4I3EA

Crystal structure of staphylococcal impase - i complexed with products.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
262
structure length
259
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal IMPase - I complexed with products.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 67
structure length 259
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i3eA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i3eA02
2CZHA 4I3YA 4I40A 2FIXA 5F24A 2FHYA 5EQAA 1NV3A 4HE1A 1FBDA 4PTKA 5ET8A 1IMBA 1FBCA 1DK4A 2VT5A 1G0HA 3RYDA 3LV0A 1D9QA 4GWWA 1FPBA 2FVZA 1INPA 5IZ1A 1NUXA 1NV6A 3T0JA 4H46A 1KA1A 2F3DA 2Q74A 1DCUA 5ET7A 1IMDA 1YXIA 1NV1A 5IZ3B 1G0IA 5J16A 1NV5A 2CZKA 4G61A 2P3VA 1FBEA 1FBFA 1BK4A 1KA0A 1RDZA 1IMEA 5DW8A 2Y5KA 4KXPA 1NI9A 2BJIA 4HE0A 5LDZA 3A29A 5ET6A 2WBBA 1AWBA 1LBVA 1RDXA 2WBDA 1FPGA 3IFAA 5EYHA 4IR8A 1LBXA 2R8TA 1K9ZA 1QGXA 5EQ8A 1IMFA 2FBPA 1LBWA 3FBPA 1YYZA 4FBPA 1FBGA 4GBVA 4HE2A 1NV7A 3BIHA 2QVUA 1Q9DA 1NV2A 1DBZA 1NV0A 3ROJA 3RPLA 1FJ9A 4HXVA 1FPDA 2OWZA 4GX6A 4GWUA 1EYIA 1K9YA 1EYKA 1FJ6A 5FBPA 1IMAA 5A5LA 4GBWA 1FPLA 2FIEA 4GWYA 4AS5A 4GWZA 4GX4A 1LBZA 1SPIA 2OX3A 2F3BA 1CNQA 1EYJA 5T3JA 2QVVA 3D1RA 4I3EA 5ESYA 2CZIA 2WEFA 2Y5LA 1LEVA 3KBZA 1NUYA 4MJOA 3KC0A 1FPIA 2QFLA 3KC1A 1FSAA 2JJKA 2QVRA 3RPLB 1VDWA 1FPKA 4QXDA 5EQ7A 2PCRA 3LUZA 5IZ3A 2Q8MA 5EQ9A 4H45A 1NUZA 2GQ1A 1IMCA 5EYGA 2HHMA 3IFCA 1FPEA 1YZ0A 2P3NA 1FBPA 1LBYA 1FTAA 1XI6A 3QMFA 5ET5A 1FRPA 1NV4A 4GX3A 1JP4A 1NUWA 4AS4A 1FPFA 4O7IA 4GWXA 3BIGA 1RDYA 1FBHA 1FPJA 1KZ8A 4GWSA 4N81A 5I3SA 3B8BA 2DDKA
chains in the Genus database with same CATH superfamily
3RY3A 4GWOA 1VFDA 2G29A 1FBCA 1TT1A 1UIUA 1B0LA 4OANA 1FQBA 2ZNTA 1NV6A 1PBQA 3FASA 4KPTA 1PB7A 4DIGA 2GHBA 2YPNA 4G61A 3C31A 4OENA 1BK4A 4R6YA 2HEUA 1IITA 5LDZA 2BJIA 1EZ9A 2DWHA 1R9QA 2W7YA 4MH5A 1SVXB 5J1DA 4E0XA 1A8FA 2I0CA 2VD2A 3JV9A 4KCDA 5LOMA 3PTYA 3MW0A 2RKMA 2V3UA 3FJ7A 3RPLA 1JVYA 4IGRA 5KCJA 3EF7A 3QAXA 4F3BA 4MIJA 1LAHE 2HZKA 1CNQA 1DPPA 4YZZA 4FATA 2WEFA 4LONB 3KBZA 4MLQA 1O7TA 3E13X 1VDWA 5EQ7A 1Z7NE 2Q8MA 1MM6A 2Z8FA 1R9LA 3PU5A 4XXUA 1Q35A 1S7YA 3IFCA 2DP8A 4RYAA 3MZBA 1XI6A 2QSXA 3TYHA 1A54A 3KFMA 3W9WA 2RCAA 3T66A 4NX1A 3TEPA 2FHYA 2HCAA 1FBDA 3OO8A 3IOWA 4HCWA 3RTWB 3K02A 1AIVA 3T0JA 2DE2A 2ONSA 1PBPA 3TODA 5B7DA 1MQHA 1QVSA 2KLFA 4KD5A 4ZE8A 4ZEIA 5ET6A 1SI1A 1Y1MA 3OOAA 4OYVA 5B70A 5CMBA 4MEVA 1A55A 1YYZA 2H4IA 4E0WA 1P1UA 4I9DA 3E78A 2VGQA 1FJ9A 4O7MA 2B4LA 2ANJA 4GFRA 5M2VA 5TP9B 1B05A 3U93A 4G8MA 1YTVA 4GWYA 2FIEA 4G68B 2F8DA 4F1VA 4ELQA 3VFJA 4HCYA 2X7PA 1EYJA 5ESYA 1POTA 1FCKA 4FE8A 2XXWA 1URDA 1DTGA 5CBSA 3KC1A 5JK4A 1O64A 4NHBA 2Y7PA 4R9FA 5AA4A 3TTLA 1NUZA 5EYGA 1O63A 3V89B 5KCJB 1B3LA 5I56A 2Z22A 4IGTA 4GLIA 1Y4TA 3ONMA 3B6TA 2HXRA 4MX6A 3R6UA 4GWSA 2I3WA 3K2DA 4H67A 3T9UA 2CZHA 2FIXA 2I48A 3CR9A 1B3HA 3MVYA 1LAXA 3K6WA 4GWWA 5EHMA 1INPA 2UVIA 5IZ1A 1Y4CA 2D21A 4OETA 4JWXA 2HQ0A 1JVXA 4OWDA 1HSLA 5IZ3B 5TPAA 4GL0A 2H99A 2CZKA 1RDZA 3D4GA 4N6DA 1AWBA 4H5GA 4RK9A 4IR8A 3K0VA 3RPWA 4X9TA 3OEKA 4IO2A 1XT8A 1PEBA 2AL5A 2DQVA 1BTJA 1Z7ME 4FEBA 1FQCA 1H45A 4ECFA 5ICQA 4R6HA 1NFTA 4X1BA 1B1XA 2NUVA 4GRKA 4P8BA 4PFUA 1I6QA 3VVFA 5EYFA 1QUKA 3LSXA 1USYE 5KDTA 1HSEA 4QRZA 2XXKA 1T0KA 4MBPA 4H0WA 1N0TA 4DI3D 3H4ZA 1AH5A 4DXUA 3PUVE 1OLAA 4NF8B 4GX3A 4KYEA 1FPFA 2DWJA 4GWXA 1ZLQA 1RDYA 1KZ8A 3QK6A 3VE1B 5I3SA 5I2NA 1GGGA 4LUBA 1TWYA 3PD8A 2V84A 2OK2A 5I59A 4PFWA 3RYDA 1D9QA 4P3LA 3PPRA 3IOTA 1MXXA 2O7UA 3K6XA 4BDQA 2F78A 3FATA 4Z7EA 3CFXA 4XKPA 3TCGA 3O9PA 5ET7A 1YXIA 4EXLA 4DZ1A 2P3VA 1AMFA 2XXYA 2VPOA 4C1TA 1PB9A 2OPEA 3K6UA 1QW0A 4OVTA 2HAVA 1MXVA 2R8TA 4DCYA 4PGNA 3AXFA 3MSTA 3O6IA 3V83A 2DOJA 4OMBA 1FBGA 1GVCA 1DBZA 3IB0A 4FAJA 4K3FA 4RXLA 3A3UA 3O28A 1ZTYA 4G68C 4GBWA 3EKIA 2XWOA 2HPGA 4KHZE 1IEJA 1LBZA 4N17A 5DYHA 4O94A 1M5BA 1UIVA 3FXUA 4XKNA 2XWVA 1XVYA 2VHAA 4H45A 4GXSB 3JZJA 1IMCA 1LB9A 1JW5A 5L9SA 3PUXE 3LBSA 4PF6A 1UTBB 4R6KA 2WYKA 5H8FB 4O7IA 1IZ1A 1FBHA 2XXHA 3MPKA 4G8HA 3FIRA 2DDKA 4G77A 5IKBA 2DXYA 4I40A 1NNKA 4PDHA 1B4HA 1IMBA 2UVJA 1NNTA 4DCXA 1G0HA 1N04A 3LV0A 2ONKE 3Q26A 2XA5A 4YMAA 1NUXA 4YKIA 1KA1A 3QUJA 1QKAA 3HPIA 4F1YA 4F22A 4JSDA 2ESNA 1NV5A 2I4BA 1ZBMA 