4I3EA

Crystal structure of staphylococcal impase - i complexed with products.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
262
structure length
259
Chain Sequence
b'KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of Staphylococcal IMPase - I complexed with products.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 67
structure length 259
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i3eA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i3eA02
2Q74A 1IMCA 5DW8A 2VT5A 1FPFA 4IR8A 5EYGA 3D1RA 4GWUA 3B8BA 5ET6A 5IZ1A 1FPLA 3T0JA 5J16A 1DBZA 2F3BA 1FPJA 1CNQA 1FBPA 1K9YA 2QVVA 1NUZA 2Y5LA 1YZ0A 5F24A 3RYDA 1G0HA 2WEFA 2CZKA 4GWSA 1XI6A 5I3SA 1FBHA 1LBWA 1D9QA 1K9ZA 1LBVA 1SPIA 3IFAA 5A5LA 2BJIA 1NI9A 3BIGA 4HE2A 1KZ8A 2FBPA 5ET8A 5ESYA 1FTAA 1FPDA 1VDWA 5EYHA 1AWBA 1LBXA 1DCUA 1RDZA 2PCRA 4HE0A 1NUXA 1RDXA 2QVRA 2Q8MA 4GWZA 4HE1A 1FPEA 1LBZA 1EYIA 4I3EA 1NV2A 4GBVA 1FPKA 4MJOA 2Y5KA 4G61A 4O7IA 4GX6A 1RDYA 4HXVA 1KA1A 4I40A 1NV7A 4H46A 1IMAA 4GWWA 1NUYA 2FHYA 2QVUA 1IMBA 1FBGA 2JJKA 1FPGA 1INPA 4KXPA 1FPIA 1FRPA 1NV3A 4QXDA 3IFCA 2FIEA 5IZ3A 2CZIA 2HHMA 1FJ9A 2P3VA 2WBBA 2QFLA 2P3NA 4GX4A 2OX3A 1IMEA 1YXIA 5ET7A 5IZ3B 3KC0A 5EQ9A 5ET5A 1EYJA 3RPLA 1FPBA 1NV4A 3FBPA 1Q9DA 5T3JA 1QGXA 3LUZA 1FBDA 1NV5A 3BIHA 2R8TA 1NUWA 3RPLB 2FIXA 4N81A 1LEVA 4AS5A 5EQ8A 2GQ1A 5FBPA 1BK4A 5LDZA 1FBFA 2FVZA 2WBDA 2CZHA 3LV0A 4AS4A 3QMFA 1FSAA 1IMFA 4GBWA 1LBYA 5EQAA 4FBPA 1EYKA 1FBEA 3KBZA 1NV0A 1NV1A 1DK4A 1KA0A 1NV6A 2OWZA 3ROJA 1JP4A 2DDKA 5EQ7A 1IMDA 3KC1A 4GX3A 4I3YA 1G0IA 1FBCA 4PTKA 3A29A 2F3DA 1YYZA 4GWXA 1FJ6A 4GWYA 4H45A
chains in the Genus database with same CATH superfamily
3I3VA 3BFUA 4IO3A 1KWHA 3SETA 2O68A 4GWUA 5EHSA 3C33A 1N3XA 3W9VA 5IKBA 3O97A 4ZEDA 1YZ0A 5ISUA 4PBQA 4FORA 1H76A 3MVXA 2D21A 2Y7IA 3SZPA 2FYIA 1NI9A 3ZKKA 2XA5A 4DIGA 3M3KA 2OK2A 3CFXA 1R9LA 4U23A 4ND9A 2ZZWA 1IXIA 4GWZA 3O29A 1FCKA 1LB9A 4U4XA 4NTLA 2Y5KA 1OQGA 2O84X 1Q1KA 3RQTA 2F7AA 4OETA 1MDP1 3KN8A 4ZEBA 4NN3A 5KZTA 4DXCA 4KYSA 2F6PA 5CMMA 2PYYA 4IB2A 2Y84A 3MSTA 2NOOA 3TCFA 3U65A 3Q29A 3C32A 4EQ9A 4G68C 2O6AA 1ANFA 1RYOA 1NFTA 1WVJA 2ESNA 1D9YA 1VE4A 2CZHA 2XX7A 3RNNA 4K3FA 4NF8A 3FXBA 4P0GA 1JETA 4XFEA 4EXKA 4YB5A 1SI1A 4TLMB 5EHMA 3Q27A 1PB8A 3WAFA 5TPAB 1T0KA 1FBCA 3QAXA 3A29A 1YCJA 3K6XA 3VV5A 2VT5A 4H67A 2XXKA 4O7MA 5CMCA 3N6TA 4OVTA 1FPLA 5I59B 2OZZA 1K9YA 4P3LA 3Q25A 5L8DA 4ELQA 1IXHA 4GWSA 4GLIA 5B70A 4QBAA 2F8DA 4LP2B 4DI4B 4KYEA 5JTYB 1ZMGA 5CC2A 1AWBA 3Q26A 3K00A 1D4NA 1MRPA 1N7WA 1FPEA 3IOUA 4LZ8A 3Q28A 1RKMA 3U1OA 1IMAA 3EHTA 1IMBA 2REGA 1Z7ME 2HAVA 1NV3A 4QXDA 5H8HB 5IZ3A 1NNKA 2VP1A 3USDA 3DP8A 5CMKA 4F1UA 4DDDA 4ELOA 4H1XA 1YTVA 4P9KA 1Q9DA 4BLAA 1I69A 4PFTA 1FQBA 1I6BA 2UVJA 4ZEIA 2DSFA 1P1UA 3MPLA 4N6DA 4HTGA 2QJEA 5KDTA 2QRYA 5DEXB 1BTJA 1FBEA 1MXVA 2VGQA 4P11A 2XXQA 4Q8RA 5EQ7A 5BUUA 3KFMA 4LATA 4GL8A 1QJMA 2GHAA 2B65A 3OO6A 2XXTA 1IMCA 4PGPA 3H6WA 4BDQA 4UABA 3H6TA 3GBAA 1MPDA 4DXBA 3CI8A 1B9JA 2G29A 1NNPA 1URSA 2Y7WA 4O3CA 1M5DA 1XHYA 1XI6A 3IOVA 3PUZE 3BFTA 2ZYMA 1IUDA 2HQ0A 3GZGA 1MY0A 4QF9A 1RDZA 5J1DA 4KR5A 2AIXA 3DLNA 1EYIA 4RK9A 3CFLA 2HCAA 2WYKA 3VE1B 4QSCA 4MAGA 4I1DA 2HAUA 4NX1A 1JW1A 4PFRA 1LAHE 2JJKA 4KCDA 3CR9A 2FNCA 2I0BA 4P47A 3V89B 4G8HA 4C1UA 3A3UA 4JWOA 1USYE 2P0SA 4M1VA 2HHMA 1B7ZA 2HZKA 2OLBA 3MZ9A 4RYAA 4NHBA 2IA4A 3EHSA 1F9BA 4GXAA 3BKIB 1AIVA 5HM4B 2Q8JA 2AL5A 4R9FA 3IO4A 4X1BA 3LUYA 5FBPA 2FVZA 4NWDA 1JVXA 1DK4A 1SW1A 4KQPA 4JBZA 1Y1ZA 2XXXA 3O6HA 3PUWE 2H98A 1IQ7A 4PDDA 2VPOA 3GXAA 2Z8EA 3FVKA 4F3GA 1B0HA 5ET6A 1II5A 4YKKA 2PBWA 4H5GA 2PFYA 2QMXA 4OFOA 1MH3A 4P0IA 3EN3A 3MUQA 1SYIA 3C36A 1FBHA 3HFUA 5H8FA 5ET8A 4G77A 4I9DA 2DWHA 4YMAA 4NMYA 4TQUQ 4GWOA 2AL4A 2DYXA 3L6HA 3S2VA 3W9WA 3LR1A 1OVBA 2YJPA 3W15C 3MVWA 4JVDA 4P56A 3KN3A 4JXIA 2ZZVA 3S9MC 4RY1A 3IFCA 3UP9A 2CZIA 4X9TA 4H5FA 4NQ8A 1TFDA 3K1PA 2H9BA 5ICTA 5IGAA 3THIA 1IMEA 3PU5A 4QRZA 3CG3A 1EYJA 5CBSA 3QXMA 2VD2A 4YMBA 3BIHA 2R8TA 1M5EA 4PC9A 3FUZA 4N91A 4F3SA 1LAGE 3MP6A 3TTMA 3H7MA 1HSJA 3SEYA 3SEXA 3G3IA 2DDKA 3BBRA 3V83A 3ECRA 5AA4B 4KYDA 1DMBA 2Q74A 3LC8A 2PFZA 1FPFA 2D3IA 5FTHA 2XXYA 3D1RA 2XXHA 3PTYA 3PPNA 4AB6A 3C31A 4LN5A 3T93B 3TEPA 2QVVA 1LCTA 1MY1A 