUYA 1ZIUA 5CM6A 2I0CA 4P1LA 3E13X 4DI3D 2PT2A 4PBQA 2DSFA 4FORA 2Z8DA 2DDKA 3VXCA 2X7PA 4RY1A 3GYYA 4NF0A 3SZPA 1EZ9A 1NH7A 4WEDA 4JBZA 4LP2B 1ATGA 1SW5A 3KC1A 1SD3A 4YMBA 4GBVA 4IO3A 4YB5A 1MY1A 5FHNA 4F29A
chains in the Genus database with same CATH topology
2PFZA 1FPKA 4PDDA 5J1DA 4HE0A 4OVQA 4F19A 4YICA 4AS5A 2HPGA 4MNIA 5A5LA 3D1RA 5ET7A 2P3VA 3PTYA 4H46A 4N81A 4F18A 3FXBA 4OVPA 2Q9TA 2FIXA 4QBAA 4N15A 3B8BA 4PBHA 4QXDA 4JVCA 5EQ8A 4O8MA 1NUYA 1FJ9A 1K9ZA 2Q8MA 5EYHA 1FBFA 3A29A 5EQAA 1VDWA 3W9VA 1FPGA 1KA1A 3RPLA 3MSTA 5ET8A 4KXPA 3T1BA 4PF6A 3U65A 4N8YA 1JP4A 1FPJA 1FPLA 4O7IA 1YXIA 3ROJA 1FJ6A 2Q74A 4M1VA 4PF8A 1IMEA 1FBGA 1FPBA 4MAGA 2JJKA 2ZZXA 3W9WA 2DVZA 2ZZVA 4GX3A 1BK4A 4N17A 3BIHA 2PCRA 2P3NA 3FBPA 4YZZA 2F3BA 2QVUA 4OVSA 2PFYA 1NUWA 3T0JA 2HHMA 2KQZA 3MYUA 1YYZA 2XWIA 4AS4A 1XI6A 4P9KA 2CZKA 4N91A 4MEVA 4MIJA 2QVVA 2OWZA 2VT5A 3CHGA 4PGPA 1RDXA 1AWBA 2XWKA 2R8TA 2F3DA 3KC0A 4GX6A 4HXVA 5T3JA 1LBZA 3E78A 2DE3A 3IFCA 2MKZA 4MX6A 2CZHA 4I40A 4XEQA 4LN5A 1LBWA 2WBDA 1FPIA 2V3QA 4GX4A 4P56A 2BJIA 5EQ9A 2WEFA 2QVRA 4MNPA 2L5VA 2FBPA 1FBEA 4HE1A 4NN3A 1FRPA 1IMDA 3KBZA 1NV1A 2QFLA 4N8GA 3ISPA 1RDZA 1FPEA 2FVZA 4N6DA 5LTCA 2FHYA 1FPDA 1DBZA 5IZ3A 4NQ8A 2CEXA 5I5PA 4N4UA 3RPLB 2HXRA 1FPFA 4MHFA 1NV0A 3B50A 1FBPA 4MNCA 4JVDA 3LV0A 4GWYA 4PFRA 4PE3A 4UABA 4GWWA 1NV2A 1IMAA 1KZ8A 5EYGA 1KA0A 4P3LA 4HCWA 2CZIA 1IMBA 1IMFA 1FSAA 5IZ1A 2XWOA 4G61A 4PCDA 5DW8A 4MCOA 5LDZA 1NI9A 3LUZA 4JVIA 4XF5A 1LEVA 4OANA 2XXKA 4GWUA 5F24A 1NV3A 3NOHA 4NGUA 4PFIA 4O7MA 2F5XA 1RDYA 2VPNA 3EKIA 2Y5LA 1K9YA 3QMFA 1CNQA 4F1VA 1YZ0A 1SPIA 2B4LA 5ESYA 1NUXA 4PFBA 4X8RA 2WBBA 1LBXA 4X04A 4PC9A 4X9TA 1LBVA 2VPOA 1INPA 5IM2A 4O94A 1FBDA 2XA5A 4PDHA 2WX9A 2QPQA 2DE4A 4P1EA 2HZLA 4PAFA 4GBWA 4IR8A 2Y5KA 4NX1A 1IMCA 4PETA 4I3EA 2XWVA 4P8BA 2HZKA 2CEYA 1DCUA 3BIGA 2GQ1A 5IZ3B 5FBPA 4NAPA 4GWXA 4FBPA 4F1UA 2FIEA 5J16A 5ET6A 4PGNA 3RYDA 4HCYA 4XFEA 4PAKA 3HFUA 4OVRA 1Q9DA 1DK4A 1FTAA 5IGAA 4OVTA 1NUZA 2OX3A 4GWSA 5EQ7A 5I7IA 4H45A 1G0HA 3IFAA 2V4CA 3E79A 5ET5A 1EYIA 1FBHA 4NG7A 4N6KA 1D9QA 1LBYA 1NV7A 4MMPA 5I3SA 2DE2A 1QGXA 1NV5A 1NV6A 4I3YA 5JK4A 4MJOA 4NHBA 4HE2A 1EYJA 4P47A 5CM6A 4P1LA 2WYKA 4DI3D 4PTKA 4PBQA 2B4MA 2DDKA 5IZZA 2ZZWA 3GYYA 4OA4A 1FBCA 4NF0A 3SZPA 4PAIA 1NV4A 4GWZA 3KC1A 1G0IA 1EYKA 2WYPA 4GBVA 2KR0A 4DI4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYZ A;  2FIE A;  1FPK A;  4AS4 A;  1FSA A;  4HE0 A;  5J16 A;  1XI6 A;  5ET6 A;  3RYD A;  5IZ1 A;  2CZK A;  4AS5 A;  4G61 A;  5A5L A;  1Q9D A;  3D1R A;  2QVV A;  5ET7 A;  2P3V A;  2OWZ A;  5DW8 A;  2VT5 A;  5LDZ A;  1NI9 A;  1DK4 A;  4H46 A;  3LUZ A;  4N81 A;  1FTA A;  1RDX A;  1AWB A;  2R8T A;  1NUZ A;  2FIX A;  1LEV A;  2F3D A;  3KC0 A;  2OX3 A;  4GWS A;  4GX6 A;  4GWU A;  4HXV