4ZZAA 1NI9A 1IXHA 2MKZA 2F7AA 3CVGA 5I57B 3MZ1A 2THIA 5H8HB 3TQLA 1LLSA 4ZE9A 2DE3A 4H65A 2WKYA 3KBRA 3FGSA 2QVUA 2AL4A 2UXAA 3T96B 5FHMA 4GXAA 3B6QA 2QMWA 3PGFA 2B3BA 2Q2AA 2UVHA 4NF4A 4U2RA 1SPIA 5CBRA 3ZKLA 3HCQA 4P1EA 1LAFE 5T3JA 3D1RA 1QUJA 2Q9TA 3C35A 4QF9A 2ZNSA 1B40A 3OMBA 3U1OA 1B2HA 1MQIA 1EU8A 1FTJA 4G68A 1LFIA 3H6UA 1IXGA 3S9MC 3ILUB 4AQ4A 2GQ1A 1JETA 4BDNA 3USDA 1FTAA 1B4ZA 4OVRA 4ZECA 4MLVA 2H5YA 1GV8A 3BIGA 4NTLA 4X04A 1MXZA 5F1QA 1AOVA 3EN3A 3KSXA 3G3GA 1R1NA 1XC1A 5F24A 3S2VA 4MNIA 4HS7A 2Y7WA 3E79A 4N07A 1MPDA 5I57A 4R74A 2VOZA 4U4XA 4ONYA 4U4SA 3IR1A 2F3DA 2E1SA 1UTBA 2O1LA 3G3JA 3PUYE 3FVKA 5I84A 1KA0A 4R2BA 4ZEBA 4KXPA 2ABHA 3KGCA 3V5AA 1N76A 3DELB 3CIJA 3MP1A 4AB5A 3B50A 4JXIA 5ICTA 4U22A 3BBRA 4GBVA 2NOOA 2CEXA 2XXXA 4RPOA 4LVQA 2IEEA 1XOCA 1GR2A 2Y7RA 1IIWA 1MXWA 3ISPA 3T9XB 4IO7A 5AE4A 2RF1A 3UIFA 4PFYA 2ZZVA 1IMAA 1XS5A 3H3GA 3RQTA 1UQWA 2OBGA 5L8DA 2F35A 3KOSA 5H8HA 4PP0A 4FORA 3MZ9A 3FJGA 1B3FA 2YJPA 3EQ1A 3H06B 2Q89A 3Q28A 2NWJA 2RCBA 4M4GA 1PDAA 4NG7A 1FQEA 1MY0A 2QS3A 4GF8A 4YKJA 2UVGA 2Y7KA 3B8BA 2M8CA 1A8EA 3W9VA 2CEYA 3VLVA 4HE1A 1SW4A 1AL3A 1NNPA 4U1OA 3T93B 2F6GA 4PFTA 4YB6A 3HN0A 1MY1A 2Z8DA 4BDOA 3PMVA 1CB6A 4TOZA 1ZJLA 2I49A 2X7QA 2O6AA 2H9BA 3VXBA 5JTYB 3SEXA 1IMEA 4P1LA 2Y5KA 2PX1A 1TXFA 1FPGA 3KZGA 4Q0CA 3OO9A 4P56A 1OMPA 3OXNA 2XX7A 4YB7A 1P1OA 3SEWA 5AA2B 4H8JA 4AB6A 1S9TA 3CSGA 2Q8JA 3TTKA 1NH8A 1FJ6A 4JWOA 4RY1A 2I0BA 4GVOA 1LGBC 1JQFA 2QRYA 1POY1 2XXTA 4DLDA 4OQOA 4YMBA 4YAHX 3SEUA 5AA1A 3UA8A 2PVUA 1WDNA 5DT6A 4KYSA 4MF3A 4QFOA 4PBHA 1FBPA 1B5JA 1B7UA 2CZLA 2RC8A 4OXVA 4F2OA 2ZYKA 4BDLA 5I2KB 5IZZA 1VR5A 4XEQA 1DK4A 1ZIUA 3IAZA 3OEMA 1Y20A 1Y3PA 4ZZEA 4PQJA 3TTRA 2B3FA 3CI8A 5DVJA 2QJEA 5AA4B 1G0IA 4PE5B 3LR1A 1MM7A 5BUUA 3A29A 4WEDA 3B7DA 1USYH 1FQFA 3DP4A 4F1UA 1N84A 4M1VA 4RNSA 2ZXTA 1XHYA 4WXJA 4C0RA 3BIHA 1QULA 2F6PA 5AA3A 1NV2A 4FECA 4PAFA 2H98A 1B7ZA 3BFUA 3O2AA 4R72A 5A5XB 1H44A 3MP8A 4F39A 4IO6A 4OEUA 1MRPA 3QXMA 1RKMA 4PAKA 4GWZA 4NF4B 4ZEDA 3U94A 1OLCA 4JBZA 1I6AA 4I1DA 1BP5A 4LP2B 4JVDA 1FSAA 1A99A 2XX9A 5DVIA 1NNFA 4O3AA 3OELA 2DVZA 1NL5A 3TTMA 2XD3A 4ISUA 1UTHA 3Q29A 3TCFA 4F2QA 1NV4A 1ZU0A 1D9YA 3G3KA 1EZOA 4TLMB 1JEVA 5IGAA 4NF5B 3T1BA 2G93A 4ND9A 3KN7A 3SERA 1NV3A 4PTKA 3MC2A 3MUQA 1B5IA 4THIA 4NQ8A 3FXRA 2L5VA 4LZ7A 2F36A 1LCFA 2I4CA 4PCDA 3CHGA 2WYPA 2H25A 3E4RA 3QIMA 4IO4A 2Q74A 4RA1A 3M3FA 4H1XA 3IOVA 3U8QA 5J16A 1MQJA 2QPQA 2Z8EA 3HSTA 1US5A 2PMSA 3FUZA 1FBFA 4N6KA 3IFAA 1RDXA 3TUSA 5H8NB 5EYHA 4QFPA 5HM4B 1M5CA 4DE8A 5EQ8A 3G3IA 3MWBA 3I5OA 3FBPA 2PFZA 3KN8A 3IO4A 4WKMA 3R7XA 4KR5A 2GFEA 5H8QA 1Q9DA 3U92A 1ATGA 5ITPA 5ITOA 2XXQA 3VVEA 4EQBA 1FPDA 2I58A 2OLBA 3G7WA 4NN3A 4ZEKA 5A5LA 1Y1ZA 1MY3A 3SZPA 2UYEA 3RT6B 4AS5A 1B58A 2HZLA 3JYRA 4N8YA 1B1HA 3LSFB 2AYSA 3CRBA 2QFLA 3C33A 3O97A 4QFLA 4TLLB 4NF5A 3PD9A 1Y3NA 4XFEA 3THIA 4KQPA 2FNCA 4MHFA 2DS9A 4F3PA 1IQ7A 2DWAA 3NOHA 3FXQA 4MMPA 3H6WA 4UABA 3HFUA 3UK4A 2FA7A 2AIXA 3VLWA 2WX9A 5CMMA 3HV1A 3FV1A 3K00A 1BLFA 4JVIA 1NMUA 4KFQA 4JVCA 4NGUA 1WVJA 3GLBA 4RPNA 3IORA 1LB8A 2UYFA 3P7IA 4HW8A 1OIBA 3EHTA 1S50A 3TPAA 3VDFA 3WAEA 3R26A 4R2FA 3MJNA 3KN3A 1MS7A 4KYDA 4EF1A 3FJMA 1D9VA 3M3LA 4G2ZA 4ELRA 4JSOA 3H6VA 2XWKA 4PETA 5AA2A 3ROJA 4FEDA 3TTNA 2OCUA 1RYOA 3S9LC 3SEVA 5FBPA 4LQ2A 3IL1B 2XWIA 2F34A 1MY4A 5AA2D 4ESXA 1SQYA 3RT8A 3KC0A 1FPIA 2X26A 1FTMA 5IZ3A 3Q25A 1A40A 1EH3A 1SD3A 2OWTA 5A5XA 1B51A 3LSLA 3N94A 2HFBA 3EPEA 3O6GA 2V3TA 1B9JA 3IB2A 1YZ0A 4N91A 2XHDA 1M5FA 3A3CA 3QMFA 4XKQA 3KEIA 2RC7A 1TFDA 3ODBA 5I7IA 1QUIA 4F19A 5BWJA 1B0HA 3FD3A 3U72A 2VPNA 3TKDA 1I69A 1I6BA 2DYXA 1MQDA 5JTYA 3M3KA 3RLFE 4PAIA 4OEVA 3IOUA 3OSRA 3TDJA 4NE4A 4EUOA 1MQGA 3G3FA 4YKPA 1A7LA 1MH3A 1IMDA 2O7IA 3A09A 3MVZA 4R9GA 4UA8A 4QSCA 2P0SA 1Y3QA 2WBDA 4QSEA 3K6VA 3H6TA 4MFIA 5I56B 1QGXA 1MXUA 3UP9A 4DXCA 4Z0IA 2NXOA 3LSWA 2PT2A 4GIZA 3K1MA 4NWDA 2F5XA 3BKIB 3MQ9A 2HXWA 4NWCA 2R71A 4OZ9A 1ZMGA 3BFTA 3E9XA 5LTCA 5EHSA 2YLNA 5I59B 3HO7A 4OERA 4H8IA 3ZS6A 2Y7IA 3O29A 4PFIA 2R6GE 5TPAB 3S9EA 4OVJA 1FPKA 1ZKBA 3DP6A 4IY6A 3C36A 5CM6A 1YPNA 4GOTA 4RK2A 4OESA 1CE2A 4O8MA 4PGPA 1FRPA 1NUWA 3UGWA 3UN6A 4XTCQ 3PPQA 1SI0A 4KCCA 2QS2A 1JEUA 5EQAA 1LBBA 1SBPA 5ET8A 4LA9A 