1MQHA 3RT8A 1FTLA 2RKMA 1FW0A 4PE3A 1SPIA 5L9SA 5ESYA 3IJOB 2GHBA 4N07A 3L6GA 4MHFA 3PPPA 3MZ1A 1LBXA 1DCUA 2PCRA 3K02A 3M8UA 4HE1A 2WKYA 3I5OA 4I3EA 4TOZA 1JEUA 4EDPA 2O1LA 2YPNA 2DE4A 5H8SA 1SYHA 3I6VA 4XIGQ 4MNPA 2VD3A 2HXWA 2X7PA 1B3HA 3VXBA 4IGRA 3G3HA 4HCWA 2R71A 4JWXA 4MH5A 5I56A 1US5A 4FAJA 4QFPA 4EF2A 3E4RA 3H6VA 2E1SA 1Y3QA 4QFKA 5HPQA 2Q88A 3MAMA 1MS7A 3OO7A 3LUZA 2OWTA 2VPNA 4O3AA 4Q0CA 3MC2A 2A5SA 3D4CA 1B4HA 4OERA 1DTZA 2NVUB 5EQ8A 3KJ7A 1ATGA 4OVJA 3IOWA 4H8IA 1EZOA 3KBZA 4X8RA 3D4GA 4N4UA 3TAJA 1OLCA 4UACA 4Q30B 3OSRA 1JW4A 4QHQA 4EF1A 3FV2A 2OPDA 2ABHA 4N6PA 1BLFA 1FQFA 1P1NA 1BP5A 4IY5A 2KR0A 4DCXA 1PDAA 2AYSA 4YKJA 1NMUA 2DXYA 2B3BA 4BDNA 3K01A 1MXZA 2H5YA 3U94A 1ZTYA 2QS2A 4N15A 2F6GA 3GLBA 4F3PA 1JEVA 2F7CA 2RINA 3CVGA 3IOTA 4EQ7A 4O94A 3U8QA 1SW2A 1MPBA 2A5TA 5AA3A 3H03A 1DSNA 1FPKA 4MJOA 1MM7A 5H8QA 1M5FA 4MF3A 1KA1A 4I40A 3OD7A 2WYPA 5JEIA 4NF4A 2I48A 5A5XA 5TP9A 4KXPA 1FPIA 3G3FA 3UORA 4YKPA 1TXFA 4F2OA 4KFQA 4OZ9A 5IZ3B 4NF5A 3VVDA 2KQZA 4DI3D 5T3JA 3OELA 4PFIA 4Z0IA 4N81A 4RA1A 1UQWA 5I84A 4AS4A 1UTBB 4NWCA 4H0WA 3RLFE 1KA0A 1S9TA 2UYFA 1M5BA 5KCJB 3OSQA 3FV1A 4GX3A 3N94A 1XVYA 3RPWA 4GWXA 2GH9A 3CRBA 5DW8A 3IAZA 4MMPA 5I58A 4F39A 2DE2A 3B8BA 4FEDA 4YKIA 1I6QA 4GFRA 1O7TA 1DBZA 3MQ9A 2ZYOA 5AE4A 4QFNA 4PQJA 2WEFA 3K6WA 1LBWA 2DVZA 2DVCA 1QUJA 1IIWA 3IB1A 4MEVA 4FJPA 2O51A 5L9OA 1ZIUA 4NGUA 2NUVA 2Y7RA 4HE0A 3FD3A 4RPOA 3TCHA 4M4GA 4YAHX 1GTKA 1QUIA 5CM6A 2FHYA 1IITA 3ILUB 3LSFB 3F11A 1FPGA 2CMOA 1B4ZA 3UA8A 4WEDA 2ONSA 3OEKA 3TODA 3UIFA 3DM0A 4XKRA 3O2AA 4NAPA 5JK4A 4G68A 1MY2A 4PE5B 1B1HA 4POWA 4I8CA 4POXA 4PAIA 2H99A 1NV5A 1NUWA 5BWJA 3A3CA 5I2KB 3IB0A 5ELVA 3C35A 4EXLA 1QW0A 1XT8A 2WBDA 3TFLA 3P7IA 3IR1A 1Z7NE 1LBYA 3EPEA 4NG7A 1NV1A 1Y4TA 4NF6B 1P1QA 1ZKBA 4L17A 3CHGA 4LQ2A 1FTOA 3QK6A 4WEPA 3G3JA 2F35A 3SEWA 2OWSA 1MXXA 2ZNSA 1H44A 2LAOA 3SEVA 1NUZA 2KLFA 2O7IA 2OPEA 2XWVA 3MP1A 3RUMA 1D9QA 2GRVA 3IFAA 2B3FA 1LCFA 2QMWA 3FVGA 4G8NA 4XF5A 3OO9A 4EQBA 4GRKA 3R6UA 1SW5A 5H8FB 4ZE8A 3TUSA 4R9GA 1R9QA 5CMBA 2Y7KA 3LSXA 5AA1A 1CB6A 2Q2CA 1B3FA 3H3GA 3H4ZA 1INPA 1Y9UA 5IM2A 1AH5A 4OWDA 1NL5A 3VVFA 4GD5A 4ZZEA 5I57B 1FJ9A 4ONYA 2P3VA 1GVCA 1B3LA 5TPAA 3VLVA 1MQGA 3RPLA 1FPBA 1B58A 3UN6A 2I49A 3KN7A 4F19A 5I59A 3ODBA 3OO8A 2VOZA 2XWKA 3HV1A 3TTNA 4N17A 1FSAA 1AL3A 3TDJA 3CSBA 2DOJA 5JTYA 2X7QA 2CZLA 1DTGA 3V5AA 4ZECA 1QULA 2F3DA 4AB5A 5H8NA 4OXVA 1Q35A 2QS3A 3PPQA 5EYGA 1MQJA 3JYRA 2QS4A 5IZ1A 3CG1A 1ELJA 2I0CA 4IO7A 4MLQA 2Y5LA 5F24A 4HS7A 5AA2D 2CZKA 3VFJA 2R9JA 3KOTA 4XEQA 5H8HA 1A99A 1B6HA 4JVCA 3RTFB 3T9XB 5A5LA 1US4A 2ONKE 1LAFE 1D9VA 1O63A 1N7XA 5AA2B 5I2NB 2W7YA 1EU8A 2RCAA 4FE8A 4BDMA 3PMWA 4G2ZA 1P99A 3TTRA 2D5WA 4F18A 1UTHB 2PT1A 3RT6B 5CRYA 4IY6A 3O66A 4QFOA 4U21A 1FBGA 3H6UA 3K6UA 4NE4A 3RN8A 3WAEA 3R26A 1Y1MA 5DEXA 2BJJX 1URGA 2H4IA 1MQDA 4OVQA 1FTMA 4HW8A 1ZLQA 2QFLA 2XD3A 5EQ9A 2ZXTA 3T9VA 5I56B 2I3VA 3IB2A 2F5XA 1S7YA 1MG1A 4OENA 1LFIA 4AS5A 3B6WA 3HO7A 1TT1A 2O1MA 4N6KA 2E0SA 3S9LC 3G3KA 4KPTA 4GIZA 4O3BA 4KI0E 2F34A 1UIVA 1EZPA 5IAIA 4MBPA 3TZAA 1LFGA 1NH7A 1N3WA 4C1TA 3UK4A 3ZSFA 1R6ZA 4XKQA 1SQYA 2CEYA 2V3TA 1DPEA 4BDLA 2I4BA 1FBPA 4IO6A 3C34A 1AOVA 3SESA 3RYDA 4E0XA 1VSOA 3HCQA 2UXAA 3KSJA 4PDHA 4R73A 4ZEFA 3LBSA 1KZ8A 4FIMA 3EF7A 4XKNA 3KBRA 1TWYA 1NUXA 4OHNA 1B40A 1LBZA 4U22A 2V3QA 5DVJA 4LZ5A 2XHDA 4GWWA 5CBRA 5H8QB 2DP8A 2ZZXA 3DP6A 3IX1A 2XXUA 2R6GE 4XKPA 2ZNTA 4NF4B 1J1NA 2FIEA 5TP9B 2DS9A 4RPNA 3PD8A 4H8JA 2X26A 3FASA 5LOMA 3IL1B 1B3EA 3QYTA 4KD5A 4BDRA 4G8MA 4JB7A 3SEUA 5F1QA 3KGCA 3KJTA 1DPPA 1BK4A 4PAKA 1PB7A 2ALUA 1A7LA 3QMFA 4WXJA 1B32A 4ESWA 3HPIA 3HSTA 4I3YA 1QVSA 4OVRA 4DLDA 1NNFA 1N0TA 2XXWA 5B7DA 2HFBA 1Y4CA 3OENA 3FJ7A 3K1MA 4OVSA 2XXVA 2XXIA 4F22A 2F3BA 1ZU0A 1FPJA 2G93A 1CNQA 2RF1A 2XWOA 4LA9A 4N13A 4NF8B 1MXYA 1IXGA 4F1YA 1SD3A 3B6QA 1PEBA 3JV9A 4JDFA 4LQ5A 5EYHA 3QUJA 3AXFA 5L9MA 1RDXA 2QVRA 4OFJA 5EYFA 2DE3A 3MWBA 1VFDA 1WODA 1NUYA 2F36A 1H3DA 4R2FA 2Y7PA 1USYH 3LSLA 5ICQA 3CSGA 1FRPA 3T9UA 4DZ1A 1B52A 1SW4A 4OQOA 2F78A 2P3NA 4QSEA 4R72A 5ET7A 1VFEA 4Z7EA 2RC7A 3TQLA 5AA4A 3T1BA 1NKXA 4PCDA 1FBDA 4OTEA 4G68B 4RJZA 2B4LA 4FEBA 1ZJLA 3U92A 2RCBA 3B50A 3K0VA 2I6EA 4QSDA 1B2HA 2HEUA 4OEUA 2QL3A 