4G61A

Crystal structure of impase/nadp phosphatase complexed with mg2+ and phosphate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
264
structure length
264
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 73
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4g61A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4g61A02
1QGXA 2BJIA 4H45A 4N81A 2R8TA 2FVZA 2WBDA 1NV6A 2QVVA 5T3JA 1NUWA 1VDWA 2Y5KA 5EQ7A 1IMFA 1FBGA 1LBVA 1JP4A 1NV1A 1FBDA 4GX6A 4I3EA 2GQ1A 1FPEA 4PTKA 2F3BA 4HE2A 1FBHA 1FJ6A 1KA0A 1RDXA 2FBPA 1FBEA 1FPFA 1NV0A 2QVRA 4GWYA 2FHYA 4O7IA 4FBPA 3D1RA 2CZIA 5ESYA 3RYDA 1FJ9A 1LBZA 2Y5LA 1FRPA 2DDKA 4GBVA 4GWSA 1NV2A 4AS4A 2JJKA 4MJOA 4HXVA 3RPLA 4QXDA 4GWXA 4I3YA 4AS5A 1IMBA 3LV0A 1IMAA 5IZ1A 2Q74A 1NV4A 1FPKA 5EYGA 1NUXA 3KBZA 1EYIA 1FBCA 1LBYA 3FBPA 1NUZA 1AWBA 3QMFA 3ROJA 2VT5A 5ET7A 4GX3A 4I40A 5FBPA 3RPLB 4IR8A 1G0HA 4H46A 2CZHA 2OWZA 4G61A 1G0IA 1IMDA 1FPJA 1NV3A 1DK4A 1SPIA 3A29A 4HE1A 1FBFA 4GWUA 5ET8A 5I3SA 1FTAA 1RDZA 1NV5A 1YZ0A 2HHMA 4GX4A 1KZ8A 1NUYA 4GWZA 1YYZA 3LUZA 2PCRA 3B8BA 3KC0A 2CZKA 2WEFA 3KC1A 1IMEA 2F3DA 2P3NA 5IZ3A 1XI6A 2QVUA 3T0JA 1CNQA 1NI9A 3IFCA 1LBXA 1EYKA 2FIXA 1YXIA 5EQAA 4GBWA 1LEVA 1Q9DA 1DBZA 3IFAA 5EYHA 4GWWA 1FPLA 1K9YA 1FBPA 5ET5A 3BIHA 4KXPA 1EYJA 1FPGA 5IZ3B 1FPBA 5J16A 2WBBA 3BIGA 5LDZA 5EQ8A 1NV7A 1RDYA 5EQ9A 2FIEA 1INPA 1IMCA 1FSAA 2P3VA 5ET6A 1FPDA 2Q8MA 2OX3A 1LBWA 1BK4A 2QFLA 4HE0A 5F24A 1DCUA 1D9QA 5DW8A 1FPIA 5A5LA 1KA1A 1K9ZA
chains in the Genus database with same CATH superfamily
3P7IA 3DP8A 2Z22A 3HV1A 3CR9A 1NUWA 4ZZEA 1VDWA 1B1HA 3MPLA 5EQ7A 3C4MA 3T9UA 1O7TA 3THIA 4ND9A 4ZECA 4GX6A 3LSFB 4P11A 2UVIA 2QSXA 4ZEFA 5KZTA 1FBHA 1KA0A 1DTGA 4NF5A 1H76A 4HW8A 3O6IA 3K6WA 2ZYNA 3RYDA 1LBZA 4XKRA 3RPLA 3H6TA 4YKJA 2QS4A 4YMBA 3UIFA 5I2KA 1N04A 5ITPA 4YMAA 5I58A 3PD9A 3B6QA 4PGPA 1EZ9A 5A5XB 3B6TA 4ZEKA 4DXBA 4G61A 1MRPA 3KSXA 3IOUA 3QAXA 4NF4B 4HCYA 4U4XA 3UA8A 1NV5A 3VLWA 2GRVA 1A99A 1IQ7A 2LAOA 3KN3A 1SW4A 1UTHA 4RNSA 3IAZA 3GXAA 1Y1MA 1MG1A 4FJPA 2NUVA 4N6DA 4GWWA 2W7YA 4N13A 3TTNA 1IUDA 1AOVA 4PFTA 2F34A 3TCGA 1IMCA 4TQUQ 2WX9A 3C34A 4X1BA 3MZ9A 3GZGA 4GWOA 3OD7A 3FGSA 3VFJA 5AA4B 3K1MA 5CMMA 4XFEA 1CB6A 5CMBA 4F19A 1USYH 2GHBA 2Y5KA 2O1MA 2MKZA 3KJTA 2P2AA 2REGA 1FBDA 2VPNA 4I3EA 3FVNA 4PFRA 4N6PA 4LZ7A 5FHNA 4E0XA 3RUMA 3FXRA 1IIWA 5ESYA 3D4CA 2RKMA 1NFTA 4PQJA 3TQLA 1YAEA 4N91A 3VLUA 3LV0A 3KOSA 4QFNA 1M5BA 1TWYA 1MY0A 3MUQA 3FV1A 4PFIA 5IZZA 3SDFA 3D4GA 3FZVA 1PEBA 3PPPA 1LLSA 1XOCA 1ZKBA 1MY4A 1GTKA 4ZDMA 3IB1A 3BBRA 1B0HA 4GL8A 4NF8A 2I0BA 1A54A 2Z8EA 3QUJA 4MAGA 4JWXA 2R9JA 3PTYA 2A5TA 1CNQA 2CEYA 2QMXA 2ABHA 3IR1A 4R9GA 4F1UA 5CC2A 4H67A 1MY1A 4OXVA 4IO3A 2B4MA 1FPLA 3N5LA 2I58A 1FQBA 2ESNA 4U2RA 4H65A 4HE0A 4I8CA 4N07A 2ONKE 1QKAA 1SW2A 2B3FA 1KA1A 2QS2A 4OVPA 4X04A 4EDPA 4NTLA 5T3JA 4NWDA 4EXKA 3KSJA 4PBHA 3V8XB 4R2BA 4YKKA 3OELA 3AXFA 1SW1A 4N6KA 4MH5A 3E79A 2H9BA 3EN3A 2F3BA 2KLFA 3V89B 2CEXA 4XF5A 3M8UA 4Z0IA 3GYYA 1MXZA 1LAXA 5B7DA 5A5XA 2HFBA 4GWXA 3H6WA 2I0CA 1B4ZA 3T93B 1Y4CA 4RJZA 1NV4A 1FPKA 5AA2B 4G8MA 1N84A 5IGAA 4NF4A 1NUZA 1AWBA 3KN7A 1NMUA 5IKBA 1G0HA 2OWZA 4U22A 1SQYA 1IXIA 5HBCA 3MVWA 2E1SA 2XXUA 3OOAA 3O28A 2QVUA 4LZ8A 1N7WA 1QKBA 4OYVA 4POXA 5TPAB 4G4PA 1Q9DA 3QUFA 1DBZA 1O64A 1YTVA 2WBBA 2HPGA 1SDXA 3TFLA 3EHUA 1NV7A 5AA4A 4NMYA 3SETA 4YB7A 3FD3A 3T22A 2M8CA 1MH3A 5BWJA 2Z23A 2YPNA 4PETA 4E0WA 5A5LA 2CZLA 2AL4A 3N6UA 1B32A 2R8TA 