5I58A 3KG2A 5F7VA 3PMWA 1J1NA 5H8SA 1JW1A 1II5A 2OWSA 4N6PA 1OQGA 4EF2A 1SYIA 2XXPA 2HAUA 1NV1A 2V93A 4RJZA 1LCTA 1H43A 1FBEA 3PUZE 5DEXB 2QL3A 1LBVA 4FIMA 1B46A 4P0IA 2DXRA 4F3SA 3MVWA 2FBPA 3IK6B 3IJOB 1MPCA 3H03A 5ISUA 1NV0A 4U1ZA 4HXVA 4PFBA 3OSQA 5H8NA 2I6EA 2OWZA 3H7MA 4GX6A 3MYUA 5TP9A 4G4PA 3VV5A 5CMCA 3CFZA 3O6HA 1D4NA 1OQHA 4N13A 4NMYA 3IJXB 4Q5TA 4N4UA 4OVSA 2O69A 3GZGA 4ZDMA 2RC9A 3I3VA 2PCRA 2F7CA 3TMGA 3MPLA 1FPEA 1NH7A 4EQ7A 4LZ8A 1FTOA 5ET5A 1MPBA 1P99A 2GHAA 1LBCA 4N81A 3E3KA 3TCHA 3FZVA 2PYYA 3PMXA 3KJ7A 4YU0A 3SEYA 2VT5A 2FVZA 4OA4A 2RINA 1PC3A 2A5TA 1MH4A 3B6WA 3N5LA 4MNCA 1Y9UA 1GTKA 5H8QB 4QFNA 1N3XA 5CI5A 4F31B 5DW8A 2PFYA 3LC8A 2WBBA 5L9OA 3QSLA 5HPQA 4Q30B 1SW1A 1UTHB 2CMOA 2OPDA 3CFLA 5TU0A 2Q88A 1NV7A 5L9MA 2VD3A 1MG1A 3RUMA 2GH9A 5FHOA 1DMBA 3L6GA 3MBPA 4F3GA 1K9YA 4MAGA 4IO3A 4OVQA 1B32A 4HTGA 3DLNA 5DTBA 4EXKA 4GX4A 4WEPA 5KDTB 1OVTA 4I62A 4OFLA 3DP8A 4POXA 4PE3A 2QS4A 3FXBA 3SESA 3L6HA 4KI0E 3GBBA 3PPNA 3LUYA 4JB7A 4NF6A 3M8UA 2HHMA 3SKPA 2DVCA 4C1UA 1JW4A 4PDDA 5ELVA 1NKXA 2B65A 4JWYA 1FQAA 3CSBA 5I2KA 2Z23A 1FW0A 4LZ5A 2ZYNA 2OJTA 3Q27A 1L5TA 4YICA 3KSJA 1DPEA 4NF0A 2ZNUA 2B4MA 4R75A 2O51A 3OD7A 1TFAA 4POWA 1FTLA 4BDMA 4TQUQ 1KWHA 2Q2CA 2REGA 3FVNA 2ALUA 1SDXA 3KOTA 5I5PA 1LFHA 3OO7A 1K9ZA 1IMFA 3GXAA 5CMKA 3ECRA 1QJMA 4NF8A 4FBPA 3TAJA 2LAOA 1DOTA 2ONRA 4OHNA 4N8GA 1N7XA 4U21A 5K2XA 4FJPA 2OZZA 4XKRA 4YKKA 2O84X 4NF6B 2GRVA 1EYIA 2XX8A 3KJTA 1EYKA 1FPLA 5FTIA 3K1PA 2OX3A 4OFJA 1N7WA 3PPPA 2Y84A 4XIGQ 2QVVA 2Y5LA 3OO6A 1NUYA 1PB8A 3SDFA 3ZSFA 1YCJA 3HHFA 3I6VA 3RNNA 1B6HA 1P1NA 1N3WA 1ELJA 3LUZA 1OVBA 3C9HA 1M5EA 4ZS9A 4LN5A 2FYIA 2I3VA 4OVPA 5K2YA 3EHSA 2E0SA 4X48A 4IB2A 3HHGA 1B5HA 4P9KA 4UACA 4GD5A 4Q8RA 1JNFA 3PUWE 4O3BA 3S4UA 4N15A 1FPJA 5JEIA 1IXCA 4QFKA 3U65A 3N6UA 3C32A 4PF8A 4QSDA 4ELPA 1P1QA 1VSOA 3VXCA 3T22A 4H6DA 4OFOA 5HBCA 2VP1A 3D4CA 2ZYMA 3IX1A 3UORA 1SW2A 3ZKKA 3TELA 1WODA 2QS1A 3C34A 5IAIA 4QBAA 2XXRA 2QMXA 1URSA 3QUFA 3QYTA 1B7HA 2PT1A 5I58B 2PBWA 5FTHA 1MY2A 3PPOA 3F11A 3CG3A 4HE0A 3FVGA 1D3KA 3WAFA 1EZPA 4P0GA 4GL8A 2F7BA 1DTZA 2ZZWA 2R9JA 3VLUA 1LBWA 3CG1A 3N6TA 3MAMA 4X1DA 1YAEA 4U23A 4EQ9A 4XF5A 2A5SA 2D3IA 1SYHA 3PV0E 1HSJA 3O66A 5CRYA 4NAPA 1B3EA 1BKAA 3T9VA 4DDDA 4F18A 1P1WA 2V25A 3MP6A 2F3BA 2IA4A 3IO6A 4EDPA 3GYYA 4BLAA 3IB1A 4BDRA 1RYXA 2JJKA 2QVRA 2ZMBA 3FVOA 4LATA 4I8CA 3K01A 2V3QA 5EQ9A 1VFEA 3N26A 1DSNA 1LBYA 4ZEFA 3TFLA 4MCOA 4IY5A 1FQDA 4JDFA 1JP4A 4AS4A 1B3GA 4PBQA 4DI4B 2XXIA 3VVDA 4QHQA 4YB5A 4I3YA 3EHUA 1LAGE 4ESWA 3K1NA 2F97A 4ELOA 5DVFA 3GBAA 1MDP1 5FHNA 4P11A 2DWIA 3OENA 3RTFB 1FPBA 1US4A 2P1SA 4H46A 2ZYOA 3V8XB 1QKBA 1DCUA 1BIYA 4L17A 2NVUB 4F29A 2ZZXA 2BJJX 1SW5A 3MVXA 2DSFA 1ANFA 1URGA 1LBXA 5KZTA 1LSTA 4O3CA 5H8FA 1IUDA 4PFRA 4LQ5A 4HE2A 4DXBA 2XXVA 3RGYA 3FV2A 1VE4A 4GQOA 4X8RA 3K4UA 4NEDA 3TQWA 3S9NC 3W15C 4GWUA 2KQZA 4H5FA 4PC9A 1MXYA 1F9BA 2DE4A 3T9HB 1H3DA 1H76A 4OTEA 3TZAA 4MNPA 1Q1KA 4I3EA 2KR0A 5IM2A 2CZIA 1LEVA 1XVXA 4MJOA 2P2AA 3RPLB 1FTKA 2REJA 3G3HA 4IO5A 4QXDA 2O1MA 3DM0A 4P47A 1R6ZA 3SETA 5DEXA 1LFGA 1MDQA 1M5DA 4G8NA 2P3NA 1IXIA 3C4MA 5CC2A 2XD2A 2A5TB 2V4CA 2XXUA 3ILTB 2O68A 5I2NB 1B52A 3RN8A 2D5WA 4R73A
chains in the Genus database with same CATH topology
3U65A 4NX1A 2CZHA 4I3YA 3W9VA 5IZZA 4I40A 2FIXA 2CEYA 5F24A 4PF8A 4MNIA 2FHYA 5EQAA 1NV3A 4HE1A 1FBDA 4PTKA 4PDHA 5ET8A 1IMBA 1FBCA 3E79A 4JVIA 4PAIA 4JVCA 1DK4A 4NGUA 4XEQA 2VT5A 1G0HA 3RYDA 4YICA 4NQ8A 4OANA 3LV0A 1D9QA 4GWWA 4HCWA 4P3LA 1FPBA 2XA5A 2FVZA 2L5VA 1INPA 4NF0A 4OA4A 5IZ1A 4PCDA 1NUXA 1NV6A 3T0JA 3CHGA 2WYPA 4H46A 1KA1A 2DE2A 2B4MA 2F3DA 2Q74A 4QBAA 4MNCA 4P1LA 3T1BA 1DCUA 5ET7A 1IMDA 1YXIA 1NV1A 5IZ3B 1G0IA 5J16A 2QPQA 1NV5A 2CZKA 4G61A 2P3VA 2ZZXA 1FBEA 1FBFA 1BK4A 1KA0A 1RDZA 1IMEA 5DW8A 4N6DA 2Y5KA 4KXPA 1NI9A 2BJIA 4HE0A 5LDZA 2PFYA 2VPOA 4N6KA 3A29A 5ET6A 5LTCA 5I5PA 2MKZA 2WBBA 1AWBA 1LBVA 1RDXA 2WBDA 1FPGA 3IFAA 4YZZA 5EYHA 4IR8A 4OVTA 4P56A 1LBXA 2R8TA 4F1UA 1K9ZA 4F19A 1QGXA 2ZZWA 5J1DA 5EQ8A 1IMFA 2DE3A 3B50A 2FBPA 4PGNA 1LBWA 4X9TA 3FBPA 2PFZA 3MSTA 4M1VA 4MEVA 4PFRA 3PTYA 1YYZA 4FBPA 1FBGA 4GBVA 4HE2A 1NV7A 2CEXA 3BIHA 2QVUA 4N8GA 1Q9DA 1NV2A 2XWKA 4PETA 1DBZA 3E78A 1NV0A 4XF5A 