2ZYKA 1I6AA 1POY1 1NV6A 4WKMA 3ROJA 5F7VA 5M2VA 3M3LA 4ZZAA 4GWYA 3K6VA 1MXUA 4OESA 4MCOA 3N5LA 1OIBA 1EZ9A 3OEMA 4YB7A 4PFWA 1N04A 4OANA 3RY3A 2QPQA 2DWJA 1N76A 4PFBA 1JVYA 1PBPA 3IORA 2MKZA 1JNFA 5KDTB 3N26A 3PUYE 4JSDA 1BKAA 4YB6A 1FTAA 1EH3A 3T66A 1FPDA 1B51A 3UGWA 3SKPA 4MNCA 4O8MA 4OMBA 3VLUA 3VXCA 1IEJA 3QUFA 4O7IA 3OMBA 3O9PA 2RC9A 3PPOA 3OXNA 1NV7A 1LFHA 1QKBA 3NOHA 1FQAA 2Q2AA 4ZS9A 4JVIA 4LVQA 5LTCA 3KC0A 5ET5A 2QSXA 4MX6A 3FATA 3C4MA 2Q89A 1QGXA 3SERA 4ZEKA 3RPLB 2V93A 1DOTA 3PUVE 1XVXA 2I58A 2XX8A 3E78A 4JWYA 1LEVA 4PFYA 1JW5A 3K2DA 5TU0A 3FGSA 2P1SA 3S4UA 3DP4A 3EKIA 4OYVA 5EQAA 4FBPA 1GGGA 1H43A 2OBGA 4YZZA 4PGNA 2B4MA 3KC1A 3TTKA 1G0IA 4PTKA 1UIUA 2IEEA 1TFAA 4IR8A 5I7IA 3FZVA 2Z8FA 5H8NB 1YAEA 2Z22A 2V25A 4DE8A 2ONRA 4LUBA 3MYUA 1B5JA 2XXRA 4KCCA 3EHUA 2DQVA 2PX1A 3PPRA 4PAFA 2XWIA 1K9ZA 1LBVA 4E0WA 2BJIA 1H45A 3TELA 4GOTA 4PFUA 2FBPA 1MDQA 3PMXA 3TYHA 4ISUA 2VHAA 4RXLA 4DXUA 2Q8MA 1B7HA 4N8GA 2V84A 1NV2A 3LSWA 4GX6A 1RDYA 4R6KA 3RGYA 3M3FA 2YLNA 3FXUA 2REJA 1UTBA 3VLWA 1YPNA 1O64A 2I3WA 2O69A 1Y3PA 2F97A 1A8EA 3T9HB 2HPGA 5KCJA 3TMGA 3DELB 3O28A 1JQFA 4RNSA 3KZGA 1MQIA 4XTCQ 4IO4A 4P1EA 5DTBA 2FIXA 2Q9TA 3ZS6A 4MNIA 4PF8A 4RK2A 1R1NA 1FQCA 5ITPA 1Y3NA 4GXSB 1BIYA 1IMFA 4GBWA 4MLVA 3K1NA 1EYKA 3TPAA 1B7UA 1LSTA 1B5HA 2Z23A 4N8YA 3R7XA 1IXCA 2ZYNA 1XS5A 3TQWA 4X48A 3MVYA 1QKAA 1A55A 2UVHA 1HSLA 4F29A 2UVIA 3T96B 4X04A 3T0JA 2XXPA 3TKDA 4THIA 2UYEA 2ZNUA 3KSXA 1G0HA 3HN0A 4MIJA 1B1XA 4HE2A 5I5PA 3U72A 3FJGA 1MY4A 4OFLA 4HCYA 2H25A 3E13X 1MXWA 4FATA 4JSOA 3HHFA 1SVXB 3T22A 4P1LA 4G61A 1URDA 4R75A 3U93A 3O6GA 5I2KA 4HXVA 4QFLA 2XD2A 1HSEA 4ZDMA 2QVUA 3TCGA 3MP8A 4I62A 1VR5A 3SDFA 1P1OA 1N84A 1SI0A 2Z8DA 4TLLB 3EQ1A 2WBBA 4NF6A 3MVZA 4OVPA 1B46A 4P8BA 3CFZA 2OJTA 1MY3A 3FBPA 2PVUA 2I4CA 3ZKLA 4H65A 3MZBA 2ANJA 4PETA 4ELRA 2DWAA 3VVEA 1WDNA 1A40A 4AQ4A 2GQ1A 1FTJA 2RC8A 4F31B 1ZBMA 4U4SA 2XX9A 1L5TA 5DYHA 3QIMA 3IJXB 1OLAA 3K4UA 1NNTA 2OWZA 3PUXE 4R2BA 1IMDA 5DT6A 4PBHA 1MM6A 4ECFA 1XOCA 3MJNA 4LZ7A 3MPKA 1A8FA 3OOAA 2THIA 1S50A 1NH8A 1P1WA 5I3SA 4R6YA 4ESXA 5DVIA 3B6TA 1LBCA 1LLSA 1B05A 4R74A 5I57A 3PV0E 1B3GA 5ITOA 1PBQA 1XC1A 4ZE9A 1LGBC 4GL0A 4GF8A 3TTLA 4GBVA 1LBBA 2DWIA 3FVNA 4H46A 3ONMA 4DCYA 4U1ZA 3GBBA 3C9HA 4IGTA 2ZMBA 2NXOA 3S9NC 1M5CA 4GX4A 1NV4A 4U1OA 5FHNA 3FXRA 2V3UA 2A5TB 4G4PA 4C0RA 2O7UA 1D3KA 1FTKA 2PT2A 4OA4A 4UA8A 4F2QA 5A5XB 4YICA 4PP0A 3G7WA 3LV0A 4NEDA 1B5IA 3FVOA 1QUKA 1SBPA 4FECA 3A09A 1JP4A 5AA2A 5I2NA 2WX9A 4NF5B 3S9EA 2FA7A 3GYYA 5K2YA 3VDFA 2NWJA 4H45A 1RYXA 5FHMA 1Y20A 1UTHA 1CE2A 1IZ1A 2F7BA 1PB9A 5HBCA 3IK6B 3MW0A 3PGFA 3PMVA 4OEVA 3IO6A 3E79A 3E3KA 4Q5TA 5J16A 4LONB 2L5VA 1PC3A 4R6HA 2CEXA 3FXQA 3RTWB 3HHGA 1GR2A 4F3BA 3BIGA 4EUOA 1FQDA 3KOSA 2V4CA 4YU0A 1B0LA 3O6IA 1VDWA 4GVOA 4MFIA 1LB8A 4X1DA 5I58B 2PMSA 5FTIA 1MPCA 3KG2A 1GV8A 1OQHA 1LAXA 3H06B 1AMFA 4NF0A 3FJMA 5DVFA 2QS1A 2M8CA 1POTA 4IO5A 1MH4A 4U2RA 3FIRA 3PD9A 2HZLA 2OX3A 1OVTA 1YXIA 2GFEA 3V8XB 2HXRA 2OCUA 3E9XA 4IO2A 3ISPA 4KHZE 1SDXA 5IZZA 4PF6A 3KEIA 4GQOA 2UVGA 3JZJA 2P2AA 5LDZA 4BDOA 1FBFA 1A54A 3CIJA 5FHOA 1OMPA 5K2XA 2DXRA 3B7DA 1NV0A 1FQEA 4H6DA 3QSLA 3ILTB 4XXUA 4ELPA 4F1VA 3G3GA 5CI5A 3N6UA 1YYZA 1FJ6A 3MBPA
chains in the Genus database with same CATH topology
2Q74A 2PFZA 1FPFA 4IR8A 5EYGA 5I7IA 3D1RA 4GWUA 3PTYA 5IZ1A 4LN5A 3W9VA 3MYUA 2QVVA 2Y5LA 1YZ0A 4PBQA 5F24A 2CZKA 4PAFA 4XEQA 2XWIA 1K9ZA 1LBVA 4PE3A 1SPIA 4JVCA 5A5LA 2BJIA 3SZPA 1NI9A 2FBPA 2XA5A 5ESYA 4MHFA 1LBXA 1DCUA 2PCRA 2Q8MA 2ZZWA 4F18A 4GWZA 4HE1A 4N8GA 4I3EA 1NV2A 2Y5KA 4GX6A 1RDYA 2DE4A 1FBGA 4MNPA 4NN3A 4OVQA 4HCWA 2HPGA 2QFLA 3MSTA 5EQ9A 3U65A 3LUZA 2VPNA 2F5XA 4P1EA 2FIXA 2Q9TA 4AS5A 4MNIA 4PF8A 5EQ8A 4N6KA 2CZHA 1IMFA 4GBWA 3FXBA 4XFEA 1EYKA 3KBZA 4X8RA 4N8YA 4N4UA 1FBCA 3A29A 2VT5A 2XXKA 4O7MA 2CEYA 4OVTA 4X04A 2KR0A 1FPLA 3T0JA 1FBPA 1K9YA 4P3LA 3RYDA 1G0HA 4GWSA 4PDHA 4QBAA 4MIJA 4DI4B 4HE2A 4N15A 5I5PA 1KZ8A 4HCYA 1AWBA 1NUXA 4O94A 4P1LA 1FPEA 1LBZA 2V3QA 1FPKA 4MJOA 4G61A 4HXVA 1KA1A 4I40A 1IMAA 2WYPA 4GWWA 2QVUA 1IMBA 2ZZXA 4KXPA 1FPIA 1NV3A 4QXDA 2FIEA 5IZ3A 2WBBA 5IZ3B 4OVPA 4P8BA 4F1UA 4P9KA 2KQZA 3FBPA 1Q9DA 5T3JA 4DI3D 4PFIA 4PETA 4N81A 2GQ1A 1BK4A 4PAKA 4N6DA 