A;  5T3J A;  1LBZ A;  5F24 A;  1NV3 A;  3IFC A;  5EQ7 A;  3B8B A;  4H45 A;  1G0H A;  2CZH A;  3IFA A;  4QXD A;  4I40 A;  5EQ8 A;  1RDY A;  5ET5 A;  1LBW A;  2WBD A;  1FPI A;  1NUY A;  1EYI A;  1FJ9 A;  1K9Z A;  1FBH A;  4GX4 A;  5EYH A;  2BJI A;  1FBF A;  3A29 A;  2Q8M A;  5EQ9 A;  2WEF A;  5EQA A;  2QVR A;  1VDW A;  2Y5L A;  1K9Y A;  1D9Q A;  3QMF A;  1CNQ A;  1YZ0 A;  1FPG A;  1LBY A;  1SPI A;  1NV7 A;  1KA1 A;  2FBP A;  3RPL A;  5ET8 A;  1FBE A;  4KXP A;  4HE1 A;  5I3S A;  5ESY A;  1NUX A;  1QGX A;  1FRP A;  1NV5 A;  1NV6 A;  1IMD A;  2WBB A;  3KBZ A;  4I3Y A;  1NV1 A;  1LBX A;  4MJO A;  2QFL A;  1JP4 A;  1FPJ A;  1RDZ A;  1FPE A;  1FPL A;  2FVZ A;  4O7I A;  1YXI A;  4HE2 A;  1LBV A;  3ROJ A;  1INP A;  1FJ6 A;  2Q74 A;  2CZI A;  1EYJ A;  1IME A;  1FBG A;  1FBD A;  1FPB A;  2FHY A;  1FPD A;  1DBZ A;  5IZ3 A;  4PTK A;  2JJK A;  3RPL B;  4GBW A;  1FPF A;  2DDK A;  4IR8 A;  2Y5K A;  1IMC A;  1NV0 A;  4GX3 A;  1BK4 A;  1FBC A;  4I3E A;  3BIH A;  1FBP A;  3LV0 A;  2PCR A;  1DCU A;  3BIG A;  4GWY A;  2P3N A;  3FBP A;  1NV4 A;  2F3B A;  2QVU A;  4GWZ A;  3KC1 A;  1G0I A;  2GQ1 A;  5IZ3 B;  1EYK A;  4GWW A;  1NUW A;  1NV2 A;  4GBV A;  1IMA A;  3T0J A;  2HHM A;  5FBP A;  1KZ8 A;  5EYG A;  1KA0 A;  4GWX A;  1IMB A;  4FBP A;  1IMF A; 
#chains in the Genus database with same CATH topology
 3TQL A;  1FPK A;  1KWH A;  5J1D A;  5AA4 A;  3ZKK A;  4OVQ A;  1IXI A;  4R2B A;  3MW0 A;  5ET7 A;  4R73 A;  3VLU A;  3JZJ A;  1PB7 A;  4N81 A;  4IY6 A;  5H8H B;  4P0G A;  4FAT A;  2CZL A;  4YB7 A;  4KPT A;  4OVP A;  1AMF A;  1P1Q A;  2Q9T A;  2FIX A;  1B32 A;  3T9H B;  2I49 A;  1B1H A;  4R6Y A;  5FHO A;  4ZEB A;  1N3W A;  5H8Q B;  4XKP A;  3OEK A;  2REJ A;  5EQ8 A;  2V25 A;  3MWB A;  4LQ2 A;  4DLD A;  1DPP A;  4O8M A;  1RYO A;  1SBP A;  1ZTY A;  3DM0 A;  1FJ9 A;  4FIM A;  2GHB A;  1SVX B;  2ZNT A;  1LBB A;  4R9F A;  2DQV A;  4KCD A;  3A3C A;  1FTK A;  4OVJ A;  2YPN A;  1UTH A;  1MM6 A;  4Z0I A;  2I6E A;  4XKN A;  5A5X A;  3U65 A;  2ABH A;  5ITO A;  1FPJ A;  5KZT A;  3ILT B;  3PUV E;  4KR5 A;  3VVF A;  3MC2 A;  1YPN A;  2Q74 A;  1IME A;  3MBP A;  3SES A;  2QS2 A;  3PD9 A;  2QS4 A;  3PUZ E;  4U4S A;  1AL3 A;  4WEP A;  2DVZ A;  5CMC A;  2OWT A;  2ZZV A;  2NWJ A;  4PE5 B;  3BIH A;  2RIN A;  3C35 A;  3TKD A;  3H7M A;  2F7A A;  1M5B A;  3LC8 A;  3EN3 A;  4FEC A;  1A99 A;  1LFG A;  4XKR A;  2HCA A;  2QVU A;  3U93 A;  4MF3 A;  2H4I A;  2ONK E;  4X1D A;  3K6U A;  1YYZ A;  3IOT A;  4F3S A;  3QSL A;  5AA2 D;  4R72 A;  1GGG A;  3SDF A;  1B0L A;  2V84 A;  2CZK A;  3MPK A;  3S9E A;  1H45 A;  1FTO A;  4YU0 A;  3FJ7 A;  1A54 A;  2R8T A;  4QFP A;  1EZO A;  1XVY A;  3I3V A;  5T3J A;  1DTZ A;  4RYA A;  4ND9 A;  3T93 B;  1OMP A;  1MY3 A;  2CZH A;  5DEX B;  