3ROJA 3RPLA 2F5XA 1FJ9A 4PAFA 4HXVA 3ISPA 4PFBA 4X8RA 1FPDA 4O7MA 2OWZA 2B4LA 4GX6A 3MYUA 4NN3A 4GWUA 2KQZA 1EYIA 4NAPA 1K9YA 4P8BA 1EYKA 1FJ6A 5FBPA 1IMAA 5A5LA 2ZZVA 4MAGA 4PC9A 4F18A 4GBWA 3EKIA 1FPLA 2FIEA 4GWYA 2XWOA 4OVQA 2HPGA 3SZPA 4F1VA 2DE4A 4AS5A 4GWZA 2XWIA 4PAKA 4N8YA 2HZLA 4GX4A 1LBZA 1SPIA 2OX3A 4HCYA 4MIJA 4MNPA 4N17A 2HZKA 4P1EA 2F3BA 1CNQA 1EYJA 5T3JA 2QVVA 3D1RA 4I3EA 2KR0A 5ESYA 2Q9TA 4O94A 2CZIA 2WEFA 2Y5LA 5IM2A 1LEVA 3KBZA 1NUYA 4MJOA 3GYYA 3KC0A 4N4UA 1FPIA 2QFLA 4PFIA 4OVSA 3KC1A 4JVDA 1FSAA 2JJKA 4PE3A 2QVRA 5JK4A 3RPLB 3FXBA 1VDWA 4NHBA 1FPKA 2XWVA 2V3QA 4QXDA 5EQ7A 2PCRA 3LUZA 5IZ3A 2Q8MA 5CM6A 2XXKA 4P47A 2DVZA 5EQ9A 4LN5A 4H45A 1NUZA 2GQ1A 4OVPA 1IMCA 5EYGA 4PBHA 2HHMA 3IFCA 4XFEA 1FPEA 4DI3D 1YZ0A 4N91A 2P3NA 1FBPA 4MHFA 1LBYA 4O8MA 1FTAA 4P9KA 1XI6A 3QMFA 4NG7A 4PGPA 4PF6A 5ET5A 4MCOA 4PDDA 5I7IA 4OVRA 1FRPA 2WYKA 1NV4A 4GX3A 1JP4A 1NUWA 4AS4A 1FPFA 3NOHA 4PBQA 4MMPA 4O7IA 4GWXA 2HXRA 4UABA 3HFUA 3W9WA 2V4CA 3BIGA 1RDYA 4DI4B 1FBHA 4N15A 1FPJA 4MX6A 1KZ8A 4GWSA 4N81A 5IGAA 4X04A 5I3SA 3B8BA 2VPNA 2DDKA 2WX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZH A;  4I3Y A;  4I40 A;  2FIX A;  5F24 A;  2FHY A;  5EQA A;  1NV3 A;  4HE1 A;  1FBD A;  4PTK A;  5ET8 A;  1IMB A;  1FBC A;  1DK4 A;  2VT5 A;  1G0H A;  3RYD A;  3LV0 A;  1D9Q A;  4GWW A;  1FPB A;  2FVZ A;  1INP A;  5IZ1 A;  1NUX A;  1NV6 A;  3T0J A;  4H46 A;  1KA1 A;  2F3D A;  2Q74 A;  1DCU A;  5ET7 A;  1IMD A;  1YXI A;  1NV1 A;  5IZ3 B;  1G0I A;  5J16 A;  1NV5 A;  2CZK A;  4G61 A;  2P3V A;  1FBE A;  1FBF A;  1BK4 A;  1KA0 A;  1RDZ A;  1IME A;  5DW8 A;  2Y5K A;  4KXP A;  1NI9 A;  2BJI A;  4HE0 A;  5LDZ A;  3A29 A;  5ET6 A;  2WBB A;  1AWB A;  1LBV A;  1RDX A;  2WBD A;  1FPG A;  3IFA A;  5EYH A;  4IR8 A;  1LBX A;  2R8T A;  1K9Z A;  1QGX A;  5EQ8 A;  1IMF A;  2FBP A;  1LBW A;  3FBP A;  1YYZ A;  4FBP A;  1FBG A;  4GBV A;  4HE2 A;  1NV7 A;  3BIH A;  2QVU A;  1Q9D A;  1NV2 A;  1DBZ A;  1NV0 A;  3ROJ A;  3RPL A;  1FJ9 A;  4HXV A;  1FPD A;  2OWZ A;  4GX6 A;  4GWU A;  1EYI A;  1K9Y A;  1EYK A;  1FJ6 A;  5FBP A;  1IMA A;  5A5L A;  4GBW A;  1FPL A;  2FIE A;  4GWY A;  4AS5 A;  4GWZ A;  4GX4 A;  1LBZ A;  1SPI A;  2OX3 A;  2F3B A;  1CNQ A;  1EYJ A;  5T3J A;  2QVV A;  3D1R A;  4I3E A;  5ESY A;  2CZI A;  2WEF A;  2Y5L A;  1LEV A;  3KBZ A;  1NUY A;  4MJO A;  3KC0 A;  1FPI A;  2QFL A;  3KC1 A;  1FSA A;  2JJK A;  2QVR A;  3RPL B;  1VDW A;  1FPK A;  4QXD A;  5EQ7 A;  2PCR A;  3LUZ A;  5IZ3 A;  2Q8M A;  5EQ9 A;  4H45 A;  1NUZ A;  2GQ1 A;  1IMC A;  5EYG A;  2HHM A;  3IFC A;  1FPE A;  1YZ0 A;  2P3N A;  1FBP A;  1LBY A;  1FTA A;  1XI6 A;  3QMF A;  5ET5 A;  1FRP A;  1NV4 A;  4GX3 A;  1JP4 A;  1NUW A;  4AS4 A;  1FPF A;  4O7I A;  4GWX A;  3BIG A;  1RDY A;  1FBH A;  1FPJ A;  1KZ8 A;  4GWS A;  4N81 A;  5I3S A;  3B8B A;  2DDK A; 
#chains in the Genus database with same CATH topology
 3RY3 A;  4GWO A;  1VFD A;  2G29 A;  1FBC A;  1TT1 A;  1UIU A;  1B0L A;  4OAN A;  1FQB A;  2ZNT A;  1NV6 A;  1PBQ A;  3FAS A;  4KPT A;  1PB7 A;  4DIG A;  2GHB A;  2YPN A;  4G61 A;  3C31 A;  4OEN A;  1BK4 A;  4R6Y A;  2HEU A;  1IIT A;  5LDZ A;  2BJI A;  1EZ9 A;  2DWH A;  1R9Q A;  2W7Y A;  4MH5 A;  1SVX B;  5J1D A;  4E0X A;  1A8F A;  2I0C A;  2VD2 A;  3JV9 A;  4KCD A;  5LOM A;  3PTY A;  3MW0 A;  2RKM A;  2V3U A;  3FJ7 A;  3RPL A;  1JVY A;  4IGR A;  5KCJ A;  3EF7 A;  3QAX A;  4F3B A;  4MIJ A;  1LAH E;  2HZK A;  1CNQ A;  1DPP A;  4YZZ A;  4FAT A;  2WEF A;  4LON B;  3KBZ A;  4MLQ A;  1O7T A;  3E13 X;  1VDW A;  5EQ7 A;  1Z7N E;  2Q8M A;  1MM6 A;  2Z8F A;  1R9L A;  3PU5 A;  4XXU A;  1Q35 A;  1S7Y A;  3IFC A;  2DP8 A;  4RYA A;  3MZB A;  1XI6 A;  2QSX A;  3TYH A;  1A54 A;  3KFM A;  3W9W A;  2RCA A;  3T66 A;  4NX1 A;  3TEP A;  2FHY A;  2HCA A;  1FBD A;  3OO8 A;  3IOW A;  4HCW A;  3RTW B;  3K02 A;  1AIV A;  3T0J A;  2DE2 A;  2ONS A;  1PBP A;  3TOD A;  5B7D A;  1MQH A;  1QVS A;  2KLF A;  4KD5 A;  4ZE8 A;  4ZEI A;  5ET6 A;  1SI1 A;  1Y1M A;  3OOA A;  4OYV A;  5B70 A;  5CMB A;  4MEV A;  1A55 A;  1YYZ A;  2H4I A;  4E0W A;  1P1U A;  4I9D A;  3E78 A;  2VGQ A;  1FJ9 A;  4O7M A;  2B4L A;  2ANJ A;  4GFR A;  5M2V A;  5TP9 B;  1B05 A;  3U93 A;  