2FVZA 4OVRA 3CHGA 1AIVA 2WBDA 3CSGA 4LN5A 1OMPA 3FV2A 3H4ZA 4MNPA 1LFHA 1MXXA 3U65A 1JVXA 3U72A 4TLMB 4MMPA 4ZS9A 1URSA 4QFPA 1D9VA 2FBPA 1N76A 4DXUA 1GVCA 4GOTA 2OBGA 4OEUA 5DYHA 2UYEA 4WXJA 3B50A 4P1EA 1D9YA 3DP4A 4PFWA 1P1NA 2FYIA 3PUWE 2OPDA 4OHNA 2Q74A 4BDNA 4EQ7A 4PDDA 1SVXB 5AA1A 3T96B 3FBPA 3Q26A 4ISUA 3SEYA 3O6HA 4PCDA 2OLBA 3K0VA 3MP8A 2PT1A 2ZZWA 2XXVA 3IOWA 4HE1A 2HZLA 2NXOA 2ZNUA 3IX1A 2ZNTA 5I3SA 1FTAA 1DSNA 4ONYA 4NF5B 4NF0A 3K00A 4KFQA 4NN3A 2P3NA 3T0JA 2XXXA 4YKPA 4PDHA 3Q27A 1B2HA 4LQ5A 3W15C 3M3KA 2ZMBA 4MIJA 1LCFA 4PE5B 1FSAA 2PFYA 1BP5A 4DCYA 1ATGA 4I9DA 1ZMGA 4O3CA 2F36A 2X26A 3HHGA 1JNFA 2VGQA 1Y3NA 2BJIA 4O3BA 4N81A 3LSXA 4I62A 4G8HA 4C1UA 3RGYA 3GBBA 3N94A 1WODA 2PT2A 3TYHA 2Y7PA 3IK6B 5F1QA 5AA2A 1N0TA 2ONRA 4R2FA 4OEVA 2GHAA 2RF1A 1M5CA 5BUUA 1B6HA 2DE3A 4QBAA 4MJOA 3E3KA 2L5VA 1NUXA 1EYIA 2IA4A 4NGUA 2UYFA 2XWKA 4FIMA 3DELB 4F18A 2V93A 4R74A 4R73A 3PPOA 2XXPA 2BJJX 1KWHA 4GD5A 3O2AA 4PF8A 3OO9A 4I1DA 1EU8A 1BTJA 3I3VA 1NNKA 3K02A 3L6HA 3OENA 1B5HA 1HSEA 5TPAA 1MQDA 1LAFE 1F9BA 4OVJA 3K1PA 3ZKKA 2RCBA 1FTOA 3MAMA 3PPQA 3VVEA 4RY1A 3JZJA 2P0SA 3MZ1A 1ANFA 3BIGA 3SKPA 3U8QA 2XD3A 3SEVA 2Q8MA 1TFDA 1BK4A 3BKIB 5H8NA 2RINA 4ZE8A 4IO4A 4LUBA 5I59B 3SEWA 4PP0A 3CFZA 1ZJLA 2QVVA 2DE2A 1R1NA 3ZS6A 3C36A 1IMFA 3IB2A 3VDFA 1USYE 2DXYA 3KEIA 2DSFA 5CBRA 4PTKA 3EF7A 3PPNA 2REJA 3RT6B 4N8YA 2F35A 1FJ9A 1BKAA 2V3QA 2DDKA 4IGRA 2OZZA 4U21A 1YPNA 4PBQA 4AS5A 1MQGA 2HQ0A 1P1UA 1Y20A 3CVGA 3KBZA 2QPQA 4FORA 4IY5A 4JWYA 3ROJA 4PFBA 1LBCA 5ICQA 2XWIA 5FTHA 4YZZA 1FBFA 2O69A 2XWOA 1OLCA 2H98A 1I6AA 2ZXTA 4F1YA 2PCRA 1B05A 3MSTA 1IZ1A 3MZBA 2Q89A 1RKMA 1B40A 1D4NA 3K4UA 1IXHA 1FTLA 4JSDA 4P0IA 2FIXA 1WVJA 5CRYA 1LEVA 2HXRA 1MPCA 1XS5A 5EYHA 3E13X 4F3PA 3VV5A 4N4UA 3C33A 1BIYA 3UP9A 1Q1KA 4O7MA 4NE4A 4MCOA 5DW8A 2QMWA 2GFEA 3T9XB 4F31B 3FXQA 1RYXA 3S4UA 1US4A 5I7IA 3L6GA 2XXTA 5J1DA 3MPKA 1FQFA 3T9VA 1B58A 2UXAA 5H8SA 4DI3D 1MY2A 1FPFA 1NV0A 1ZLQA 1B4HA 1ZU0A 3V5AA 4UABA 3EHSA 4N8GA 4DIGA 4PAFA 4GBVA 4X1DA 2UVHA 1R9LA 1SW5A 3MC2A 5EYGA 4ESXA 2O6AA 2HAVA 4FE8A 5B70A 2V84A 3BFUA 4P1LA 3QMFA 2ZNSA 5ET7A 2HXWA 4I40A 3VE1B 1M5DA 1NH8A 1MXVA 4O94A 4H46A 3G3JA 2AYSA 2R6GE 1NV3A 4XXUA 1NH7A 1NL5A 2DWJA 2Y84A 2Z8DA 4HTGA 3R26A 2KQZA 3S9NC 3PGFA 4AB5A 1YZ0A 1A8EA 2HHMA 5CMKA 3CFLA 1YYZA 5H8FB 4MLQA 4Q8RA 3SZPA 4IO5A 4RK9A 1ZIUA 4ZEBA 4KHZE 1EYJA 4FEBA 1VR5A 4K3FA 3UK4A 5I59A 1AMFA 2H25A 4H8IA 3OSQA 1LSTA 2XD2A 4EXLA 1OVBA 4GFRA 1N3WA 1LAHE 4Q5TA 2H99A 1MXWA 4F1VA 5TU0A 1UQWA 2DVZA 3OO8A 4Z7EA 1IXGA 2PX1A 4MNCA 2HCAA 4QFOA 1OQHA 1RYOA 1MH4A 3HHFA 2OK2A 2QRYA 5LTCA 1FQDA 1JP4A 4AQ4A 4MNIA 3TMGA 3B6WA 3IOTA 3N26A 3D1RA 2CZIA 4RYAA 4P56A 4JXIA 4YU0A 2Y5LA 2XWVA 4AS4A 1PC3A 3SERA 3O66A 4I3YA 3RTWB 2PBWA 2YJPA 2G29A 4OQOA 4QSEA 2O68A 2DWAA 3PPRA 5EHMA 2F8DA 2ZYMA 3E4RA 5H8HB 4U4SA 4ELOA 3HSTA 4GVOA 3U93A 3ILUB 2I4BA 4F22A 4GX4A 4EF2A 2CZKA 1IMEA 5DVJA 3KBRA 3K6XA 4LATA 3MP1A 4IB2A 2DXRA 4BLAA 4F39A 1FPGA 4PF6A 3FVGA 4GRKA 2VOZA 3HN0A 5F24A 1BLFA 4M4GA 4QRZA 3PUXE 4ECFA 1OVTA 1FW0A 1MY3A 5I57B 4G68B 4NWCA 4H45A 3PU5A 5JTYB 2YLNA 1S50A 1TFAA 3HCQA 2FA7A 1MM7A 4NAPA 1B7HA 1FBGA 1CE2A 4X9TA 2XXRA 1VSOA 4MBPA 3VVFA 4GL0A 4NG7A 3I6VA 1FJ6A 1H45A 1P1WA 2B4LA 2V3TA 5EYFA 5H8NB 2OJTA 3U92A 1II5A 4JVDA 1R6ZA 3LUYA 3G3HA 2Q2CA 1MXYA 3TEPA 3C32A 5I5PA 3S2VA 2X7QA 4OVTA 1FPJA 4YAHX 3QK6A 3FVOA 3K6VA 3PUZE 5H8FA 3A29A 5I84A 2AIXA 3V83A 2DE4A 2VD3A 3N6TA 1GV8A 