3PV0 E;  4XEQ A;  1B7Z A;  2WBD A;  2OPE A;  4P56 A;  5EQ9 A;  3OSR A;  4MNP A;  2GHA A;  3PD8 A;  1MXV A;  4NN3 A;  5BWJ A;  3EHT A;  3TTR A;  1IMD A;  4OET A;  4FJP A;  4FEB A;  4P11 A;  2IA4 A;  1RDZ A;  3UIF A;  2FVZ A;  1Y1M A;  2NUV A;  2ONS A;  2DS9 A;  5H8H A;  2PYY A;  3SEW A;  5LTC A;  2FHY A;  2Q89 A;  2B3B A;  3FD3 A;  2X26 A;  5I5P A;  3RPL B;  1JW4 A;  3KJT A;  3Q25 A;  5H8Q A;  4Q0C A;  1NV0 A;  3B50 A;  4GF8 A;  1FBP A;  4ZEF A;  4NED A;  1DPE A;  4QFL A;  1D3K A;  4GWW A;  4NF5 B;  1IMA A;  3SER A;  4IB2 A;  3CR9 A;  2OCU A;  3TMG A;  3T66 A;  4PFU A;  4QSC A;  4GLI A;  4XTC Q;  5IZ1 A;  1SW1 A;  2O1M A;  4LAT A;  3MUQ A;  1RKM A;  1URS A;  4WXJ A;  4BDN A;  1R9L A;  5DW8 A;  4DZ1 A;  1NI9 A;  3LUZ A;  4OZ9 A;  3PUW E;  2HAV A;  1MPD A;  4YKJ A;  4PFT A;  1MXW A;  5DVJ A;  2F34 A;  1QUL A;  1Y9U A;  3Q28 A;  3NOH A;  4ZEC A;  4MBP A;  5I56 B;  3K02 A;  1N7W A;  4PFI A;  4O7M A;  3RY3 A;  4QFN A;  5EHS A;  4JWO A;  1NNK A;  1UTB B;  1SW4 A;  2XXR A;  1QJM A;  1ZJL A;  4PQJ A;  2OK2 A;  3B6Q A;  4POW A;  3MP8 A;  1K9Y A;  3PPO A;  3QMF A;  1ZU0 A;  1B5J A;  2IEE A;  1YZ0 A;  2NOO A;  3L6H A;  4F1V A;  3DP6 A;  4PFB A;  1LB9 A;  4RNS A;  1UIV A;  3KSJ A;  1LBX A;  3B6W A;  4PC9 A;  2A5T B;  2VPO A;  5IM2 A;  3RNN A;  1P1N A;  1Y3N A;  4YMA A;  4R75 A;  4LQ5 A;  1R9Q A;  4NF6 B;  4NX1 A;  3KG2 A;  3IO6 A;  3RT8 A;  4E0W A;  2E0S A;  1VSO A;  2Y7P A;  5FBP A;  4NAP A;  5CMK A;  1B2H A;  1I6B A;  4GWO A;  4F1U A;  3OMB A;  1MRP A;  2FIE A;  1CB6 A;  2V3U A;  3IJX B;  2RF1 A;  2XXT A;  4HCY A;  2XXH A;  2XX8 A;  4JXI A;  4TOZ A;  1JNF A;  2VD3 A;  4OVR A;  4GD5 A;  1Q9D A;  3FGS A;  4KYE A;  1DK4 A;  1JEU A;  4KQP A;  5I2N B;  1EH3 A;  4G77 A;  5IGA A;  1S50 A;  3SEX A;  4GWS A;  3DP4 A;  3MPL A;  3H4Z A;  1TFA A;  5I7I A;  3MVZ A;  4H45 A;  1G0H A;  4XXU A;  1MXY A;  3RTW B;  1FQD A;  1B4Z A;  4IO7 A;  3IK6 B;  4EXK A;  4NF5 A;  4N6K A;  1BTJ A;  1LBY A;  3ZS6 A;  4MMP A;  4Z7E A;  3UA8 A;  1QGX A;  1MH4 A;  3S2V A;  1NV5 A;  1A8F A;  4YB6 A;  3TPA A;  5KCJ B;  4GL8 A;  2ZXT A;  4QRZ A;  4QSE A;  4BDM A;  2PT1 A;  3JYR A;  4IO4 A;  5L9O A;  3G3H A;  3O9P A;  3RQT A;  1ZLQ A;  2XXX A;  5I56 A;  4G2Z A;  3TQW A;  5ICQ A;  5LOM A;  2B4M A;  4PFW A;  1B7H A;  1UTB A;  2VD2 A;  5H8N B;  1FBC A;  2B65 A;  3IB0 A;  2F7B A;  2YJP A;  4ELQ A;  3IO4 A;  2RCA A;  4HW8 A;  1MQH A;  3QAX A;  3FIR A;  1M5D A;  2PFZ A;  5L9S A;  3PUX E;  2A5T A;  4XKQ A;  5H8F B;  5BUU A;  3TDJ A;  4AS5 A;  2QS3 A;  1US5 A;  3DLN A;  5A5L A;  3D1R A;  3P7I A;  3PTY A;  2ZYK A;  3C33 A;  3M8U A;  3TCF A;  5ICT A;  4EF1 A;  2QSX A;  3FXB A;  4EDP A;  4QBA A;  5F1Q A;  1OLA A;  3CG3 A;  4THI A;  3UK4 A;  3Q27 A;  1HSL A;  4NF6 A;  5FTH A;  4N15 