4G8M A;  1YTV A;  4GWY A;  2FIE A;  4G68 B;  2F8D A;  4F1V A;  4ELQ A;  3VFJ A;  4HCY A;  2X7P A;  1EYJ A;  5ESY A;  1POT A;  1FCK A;  4FE8 A;  2XXW A;  1URD A;  1DTG A;  5CBS A;  3KC1 A;  5JK4 A;  1O64 A;  4NHB A;  2Y7P A;  4R9F A;  5AA4 A;  3TTL A;  1NUZ A;  5EYG A;  1O63 A;  3V89 B;  5KCJ B;  1B3L A;  5I56 A;  2Z22 A;  4IGT A;  4GLI A;  1Y4T A;  3ONM A;  3B6T A;  2HXR A;  4MX6 A;  3R6U A;  4GWS A;  2I3W A;  3K2D A;  4H67 A;  3T9U A;  2CZH A;  2FIX A;  2I48 A;  3CR9 A;  1B3H A;  3MVY A;  1LAX A;  3K6W A;  4GWW A;  5EHM A;  1INP A;  2UVI A;  5IZ1 A;  1Y4C A;  2D21 A;  4OET A;  4JWX A;  2HQ0 A;  1JVX A;  4OWD A;  1HSL A;  5IZ3 B;  5TPA A;  4GL0 A;  2H99 A;  2CZK A;  1RDZ A;  3D4G A;  4N6D A;  1AWB A;  4H5G A;  4RK9 A;  4IR8 A;  3K0V A;  3RPW A;  4X9T A;  3OEK A;  4IO2 A;  1XT8 A;  1PEB A;  2AL5 A;  2DQV A;  1BTJ A;  1Z7M E;  4FEB A;  1FQC A;  1H45 A;  4ECF A;  5ICQ A;  4R6H A;  1NFT A;  4X1B A;  1B1X A;  2NUV A;  4GRK A;  4P8B A;  4PFU A;  1I6Q A;  3VVF A;  5EYF A;  1QUK A;  3LSX A;  1USY E;  5KDT A;  1HSE A;  4QRZ A;  2XXK A;  1T0K A;  4MBP A;  4H0W A;  1N0T A;  4DI3 D;  3H4Z A;  1AH5 A;  4DXU A;  3PUV E;  1OLA A;  4NF8 B;  4GX3 A;  4KYE A;  1FPF A;  2DWJ A;  4GWX A;  1ZLQ A;  1RDY A;  1KZ8 A;  3QK6 A;  3VE1 B;  5I3S A;  5I2N A;  1GGG A;  4LUB A;  1TWY A;  3PD8 A;  2V84 A;  2OK2 A;  5I59 A;  4PFW A;  3RYD A;  1D9Q A;  4P3L A;  3PPR A;  3IOT A;  1MXX A;  2O7U A;  3K6X A;  4BDQ A;  2F78 A;  3FAT A;  4Z7E A;  3CFX A;  4XKP A;  3TCG A;  3O9P A;  5ET7 A;  1YXI A;  4EXL A;  4DZ1 A;  2P3V A;  1AMF A;  2XXY A;  2VPO A;  4C1T A;  1PB9 A;  2OPE A;  3K6U A;  1QW0 A;  4OVT A;  2HAV A;  1MXV A;  2R8T A;  4DCY A;  4PGN A;  3AXF A;  3MST A;  3O6I A;  3V83 A;  2DOJ A;  4OMB A;  1FBG A;  1GVC A;  1DBZ A;  3IB0 A;  4FAJ A;  4K3F A;  4RXL A;  3A3U A;  3O28 A;  1ZTY A;  4G68 C;  4GBW A;  3EKI A;  2XWO A;  2HPG A;  4KHZ E;  1IEJ A;  1LBZ A;  4N17 A;  5DYH A;  4O94 A;  1M5B A;  1UIV A;  3FXU A;  4XKN A;  2XWV A;  1XVY A;  2VHA A;  4H45 A;  4GXS B;  3JZJ A;  1IMC A;  1LB9 A;  1JW5 A;  5L9S A;  3PUX E;  3LBS A;  4PF6 A;  1UTB B;  4R6K A;  2WYK A;  5H8F B;  4O7I A;  1IZ1 A;  1FBH A;  2XXH A;  3MPK A;  4G8H A;  3FIR A;  2DDK A;  4G77 A;  5IKB A;  2DXY A;  4I40 A;  1NNK A;  4PDH A;  1B4H A;  1IMB A;  2UVJ A;  1NNT A;  4DCX A;  1G0H A;  1N04 A;  3LV0 A;  2ONK E;  3Q26 A;  2XA5 A;  4YMA A;  1NUX A;  4YKI A;  1KA1 A;  3QUJ A;  1QKA A;  3HPI A;  4F1Y A;  4F22 A;  4JSD A;  2ESN A;  1NV5 A;  2I4B A;  1ZBM A;  4ZZA A;  1NI9 A;  1IXH A;  2MKZ A;  2F7A A;  3CVG A;  5I57 B;  3MZ1 A;  2THI A;  5H8H B;  3TQL A;  1LLS A;  4ZE9 A;  2DE3 A;  4H65 A;  2WKY A;  3KBR A;  3FGS A;  2QVU A;  2AL4 A;  2UXA A;  3T96 B;  5FHM A;  4GXA A;  3B6Q A;  2QMW A;  3PGF A;  2B3B A;  2Q2A A;  2UVH A;  4NF4 A;  4U2R A;  1SPI A;  5CBR A;  3ZKL A;  3HCQ A;  4P1E A;  1LAF E;  5T3J A;  3D1R A;  1QUJ A;  2Q9T A;  3C35 A;  4QF9 A;  2ZNS A;  1B40 A;  3OMB A;  3U1O A;  1B2H A;  1MQI A;  1EU8 A;  1FTJ A;  4G68 A;  1LFI A;  3H6U A;  1IXG A;  3S9M C;  3ILU B;  4AQ4 A;  2GQ1 A;  1JET A;  4BDN A;  3USD A;  1FTA A;  1B4Z A;  4OVR A;  4ZEC A;  4MLV A;  2H5Y A;  1GV8 A;  3BIG A;  4NTL A;  4X04 A;  1MXZ A;  5F1Q A;  1AOV A;  3EN3 A;  3KSX A;  3G3G A;  1R1N A;  1XC1 A;  5F24 A;  3S2V A;  4MNI A;  4HS7 A;  2Y7W A;  3E79 A;  4N07 A;  1MPD A;  5I57 A;  4R74 A;  2VOZ A;  4U4X A;  4ONY A;  4U4S A;  3IR1 A;  2F3D A;  2E1S A;  1UTB A;  2O1L A;  3G3J A;  3PUY E;  3FVK A;  5I84 A;  1KA0 A;  4R2B A;  4ZEB A;  4KXP A;  2ABH A;  3KGC A;  3V5A A;  1N76 A;  3DEL B;  3CIJ A;  3MP1 A;  4AB5 A;  3B50 A;  4JXI A;  5ICT A;  4U22 A;  3BBR A;  4GBV A;  2NOO A;  2CEX A;  2XXX A;  4RPO A;  4LVQ A;  2IEE A;  1XOC A;  1GR2 A;  2Y7R A;  1IIW A;  1MXW A;  3ISP A;  3T9X B;  4IO7 A;  5AE4 A;  2RF1 A;  3UIF A;  4PFY A;  2ZZV A;  1IMA A;  1XS5 A;  3H3G A;  3RQT A;  1UQW A;  2OBG A;  5L8D A;  2F35 A;  3KOS A;  5H8H A;  4PP0 A;  4FOR A;  3MZ9 A;  3FJG A;  1B3F A;  2YJP A;  3EQ1 A;  3H06 B;  2Q89 A;  3Q28 A;  2NWJ A;  2RCB A;  4M4G A;  1PDA A;  4NG7 A;  1FQE A;  1MY0 A;  2QS3 A;  4GF8 A;  4YKJ A;  2UVG A;  2Y7K A;  3B8B A;  2M8C A;  1A8E A;  3W9V A;  2CEY A;  3VLV