4AS4A 3QMFA 1FBEA 1KA0A 2OWZA 5EQ7A 1IMDA 4OVRA 4GX3A 4I3YA 4PBHA 4GWXA 1IMCA 5DW8A 4PGPA 4MMPA 4OVSA 4UABA 2DE2A 3B8BA 1DBZA 2F3BA 1FPJA 2XWOA 1CNQA 2WEFA 5I3SA 1XI6A 1LBWA 2DVZA 4MEVA 5EYHA 4NGUA 5J1DA 1RDZA 4HE0A 1RDXA 2QVRA 1EYIA 4GBVA 2DE3A 2WYKA 4MAGA 4H46A 5CM6A 4NX1A 4PFRA 1NUYA 2FHYA 2JJKA 1FPGA 4P47A 1FRPA 4M1VA 2HHMA 2HZKA 4NAPA 4NHBA 5JK4A 2P3NA 4GX4A 5ET7A 1NV4A 3T1BA 4PCDA 4PAIA 1FBDA 1NV5A 1NUWA 2B4LA 4OA4A 5FBPA 3B50A 4YICA 2FVZA 2WBDA 3LV0A 1LBYA 4NG7A 1NV1A 1DK4A 1NV6A 3ROJA 1JP4A 2WX9A 3GYYA 4PDDA 2VPOA 4GWYA 4H45A 3CHGA 4MCOA 3E79A 5ET6A 4OANA 5J16A 2QPQA 2PFYA 4PFBA 1NUZA 2MKZA 2L5VA 2XWVA 1FBHA 1D9QA 2CEXA 3IFAA 3HFUA 3BIGA 5ET8A 2V4CA 1FTAA 1FPDA 1VDWA 4XF5A 4MNCA 4O8MA 4O7IA 1NV7A 3W9WA 3NOHA 4JVDA 4P56A 1INPA 2ZZVA 5IM2A 4NF0A 3IFCA 2CZIA 4X9TA 4NQ8A 1FJ9A 4JVIA 5IGAA 2P3VA 2HZLA 2OX3A 5LTCA 1IMEA 1YXIA 3KC0A 5ET5A 2HXRA 1EYJA 3RPLA 1FPBA 4MX6A 3ISPA 1QGXA 5IZZA 4PF6A 3BIHA 2R8TA 3RPLB 3E78A 1LEVA 4F19A 4PC9A 4N91A 2XWKA 5LDZA 1FBFA 4N17A 3EKIA 1FSAA 5EQAA 4FBPA 1NV0A 4YZZA 4PGNA 2DDKA 2B4MA 4F1VA 3KC1A 1G0IA 4PTKA 2F3DA 1YYZA 1FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q74 A;  1IMC A;  5DW8 A;  2VT5 A;  1FPF A;  4IR8 A;  5EYG A;  3D1R A;  4GWU A;  3B8B A;  5ET6 A;  5IZ1 A;  1FPL A;  3T0J A;  5J16 A;  1DBZ A;  2F3B A;  1FPJ A;  1CNQ A;  1FBP A;  1K9Y A;  2QVV A;  1NUZ A;  2Y5L A;  1YZ0 A;  5F24 A;  3RYD A;  1G0H A;  2WEF A;  2CZK A;  4GWS A;  1XI6 A;  5I3S A;  1FBH A;  1LBW A;  1D9Q A;  1K9Z A;  1LBV A;  1SPI A;  3IFA A;  5A5L A;  2BJI A;  1NI9 A;  3BIG A;  4HE2 A;  1KZ8 A;  2FBP A;  5ET8 A;  5ESY A;  1FTA A;  1FPD A;  1VDW A;  5EYH A;  1AWB A;  1LBX A;  1DCU A;  1RDZ A;  2PCR A;  4HE0 A;  1NUX A;  1RDX A;  2QVR A;  2Q8M A;  4GWZ A;  4HE1 A;  1FPE A;  1LBZ A;  1EYI A;  4I3E A;  1NV2 A;  4GBV A;  1FPK A;  4MJO A;  2Y5K A;  4G61 A;  4O7I A;  4GX6 A;  1RDY A;  4HXV A;  1KA1 A;  4I40 A;  1NV7 A;  4H46 A;  1IMA A;  4GWW A;  1NUY A;  2FHY A;  2QVU A;  1IMB A;  1FBG A;  2JJK A;  1FPG A;  1INP A;  4KXP A;  1FPI A;  1FRP A;  1NV3 A;  4QXD A;  3IFC A;  2FIE A;  5IZ3 A;  2CZI A;  2HHM A;  1FJ9 A;  2P3V A;  2WBB A;  2QFL A;  2P3N A;  4GX4 A;  2OX3 A;  1IME A;  1YXI A;  5ET7 A;  5IZ3 B;  3KC0 A;  5EQ9 A;  5ET5 A;  1EYJ A;  3RPL A;  1FPB A;  1NV4 A;  3FBP A;  1Q9D A;  5T3J A;  1QGX A;  3LUZ A;  1FBD A;  1NV5 A;  3BIH A;  2R8T A;  1NUW A;  3RPL B;  2FIX A;  4N81 A;  1LEV A;  4AS5 A;  5EQ8 A;  2GQ1 A;  5FBP A;  1BK4 A;  5LDZ A;  1FBF A;  2FVZ A;  2WBD A;  2CZH A;  3LV0 A;  4AS4 A;  3QMF A;  1FSA A;  1IMF A;  4GBW A;  1LBY A;  5EQA A;  4FBP A;  1EYK A;  1FBE A;  3KBZ A;  1NV0 A;  1NV1 A;  1DK4 A;  1KA0 A;  1NV6 A;  2OWZ A;  3ROJ A;  1JP4 A;  2DDK A;  5EQ7 A;  1IMD A;  3KC1 A;  4GX3 A;  4I3Y A;  1G0I A;  1FBC A;  4PTK A;  3A29 A;  2F3D A;  1YYZ A;  4GWX A;  1FJ6 A;  4GWY A;  4H45 A; 
#chains in the Genus database with same CATH topology
 3I3V A;  3BFU A;  4IO3 A;  1KWH A;  3SET A;  2O68 A;  4GWU A;  5EHS A;  3C33 A;  1N3X A;  3W9V A;  5IKB A;  3O97 A;  4ZED A;  1YZ0 A;  5ISU A;  4PBQ A;  4FOR A;  1H76 A;  3MVX A;  2D21 A;  2Y7I A;  3SZP A;  2FYI A;  1NI9 A;  3ZKK A;  2XA5 A;  4DIG A;  3M3K A;  2OK2 A;  3CFX A;  1R9L A;  4U23 A;  4ND9 A;  2ZZW A;  1IXI A;  4GWZ A;  3O29 A;  1FCK A;  1LB9 A;  4U4X A;  4NTL A;  2Y5K A;  1OQG A;  2O84 X;  1Q1K A;  3RQT A;  2F7A A;  4OET A;  1MDP 1;  3KN8 A;  4ZEB A;  4NN3 A;  5KZT A;  4DXC A;  4KYS A;  2F6P A;  5CMM A;  2PYY A;  4IB2 A;  2Y84 A;  3MST A;  2NOO A;  3TCF A;  3U65 A;  3Q29 A;  3C32 A;  4EQ9 A;  4G68 C;  2O6A A;  1ANF A;  1RYO A;  1NFT A;  1WVJ A;  2ESN A;  1D9Y A;  1VE4 A;  2CZH A;  2XX7 A;  3RNN A;  4K3F A;  4NF8 A;  3FXB A;  4P0G A;  1JET A;  4XFE A;  4EXK A;  4YB5 A;  1SI1 A;  4TLM B;  5EHM A;  3Q27 A;  1PB8 A;  3WAF A;  5TPA B;  1T0K A;  1FBC A;  3QAX A;  3A29 A;  1YCJ A;  3K6X A;  3VV5 A;  2VT5 A;  4H67 A;  2XXK A;  4O7M A;  5CMC A;  3N6T A;  4OVT A;  1FPL A;  5I59 B;  2OZZ A;  1K9Y A;  4P3L A;  3Q25 A;  5L8D A;  4ELQ A;  1IXH A;  4GWS A;  4GLI A;  5B70 A;  4QBA A;  2F8D A;  4LP2 B;  4DI4 B;  4KYE A;  5JTY B;  1ZMG A;  5CC2 A;  1AWB A;  3Q26 A;  3K00 A;  1D4N A;  1MRP A;  1N7W A;  1FPE A;  