A;  5TPA B;  4PBH A;  3MZ1 A;  5B7D A;  1WOD A;  2O69 A;  4GVO A;  2Q8M A;  5EYH A;  1FBF A;  4F2Q A;  5I84 A;  4NWD A;  2HAU A;  3W9V A;  3VVD A;  1KA1 A;  3VXB A;  5ET8 A;  3BFU A;  4OEU A;  2UYE A;  3SEY A;  1B0H A;  3WAF A;  2F78 A;  1GV8 A;  4PF6 A;  1MH3 A;  1USY E;  4O7I A;  2Z8E A;  3AXF A;  1FJ6 A;  4PF8 A;  3KFM A;  1B3F A;  1FBG A;  5I2N A;  2I4B A;  2D3I A;  3G3J A;  1MDQ A;  1PB9 A;  1TXF A;  3K1P A;  1Z7M E;  1I6A A;  4OMB A;  3CG1 A;  4EQ7 A;  2O68 A;  3CFX A;  1LGB C;  4N6P A;  1Y4T A;  3KN8 A;  2DXY A;  2P3N A;  2HFB A;  5CMM A;  4OVS A;  3T0J A;  1N0T A;  4BDQ A;  4H1X A;  5I58 B;  1GVC A;  5KCJ A;  1FCK A;  3PMV A;  2XWI A;  4AS4 A;  3HCQ A;  3HV1 A;  3MQ9 A;  1XI6 A;  3ODB A;  2HQ0 A;  3K0V A;  4MEV A;  2QVV A;  2OWZ A;  5DVI A;  2XX7 A;  3CHG A;  4G68 C;  3T9V A;  1A7L A;  3IAZ A;  1FTM A;  1RDX A;  2XWK A;  1OQG A;  1B3G A;  4OFL A;  2Q8J A;  1N04 A;  4PFY A;  4GX6 A;  4HXV A;  3QXM A;  5JTY B;  4MX6 A;  5H8N A;  3TCG A;  4HTG A;  4I40 A;  2UVH A;  3V5A A;  1Y4C A;  3ILU B;  4LN5 A;  3VLW A;  1AOV A;  1LBW A;  1FPI A;  1IEJ A;  3MAM A;  4GX4 A;  5CBS A;  1N76 A;  4RJZ A;  3K1M A;  3S4U A;  1OVB A;  3CVG A;  1A55 A;  4DE8 A;  3CSB A;  3CI8 A;  3MVX A;  5H8F A;  3QUF A;  1URD A;  4N6D A;  1IIT A;  4QFK A;  1YTV A;  2QRY A;  5TP9 A;  4F31 B;  5CI5 A;  1NNF A;  1FPD A;  1MQD A;  2CMO A;  4ZDM A;  3U92 A;  1QW0 A;  2CEX A;  3THI A;  2HXR A;  2O7U A;  3U8Q A;  2YLN A;  1FPF A;  4MHF A;  3M3K A;  1LFH A;  4IGR A;  3FV2 A;  3T9X B;  4GFR A;  2F36 A;  4JVD A;  3FXR A;  3LV0 A;  3OSQ A;  4AB6 A;  3O29 A;  5K2Y A;  4JWX A;  1IXC A;  1NV2 A;  3N94 A;  5EYG A;  2CZI A;  3LSF B;  1IMF A;  1B5I A;  1S9T A;  3O2A A;  1N84 A;  1B05 A;  3BKI B;  1YCJ A;  3OO8 A;  5F7V A;  4G61 A;  3EF7 A;  2R6G E;  3EQ1 A;  1LEV A;  1D9Y A;  3O6G A;  2D21 A;  4ONY A;  3HHF A;  3EKI A;  3N6T A;  4KHZ E;  4FAJ A;  3BBR A;  2V93 A;  4GRK A;  2O6A A;  2F8D A;  5ESY A;  3MZ9 A;  1SW2 A;  1NUX A;  4KD5 A;  4X8R A;  4X04 A;  2VGQ A;  5I2K B;  3HPI A;  1INP A;  2V3T A;  1OLC A;  3K1N A;  2ALU A;  2X7Q A;  2XXW A;  2OZZ A;  2UYF A;  1MG1 A;  2Y7K A;  4PAF A;  1POT A;  5DT6 A;  4GBW A;  4IY5 A;  4IR8 A;  1TWY A;  3K4U A;  4PET A;  1ANF A;  4I3E A;  2XWV A;  4P8B A;  1NNP A;  5TU0 A;  2CEY A;  1DCU A;  4GQO A;  2O7I A;  4YKK A;  3FV1 A;  4P0I A;  5IZ3 B;  3UOR A;  4NF8 B;  4GWX A;  1JW1 A;  4YKI A;  4Q5T A;  4H67 A;  2I0B A;  1MS7 A;  3FVO A;  3N5L A;  5ET6 A;  3RYD A;  2Q2A A;  4XFE A;  1PBP A;  3HO7 A;  4ESW A;  4LA9 A;  3VVE A;  1B6H A;  3T9U A;  2BJJ X;  4U2R A;  1B3L A;  1XOC A;  1B3H A;  3FAS A;  1NH8 A;  2I48 A;  2I3V A;  1NUZ A;  3QUJ A;  2OX3 A;  5EQ7 A;  4F39 A;  3UP9 A;  2G93 A;  3IFA A;  3V89 B;  3IOW A;  3E79 A;  3PUY E;  1MXU