A;  4HE1 A;  1SW4 A;  1AL3 A;  1NNP A;  4U1O A;  3T93 B;  2F6G A;  4PFT A;  4YB6 A;  3HN0 A;  1MY1 A;  2Z8D A;  4BDO A;  3PMV A;  1CB6 A;  4TOZ A;  1ZJL A;  2I49 A;  2X7Q A;  2O6A A;  2H9B A;  3VXB A;  5JTY B;  3SEX A;  1IME A;  4P1L A;  2Y5K A;  2PX1 A;  1TXF A;  1FPG A;  3KZG A;  4Q0C A;  3OO9 A;  4P56 A;  1OMP A;  3OXN A;  2XX7 A;  4YB7 A;  1P1O A;  3SEW A;  5AA2 B;  4H8J A;  4AB6 A;  1S9T A;  3CSG A;  2Q8J A;  3TTK A;  1NH8 A;  1FJ6 A;  4JWO A;  4RY1 A;  2I0B A;  4GVO A;  1LGB C;  1JQF A;  2QRY A;  1POY 1;  2XXT A;  4DLD A;  4OQO A;  4YMB A;  4YAH X;  3SEU A;  5AA1 A;  3UA8 A;  2PVU A;  1WDN A;  5DT6 A;  4KYS A;  4MF3 A;  4QFO A;  4PBH A;  1FBP A;  1B5J A;  1B7U A;  2CZL A;  2RC8 A;  4OXV A;  4F2O A;  2ZYK A;  4BDL A;  5I2K B;  5IZZ A;  1VR5 A;  4XEQ A;  1DK4 A;  1ZIU A;  3IAZ A;  3OEM A;  1Y20 A;  1Y3P A;  4ZZE A;  4PQJ A;  3TTR A;  2B3F A;  3CI8 A;  5DVJ A;  2QJE A;  5AA4 B;  1G0I A;  4PE5 B;  3LR1 A;  1MM7 A;  5BUU A;  3A29 A;  4WED A;  3B7D A;  1USY H;  1FQF A;  3DP4 A;  4F1U A;  1N84 A;  4M1V A;  4RNS A;  2ZXT A;  1XHY A;  4WXJ A;  4C0R A;  3BIH A;  1QUL A;  2F6P A;  5AA3 A;  1NV2 A;  4FEC A;  4PAF A;  2H98 A;  1B7Z A;  3BFU A;  3O2A A;  4R72 A;  5A5X B;  1H44 A;  3MP8 A;  4F39 A;  4IO6 A;  4OEU A;  1MRP A;  3QXM A;  1RKM A;  4PAK A;  4GWZ A;  4NF4 B;  4ZED A;  3U94 A;  1OLC A;  4JBZ A;  1I6A A;  4I1D A;  1BP5 A;  4LP2 B;  4JVD A;  1FSA A;  1A99 A;  2XX9 A;  5DVI A;  1NNF A;  4O3A A;  3OEL A;  2DVZ A;  1NL5 A;  3TTM A;  2XD3 A;  4ISU A;  1UTH A;  3Q29 A;  3TCF A;  4F2Q A;  1NV4 A;  1ZU0 A;  1D9Y A;  3G3K A;  1EZO A;  4TLM B;  1JEV A;  5IGA A;  4NF5 B;  3T1B A;  2G93 A;  4ND9 A;  3KN7 A;  3SER A;  1NV3 A;  4PTK A;  3MC2 A;  3MUQ A;  1B5I A;  4THI A;  4NQ8 A;  3FXR A;  2L5V A;  4LZ7 A;  2F36 A;  1LCF A;  2I4C A;  4PCD A;  3CHG A;  2WYP A;  2H25 A;  3E4R A;  3QIM A;  4IO4 A;  2Q74 A;  4RA1 A;  3M3F A;  4H1X A;  3IOV A;  3U8Q A;  5J16 A;  1MQJ A;  2QPQ A;  2Z8E A;  3HST A;  1US5 A;  2PMS A;  3FUZ A;  1FBF A;  4N6K A;  3IFA A;  1RDX A;  3TUS A;  5H8N B;  5EYH A;  4QFP A;  5HM4 B;  1M5C A;  4DE8 A;  5EQ8 A;  3G3I A;  3MWB A;  3I5O A;  3FBP A;  2PFZ A;  3KN8 A;  3IO4 A;  4WKM A;  3R7X A;  4KR5 A;  2GFE A;  5H8Q A;  1Q9D A;  3U92 A;  1ATG A;  5ITP A;  5ITO A;  2XXQ A;  3VVE A;  4EQB A;  1FPD A;  2I58 A;  2OLB A;  3G7W A;  4NN3 A;  4ZEK A;  5A5L A;  1Y1Z A;  1MY3 A;  3SZP A;  2UYE A;  3RT6 B;  4AS5 A;  1B58 A;  2HZL A;  3JYR A;  4N8Y A;  1B1H A;  3LSF B;  2AYS A;  3CRB A;  2QFL A;  3C33 A;  3O97 A;  4QFL A;  4TLL B;  4NF5 A;  3PD9 A;  1Y3N A;  4XFE A;  3THI A;  4KQP A;  2FNC A;  4MHF A;  2DS9 A;  4F3P A;  1IQ7 A;  2DWA A;  3NOH A;  3FXQ A;  4MMP A;  3H6W A;  4UAB A;  3HFU A;  3UK4 A;  2FA7 A;  2AIX A;  3VLW A;  2WX9 A;  5CMM A;  3HV1 A;  3FV1 A;  3K00 A;  1BLF A;  4JVI A;  1NMU A;  4KFQ A;  4JVC A;  4NGU A;  1WVJ A;  3GLB A;  4RPN A;  3IOR A;  1LB8 A;  2UYF A;  3P7I A;  4HW8 A;  1OIB A;  3EHT A;  1S50 A;  3TPA A;  3VDF A;  3WAE A;  3R26 A;  4R2F A;  3MJN A;  3KN3 A;  1MS7 A;  4KYD A;  4EF1 A;  3FJM A;  1D9V A;  3M3L A;  4G2Z A;  4ELR A;  4JSO A;  3H6V A;  2XWK A;  4PET A;  5AA2 A;  3ROJ A;  4FED A;  3TTN A;  2OCU A;  1RYO A;  3S9L C;  3SEV A;  5FBP A;  4LQ2 A;  3IL1 B;  2XWI A;  2F34 A;  1MY4 A;  5AA2 D;  4ESX A;  1SQY A;  3RT8 A;  3KC0 A;  1FPI A;  2X26 A;  1FTM A;  5IZ3 A;  3Q25 A;  1A40 A;  1EH3 A;  1SD3 A;  2OWT A;  5A5X A;  1B51 A;  3LSL A;  3N94 A;  2HFB A;  3EPE A;  3O6G A;  2V3T A;  1B9J A;  3IB2 A;  1YZ0 A;  4N91 A;  2XHD A;  1M5F A;  3A3C A;  3QMF A;  4XKQ A;  3KEI A;  2RC7 A;  1TFD A;  3ODB A;  5I7I A;  1QUI A;  4F19 A;  5BWJ A;  1B0H A;  3FD3 A;  3U72 A;  2VPN A;  3TKD A;  1I69 A;  1I6B A;  2DYX A;  1MQD A;  5JTY A;  3M3K A;  3RLF E;  4PAI A;  4OEV A;  3IOU A;  3OSR A;  3TDJ A;  4NE4 A;  4EUO A;  1MQG A;  3G3F A;  4YKP A;  1A7L A;  1MH3 A;  1IMD A;  2O7I A;  3A09 A;  3MVZ A;  4R9G A;  4UA8 A;  4QSC A;  2P0S A;  1Y3Q A;  2WBD A;  4QSE A;  3K6V A;  3H6T A;  4MFI A;  5I56 B;  1QGX A;  1MXU A;  3UP9 A;  4DXC A;  4Z0I A;  2NXO A;  3LSW A;  2PT2 A;  4GIZ A;  3K1M A;  4NWD A;  2F5X A;  3BKI B;  3MQ9 A;  2HXW A;  4NWC A;  2R71 A;  4OZ9 A;  1ZMG A;  