3IOU A;  4LZ8 A;  3Q28 A;  1RKM A;  3U1O A;  1IMA A;  3EHT A;  1IMB A;  2REG A;  1Z7M E;  2HAV A;  1NV3 A;  4QXD A;  5H8H B;  5IZ3 A;  1NNK A;  2VP1 A;  3USD A;  3DP8 A;  5CMK A;  4F1U A;  4DDD A;  4ELO A;  4H1X A;  1YTV A;  4P9K A;  1Q9D A;  4BLA A;  1I69 A;  4PFT A;  1FQB A;  1I6B A;  2UVJ A;  4ZEI A;  2DSF A;  1P1U A;  3MPL A;  4N6D A;  4HTG A;  2QJE A;  5KDT A;  2QRY A;  5DEX B;  1BTJ A;  1FBE A;  1MXV A;  2VGQ A;  4P11 A;  2XXQ A;  4Q8R A;  5EQ7 A;  5BUU A;  3KFM A;  4LAT A;  4GL8 A;  1QJM A;  2GHA A;  2B65 A;  3OO6 A;  2XXT A;  1IMC A;  4PGP A;  3H6W A;  4BDQ A;  4UAB A;  3H6T A;  3GBA A;  1MPD A;  4DXB A;  3CI8 A;  1B9J A;  2G29 A;  1NNP A;  1URS A;  2Y7W A;  4O3C A;  1M5D A;  1XHY A;  1XI6 A;  3IOV A;  3PUZ E;  3BFT A;  2ZYM A;  1IUD A;  2HQ0 A;  3GZG A;  1MY0 A;  4QF9 A;  1RDZ A;  5J1D A;  4KR5 A;  2AIX A;  3DLN A;  1EYI A;  4RK9 A;  3CFL A;  2HCA A;  2WYK A;  3VE1 B;  4QSC A;  4MAG A;  4I1D A;  2HAU A;  4NX1 A;  1JW1 A;  4PFR A;  1LAH E;  2JJK A;  4KCD A;  3CR9 A;  2FNC A;  2I0B A;  4P47 A;  3V89 B;  4G8H A;  4C1U A;  3A3U A;  4JWO A;  1USY E;  2P0S A;  4M1V A;  2HHM A;  1B7Z A;  2HZK A;  2OLB A;  3MZ9 A;  4RYA A;  4NHB A;  2IA4 A;  3EHS A;  1F9B A;  4GXA A;  3BKI B;  1AIV A;  5HM4 B;  2Q8J A;  2AL5 A;  4R9F A;  3IO4 A;  4X1B A;  3LUY A;  5FBP A;  2FVZ A;  4NWD A;  1JVX A;  1DK4 A;  1SW1 A;  4KQP A;  4JBZ A;  1Y1Z A;  2XXX A;  3O6H A;  3PUW E;  2H98 A;  1IQ7 A;  4PDD A;  2VPO A;  3GXA A;  2Z8E A;  3FVK A;  4F3G A;  1B0H A;  5ET6 A;  1II5 A;  4YKK A;  2PBW A;  4H5G A;  2PFY A;  2QMX A;  4OFO A;  1MH3 A;  4P0I A;  3EN3 A;  3MUQ A;  1SYI A;  3C36 A;  1FBH A;  3HFU A;  5H8F A;  5ET8 A;  4G77 A;  4I9D A;  2DWH A;  4YMA A;  4NMY A;  4TQU Q;  4GWO A;  2AL4 A;  2DYX A;  3L6H A;  3S2V A;  3W9W A;  3LR1 A;  1OVB A;  2YJP A;  3W15 C;  3MVW A;  4JVD A;  4P56 A;  3KN3 A;  4JXI A;  2ZZV A;  3S9M C;  4RY1 A;  3IFC A;  3UP9 A;  2CZI A;  4X9T A;  4H5F A;  4NQ8 A;  1TFD A;  3K1P A;  2H9B A;  5ICT A;  5IGA A;  3THI A;  1IME A;  3PU5 A;  4QRZ A;  3CG3 A;  1EYJ A;  5CBS A;  3QXM A;  2VD2 A;  4YMB A;  3BIH A;  2R8T A;  1M5E A;  4PC9 A;  3FUZ A;  4N91 A;  4F3S A;  1LAG E;  3MP6 A;  3TTM A;  3H7M A;  1HSJ A;  3SEY A;  3SEX A;  3G3I A;  2DDK A;  3BBR A;  3V83 A;  3ECR A;  5AA4 B;  4KYD A;  1DMB A;  2Q74 A;  3LC8 A;  2PFZ A;  1FPF A;  2D3I A;  5FTH A;  2XXY A;  3D1R A;  2XXH A;  3PTY A;  3PPN A;  4AB6 A;  3C31 A;  4LN5 A;  3T93 B;  3TEP A;  2QVV A;  1LCT A;  1MY1 A;  1MQH A;  3RT8 A;  1FTL A;  2RKM A;  1FW0 A;  4PE3 A;  1SPI A;  5L9S A;  5ESY A;  3IJO B;  2GHB A;  4N07 A;  3L6G A;  4MHF A;  3PPP A;  3MZ1 A;  1LBX A;  1DCU A;  2PCR A;  3K02 A;  3M8U A;  4HE1 A;  2WKY A;  3I5O A;  4I3E A;  4TOZ A;  1JEU A;  4EDP A;  2O1L A;  2YPN A;  2DE4 A;  5H8S A;  1SYH A;  3I6V A;  4XIG Q;  4MNP A;  2VD3 A;  2HXW A;  2X7P A;  1B3H A;  3VXB A;  4IGR A;  3G3H A;  4HCW A;  2R71 A;  4JWX A;  4MH5 A;  5I56 A;  1US5 A;  4FAJ A;  4QFP A;  4EF2 A;  3E4R A;  3H6V A;  2E1S A;  1Y3Q A;  4QFK A;  5HPQ A;  2Q88 A;  3MAM A;  1MS7 A;  3OO7 A;  3LUZ A;  2OWT A;  2VPN A;  4O3A A;  4Q0C A;  3MC2 A;  2A5S A;  3D4C A;  1B4H A;  4OER A;  1DTZ A;  2NVU B;  5EQ8 A;  3KJ7 A;  1ATG A;  4OVJ A;  3IOW A;  4H8I A;  1EZO A;  3KBZ A;  4X8R A;  3D4G A;  4N4U A;  3TAJ A;  1OLC A;  4UAC A;  4Q30 B;  3OSR A;  1JW4 A;  4QHQ A;  4EF1 A;  3FV2 A;  2OPD A;  2ABH A;  4N6P A;  1BLF A;  1FQF A;  1P1N A;  1BP5 A;  4IY5 A;  2KR0 A;  4DCX A;  1PDA A;  2AYS A;  4YKJ A;  1NMU A;  2DXY A;  2B3B A;  4BDN A;  3K01 A;  1MXZ A;  2H5Y A;  3U94 A;  1ZTY A;  2QS2 A;  4N15 A;  2F6G A;  3GLB A;  4F3P A;  1JEV A;  2F7C A;  2RIN A;  3CVG A;  3IOT A;  4EQ7 A;  4O94 A;  3U8Q A;  1SW2 A;  1MPB A;  2A5T A;  5AA3 A;  3H03 A;  1DSN A;  1FPK A;  4MJO A;  1MM7 A;  5H8Q A;  1M5F A;  4MF3 A;  1KA1 A;  4I40 A;  3OD7 A;  2WYP A;  5JEI A;  4NF4 A;  2I48 A;  5A5X A;  5TP9 A;  4KXP A;  1FPI A;  3G3F A;  3UOR A;  4YKP A;  1TXF A;  4F2O A;  4KFQ A;  4OZ9 A;  5IZ3 B;  4NF5 A;  3VVD A;  2KQZ A;  4DI3 D;  5T3J A;  3OEL A;  4PFI A;  4Z0I A;  4N81 A;  4RA1 A;  1UQW A;  5I84 A;  4AS4 A;  1UTB B;  4NWC A;  4H0W A;  3RLF E;  1KA0 A;  1S9T A;  2UYF A;  1M5B A;  5KCJ B;  