A;  1EYI A;  1IQ7 A;  4F3B A;  4ELP A;  2ANJ A;  2W7Y A;  1N7X A;  4TLM B;  4N07 A;  1DSN A;  1QUK A;  1D9Q A;  3FXU A;  1NV7 A;  1H44 A;  2O51 A;  2DE2 A;  1USY H;  4GIZ A;  5JEI A;  4TLL B;  3KN3 A;  3HST A;  4DXC A;  1EYJ A;  1IIW A;  4K3F A;  1LLS A;  4OFO A;  2WYK A;  4F22 A;  3HN0 A;  5EHM A;  3TOD A;  2H25 A;  4PTK A;  2P2A A;  2UXA A;  3T96 B;  1VFD A;  1GTK A;  2ZNS A;  4R2F A;  5IZZ A;  2ZZW A;  4U4X A;  4MFI A;  2PBW A;  2Z23 A;  1O63 A;  3RGY A;  1LBC A;  2FNC A;  1NV4 A;  4GWZ A;  1G0I A;  1B51 A;  1EYK A;  3FVN A;  4DI4 B;  4RPO A;  3M3F A;  1NFT A;  1FTJ A;  3GBA A;  2FYI A;  5DEX A;  5I2K A;  4H0W A;  2R71 A;  3TTM A;  4HE0 A;  4LUB A;  4F19 A;  3H06 B;  3IJO B;  2HPG A;  3I5O A;  2P3V A;  2UVI A;  4M4G A;  2QJE A;  4GL0 A;  3B8B A;  2QS1 A;  3M3L A;  1LAG E;  4GOT A;  1ZBM A;  4BDO A;  1K9Z A;  3A29 A;  1N3X A;  4ECF A;  3OXN A;  5EQA A;  1VDW A;  1PC3 A;  3SKP A;  4NF8 A;  1FPG A;  2DXR A;  1NL5 A;  3RPL A;  3MST A;  1QUJ A;  4RA1 A;  3C36 A;  3GBB A;  3H6W A;  3CFL A;  1A8E A;  4N8Y A;  1JP4 A;  1OIB A;  2KLF A;  1YXI A;  4F3P A;  1BIY A;  2QMX A;  4LON B;  2ZZX A;  1D9V A;  1B58 A;  1LCF A;  5I59 B;  2FA7 A;  3K6W A;  1JVX A;  4H8I A;  4GX3 A;  1FTL A;  1BK4 A;  4N17 A;  2R9J A;  4U1Z A;  2PCR A;  1LAF E;  1Z7N E;  4U22 A;  1Q1K A;  1NKX A;  3U94 A;  2AIX A;  3EPE A;  4YZZ A;  4BLA A;  2F3B A;  2WKY A;  1NUW A;  2I58 A;  4TQU Q;  2XXU A;  1DMB A;  2KQZ A;  3H6U A;  3O66 A;  4LVQ A;  4OQO A;  1F9B A;  3V8X B;  3O6H A;  2REG A;  2PX1 A;  4P9K A;  1B5H A;  3GLB A;  4OHN A;  2DWH A;  3IOU A;  3MVW A;  4MIJ A;  1LST A;  4NE4 A;  3K2D A;  2VT5 A;  3VDF A;  4C0R A;  2H5Y A;  1HSJ A;  4PGP A;  1AWB A;  3OO9 A;  4G8N A;  3TCH A;  3I6V A;  2DE3 A;  3TEP A;  3R6U A;  3CIJ A;  2F7C A;  3W15 C;  1FQB A;  4DDD A;  1HSE A;  3S9N C;  2O84 X;  2BJI A;  2WEF A;  2QVR A;  1EU8 A;  1II5 A;  2L5V A;  1GR2 A;  2ZYN A;  1LFI A;  1FBE A;  4HE1 A;  3TZA A;  4U23 A;  3FJM A;  1NV1 A;  4R74 A;  3MP6 A;  1JW5 A;  4N8G A;  1FPE A;  3MP1 A;  2OWS A;  2OJT A;  2LAO A;  2XXV A;  1PDA A;  1SYH A;  1DBZ A;  1P1U A;  3IX1 A;  4Q30 B;  3VFJ A;  3PMX A;  3N26 A;  4RK2 A;  2UVG A;  4OYV A;  1QUI A;  2AL4 A;  2G29 A;  2M8C A;  4MNC A;  3E9X A;  3Q29 A;  2F35 A;  4GWY A;  2VHA A;  4EXL A;  2GH9 A;  1OQH A;  4PFR A;  3TEL A;  4PE3 A;  4NF4 B;  4IO6 A;  3U72 A;  4H5G A;  1KA0 A;  4P3L A;  1IMB A;  1DTG A;  3Q26 A;  3T22 A;  1FSA A;  1NNT A;  4UAC A;  3IOR A;  3JV9 A;  2DWA A;  3PMW A;  4KFQ A;  4C1T A;  4H8J A;  4MCO A;  5LDZ A;  1JVY A;  1B1X A;  3DEL B;  3RPW A;  5FTI A;  4DCX A;  4XF5 A;  5I59 A;  4UA8 A;  4OAN A;  3KN7 A;  1M5F A;  4GWU A;  1MXZ A;  4NGU A;  4YAH X;  3LBS A;  1FQF A;  2NVU B;  4F3G A;  4OEV A;  1UQW A;  5KDT B;  3TYH