3BFT A;  3E9X A;  5LTC A;  5EHS A;  2YLN A;  5I59 B;  3HO7 A;  4OER A;  4H8I A;  3ZS6 A;  2Y7I A;  3O29 A;  4PFI A;  2R6G E;  5TPA B;  3S9E A;  4OVJ A;  1FPK A;  1ZKB A;  3DP6 A;  4IY6 A;  3C36 A;  5CM6 A;  1YPN A;  4GOT A;  4RK2 A;  4OES A;  1CE2 A;  4O8M A;  4PGP A;  1FRP A;  1NUW A;  3UGW A;  3UN6 A;  4XTC Q;  3PPQ A;  1SI0 A;  4KCC A;  2QS2 A;  1JEU A;  5EQA A;  1LBB A;  1SBP A;  5ET8 A;  4LA9 A;  5I58 A;  3KG2 A;  5F7V A;  3PMW A;  1J1N A;  5H8S A;  1JW1 A;  1II5 A;  2OWS A;  4N6P A;  1OQG A;  4EF2 A;  1SYI A;  2XXP A;  2HAU A;  1NV1 A;  2V93 A;  4RJZ A;  1LCT A;  1H43 A;  1FBE A;  3PUZ E;  5DEX B;  2QL3 A;  1LBV A;  4FIM A;  1B46 A;  4P0I A;  2DXR A;  4F3S A;  3MVW A;  2FBP A;  3IK6 B;  3IJO B;  1MPC A;  3H03 A;  5ISU A;  1NV0 A;  4U1Z A;  4HXV A;  4PFB A;  3OSQ A;  5H8N A;  2I6E A;  2OWZ A;  3H7M A;  4GX6 A;  3MYU A;  5TP9 A;  4G4P A;  3VV5 A;  5CMC A;  3CFZ A;  3O6H A;  1D4N A;  1OQH A;  4N13 A;  4NMY A;  3IJX B;  4Q5T A;  4N4U A;  4OVS A;  2O69 A;  3GZG A;  4ZDM A;  2RC9 A;  3I3V A;  2PCR A;  2F7C A;  3TMG A;  3MPL A;  1FPE A;  1NH7 A;  4EQ7 A;  4LZ8 A;  1FTO A;  5ET5 A;  1MPB A;  1P99 A;  2GHA A;  1LBC A;  4N81 A;  3E3K A;  3TCH A;  3FZV A;  2PYY A;  3PMX A;  3KJ7 A;  4YU0 A;  3SEY A;  2VT5 A;  2FVZ A;  4OA4 A;  2RIN A;  1PC3 A;  2A5T A;  1MH4 A;  3B6W A;  3N5L A;  4MNC A;  1Y9U A;  1GTK A;  5H8Q B;  4QFN A;  1N3X A;  5CI5 A;  4F31 B;  5DW8 A;  2PFY A;  3LC8 A;  2WBB A;  5L9O A;  3QSL A;  5HPQ A;  4Q30 B;  1SW1 A;  1UTH B;  2CMO A;  2OPD A;  3CFL A;  5TU0 A;  2Q88 A;  1NV7 A;  5L9M A;  2VD3 A;  1MG1 A;  3RUM A;  2GH9 A;  5FHO A;  1DMB A;  3L6G A;  3MBP A;  4F3G A;  1K9Y A;  4MAG A;  4IO3 A;  4OVQ A;  1B32 A;  4HTG A;  3DLN A;  5DTB A;  4EXK A;  4GX4 A;  4WEP A;  5KDT B;  1OVT A;  4I62 A;  4OFL A;  3DP8 A;  4POX A;  4PE3 A;  2QS4 A;  3FXB A;  3SES A;  3L6H A;  4KI0 E;  3GBB A;  3PPN A;  3LUY A;  4JB7 A;  4NF6 A;  3M8U A;  2HHM A;  3SKP A;  2DVC A;  4C1U A;  1JW4 A;  4PDD A;  5ELV A;  1NKX A;  2B65 A;  4JWY A;  1FQA A;  3CSB A;  5I2K A;  2Z23 A;  1FW0 A;  4LZ5 A;  2ZYN A;  2OJT A;  3Q27 A;  1L5T A;  4YIC A;  3KSJ A;  1DPE A;  4NF0 A;  2ZNU A;  2B4M A;  4R75 A;  2O51 A;  3OD7 A;  1TFA A;  4POW A;  1FTL A;  4BDM A;  4TQU Q;  1KWH A;  2Q2C A;  2REG A;  3FVN A;  2ALU A;  1SDX A;  3KOT A;  5I5P A;  1LFH A;  3OO7 A;  1K9Z A;  1IMF A;  3GXA A;  5CMK A;  3ECR A;  1QJM A;  4NF8 A;  4FBP A;  3TAJ A;  2LAO A;  1DOT A;  2ONR A;  4OHN A;  4N8G A;  1N7X A;  4U21 A;  5K2X A;  4FJP A;  2OZZ A;  4XKR A;  4YKK A;  2O84 X;  4NF6 B;  2GRV A;  1EYI A;  2XX8 A;  3KJT A;  1EYK A;  1FPL A;  5FTI A;  3K1P A;  2OX3 A;  4OFJ A;  1N7W A;  3PPP A;  2Y84 A;  4XIG Q;  2QVV A;  2Y5L A;  3OO6 A;  1NUY A;  1PB8 A;  3SDF A;  3ZSF A;  1YCJ A;  3HHF A;  3I6V A;  3RNN A;  1B6H A;  1P1N A;  1N3W A;  1ELJ A;  3LUZ A;  1OVB A;  3C9H A;  1M5E A;  4ZS9 A;  4LN5 A;  2FYI A;  2I3V A;  4OVP A;  5K2Y A;  3EHS A;  2E0S A;  4X48 A;  4IB2 A;  3HHG A;  1B5H A;  4P9K A;  4UAC A;  4GD5 A;  4Q8R A;  1JNF A;  3PUW E;  4O3B A;  3S4U A;  4N15 A;  1FPJ A;  5JEI A;  1IXC A;  4QFK A;  3U65 A;  3N6U A;  3C32 A;  4PF8 A;  4QSD A;  4ELP A;  1P1Q A;  1VSO A;  3VXC A;  3T22 A;  4H6D A;  4OFO A;  5HBC A;  2VP1 A;  3D4C A;  2ZYM A;  3IX1 A;  3UOR A;  1SW2 A;  3ZKK A;  3TEL A;  1WOD A;  2QS1 A;  3C34 A;  5IAI A;  4QBA A;  2XXR A;  2QMX A;  1URS A;  3QUF A;  3QYT A;  1B7H A;  2PT1 A;  5I58 B;  2PBW A;  5FTH A;  1MY2 A;  3PPO A;  3F11 A;  3CG3 A;  4HE0 A;  3FVG A;  1D3K A;  3WAF A;  1EZP A;  4P0G A;  4GL8 A;  2F7B A;  1DTZ A;  2ZZW A;  2R9J A;  3VLU A;  1LBW A;  3CG1 A;  3N6T A;  3MAM A;  4X1D A;  1YAE A;  4U23 A;  4EQ9 A;  4XF5 A;  2A5S A;  2D3I A;  1SYH A;  3PV0 E;  1HSJ A;  3O66 A;  5CRY A;  4NAP A;  1B3E A;  1BKA A;  3T9V A;  4DDD A;  4F18 A;  1P1W A;  2V25 A;  3MP6 A;  2F3B A;  2IA4 A;  3IO6 A;  4EDP A;  3GYY A;  4BLA A;  3IB1 A;  4BDR A;  1RYX A;  2JJK A;  2QVR A;  2ZMB A;  3FVO A;  4LAT A;  4I8C A;  3K01 A;  2V3Q A;  5EQ9 A;  1VFE A;  3N26 A;  1DSN A;  1LBY A;  4ZEF A;  3TFL A;  4MCO A;  4IY5 A;  1FQD A;  4JDF A;  1JP4 A;  4AS4 A;  1B3G A;  4PBQ A;  4DI4 B;  2XXI A;  3VVD A;  4QHQ A;  4YB5 A;  4I3Y A;  