3OSQ A;  3FV1 A;  4GX3 A;  3N94 A;  1XVY A;  3RPW A;  4GWX A;  2GH9 A;  3CRB A;  5DW8 A;  3IAZ A;  4MMP A;  5I58 A;  4F39 A;  2DE2 A;  3B8B A;  4FED A;  4YKI A;  1I6Q A;  4GFR A;  1O7T A;  1DBZ A;  3MQ9 A;  2ZYO A;  5AE4 A;  4QFN A;  4PQJ A;  2WEF A;  3K6W A;  1LBW A;  2DVZ A;  2DVC A;  1QUJ A;  1IIW A;  3IB1 A;  4MEV A;  4FJP A;  2O51 A;  5L9O A;  1ZIU A;  4NGU A;  2NUV A;  2Y7R A;  4HE0 A;  3FD3 A;  4RPO A;  3TCH A;  4M4G A;  4YAH X;  1GTK A;  1QUI A;  5CM6 A;  2FHY A;  1IIT A;  3ILU B;  3LSF B;  3F11 A;  1FPG A;  2CMO A;  1B4Z A;  3UA8 A;  4WED A;  2ONS A;  3OEK A;  3TOD A;  3UIF A;  3DM0 A;  4XKR A;  3O2A A;  4NAP A;  5JK4 A;  4G68 A;  1MY2 A;  4PE5 B;  1B1H A;  4POW A;  4I8C A;  4POX A;  4PAI A;  2H99 A;  1NV5 A;  1NUW A;  5BWJ A;  3A3C A;  5I2K B;  3IB0 A;  5ELV A;  3C35 A;  4EXL A;  1QW0 A;  1XT8 A;  2WBD A;  3TFL A;  3P7I A;  3IR1 A;  1Z7N E;  1LBY A;  3EPE A;  4NG7 A;  1NV1 A;  1Y4T A;  4NF6 B;  1P1Q A;  1ZKB A;  4L17 A;  3CHG A;  4LQ2 A;  1FTO A;  3QK6 A;  4WEP A;  3G3J A;  2F35 A;  3SEW A;  2OWS A;  1MXX A;  2ZNS A;  1H44 A;  2LAO A;  3SEV A;  1NUZ A;  2KLF A;  2O7I A;  2OPE A;  2XWV A;  3MP1 A;  3RUM A;  1D9Q A;  2GRV A;  3IFA A;  2B3F A;  1LCF A;  2QMW A;  3FVG A;  4G8N A;  4XF5 A;  3OO9 A;  4EQB A;  4GRK A;  3R6U A;  1SW5 A;  5H8F B;  4ZE8 A;  3TUS A;  4R9G A;  1R9Q A;  5CMB A;  2Y7K A;  3LSX A;  5AA1 A;  1CB6 A;  2Q2C A;  1B3F A;  3H3G A;  3H4Z A;  1INP A;  1Y9U A;  5IM2 A;  1AH5 A;  4OWD A;  1NL5 A;  3VVF A;  4GD5 A;  4ZZE A;  5I57 B;  1FJ9 A;  4ONY A;  2P3V A;  1GVC A;  1B3L A;  5TPA A;  3VLV A;  1MQG A;  3RPL A;  1FPB A;  1B58 A;  3UN6 A;  2I49 A;  3KN7 A;  4F19 A;  5I59 A;  3ODB A;  3OO8 A;  2VOZ A;  2XWK A;  3HV1 A;  3TTN A;  4N17 A;  1FSA A;  1AL3 A;  3TDJ A;  3CSB A;  2DOJ A;  5JTY A;  2X7Q A;  2CZL A;  1DTG A;  3V5A A;  4ZEC A;  1QUL A;  2F3D A;  4AB5 A;  5H8N A;  4OXV A;  1Q35 A;  2QS3 A;  3PPQ A;  5EYG A;  1MQJ A;  3JYR A;  2QS4 A;  5IZ1 A;  3CG1 A;  1ELJ A;  2I0C A;  4IO7 A;  4MLQ A;  2Y5L A;  5F24 A;  4HS7 A;  5AA2 D;  2CZK A;  3VFJ A;  2R9J A;  3KOT A;  4XEQ A;  5H8H A;  1A99 A;  1B6H A;  4JVC A;  3RTF B;  3T9X B;  5A5L A;  1US4 A;  2ONK E;  1LAF E;  1D9V A;  1O63 A;  1N7X A;  5AA2 B;  5I2N B;  2W7Y A;  1EU8 A;  2RCA A;  4FE8 A;  4BDM A;  3PMW A;  4G2Z A;  1P99 A;  3TTR A;  2D5W A;  4F18 A;  1UTH B;  2PT1 A;  3RT6 B;  5CRY A;  4IY6 A;  3O66 A;  4QFO A;  4U21 A;  1FBG A;  3H6U A;  3K6U A;  4NE4 A;  3RN8 A;  3WAE A;  3R26 A;  1Y1M A;  5DEX A;  2BJJ X;  1URG A;  2H4I A;  1MQD A;  4OVQ A;  1FTM A;  4HW8 A;  1ZLQ A;  2QFL A;  2XD3 A;  5EQ9 A;  2ZXT A;  3T9V A;  5I56 B;  2I3V A;  3IB2 A;  2F5X A;  1S7Y A;  1MG1 A;  4OEN A;  1LFI A;  4AS5 A;  3B6W A;  3HO7 A;  1TT1 A;  2O1M A;  4N6K A;  2E0S A;  3S9L C;  3G3K A;  4KPT A;  4GIZ A;  4O3B A;  4KI0 E;  2F34 A;  1UIV A;  1EZP A;  5IAI A;  4MBP A;  3TZA A;  1LFG A;  1NH7 A;  1N3W A;  4C1T A;  3UK4 A;  3ZSF A;  1R6Z A;  4XKQ A;  1SQY A;  2CEY A;  2V3T A;  1DPE A;  4BDL A;  2I4B A;  1FBP A;  4IO6 A;  3C34 A;  1AOV A;  3SES A;  3RYD A;  4E0X A;  1VSO A;  3HCQ A;  2UXA A;  3KSJ A;  4PDH A;  4R73 A;  4ZEF A;  3LBS A;  1KZ8 A;  4FIM A;  3EF7 A;  4XKN A;  3KBR A;  1TWY A;  1NUX A;  4OHN A;  1B40 A;  1LBZ A;  4U22 A;  2V3Q A;  5DVJ A;  4LZ5 A;  2XHD A;  4GWW A;  5CBR A;  5H8Q B;  2DP8 A;  2ZZX A;  3DP6 A;  3IX1 A;  2XXU A;  2R6G E;  4XKP A;  2ZNT A;  4NF4 B;  1J1N A;  2FIE A;  5TP9 B;  2DS9 A;  4RPN A;  3PD8 A;  4H8J A;  2X26 A;  3FAS A;  5LOM A;  3IL1 B;  1B3E A;  3QYT A;  4KD5 A;  4BDR A;  4G8M A;  4JB7 A;  3SEU A;  5F1Q A;  3KGC A;  3KJT A;  1DPP A;  1BK4 A;  4PAK A;  1PB7 A;  2ALU A;  1A7L A;  3QMF A;  4WXJ A;  1B32 A;  4ESW A;  3HPI A;  3HST A;  4I3Y A;  1QVS A;  4OVR A;  4DLD A;  1NNF A;  1N0T A;  2XXW A;  5B7D A;  2HFB A;  1Y4C A;  3OEN A;  3FJ7 A;  3K1M A;  4OVS A;  2XXV A;  2XXI A;  4F22 A;  2F3B A;  1ZU0 A;  1FPJ A;  2G93 A;  1CNQ A;  2RF1 A;  2XWO A;  4LA9 A;  4N13 A;  4NF8 B;  1MXY A;  1IXG A;  4F1Y A;  1SD3 A;  3B6Q A;  1PEB A;  3JV9 A;  4JDF A;  4LQ5 A;  5EYH A;  3QUJ A;  3AXF A;  5L9M A;  1RDX A;  2QVR A;  4OFJ A;  5EYF A;  2DE3 A;  3MWB A;  1VFD A;  1WOD A;  1NUY A;  2F36 A;  1H3D A;  