A;  3K6X A;  4NMY A;  2Y5L A;  3G3G A;  5L9M A;  3RT6 B;  1CNQ A;  2O1L A;  1SPI A;  1MDP 1;  2RKM A;  2ZMB A;  4X9T A;  4R6H A;  3EHU A;  1SI0 A;  1Q35 A;  3H3G A;  1LBV A;  5CRY A;  4IO5 A;  3O97 A;  2QL3 A;  4U1O A;  4O94 A;  2GFE A;  2RC7 A;  3K6V A;  1FBD A;  4PDH A;  1B3E A;  1B4H A;  3H6V A;  3VE1 B;  3O6I A;  2QPQ A;  2DE4 A;  3MZB A;  1ELJ A;  2HZL A;  1P99 A;  4G8H A;  1R6Z A;  2RC9 A;  3OD7 A;  1IMC A;  2DVC A;  4JB7 A;  1P1O A;  3BIG A;  3QK6 A;  2A5S A;  3SET A;  1IXG A;  4FBP A;  3R26 A;  1M5E A;  4ZED A;  3OEL A;  1B7U A;  5TPA A;  1XC1 A;  1H3D A;  3FUZ A;  1BP5 A;  3G7W A;  4PAK A;  4LZ5 A;  1XVX A;  1MPB A;  3ECR A;  1I69 A;  3MVY A;  1FQE A;  4MH5 A;  2Z8F A;  3KSX A;  4YKP A;  2B3F A;  1URG A;  3C31 A;  1WVJ A;  2H99 A;  2V4C A;  2XXP A;  4OXV A;  4N13 A;  2UVJ A;  5ET5 A;  3H03 A;  1Y3Q A;  4FE8 A;  1FBH A;  3TAJ A;  4NF4 A;  4EUO A;  1B46 A;  3OOA A;  4OES A;  3TTK A;  4AQ4 A;  3D4G A;  1BKA A;  1NV6 A;  2HEU A;  4I3Y A;  2I3W A;  5IAI A;  2VP1 A;  1IZ1 A;  3E4R A;  1FQC A;  1O7T A;  1UIU A;  2XX9 A;  4HE2 A;  4LZ8 A;  1SYI A;  1POY 1;  1M5C A;  4P47 A;  2DP8 A;  3KBR A;  1R1N A;  3C4M A;  5B70 A;  5AA1 A;  5I58 A;  4ELR A;  4ELO A;  4ZE9 A;  3PPN A;  4G68 B;  3KJ7 A;  1MM7 A;  3FVG A;  1NMU A;  2ONR A;  5KDT A;  4OA4 A;  5K2X A;  4EQ9 A;  1EZP A;  4HS7 A;  3C34 A;  4PAI A;  2DOJ A;  5HPQ A;  5CMB A;  2WYP A;  2KR0 A;  2F97 A;  5JTY A;  4PDD A;  1PEB A;  3G3K A;  3RLF E;  2PMS A;  3ZKL A;  4YIC A;  4OFJ A;  3IR1 A;  1BLF A;  2DYX A;  4IO2 A;  4MNI A;  2P0S A;  3UGW A;  3KEI A;  1IUD A;  4BDR A;  3EHS A;  4H46 A;  4NTL A;  1Y1Z A;  4ZEI A;  4F18 A;  3KGC A;  1XHY A;  4NWC A;  3A09 A;  4F1Y A;  4DXU A;  1P1W A;  3O28 A;  3S9M C;  2ZNU A;  3L6G A;  4QXD A;  1QVS A;  4JVC A;  3K01 A;  1NUY A;  3VV5 A;  1QKB A;  3S9L C;  1FW0 A;  4XIG Q;  3PGF A;  3ZSF A;  3FAT A;  3C9H A;  1YAE A;  3LSL A;  5M2V A;  4KXP A;  4ZS9 A;  4H5F A;  4OER A;  4O3A A;  1RYX A;  2DWI A;  3T1B A;  3OEN A;  5I57 B;  1XS5 A;  1FPL A;  2XD3 A;  2F6G A;  3ROJ A;  4M1V A;  1FPB A;  1DOT A;  4MAG A;  4OWD A;  2AYS A;  4WKM A;  1TT1 A;  2JJK A;  4H65 A;  4KYS A;  3W9W A;  5IKB A;  1A40 A;  2RCB A;  3R7X A;  2Q88 A;  3OO7 A;  1B40 A;  3FBP A;  4RK9 A;  1MQI A;  4GXA A;  3N6U A;  2PFY A;  2HHM A;  1SDX A;  1Y3P A;  3HHG A;  4JSD A;  5AA2 B;  3WAE A;  3MYU A;  3PPP A;  1MQG A;  3TTL A;  2XXY A;  3KOT A;  3K00 A;  4N91 A;  4O3B A;  4QHQ A;  2OPD A;  1IXH A;  4I8C A;  3LSW A;  4DCY A;  5AA3 A;  5EYF A;  3IB1 A;  2F3D A;  4ZEK A;  3KC0 A;  4G68 A;  1LBZ A;  3E78 A;  1AIV A;  2MKZ A;  3IFC A;  1H76 A;  2Q2C A;  4EF2 A;  1I6Q A;  5ITP A;  3V83 A;  4OTE A;  2Y7R A;  2V3Q A;  1JET A;  3H6T A;  2GRV A;  2HXW A;  2AL5 A;  4QF9 A;  2FBP A;  4QFO