1QW0A 3S9EA 2DWHA 3G3FA 4R6YA 1KZ8A 3H7MA 1Y3PA 3O9PA 3R6UA 2X7PA 2F6PA 4JVIA 5FTIA 3EHTA 3CRBA 1LBXA 4GLIA 1B3EA 4H0WA 2ZYOA 2F78A 3PV0E 4NEDA 4FECA 1D9QA 4H8JA 1SYHA 4RPOA 2XXQA 2O7IA 3KN8A 4F3GA 3JYRA 2UVGA 3OMBA 4GXSB 4F2QA 3T1BA 4MEVA 4P0GA 1YCJA 2F7AA 4BDMA 1AH5A 4KCCA 3PMXA 4ZE9A 2QVRA 4GWYA 2FHYA 3S9MC 5CI5A 4L17A 4BDLA 3LR1A 4OVSA 1VFDA 3MBPA 5H8HA 1NNFA 4KYSA 1NKXA 1SBPA 1TT1A 4LVQA 3KOTA 4DI4B 1XT8A 2VT5A 3DLNA 5L9SA 4ESWA 1B9JA 4P3LA 5ISUA 4TLLB 3IO6A 4QHQA 4DLDA 5I2NB 3PMVA 1SPIA 2XX8A 3PUVE 5ET8A 4IO6A 2RC8A 2DOJA 1TXFA 3IO4A 2PVUA 2H4IA 2QJEA 5TP9B 1NNTA 1MQHA 4YKIA 1XI6A 3W9WA 1NI9A 4FAJA 3EPEA 1LFIA 1OQGA 4PAIA 1JEVA 3LC8A 2ZZVA 1K9YA 3BIHA 4KXPA 4Q0CA 4G8NA 3CSBA 5LDZA 1Y3QA 4O3AA 5DT6A 2I3WA 4ZEIA 5I57A 4G68A 4WEDA 5JTYA 4XKQA 1DTZA 1LGBC 3CI8A 3SEXA 1FQEA 3IB0A 1H43A 3FXBA 1ELJA 3ZKLA 1QGXA 2G93A 2Y7RA 2GH9A 4O8MA 4WEPA 4GQOA 2HAUA 2WYPA 4IY6A 3FIRA 5F7VA 3IORA 3G3KA 1QUKA 4R72A 2O1LA 1RDXA 5IM2A 4MHFA 1FRPA 4UA8A 4MLVA 2THIA 4U1ZA 3MJNA 3R7XA 4BDRA 4DCXA 1B3HA 3RQTA 1IMBA 3CG3A 3TZAA 3OO7A 4LZ5A 2QL3A 5ELVA 3O29A 1M5FA 4JBZA 2KR0A 3FJMA 4EUOA 2NVUB 1FCKA 4KI0E 1SI1A 1N3XA 3A3UA 4GIZA 2XXWA 4OERA 2RCAA 3HO7A 1B3FA 1G0IA 1B46A 3MVYA 2F7CA 4F3BA 5FHOA 3RY3A 3VVDA 4GXAA 4GWZA 4OENA 1SYIA 4G77A 1EZPA 4X48A 5EQAA 3C31A 3RNNA 4AB6A 3IFAA 4OESA 1I69A 1H3DA 1MS7A 3FATA 5J16A 3H06B 4KD5A 4XTCQ 5EQ9A 1INPA 3ECRA 1N7XA 4WKMA 2VHAA 2Y7KA 3ODBA 3CG1A 1MDQA 4LP2B 2XXIA 3HPIA 3CIJA 5H8QB 3ILTB 3TPAA 2PYYA 5CBSA 3TKDA 1URGA 2OWTA 3KZGA 4ELQA 1H44A 1QJMA 1UIUA 5DTBA 4NHBA 2ZYKA 4H1XA 2GQ1A 2I6EA 5JEIA 4HE2A 3NOHA 1QULA 1FBEA 2D5WA 4KCDA 3FJGA 3KJ7A 2DWIA 3UN6A 2F5XA 1LCTA 1A7LA 3OEKA 2WYKA 1IMAA 3TTRA 1POY1 1D3KA 3FASA 2OPEA 5I2NA 3IOVA 4P9KA 1FQAA 3IJXB 2ANJA 2CZHA 5TP9A 1S9TA 3QSLA 3ISPA 4F2OA 3W9VA 4KPTA 4NQ8A 2B3BA 4OMBA 4N15A 1XC1A 1B0LA 2H5YA 1NUYA 1DMBA 2OWSA 3KC1A 2XX7A 2ZZXA 3H6VA 4QF9A 1VFEA 4GF8A 3G3IA 3G3GA 1FBPA 3H6UA 4OWDA 1B3GA 4RA1A 5DVFA 1O63A 3HFUA 4KR5A 4U1OA 4C0RA 1SI0A 4JB7A 3DP6A 1US5A 1DCUA 4NF6B 2P1SA 3MQ9A 1JW5A 2V25A 4X8RA 4BDQA 2XXHA 1MPDA 1Q35A 3TODA 2XX9A 1ZTYA 2I3VA 4RPNA 4P8BA 3RT8A 2OCUA 3TTKA 4ELPA 1DOTA 4DXCA 4UACA 3Q29A 3C9HA 2PMSA 3TUSA 1LB8A 4YB6A 4FBPA 1WDNA 4MF3A 2JJKA 3BFTA 1FTJA 4OZ9A 4RXLA 4RK2A 4OFLA 1P1QA 1IEJA 5AE4A 2D3IA 2VP1A 2Q8JA 4MX6A 1UIVA 1JQFA 3RN8A 4BDOA 4DDDA 1VE4A 3TTLA 3K1NA 2Z8FA 1AL3A 1B5JA 3K6UA 3JV9A 3UGWA 2AL5A 3LUZA 3B8BA 3MW0A 2XXYA 1DPEA 5CM6A 4NX1A 1JVYA 2Q2AA 3ZSFA 5CMCA 4IO7A 1EYKA 2DQVA 3B7DA 2D21A 1I6QA 1YXIA 1PB8A 4GBWA 4JVCA 3H03A 1PBQA 4DE8A 2QS3A 1A55A 3C35A 3F11A 4PC9A 5EQ8A 4N17A 5H8QA 5AA3A 4TOZA 4OFJA 1LBBA 4F3SA 1QUJA 3T9HB 2VD2A 3TQWA 4IO2A 3TTMA 4OTEA 3KG2A 1MQIA 1MDP1 5FHMA 5I56B 1NV6A 3VXCA 3SESA 3E9XA 5ICTA 4R6HA 1URDA 4POWA 3M3LA 3TAJA 4Q30B 3RTFB 1FTKA 4QSDA 3MVZA 1Z7NE 3KFMA 3K01A 4LA9A 1GR2A 1S7YA 5LOMA 3LBSA 2Y7WA 3RPWA 2IEEA 1JEUA 3OXNA 1NV2A 1XVXA 4JDFA 5DEXB 3Q28A 5M2VA 5IZ1A 4F29A 2XA5A 4QSCA 3A3CA 1B51A 1LAGE 3PMWA 4FATA 1IXCA 4GX3A 3MVXA 3QYTA 4JWOA 2XHDA 3SEUA 2HEUA 4QFLA 5KDTB 5HM4B 3FJ7A 4R75A 3ONMA 4PE3A 1Y9UA 2UVJA 3PD8A 2VPOA 3IJOB 3GBAA 3PUYE 3RLFE 1PDAA 4H5FA 1JETA 3IFCA 1POTA 3MP6A 4P47A 1B7ZA 1OLAA 3VXBA 1QVSA 2DS9A 5KCJB 4NF6A 3WAFA 5IZ3B 1QUIA 4XIGQ 2NWJA 1P99A 5L9MA 2FIEA 1P1OA 2P3VA 4ELRA 4THIA 5JK4A 3DM0A 3GLBA 1UTBB 2DP8A 1K9ZA 2ALUA 4OVQA 4XKNA 4KQPA 1B1XA 3QXMA 3KGCA 1Z7ME 5ITOA 1LBVA 5K2XA 4YICA 1B7UA 3K2DA 1NV1A 1J1NA 