4R2F A;  2Y7P A;  1USY H;  3LSL A;  5ICQ A;  3CSG A;  1FRP A;  3T9U A;  4DZ1 A;  1B52 A;  1SW4 A;  4OQO A;  2F78 A;  2P3N A;  4QSE A;  4R72 A;  5ET7 A;  1VFE A;  4Z7E A;  2RC7 A;  3TQL A;  5AA4 A;  3T1B A;  1NKX A;  4PCD A;  1FBD A;  4OTE A;  4G68 B;  4RJZ A;  2B4L A;  4FEB A;  1ZJL A;  3U92 A;  2RCB A;  3B50 A;  3K0V A;  2I6E A;  4QSD A;  1B2H A;  2HEU A;  4OEU A;  2QL3 A;  2ZYK A;  1I6A A;  1POY 1;  1NV6 A;  4WKM A;  3ROJ A;  5F7V A;  5M2V A;  3M3L A;  4ZZA A;  4GWY A;  3K6V A;  1MXU A;  4OES A;  4MCO A;  3N5L A;  1OIB A;  1EZ9 A;  3OEM A;  4YB7 A;  4PFW A;  1N04 A;  4OAN A;  3RY3 A;  2QPQ A;  2DWJ A;  1N76 A;  4PFB A;  1JVY A;  1PBP A;  3IOR A;  2MKZ A;  1JNF A;  5KDT B;  3N26 A;  3PUY E;  4JSD A;  1BKA A;  4YB6 A;  1FTA A;  1EH3 A;  3T66 A;  1FPD A;  1B51 A;  3UGW A;  3SKP A;  4MNC A;  4O8M A;  4OMB A;  3VLU A;  3VXC A;  1IEJ A;  3QUF A;  4O7I A;  3OMB A;  3O9P A;  2RC9 A;  3PPO A;  3OXN A;  1NV7 A;  1LFH A;  1QKB A;  3NOH A;  1FQA A;  2Q2A A;  4ZS9 A;  4JVI A;  4LVQ A;  5LTC A;  3KC0 A;  5ET5 A;  2QSX A;  4MX6 A;  3FAT A;  3C4M A;  2Q89 A;  1QGX A;  3SER A;  4ZEK A;  3RPL B;  2V93 A;  1DOT A;  3PUV E;  1XVX A;  2I58 A;  2XX8 A;  3E78 A;  4JWY A;  1LEV A;  4PFY A;  1JW5 A;  3K2D A;  5TU0 A;  3FGS A;  2P1S A;  3S4U A;  3DP4 A;  3EKI A;  4OYV A;  5EQA A;  4FBP A;  1GGG A;  1H43 A;  2OBG A;  4YZZ A;  4PGN A;  2B4M A;  3KC1 A;  3TTK A;  1G0I A;  4PTK A;  1UIU A;  2IEE A;  1TFA A;  4IR8 A;  5I7I A;  3FZV A;  2Z8F A;  5H8N B;  1YAE A;  2Z22 A;  2V25 A;  4DE8 A;  2ONR A;  4LUB A;  3MYU A;  1B5J A;  2XXR A;  4KCC A;  3EHU A;  2DQV A;  2PX1 A;  3PPR A;  4PAF A;  2XWI A;  1K9Z A;  1LBV A;  4E0W A;  2BJI A;  1H45 A;  3TEL A;  4GOT A;  4PFU A;  2FBP A;  1MDQ A;  3PMX A;  3TYH A;  4ISU A;  2VHA A;  4RXL A;  4DXU A;  2Q8M A;  1B7H A;  4N8G A;  2V84 A;  1NV2 A;  3LSW A;  4GX6 A;  1RDY A;  4R6K A;  3RGY A;  3M3F A;  2YLN A;  3FXU A;  2REJ A;  1UTB A;  3VLW A;  1YPN A;  1O64 A;  2I3W A;  2O69 A;  1Y3P A;  2F97 A;  1A8E A;  3T9H B;  2HPG A;  5KCJ A;  3TMG A;  3DEL B;  3O28 A;  1JQF A;  4RNS A;  3KZG A;  1MQI A;  4XTC Q;  4IO4 A;  4P1E A;  5DTB A;  2FIX A;  2Q9T A;  3ZS6 A;  4MNI A;  4PF8 A;  4RK2 A;  1R1N A;  1FQC A;  5ITP A;  1Y3N A;  4GXS B;  1BIY A;  1IMF A;  4GBW A;  4MLV A;  3K1N A;  1EYK A;  3TPA A;  1B7U A;  1LST A;  1B5H A;  2Z23 A;  4N8Y A;  3R7X A;  1IXC A;  2ZYN A;  1XS5 A;  3TQW A;  4X48 A;  3MVY A;  1QKA A;  1A55 A;  2UVH A;  1HSL A;  4F29 A;  2UVI A;  3T96 B;  4X04 A;  3T0J A;  2XXP A;  3TKD A;  4THI A;  2UYE A;  2ZNU A;  3KSX A;  1G0H A;  3HN0 A;  4MIJ A;  1B1X A;  4HE2 A;  5I5P A;  3U72 A;  3FJG A;  1MY4 A;  4OFL A;  4HCY A;  2H25 A;  3E13 X;  1MXW A;  4FAT A;  4JSO A;  3HHF A;  1SVX B;  3T22 A;  4P1L A;  4G61 A;  1URD A;  4R75 A;  3U93 A;  3O6G A;  5I2K A;  4HXV A;  4QFL A;  2XD2 A;  1HSE A;  4ZDM A;  2QVU A;  3TCG A;  3MP8 A;  4I62 A;  1VR5 A;  3SDF A;  1P1O A;  1N84 A;  1SI0 A;  2Z8D A;  4TLL B;  3EQ1 A;  2WBB A;  4NF6 A;  3MVZ A;  4OVP A;  1B46 A;  4P8B A;  3CFZ A;  2OJT A;  1MY3 A;  3FBP A;  2PVU A;  2I4C A;  3ZKL A;  4H65 A;  3MZB A;  2ANJ A;  4PET A;  4ELR A;  2DWA A;  3VVE A;  1WDN A;  1A40 A;  4AQ4 A;  2GQ1 A;  1FTJ A;  2RC8 A;  4F31 B;  1ZBM A;  4U4S A;  2XX9 A;  1L5T A;  5DYH A;  3QIM A;  3IJX B;  1OLA A;  3K4U A;  1NNT A;  2OWZ A;  3PUX E;  4R2B A;  1IMD A;  5DT6 A;  4PBH A;  1MM6 A;  4ECF A;  1XOC A;  3MJN A;  4LZ7 A;  3MPK A;  1A8F A;  3OOA A;  2THI A;  1S50 A;  1NH8 A;  1P1W A;  5I3S A;  4R6Y A;  4ESX A;  5DVI A;  3B6T A;  1LBC A;  1LLS A;  1B05 A;  4R74 A;  5I57 A;  3PV0 E;  1B3G A;  5ITO A;  1PBQ A;  1XC1 A;  4ZE9 A;  1LGB C;  4GL0 A;  4GF8 A;  3TTL A;  4GBV A;  1LBB A;  2DWI A;  3FVN A;  4H46 A;  3ONM A;  4DCY A;  4U1Z A;  3GBB A;  3C9H A;  4IGT A;  2ZMB A;  2NXO A;  3S9N C;  1M5C A;  4GX4 A;  1NV4 A;  4U1O A;  5FHN A;  3FXR A;  2V3U A;  2A5T B;  4G4P A;  4C0R A;  2O7U A;  1D3K A;  1FTK A;  2PT2 A;  4OA4 A;  4UA8 A;  4F2Q A;  5A5X B;  4YIC A;  4PP0 A;  3G7W A;  3LV0 A;  4NED A;  1B5I A;  3FVO A;  1QUK A;  1SBP A;  4FEC A;  3A09 A;  1JP4 A;  5AA2 A;  5I2N A;  2WX9 A;  4NF5 B;  3S9E A;  2FA7 A;  3GYY A;  5K2Y A;  3VDF A;  2NWJ A;  4H45 