A;  1S7Y A;  5L8D A;  3SEV A;  1FRP A;  3KBZ A;  1O64 A;  2ZYO A;  2QFL A;  3ISP A;  3CRB A;  3BFT A;  3QIM A;  4KCC A;  3U1O A;  3D4C A;  3E3K A;  4X48 A;  5IZ3 A;  4NQ8 A;  4ISU A;  1JEV A;  2ZYM A;  4N4U A;  4IGT A;  1JQF A;  3RUM A;  4ESX A;  3LR1 A;  1SQY A;  2I4C A;  1VFE A;  4L17 A;  4KI0 E;  5H8S A;  5ELV A;  1MXX A;  3USD A;  2XXQ A;  2D5W A;  3FZV A;  4RXL A;  4DXB A;  4F2O A;  4FED A;  3UN6 A;  2E1S A;  4UAB A;  3TUS A;  1H43 A;  3KOS A;  4I62 A;  5HBC A;  1KZ8 A;  2H98 A;  4HCW A;  3OEM A;  2PVU A;  4LZ7 A;  5I57 A;  1MPC A;  3CSG A;  2XWO A;  3B7D A;  1PBQ A;  4PCD A;  1L5T A;  2THI A;  4JVI A;  2ESN A;  1D4N A;  4Q8R A;  5DTB A;  1TFD A;  1VE4 A;  3GXA A;  4POX A;  4I9D A;  3QYT A;  2XXK A;  5F24 A;  1NV3 A;  4KYD A;  2Y7I A;  1XT8 A;  4H6D A;  2F5X A;  1RDY A;  2VPN A;  4EQB A;  4ZE8 A;  1FQA A;  4JDF A;  1LAX A;  2B4L A;  5AA2 A;  3TFL A;  3CFZ A;  4ZZA A;  2P1S A;  5FHM A;  2WBB A;  2NXO A;  3FJG A;  5AE4 A;  3PPR A;  5AA4 B;  3IB2 A;  1MQJ A;  5HM4 B;  4BDL A;  3F11 A;  2XA5 A;  1MY0 A;  2WX9 A;  4U21 A;  1ZKB A;  3LSX A;  2OLB A;  5DVF A;  4P1E A;  3VLV A;  5CBR A;  2XHD A;  2DWJ A;  4G8M A;  4QSD A;  4E0X A;  4O3C A;  2Y5K A;  3GZG A;  4DIG A;  4C1U A;  2QMW A;  3IOV A;  2XXI A;  4I1D A;  1CE2 A;  1B9J A;  3A3U A;  2HZK A;  1ZMG A;  5TP9 B;  1SI1 A;  1AH5 A;  2GQ1 A;  2RC8 A;  1B52 A;  1MY2 A;  3IL1 B;  3G3F A;  4R9G A;  4OEN A;  1UTH B;  5J16 A;  4PGN A;  4JSO A;  5A5X B;  1WDN A;  3HFU A;  1T0K A;  3OO6 A;  2OBG A;  1FTA A;  2Y84 A;  4OVT A;  1LCT A;  4RPN A;  1LAH E;  1VR5 A;  4X1B A;  2Y7W A;  5DYH A;  3SEU A;  4JWY A;  4R6K A;  3G3I A;  1J1N A;  3KZG A;  3DP8 A;  3ONM A;  3MJN A;  3TTN A;  1OVT A;  2VOZ A;  2XD2 A;  4ZZE A;  3B6T A;  4MLV A;  3RTF B;  5ISU A;  3PPQ A;  2H9B A;  4AB5 A;  1LB8 A;  4NG7 A;  1Y20 A;  4GXS B;  5I3S A;  1MY4 A;  4PP0 A;  3FXQ A;  1US4 A;  5JK4 A;  4MJO A;  3FVK A;  3RN8 A;  4NHB A;  4G4P A;  1PB8 A;  3PU5 A;  4MLQ A;  2F6P A;  2Z22 A;  5CC2 A;  3C32 A;  1QKA A;  3LUY A;  1ZIU A;  5CM6 A;  2I0C A;  4P1L A;  3E13 X;  4DI3 D;  2PT2 A;  4PBQ A;  2DSF A;  4FOR A;  2Z8D A;  2DDK A;  3VXC A;  2X7P A;  4RY1 A;  3GYY A;  4NF0 A;  3SZP A;  1EZ9 A;  1NH7 A;  4WED A;  4JBZ A;  4LP2 B;  1ATG A;  1SW5 A;  3KC1 A;  1SD3 A;  4YMB A;  4GBV A;  4IO3 A;  4YB5 A;  1MY1 A;  5FHN A;  4F29 A; 
#chains in the Genus database with same CATH homology