5L8DA 4DZ1A 1Y1ZA 1FPEA 4G2ZA 1OIBA 2PFZA 5L9OA 2F7BA 4O7IA 1I6BA 2DVCA 2I4CA 2QS1A 2RC7A 3OSRA 2O7UA 3Q25A 4HXVA 4QXDA 1IITA 4H6DA 2NOOA 1FTMA 1MQJA 2Q9TA 1B5IA 2XXKA 3M3FA 3TCFA 5AA2D 4MFIA 3RPLB 3T66A 4IR8A 4QFKA 5I2KB 5I58B 5EHSA 1M5EA 1RDZA 3FXUA 2WKYA 4HS7A 4PFUA 4LONB 3KC0A 4PGNA 1MPBA 4EF1A 2R71A 1A40A 5HPQA 5K2YA 3E78A 4YB5A 4XEQA 1PBPA 2E0SA 1LFGA 4R9FA 4U23A 1UTHB 3G7WA 1PB9A 4C1TA 5IAIA 5I56A 5ET6A 1MM6A 4ZZAA 4LQ2A 4EQBA 3VLVA 1LB9A 2ONSA 4OA4A 2O84X 1R9QA 1Y4TA 4R6KA 1FQCA 3EKIA 1JW4A 2FNCA 2Y7IA 2A5SA 4H5GA 3UORA 3WAEA 3IL1B 3MYUA 4PFYA 5DEXA 2B65A 4JSOA 3LSLA 3OEMA 3S9LC 1L5TA 2HZKA 4M1VA 1DPPA 4GWSA 1T0KA 1HSLA 4KYEA 4IGTA 3TCHA 2I48A 1FBCA 3LSWA 2Q88A 1EZOA 1LBYA 5KDTA 3O6GA 2I49A 4PAKA 1GGGA 5DVIA 4FEDA 5FBPA 1SD3A 1IMDA 4OETA 1DK4A 3TELA 4GWUA 4HCWA 1B3LA 1XHYA 4EQ9A 2V3UA 1PB7A 2V4CA 2F6GA 4ZEDA 1XVYA 5KCJA 4XKPA 3U1OA 2WEFA 2CMOA 4G68C 2O51A 2F3DA 5IZ3A 3CFXA 2RC9A 3O97A 3H3GA 4OANA 1B52A 4NF8B 3USDA 1EH3A 3TDJA 4KYDA 1HSJA 5ET5A 2A5TB 3EQ1A 1FPBA 3OO6A 1UTBA 3U94A 3FVKA 2DYXA 1RDYA 3FUZA 3MWBA 1FPDA 2OX3A 1ZBMA 1LBWA 3QIMA 2QFLA 3I5OA 4OFOA 1FPIA 1NNPA 2F97A 1JW1A 1MXUA 1A8FA 3A09A
chains in the Genus database with same CATH topology
2BJIA 4H45A 4N81A 4P8BA 1NUWA 1VDWA 4NAPA 5EQ7A 1FBGA 4X9TA 4GX6A 4NG7A 1FBHA 1FJ6A 1KA0A 4FBPA 3RYDA 1LBZA 2B4LA 2DE3A 4QBAA 2JJKA 4MJOA 3RPLA 2L5VA 4JVDA 1NUXA 1EYIA 4NGUA 4PGPA 2XWKA 4MX6A 4F18A 5I5PA 4G61A 4OVTA 1FPJA 3A29A 4PF8A 4HCYA 2DE4A 1NV5A 1KZ8A 3LUZA 3B8BA 5CM6A 4NX1A 4JVIA 1LBXA 1EYKA 1YXIA 4GBWA 4JVCA 4N6DA 4GWWA 4PC9A 3BIGA 5EQ8A 4N17A 1IMCA 2WX9A 2Q8MA 1BK4A 1D9QA 4XFEA 4F19A 1NV6A 2QVVA 3T1BA 2DE2A 2Y5KA 4MEVA 1IMFA 2MKZA 1FBDA 2VPNA 4I3EA 4PFRA 4PTKA 2QVRA 4GWYA 2FHYA 4N8YA 5ESYA 1FJ9A 2V3QA 2DDKA 4OVSA 1NV2A 4PBQA 4AS5A 4N91A 3LV0A 5IZ1A 2XA5A 3KBZA 2QPQA 4PFIA 5IZZA 3ROJA 4DI4B 2VT5A 4GX3A 4PFBA 4P3LA 2XWIA 4YZZA 1SPIA 1FBFA 4PE3A 5ET8A 2XWOA 2VPOA 4MAGA 2PCRA 3MSTA 3PTYA 1XI6A 1CNQA 3W9WA 1NI9A 3IFCA 2CEYA 4F1UA 4PAIA 4P47A 2FIXA 1LEVA 2HXRA 2ZZVA 5EYHA 2B4MA 1FPLA 1K9YA 3BIHA 4KXPA 5IZ3B 4N4UA 5LDZA 2FIEA 2P3VA 4HE0A 5JK4A 4O7MA 4MCOA 5DW8A 1KA1A 1K9ZA 3FXBA 4OVQA 1QGXA 5I7IA 4OVPA 4X04A 5J1DA 4O8MA 5T3JA 4PBHA 2WYPA 1LBVA 4YICA 4N6KA 1NV1A 3E79A 1FPEA 2F3BA 2PFZA 4DI3D 1RDXA 1FPFA 1NV0A 4O7IA 5IM2A 2CEXA 4XF5A 4UABA 4MHFA 4N8GA 1FRPA 3GYYA 4PAFA 4GBVA 4HXVA 4QXDA 4GWXA 1IMBA 1NV4A 1FPKA 5EYGA 2Q9TA 2XXKA 2KR0A 5IGAA 1NUZA 4P1LA 1AWBA 3QMFA 5ET7A 4I40A 4O94A 3RPLB 4IR8A 1G0HA 4H46A 2OWZA 1G0IA 1NV3A 2KQZA 1RDZA 1YZ0A 2HHMA 4GWZA 1YYZA 3KC0A 4PGNA 2QVUA 3SZPA 3E78A 5EQAA 1Q9DA 1DBZA 3IFAA 4XEQA 1EYJA 5J16A 2WBBA 2HPGA 1NV7A 5EQ9A 1INPA 5ET6A 4PETA 5A5LA 4OA4A 3EKIA 4F1VA 2R8TA 2FVZA 2DVZA 4OVRA 3CHGA 2WBDA 4MNCA 4LN5A 4MNPA 3U65A 3MYUA 5LTCA 1JP4A 4NHBA 4MMPA 2GQ1A 4MNIA 4HE2A 2FBPA 3NOHA 1FBEA 3D1RA 2CZIA 2HZKA 4P56A 2Y5LA 4M1VA 2F5XA 2XWVA 3B50A 4GWSA 4P1EA 4AS4A 2WYKA 4I3YA 1IMAA 2Q74A 4PDDA 1FBCA 1LBYA 3FBPA 4PAKA 4P9KA 5FBPA 4PCDA 2CZHA 3ISPA 1IMDA 2ZZWA 1DK4A 3W9VA 4HE1A 4NQ8A 4GWUA 2HZLA 4HCWA 4N15A 5I3SA 1FTAA 4GX4A 2V4CA 1NUYA 4NF0A 3KC1A 2CZKA 2WEFA 1IMEA 2F3DA 2P3NA 5IZ3A 3T0JA 4NN3A 4OANA 4PDHA 2ZZXA 1FBPA 5ET5A 1FPGA 4PF6A 1FPBA 4MIJA 1RDYA 1FSAA 3HFUA 1FPDA 2OX3A 1LBWA 2PFYA 2QFLA 5F24A 1DCUA 1FPIA 4X8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGX A;  2BJI A;  4H45 A;  4N81 A;  2R8T A;  2FVZ A;  2WBD A;  1NV6 A;  2QVV A;  5T3J A;  1NUW