A;  1RYX A;  5FHM A;  1Y20 A;  1UTH A;  1CE2 A;  1IZ1 A;  2F7B A;  1PB9 A;  5HBC A;  3IK6 B;  3MW0 A;  3PGF A;  3PMV A;  4OEV A;  3IO6 A;  3E79 A;  3E3K A;  4Q5T A;  5J16 A;  4LON B;  2L5V A;  1PC3 A;  4R6H A;  2CEX A;  3FXQ A;  3RTW B;  3HHG A;  1GR2 A;  4F3B A;  3BIG A;  4EUO A;  1FQD A;  3KOS A;  2V4C A;  4YU0 A;  1B0L A;  3O6I A;  1VDW A;  4GVO A;  4MFI A;  1LB8 A;  4X1D A;  5I58 B;  2PMS A;  5FTI A;  1MPC A;  3KG2 A;  1GV8 A;  1OQH A;  1LAX A;  3H06 B;  1AMF A;  4NF0 A;  3FJM A;  5DVF A;  2QS1 A;  2M8C A;  1POT A;  4IO5 A;  1MH4 A;  4U2R A;  3FIR A;  3PD9 A;  2HZL A;  2OX3 A;  1OVT A;  1YXI A;  2GFE A;  3V8X B;  2HXR A;  2OCU A;  3E9X A;  4IO2 A;  3ISP A;  4KHZ E;  1SDX A;  5IZZ A;  4PF6 A;  3KEI A;  4GQO A;  2UVG A;  3JZJ A;  2P2A A;  5LDZ A;  4BDO A;  1FBF A;  1A54 A;  3CIJ A;  5FHO A;  1OMP A;  5K2X A;  2DXR A;  3B7D A;  1NV0 A;  1FQE A;  4H6D A;  3QSL A;  3ILT B;  4XXU A;  4ELP A;  4F1V A;  3G3G A;  5CI5 A;  3N6U A;  1YYZ A;  1FJ6 A;  3MBP A; 
#chains in the Genus database with same CATH homology
 2Q74 A;  2PFZ A;  1FPF A;  4IR8 A;  5EYG A;  5I7I A;  3D1R A;  4GWU A;  3PTY A;  5IZ1 A;  4LN5 A;  3W9V A;  3MYU A;  2QVV A;  2Y5L A;  1YZ0 A;  4PBQ A;  5F24 A;  2CZK A;  4PAF A;  4XEQ A;  2XWI A;  1K9Z A;  1LBV A;  4PE3 A;  1SPI A;  4JVC A;  5A5L A;  2BJI A;  3SZP A;  1NI9 A;  2FBP A;  2XA5 A;  5ESY A;  4MHF A;  1LBX A;  1DCU A;  2PCR A;  2Q8M A;  2ZZW A;  4F18 A;  4GWZ A;  4HE1 A;  4N8G A;  4I3E A;  1NV2 A;  2Y5K A;  4GX6 A;  1RDY A;  2DE4 A;  1FBG A;  4MNP A;  4NN3 A;  4OVQ A;  4HCW A;  2HPG A;  2QFL A;  3MST A;  5EQ9 A;  3U65 A;  3LUZ A;  2VPN A;  2F5X A;  4P1E A;  2FIX A;  2Q9T A;  4AS5 A;  4MNI A;  4PF8 A;  5EQ8 A;  4N6K A;  2CZH A;  1IMF A;  4GBW A;  3FXB A;  4XFE A;  1EYK A;  3KBZ A;  4X8R A;  4N8Y A;  4N4U A;  1FBC A;  3A29 A;  2VT5 A;  2XXK A;  4O7M A;  2CEY A;  4OVT A;  4X04 A;  2KR0 A;  1FPL A;  3T0J A;  1FBP A;  1K9Y A;  4P3L A;  3RYD A;  1G0H A;  4GWS A;  4PDH A;  4QBA A;  4MIJ A;  4DI4 B;  4HE2 A;  4N15 A;  5I5P A;  1KZ8 A;  4HCY A;  1AWB A;  1NUX A;  4O94 A;  4P1L A;  1FPE A;  1LBZ A;  2V3Q A;  1FPK A;  4MJO A;  4G61 A;  4HXV A;  1KA1 A;  4I40 A;  1IMA A;  2WYP A;  4GWW A;  2QVU A;  1IMB A;  2ZZX A;  4KXP A;  1FPI A;  1NV3 A;  4QXD A;  2FIE A;  5IZ3 A;  2WBB A;  5IZ3 B;  4OVP A;  4P8B A;  4F1U A;  4P9K A;  2KQZ A;  3FBP A;  1Q9D A;  5T3J A;  4DI3 D;  4PFI A;  4PET A;  4N81 A;  2GQ1 A;  1BK4 A;  4PAK A;  4N6D A;  4AS4 A;  3QMF A;  1FBE A;  1KA0 A;  2OWZ A;  5EQ7 A;  1IMD A;  4OVR A;  4GX3 A;  4I3Y A;  4PBH A;  4GWX A;  1IMC A;  5DW8 A;  4PGP A;  4MMP A;  4OVS A;  4UAB A;  2DE2 A;  3B8B A;  1DBZ A;  2F3B A;  1FPJ A;  2XWO A;  1CNQ A;  2WEF A;  5I3S A;  1XI6 A;  1LBW A;  2DVZ A;  4MEV A;  5EYH A;  4NGU A;  5J1D A;  1RDZ A;  4HE0 A;  1RDX A;  2QVR A;  1EYI A;  4GBV A;  2DE3 A;  2WYK A;  4MAG A;  4H46 A;  5CM6 A;  4NX1 A;  4PFR A;  1NUY A;  2FHY A;  2JJK A;  1FPG A;  4P47 A;  1FRP A;  4M1V A;  2HHM A;  2HZK A;  4NAP A;  4NHB A;  5JK4 A;  2P3N A;  4GX4 A;  5ET7 A;  1NV4 A;  3T1B A;  4PCD A;  4PAI A;  1FBD A;  1NV5 A;  1NUW A;  2B4L A;  4OA4 A;  5FBP A;  3B50 A;  4YIC A;  2FVZ A;  2WBD A;  3LV0 A;  1LBY A;  4NG7 A;  1NV1 A;  1DK4 A;  1NV6 A;  3ROJ A;  1JP4 A;  2WX9 A;  3GYY A;  4PDD A;  2VPO A;  4GWY A;  4H45 A;  3CHG A;  4MCO A;  3E79 A;  5ET6 A;  4OAN A;  5J16 A;  2QPQ A;  2PFY A;  4PFB A;  1NUZ A;  2MKZ A;  2L5V A;  2XWV A;  1FBH A;  1D9Q A;  2CEX A;  3IFA A;  3HFU A;  3BIG A;  5ET8 A;  2V4C A;  1FTA A;  1FPD A;  1VDW A;  4XF5 A;  4MNC A;  4O8M A;  4O7I A;  1NV7 A;  3W9W A;  3NOH A;  4JVD A;  4P56 A;  1INP A;  2ZZV A;  5IM2 A;  4NF0 A;  3IFC A;  2CZI A;  4X9T A;  4NQ8 A;  1FJ9 A;  4JVI A;  5IGA A;  2P3V A;  2HZL A;  2OX3 A;  5LTC A;  1IME A;  1YXI A;  3KC0 A;  5ET5 A;  2HXR A;  1EYJ A;  3RPL A;  1FPB A;  4MX6 A;  3ISP A;  1QGX A;  5IZZ A;  4PF6 A;  3BIH A;  2R8T A;  3RPL B;  3E78 A;  1LEV A;  4F19 A;  4PC9 A;  4N91 A;  2XWK A;  5LDZ A;  1FBF A;  4N17 A;  3EKI A;  1FSA A;  5EQA A;  4FBP A;  1NV0 A;  4YZZ A;  4PGN A;  2DDK A;  2B4M A;  4F1V A;  3KC1 A;  1G0I A;  4PTK A;  2F3D A;  1YYZ A;  1FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...