3EHU A;  1LAG E;  4ESW A;  3K1N A;  2F97 A;  4ELO A;  5DVF A;  3GBA A;  1MDP 1;  5FHN A;  4P11 A;  2DWI A;  3OEN A;  3RTF B;  1FPB A;  1US4 A;  2P1S A;  4H46 A;  2ZYO A;  3V8X B;  1QKB A;  1DCU A;  1BIY A;  4L17 A;  2NVU B;  4F29 A;  2ZZX A;  2BJJ X;  1SW5 A;  3MVX A;  2DSF A;  1ANF A;  1URG A;  1LBX A;  5KZT A;  1LST A;  4O3C A;  5H8F A;  1IUD A;  4PFR A;  4LQ5 A;  4HE2 A;  4DXB A;  2XXV A;  3RGY A;  3FV2 A;  1VE4 A;  4GQO A;  4X8R A;  3K4U A;  4NED A;  3TQW A;  3S9N C;  3W15 C;  4GWU A;  2KQZ A;  4H5F A;  4PC9 A;  1MXY A;  1F9B A;  2DE4 A;  3T9H B;  1H3D A;  1H76 A;  4OTE A;  3TZA A;  4MNP A;  1Q1K A;  4I3E A;  2KR0 A;  5IM2 A;  2CZI A;  1LEV A;  1XVX A;  4MJO A;  2P2A A;  3RPL B;  1FTK A;  2REJ A;  3G3H A;  4IO5 A;  4QXD A;  2O1M A;  3DM0 A;  4P47 A;  1R6Z A;  3SET A;  5DEX A;  1LFG A;  1MDQ A;  1M5D A;  4G8N A;  2P3N A;  1IXI A;  3C4M A;  5CC2 A;  2XD2 A;  2A5T B;  2V4C A;  2XXU A;  3ILT B;  2O68 A;  5I2N B;  1B52 A;  3RN8 A;  2D5W A;  4R73 A; 
#chains in the Genus database with same CATH homology
 3U65 A;  4NX1 A;  2CZH A;  4I3Y A;  3W9V A;  5IZZ A;  4I40 A;  2FIX A;  2CEY A;  5F24 A;  4PF8 A;  4MNI A;  2FHY A;  5EQA A;  1NV3 A;  4HE1 A;  1FBD A;  4PTK A;  4PDH A;  5ET8 A;  1IMB A;  1FBC A;  3E79 A;  4JVI A;  4PAI A;  4JVC A;  1DK4 A;  4NGU A;  4XEQ A;  2VT5 A;  1G0H A;  3RYD A;  4YIC A;  4NQ8 A;  4OAN A;  3LV0 A;  1D9Q A;  4GWW A;  4HCW A;  4P3L A;  1FPB A;  2XA5 A;  2FVZ A;  2L5V A;  1INP A;  4NF0 A;  4OA4 A;  5IZ1 A;  4PCD A;  1NUX A;  1NV6 A;  3T0J A;  3CHG A;  2WYP A;  4H46 A;  1KA1 A;  2DE2 A;  2B4M A;  2F3D A;  2Q74 A;  4QBA A;  4MNC A;  4P1L A;  3T1B A;  1DCU A;  5ET7 A;  1IMD A;  1YXI A;  1NV1 A;  5IZ3 B;  1G0I A;  5J16 A;  2QPQ A;  1NV5 A;  2CZK A;  4G61 A;  2P3V A;  2ZZX A;  1FBE A;  1FBF A;  1BK4 A;  1KA0 A;  1RDZ A;  1IME A;  5DW8 A;  4N6D A;  2Y5K A;  4KXP A;  1NI9 A;  2BJI A;  4HE0 A;  5LDZ A;  2PFY A;  2VPO A;  4N6K A;  3A29 A;  5ET6 A;  5LTC A;  5I5P A;  2MKZ A;  2WBB A;  1AWB A;  1LBV A;  1RDX A;  2WBD A;  1FPG A;  3IFA A;  4YZZ A;  5EYH A;  4IR8 A;  4OVT A;  4P56 A;  1LBX A;  2R8T A;  4F1U A;  1K9Z A;  4F19 A;  1QGX A;  2ZZW A;  5J1D A;  5EQ8 A;  1IMF A;  2DE3 A;  3B50 A;  2FBP A;  4PGN A;  1LBW A;  4X9T A;  3FBP A;  2PFZ A;  3MST A;  4M1V A;  4MEV A;  4PFR A;  3PTY A;  1YYZ A;  4FBP A;  1FBG A;  4GBV A;  4HE2 A;  1NV7 A;  2CEX A;  3BIH A;  2QVU A;  4N8G A;  1Q9D A;  1NV2 A;  2XWK A;  4PET A;  1DBZ A;  3E78 A;  1NV0 A;  4XF5 A;  3ROJ A;  3RPL A;  2F5X A;  1FJ9 A;  4PAF A;  4HXV A;  3ISP A;  4PFB A;  4X8R A;  1FPD A;  4O7M A;  2OWZ A;  2B4L A;  4GX6 A;  3MYU A;  4NN3 A;  4GWU A;  2KQZ A;  1EYI A;  4NAP A;  1K9Y A;  4P8B A;  1EYK A;  1FJ6 A;  5FBP A;  1IMA A;  5A5L A;  2ZZV A;  4MAG A;  4PC9 A;  4F18 A;  4GBW A;  3EKI A;  1FPL A;  2FIE A;  4GWY A;  2XWO A;  4OVQ A;  2HPG A;  3SZP A;  4F1V A;  2DE4 A;  4AS5 A;  4GWZ A;  2XWI A;  4PAK A;  4N8Y A;  2HZL A;  4GX4 A;  1LBZ A;  1SPI A;  2OX3 A;  4HCY A;  4MIJ A;  4MNP A;  4N17 A;  2HZK A;  4P1E A;  2F3B A;  1CNQ A;  1EYJ A;  5T3J A;  2QVV A;  3D1R A;  4I3E A;  2KR0 A;  5ESY A;  2Q9T A;  4O94 A;  2CZI A;  2WEF A;  2Y5L A;  5IM2 A;  1LEV A;  3KBZ A;  1NUY A;  4MJO A;  3GYY A;  3KC0 A;  4N4U A;  1FPI A;  2QFL A;  4PFI A;  4OVS A;  3KC1 A;  4JVD A;  1FSA A;  2JJK A;  4PE3 A;  2QVR A;  5JK4 A;  3RPL B;  3FXB A;  1VDW A;  4NHB A;  1FPK A;  2XWV A;  2V3Q A;  4QXD A;  5EQ7 A;  2PCR A;  3LUZ A;  5IZ3 A;  2Q8M A;  5CM6 A;  2XXK A;  4P47 A;  2DVZ A;  5EQ9 A;  4LN5 A;  4H45 A;  1NUZ A;  2GQ1 A;  4OVP A;  1IMC A;  5EYG A;  4PBH A;  2HHM A;  3IFC A;  4XFE A;  1FPE A;  4DI3 D;  1YZ0 A;  4N91 A;  2P3N A;  1FBP A;  4MHF A;  1LBY A;  4O8M A;  1FTA A;  4P9K A;  1XI6 A;  3QMF A;  4NG7 A;  4PGP A;  4PF6 A;  5ET5 A;  4MCO A;  4PDD A;  5I7I A;  4OVR A;  1FRP A;  2WYK A;  1NV4 A;  4GX3 A;  1JP4 A;  1NUW A;  4AS4 A;  1FPF A;  3NOH A;  4PBQ A;  4MMP A;  4O7I A;  4GWX A;  2HXR A;  4UAB A;  3HFU A;  3W9W A;  2V4C A;  3BIG A;  1RDY A;  4DI4 B;  1FBH A;  4N15 A;  1FPJ A;  4MX6 A;  1KZ8 A;  4GWS A;  4N81 A;  5IGA A;  4X04 A;  5I3S A;  3B8B A;  2VPN A;  2DDK A;  2WX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...