A;  1VDW A;  2Y5K A;  5EQ7 A;  1IMF A;  1FBG A;  1LBV A;  1JP4 A;  1NV1 A;  1FBD A;  4GX6 A;  4I3E A;  2GQ1 A;  1FPE A;  4PTK A;  2F3B A;  4HE2 A;  1FBH A;  1FJ6 A;  1KA0 A;  1RDX A;  2FBP A;  1FBE A;  1FPF A;  1NV0 A;  2QVR A;  4GWY A;  2FHY A;  4O7I A;  4FBP A;  3D1R A;  2CZI A;  5ESY A;  3RYD A;  1FJ9 A;  1LBZ A;  2Y5L A;  1FRP A;  2DDK A;  4GBV A;  4GWS A;  1NV2 A;  4AS4 A;  2JJK A;  4MJO A;  4HXV A;  3RPL A;  4QXD A;  4GWX A;  4I3Y A;  4AS5 A;  1IMB A;  3LV0 A;  1IMA A;  5IZ1 A;  2Q74 A;  1NV4 A;  1FPK A;  5EYG A;  1NUX A;  3KBZ A;  1EYI A;  1FBC A;  1LBY A;  3FBP A;  1NUZ A;  1AWB A;  3QMF A;  3ROJ A;  2VT5 A;  5ET7 A;  4GX3 A;  4I40 A;  5FBP A;  3RPL B;  4IR8 A;  1G0H A;  4H46 A;  2CZH A;  2OWZ A;  4G61 A;  1G0I A;  1IMD A;  1FPJ A;  1NV3 A;  1DK4 A;  1SPI A;  3A29 A;  4HE1 A;  1FBF A;  4GWU A;  5ET8 A;  5I3S A;  1FTA A;  1RDZ A;  1NV5 A;  1YZ0 A;  2HHM A;  4GX4 A;  1KZ8 A;  1NUY A;  4GWZ A;  1YYZ A;  3LUZ A;  2PCR A;  3B8B A;  3KC0 A;  2CZK A;  2WEF A;  3KC1 A;  1IME A;  2F3D A;  2P3N A;  5IZ3 A;  1XI6 A;  2QVU A;  3T0J A;  1CNQ A;  1NI9 A;  3IFC A;  1LBX A;  1EYK A;  2FIX A;  1YXI A;  5EQA A;  4GBW A;  1LEV A;  1Q9D A;  1DBZ A;  3IFA A;  5EYH A;  4GWW A;  1FPL A;  1K9Y A;  1FBP A;  5ET5 A;  3BIH A;  4KXP A;  1EYJ A;  1FPG A;  5IZ3 B;  1FPB A;  5J16 A;  2WBB A;  3BIG A;  5LDZ A;  5EQ8 A;  1NV7 A;  1RDY A;  5EQ9 A;  2FIE A;  1INP A;  1IMC A;  1FSA A;  2P3V A;  5ET6 A;  1FPD A;  2Q8M A;  2OX3 A;  1LBW A;  1BK4 A;  2QFL A;  4HE0 A;  5F24 A;  1DCU A;  1D9Q A;  5DW8 A;  1FPI A;  5A5L A;  1KA1 A;  1K9Z A; 
#chains in the Genus database with same CATH topology
 3P7I A;  3DP8 A;  2Z22 A;  3HV1 A;  3CR9 A;  1NUW A;  4ZZE A;  1VDW A;  1B1H A;  3MPL A;  5EQ7 A;  3C4M A;  3T9U A;  1O7T A;  3THI A;  4ND9 A;  4ZEC A;  4GX6 A;  3LSF B;  4P11 A;  2UVI A;  2QSX A;  4ZEF A;  5KZT A;  1FBH A;  1KA0 A;  1DTG A;  4NF5 A;  1H76 A;  4HW8 A;  3O6I A;  3K6W A;  2ZYN A;  3RYD A;  1LBZ A;  4XKR A;  3RPL A;  3H6T A;  4YKJ A;  2QS4 A;  4YMB A;  3UIF A;  5I2K A;  1N04 A;  5ITP A;  4YMA A;  5I58 A;  3PD9 A;  3B6Q A;  4PGP A;  1EZ9 A;  5A5X B;  3B6T A;  4ZEK A;  4DXB A;  4G61 A;  1MRP A;  3KSX A;  3IOU A;  3QAX A;  4NF4 B;  4HCY A;  4U4X A;  3UA8 A;  1NV5 A;  3VLW A;  2GRV A;  1A99 A;  1IQ7 A;  2LAO A;  3KN3 A;  1SW4 A;  1UTH A;  4RNS A;  3IAZ A;  3GXA A;  1Y1M A;  1MG1 A;  4FJP A;  2NUV A;  4N6D A;  4GWW A;  2W7Y A;  4N13 A;  3TTN A;  1IUD A;  1AOV A;  4PFT A;  2F34 A;  3TCG A;  1IMC A;  4TQU Q;  2WX9 A;  3C34 A;  4X1B A;  3MZ9 A;  3GZG A;  4GWO A;  3OD7 A;  3FGS A;  3VFJ A;  5AA4 B;  3K1M A;  5CMM A;  4XFE A;  1CB6 A;  5CMB A;  4F19 A;  1USY H;  2GHB A;  2Y5K A;  2O1M A;  2MKZ A;  3KJT A;  2P2A A;  2REG A;  1FBD A;  2VPN A;  4I3E A;  3FVN A;  4PFR A;  4N6P A;  4LZ7 A;  5FHN A;  4E0X A;  3RUM A;  3FXR A;  1IIW A;  5ESY A;  3D4C A;  2RKM A;  1NFT A;  4PQJ A;  3TQL A;  1YAE A;  4N91 A;  3VLU A;  3LV0 A;  3KOS A;  4QFN A;  1M5B A;  1TWY A;  1MY0 A;  3MUQ A;  3FV1 A;  4PFI A;  5IZZ A;  3SDF A;  3D4G A;  3FZV A;  1PEB A;  3PPP A;  1LLS A;  1XOC A;  1ZKB A;  1MY4 A;  1GTK A;  4ZDM A;  3IB1 A;  3BBR A;  1B0H A;  4GL8 A;  4NF8 A;  2I0B A;  1A54 A;  2Z8E A;  3QUJ A;  4MAG A;  4JWX A;  2R9J A;  3PTY A;  2A5T A;  1CNQ A;  2CEY A;  2QMX A;  2ABH A;  3IR1 A;  4R9G A;  4F1U A;  5CC2 A;  4H67 A;  1MY1 A;  4OXV A;  4IO3 A;  2B4M A;  1FPL A;  3N5L A;  2I58 A;  1FQB A;  2ESN