 2PFZ A;  1FPK A;  4PDD A;  5J1D A;  4HE0 A;  4OVQ A;  4F19 A;  4YIC A;  4AS5 A;  2HPG A;  4MNI A;  5A5L A;  3D1R A;  5ET7 A;  2P3V A;  3PTY A;  4H46 A;  4N81 A;  4F18 A;  3FXB A;  4OVP A;  2Q9T A;  2FIX A;  4QBA A;  4N15 A;  3B8B A;  4PBH A;  4QXD A;  4JVC A;  5EQ8 A;  4O8M A;  1NUY A;  1FJ9 A;  1K9Z A;  2Q8M A;  5EYH A;  1FBF A;  3A29 A;  5EQA A;  1VDW A;  3W9V A;  1FPG A;  1KA1 A;  3RPL A;  3MST A;  5ET8 A;  4KXP A;  3T1B A;  4PF6 A;  3U65 A;  4N8Y A;  1JP4 A;  1FPJ A;  1FPL A;  4O7I A;  1YXI A;  3ROJ A;  1FJ6 A;  2Q74 A;  4M1V A;  4PF8 A;  1IME A;  1FBG A;  1FPB A;  4MAG A;  2JJK A;  2ZZX A;  3W9W A;  2DVZ A;  2ZZV A;  4GX3 A;  1BK4 A;  4N17 A;  3BIH A;  2PCR A;  2P3N A;  3FBP A;  4YZZ A;  2F3B A;  2QVU A;  4OVS A;  2PFY A;  1NUW A;  3T0J A;  2HHM A;  2KQZ A;  3MYU A;  1YYZ A;  2XWI A;  4AS4 A;  1XI6 A;  4P9K A;  2CZK A;  4N91 A;  4MEV A;  4MIJ A;  2QVV A;  2OWZ A;  2VT5 A;  3CHG A;  4PGP A;  1RDX A;  1AWB A;  2XWK A;  2R8T A;  2F3D A;  3KC0 A;  4GX6 A;  4HXV A;  5T3J A;  1LBZ A;  3E78 A;  2DE3 A;  3IFC A;  2MKZ A;  4MX6 A;  2CZH A;  4I40 A;  4XEQ A;  4LN5 A;  1LBW A;  2WBD A;  1FPI A;  2V3Q A;  4GX4 A;  4P56 A;  2BJI A;  5EQ9 A;  2WEF A;  2QVR A;  4MNP A;  2L5V A;  2FBP A;  1FBE A;  4HE1 A;  4NN3 A;  1FRP A;  1IMD A;  3KBZ A;  1NV1 A;  2QFL A;  4N8G A;  3ISP A;  1RDZ A;  1FPE A;  2FVZ A;  4N6D A;  5LTC A;  2FHY A;  1FPD A;  1DBZ A;  5IZ3 A;  4NQ8 A;  2CEX A;  5I5P A;  4N4U A;  3RPL B;  2HXR A;  1FPF A;  4MHF A;  1NV0 A;  3B50 A;  1FBP A;  4MNC A;  4JVD A;  3LV0 A;  4GWY A;  4PFR A;  4PE3 A;  4UAB A;  4GWW A;  1NV2 A;  1IMA A;  1KZ8 A;  5EYG A;  1KA0 A;  4P3L A;  4HCW A;  2CZI A;  1IMB A;  1IMF A;  1FSA A;  5IZ1 A;  2XWO A;  4G61 A;  4PCD A;  5DW8 A;  4MCO A;  5LDZ A;  1NI9 A;  3LUZ A;  4JVI A;  4XF5 A;  1LEV A;  4OAN A;  2XXK A;  4GWU A;  5F24 A;  1NV3 A;  3NOH A;  4NGU A;  4PFI A;  4O7M A;  2F5X A;  1RDY A;  2VPN A;  3EKI A;  2Y5L A;  1K9Y A;  3QMF A;  1CNQ A;  4F1V A;  1YZ0 A;  1SPI A;  2B4L A;  5ESY A;  1NUX A;  4PFB A;  4X8R A;  2WBB A;  1LBX A;  4X04 A;  4PC9 A;  4X9T A;  1LBV A;  2VPO A;  1INP A;  5IM2 A;  4O94 A;  1FBD A;  2XA5 A;  4PDH A;  2WX9 A;  2QPQ A;  2DE4 A;  4P1E A;  2HZL A;  4PAF A;  4GBW A;  4IR8 A;  2Y5K A;  4NX1 A;  1IMC A;  4PET A;  4I3E A;  2XWV A;  4P8B A;  2HZK A;  2CEY A;  1DCU A;  3BIG A;  2GQ1 A;  5IZ3 B;  5FBP A;  4NAP A;  4GWX A;  4FBP A;  4F1U A;  2FIE A;  5J16 A;  5ET6 A;  4PGN A;  3RYD A;  4HCY A;  4XFE A;  4PAK A;  3HFU A;  4OVR A;  1Q9D A;  1DK4 A;  1FTA A;  5IGA A;  4OVT A;  1NUZ A;  2OX3 A;  4GWS A;  5EQ7 A;  5I7I A;  4H45 A;  1G0H A;  3IFA A;  2V4C A;  3E79 A;  5ET5 A;  1EYI A;  1FBH A;  4NG7 A;  4N6K A;  1D9Q A;  1LBY A;  1NV7 A;  4MMP A;  5I3S A;  2DE2 A;  1QGX A;  1NV5 A;  1NV6 A;  4I3Y A;  5JK4 A;  4MJO A;  4NHB A;  4HE2 A;  1EYJ A;  4P47 A;  5CM6 A;  4P1L A;  2WYK A;  4DI3 D;  4PTK A;  4PBQ A;  2B4M A;  2DDK A;  5IZZ A;  2ZZW A;  3GYY A;  4OA4 A;  1FBC A;  4NF0 A;  3SZP A;  4PAI A;  1NV4 A;  4GWZ A;  3KC1 A;  1G0I A;  1EYK A;  2WYP A;  4GBV A;  2KR0 A;  4DI4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...