A;  4U2R A;  4H65 A;  4HE0 A;  4I8C A;  4N07 A;  2ONK E;  1QKA A;  1SW2 A;  2B3F A;  1KA1 A;  2QS2 A;  4OVP A;  4X04 A;  4EDP A;  4NTL A;  5T3J A;  4NWD A;  4EXK A;  3KSJ A;  4PBH A;  3V8X B;  4R2B A;  4YKK A;  3OEL A;  3AXF A;  1SW1 A;  4N6K A;  4MH5 A;  3E79 A;  2H9B A;  3EN3 A;  2F3B A;  2KLF A;  3V89 B;  2CEX A;  4XF5 A;  3M8U A;  4Z0I A;  3GYY A;  1MXZ A;  1LAX A;  5B7D A;  5A5X A;  2HFB A;  4GWX A;  3H6W A;  2I0C A;  1B4Z A;  3T93 B;  1Y4C A;  4RJZ A;  1NV4 A;  1FPK A;  5AA2 B;  4G8M A;  1N84 A;  5IGA A;  4NF4 A;  1NUZ A;  1AWB A;  3KN7 A;  1NMU A;  5IKB A;  1G0H A;  2OWZ A;  4U22 A;  1SQY A;  1IXI A;  5HBC A;  3MVW A;  2E1S A;  2XXU A;  3OOA A;  3O28 A;  2QVU A;  4LZ8 A;  1N7W A;  1QKB A;  4OYV A;  4POX A;  5TPA B;  4G4P A;  1Q9D A;  3QUF A;  1DBZ A;  1O64 A;  1YTV A;  2WBB A;  2HPG A;  1SDX A;  3TFL A;  3EHU A;  1NV7 A;  5AA4 A;  4NMY A;  3SET A;  4YB7 A;  3FD3 A;  3T22 A;  2M8C A;  1MH3 A;  5BWJ A;  2Z23 A;  2YPN A;  4PET A;  4E0W A;  5A5L A;  2CZL A;  2AL4 A;  3N6U A;  1B32 A;  2R8T A;  2FVZ A;  4OVR A;  3CHG A;  1AIV A;  2WBD A;  3CSG A;  4LN5 A;  1OMP A;  3FV2 A;  3H4Z A;  4MNP A;  1LFH A;  1MXX A;  3U65 A;  1JVX A;  3U72 A;  4TLM B;  4MMP A;  4ZS9 A;  1URS A;  4QFP A;  1D9V A;  2FBP A;  1N76 A;  4DXU A;  1GVC A;  4GOT A;  2OBG A;  4OEU A;  5DYH A;  2UYE A;  4WXJ A;  3B50 A;  4P1E A;  1D9Y A;  3DP4 A;  4PFW A;  1P1N A;  2FYI A;  3PUW E;  2OPD A;  4OHN A;  2Q74 A;  4BDN A;  4EQ7 A;  4PDD A;  1SVX B;  5AA1 A;  3T96 B;  3FBP A;  3Q26 A;  4ISU A;  3SEY A;  3O6H A;  4PCD A;  2OLB A;  3K0V A;  3MP8 A;  2PT1 A;  2ZZW A;  2XXV A;  3IOW A;  4HE1 A;  2HZL A;  2NXO A;  2ZNU A;  3IX1 A;  2ZNT A;  5I3S A;  1FTA A;  1DSN A;  4ONY A;  4NF5 B;  4NF0 A;  3K00 A;  4KFQ A;  4NN3 A;  2P3N A;  3T0J A;  2XXX A;  4YKP A;  4PDH A;  3Q27 A;  1B2H A;  4LQ5 A;  3W15 C;  3M3K A;  2ZMB A;  4MIJ A;  1LCF A;  4PE5 B;  1FSA A;  2PFY A;  1BP5 A;  4DCY A;  1ATG A;  4I9D A;  1ZMG A;  4O3C A;  2F36 A;  2X26 A;  3HHG A;  1JNF A;  2VGQ A;  1Y3N A;  2BJI A;  4O3B A;  4N81 A;  3LSX A;  4I62 A;  4G8H A;  4C1U A;  3RGY A;  3GBB A;  3N94 A;  1WOD A;  2PT2 A;  3TYH A;  2Y7P A;  3IK6 B;  5F1Q A;  5AA2 A;  1N0T A;  2ONR A;  4R2F A;  4OEV A;  2GHA A;  2RF1 A;  1M5C A;  5BUU A;  1B6H A;  2DE3 A;  4QBA A;  4MJO A;  3E3K A;  2L5V A;  1NUX A;  1EYI A;  2IA4 A;  4NGU A;  2UYF A;  2XWK A;  4FIM A;  3DEL B;  4F18 A;  2V93 A;  4R74 A;  4R73 A;  3PPO A;  2XXP A;  2BJJ X;  1KWH A;  4GD5 A;  3O2A A;  4PF8 A;  3OO9 A;  4I1D A;  1EU8 A;  1BTJ A;  3I3V A;  1NNK A;  3K02 A;  3L6H A;  3OEN A;  1B5H A;  1HSE A;  5TPA A;  1MQD A;  1LAF E;  1F9B A;  4OVJ A;  3K1P A;  3ZKK A;  2RCB A;  1FTO A;  3MAM A;  3PPQ A;  3VVE A;  4RY1 A;  3JZJ A;  2P0S A;  3MZ1 A;  1ANF A;  3BIG A;  3SKP A;  3U8Q A;  2XD3 A;  3SEV A;  2Q8M A;  1TFD A;  1BK4 A;  3BKI B;  5H8N A;  2RIN A;  4ZE8 A;  4IO4 A;  4LUB A;  5I59 B;  3SEW A;  4PP0 A;  3CFZ A;  1ZJL A;  2QVV A;  2DE2 A;  1R1N A;  3ZS6 A;  3C36 A;  1IMF A;  3IB2 A;  3VDF A;  1USY E;  2DXY A;  3KEI A;  2DSF A;  5CBR A;  4PTK A;  3EF7 A;  3PPN A;  2REJ A;  3RT6 B;  4N8Y A;  2F35 A;  1FJ9 A;  1BKA A;  2V3Q A;  2DDK A;  4IGR A;  2OZZ A;  4U21 A;  1YPN A;  4PBQ A;  4AS5 A;  1MQG A;  2HQ0 A;  1P1U A;  1Y20 A;  3CVG A;  3KBZ A;  2QPQ A;  4FOR A;  4IY5 A;  4JWY A;  3ROJ A;  4PFB A;  1LBC A;  5ICQ A;  2XWI A;  5FTH A;  4YZZ A;  1FBF A;  2O69 A;  2XWO A;  1OLC A;  2H98 A;  1I6A A;  2ZXT A;  4F1Y A;  2PCR A;  1B05 A;  3MST A;  1IZ1 A;  3MZB A;  2Q89 A;  1RKM A;  1B40 A;  1D4N A;  3K4U A;  1IXH A;  1FTL A;  4JSD A;  4P0I A;  2FIX A;  1WVJ A;  5CRY A;  1LEV A;  2HXR A;  1MPC A;  1XS5 A;  5EYH A;  3E13 X;  4F3P A;  3VV5 A;  4N4U A;  3C33 A;  1BIY A;  3UP9 A;  1Q1K A;  4O7M A;  4NE4 A;  4MCO A;  5DW8 A;  2QMW A;  2GFE A;  3T9X B;  4F31 B;  3FXQ A;  1RYX A;  3S4U A;  1US4 A;  5I7I A;  3L6G A;  2XXT A;  5J1D A;  3MPK A;  1FQF A;  3T9V A;  1B58 A;  2UXA A;  5H8S A;  4DI3 D;  1MY2 A;  1FPF A;  1NV0 A;  1ZLQ A;  1B4H A;  1ZU0 A;  3V5A A;  4UAB A;  3EHS A;  4N8G A;  4DIG A;  4PAF A;  4GBV A;  4X1D A;  2UVH A;  1R9L A;  1SW5 A;  3MC2 A;  5EYG A;  4ESX A;  2O6A A;  2HAV A;  4FE8 A;  5B70 A;  2V84 A;  3BFU A;  4P1L A;  3QMF A;  2ZNS A;  5ET7 A;  2HXW A;  4I40 A;  3VE1 B;  1M5D A;  1NH8 A;  1MXV A;  4O94 A;  4H46 A;  3G3J A;  2AYS A;  2R6G E;  1NV3 A;  4XXU A;  1NH7 A;  1NL5 A;  2DWJ A;  2Y84 A;  2Z8D A;  4HTG A;  3R26 A;  2KQZ A;  3S9N C;  3PGF A;  4AB5 A;  1YZ0 A;  1A8E A;  2HHM A;  5CMK A;  3CFL A;  1YYZ A;  5H8F B;  4MLQ A;  4Q8R A;  3SZP A;  4IO5 A;  4RK9 A;  1ZIU A;  4ZEB A;  4KHZ E;  1EYJ A;  4FEB A;  1VR5 A;  4K3F A;  3UK4 A;  5I59 A;  1AMF A;  2H25 A;  4H8I A;  3OSQ A;  1LST A;  2XD2 A;  4EXL A;  1OVB A;  4GFR A;  1N3W A;  1LAH E;  4Q5T A;  2H99 A;  1MXW A;  4F1V A;  5TU0 A;  1UQW A;  2DVZ A;  3OO8 A;  4Z7E A;  1IXG A;  2PX1 A;  4MNC A;  2HCA A;  4QFO A;  1OQH A;  1RYO A;  1MH4 A;  3HHF A;  2OK2 A;  2QRY A;  5LTC A;  1FQD A;  1JP4 A;  4AQ4 A;  4MNI A;  3TMG A;  3B6W A;  3IOT A;  3N26 A;  3D1R A;  2CZI A;  4RYA A;  4P56 A;  4JXI A;  4YU0 A;  2Y5L A;  2XWV A;  4AS4 A;  1PC3 A;  3SER A;  3O66 A;  4I3Y A;  3RTW B;  2PBW A;  2YJP A;  2G29 A;  4OQO A;  4QSE A;  2O68 A;  2DWA A;  3PPR A;  5EHM A;  2F8D A;  2ZYM A;  3E4R A;  5H8H B;  4U4S A;  4ELO A;  3HST A;  4GVO A;  3U93 A;  3ILU B;  2I4B A;  4F22 A;  4GX4 A;  4EF2 A;  2CZK A;  1IME A;  5DVJ A;  3KBR A;  3K6X A;  4LAT A;  3MP1 A;  4IB2 A;  2DXR A;  4BLA A;  4F39 A;  1FPG A;  4PF6 A;  3FVG A;  4GRK A;  2VOZ A;  3HN0 A;  5F24 A;  1BLF A;  4M4G A;  4QRZ A;  3PUX E;  4ECF A;  1OVT A;  1FW0 A;  1MY3 A;  5I57 B;  4G68 B;  4NWC A;  4H45 A;  3PU5 A;  5JTY B;  2YLN A;  1S50 A;  1TFA A;  3HCQ A;  2FA7 A;  1MM7 A;  4NAP A;  1B7H A;  1FBG A;  1CE2 A;  4X9T A;  2XXR A;  1VSO A;  4MBP A;  3VVF A;  4GL0 A;  4NG7 A;  3I6V A;  1FJ6 A;  1H45 A;  1P1W A;  2B4L A;  2V3T A;  5EYF A;  5H8N B;  2OJT A;  3U92 A;  1II5 A;  4JVD A;  1R6Z A;  3LUY A;  3G3H A;  2Q2C A;  1MXY A;  3TEP A;  3C32 A;  5I5P A;  3S2V A;  2X7Q A;  4OVT A;  1FPJ A;  4YAH X;  3QK6 A;  3FVO A;  3K6V A;  3PUZ E;  5H8F A;  3A29 A;  5I84 A;  2AIX A;  3V83 A;  2DE4 A;  2VD3 A;  3N6T A;  1GV8 A;  1QW0 A;  3S9E A;  2DWH A;  3G3F A;  4R6Y A;  1KZ8 A;  3H7M A;  1Y3P A;  3O9P A;  3R6U A;  2X7P A;  2F6P A;  4JVI A;  5FTI A;  3EHT A;  3CRB A;  1LBX A;  4GLI A;  1B3E A;  4H0W A;  2ZYO A;  2F78 A;  3PV0 E;  4NED A;  4FEC A;  1D9Q A;  4H8J A;  1SYH A;  4RPO A;  2XXQ A;  2O7I A;  3KN8 A;  4F3G A;  3JYR A;  2UVG A;  3OMB A;  4GXS B;  4F2Q A;  3T1B A;  4MEV A;  4P0G A;  1YCJ A;  2F7A A;  4BDM A;  1AH5 A;  4KCC A;  3PMX A;  4ZE9 A;  2QVR A;  4GWY A;  2FHY A;  3S9M C;  5CI5 A;  4L17 A;  4BDL A;  3LR1 A;  4OVS A;  1VFD A;  3MBP A;  5H8H A;  1NNF A;  4KYS A;  1NKX A;  1SBP A;  1TT1 A;  4LVQ A;  3KOT A;  4DI4 B;  1XT8 A;  2VT5 A;  3DLN A;  5L9S A;  4ESW A;  1B9J A;  4P3L A;  5ISU A;  4TLL B;  3IO6 A;  4QHQ A;  4DLD A;  5I2N B;  3PMV A;  1SPI A;  2XX8 A;  3PUV E;  5ET8 A;  4IO6 A;  2RC8 A;  2DOJ A;  1TXF A;  3IO4 A;  2PVU A;  2H4I A;  2QJE A;  5TP9 B;  1NNT A;  1MQH A;  4YKI A;  1XI6 A;  3W9W A;  1NI9 A;  4FAJ A;  3EPE A;  1LFI A;  1OQG A;  4PAI A;  1JEV A;  3LC8 A;  2ZZV A;  1K9Y A;  3BIH A;  4KXP A;  4Q0C A;  4G8N A;  3CSB A;  5LDZ A;  1Y3Q A;  4O3A A;  5DT6 A;  2I3W A;  4ZEI A;  5I57 A;  4G68 A;  4WED A;  5JTY A;  4XKQ A;  1DTZ A;  1LGB C;  3CI8 A;  3SEX A;  1FQE A;  3IB0 A;  1H43 A;  3FXB A;  1ELJ A;  3ZKL A;  1QGX A;  2G93 A;  2Y7R A;  2GH9 A;  4O8M A;  4WEP A;  4GQO A;  2HAU A;  2WYP A;  4IY6 A;  3FIR A;  5F7V A;  3IOR A;  3G3K A;  1QUK A;  4R72 A;  2O1L A;  1RDX A;  5IM2 A;  4MHF A;  1FRP A;  4UA8 A;  4MLV A;  2THI A;  4U1Z A;  3MJN A;  3R7X A;  4BDR A;  4DCX A;  1B3H A;  3RQT A;  1IMB A;  3CG3 A;  3TZA A;  3OO7 A;  4LZ5 A;  2QL3 A;  5ELV A;  3O29 A;  1M5F A;  4JBZ A;  2KR0 A;  3FJM A;  4EUO A;  2NVU B;  1FCK A;  4KI0 E;  1SI1 A;  1N3X A;  3A3U A;  4GIZ A;  2XXW A;  4OER A;  2RCA A;  3HO7 A;  1B3F A;  1G0I A;  1B46 A;  3MVY A;  2F7C A;  4F3B A;  5FHO A;  3RY3 A;  3VVD A;  4GXA A;  4GWZ A;  4OEN A;  1SYI A;  4G77 A;  1EZP A;  4X48 A;  5EQA A;  3C31 A;  3RNN A;  4AB6 A;  3IFA A;  4OES A;  1I69 A;  1H3D A;  1MS7 A;  3FAT A;  5J16 A;  3H06 B;  4KD5 A;  4XTC Q;  5EQ9 A;  1INP A;  3ECR A;  1N7X A;  4WKM A;  2VHA A;  2Y7K A;  3ODB A;  3CG1 A;  1MDQ A;  4LP2 B;  2XXI A;  3HPI A;  3CIJ A;  5H8Q B;  3ILT B;  3TPA A;  2PYY A;  5CBS A;  3TKD A;  1URG A;  2OWT A;  3KZG A;  4ELQ A;  1H44 A;  1QJM A;  1UIU A;  5DTB A;  4NHB A;  2ZYK A;  4H1X A;  2GQ1 A;  2I6E A;  5JEI A;  4HE2 A;  3NOH A;  1QUL A;  1FBE A;  2D5W A;  4KCD A;  3FJG A;  3KJ7 A;  2DWI A;  3UN6 A;  2F5X A;  1LCT A;  1A7L A;  3OEK A;  2WYK A;  1IMA A;  3TTR A;  1POY 1;  1D3K A;  3FAS A;  2OPE A;  5I2N A;  3IOV A;  4P9K A;  1FQA A;  3IJX B;  2ANJ A;  2CZH A;  5TP9 A;  1S9T A;  3QSL A;  3ISP A;  4F2O A;  3W9V A;  4KPT A;  4NQ8 A;  2B3B A;  4OMB A;  4N15 A;  1XC1 A;  1B0L A;  2H5Y A;  1NUY A;  1DMB A;  2OWS A;  3KC1 A;  2XX7 A;  2ZZX A;  3H6V A;  4QF9 A;  1VFE A;  4GF8 A;  3G3I A;  3G3G A;  1FBP A;  3H6U A;  4OWD A;  1B3G A;  4RA1 A;  5DVF A;  1O63 A;  3HFU A;  4KR5 A;  4U1O A;  4C0R A;  1SI0 A;  4JB7 A;  3DP6 A;  1US5 A;  1DCU A;  4NF6 B;  2P1S A;  3MQ9 A;  1JW5 A;  2V25 A;  4X8R A;  4BDQ A;  2XXH A;  1MPD A;  1Q35 A;  3TOD A;  2XX9 A;  1ZTY A;  2I3V A;  4RPN A;  4P8B A;  3RT8 A;  2OCU A;  3TTK A;  4ELP A;  1DOT A;  4DXC A;  4UAC A;  3Q29 A;  3C9H A;  2PMS A;  3TUS A;  1LB8 A;  4YB6 A;  4FBP A;  1WDN A;  4MF3 A;  2JJK A;  3BFT A;  1FTJ A;  4OZ9 A;  4RXL A;  4RK2 A;  4OFL A;  1P1Q A;  1IEJ A;  5AE4 A;  2D3I A;  2VP1 A;  2Q8J A;  4MX6 A;  1UIV A;  1JQF A;  3RN8 A;  4BDO A;  4DDD A;  1VE4 A;  3TTL A;  3K1N A;  2Z8F A;  1AL3 A;  1B5J A;  3K6U A;  3JV9 A;  3UGW A;  2AL5 A;  3LUZ A;  3B8B A;  3MW0 A;  2XXY A;  1DPE A;  5CM6 A;  4NX1 A;  1JVY A;  2Q2A A;  3ZSF A;  5CMC A;  4IO7 A;  1EYK A;  2DQV A;  3B7D A;  2D21 A;  1I6Q A;  1YXI A;  1PB8 A;  4GBW A;  4JVC A;  3H03 A;  1PBQ A;  4DE8 A;  2QS3 A;  1A55 A;  3C35 A;  3F11 A;  4PC9 A;  5EQ8 A;  4N17 A;  5H8Q A;  5AA3 A;  4TOZ A;  4OFJ A;  1LBB A;  4F3S A;  1QUJ A;  3T9H B;  2VD2 A;  3TQW A;  4IO2 A;  3TTM A;  4OTE A;  3KG2 A;  1MQI A;  1MDP 1;  5FHM A;  5I56 B;  1NV6 A;  3VXC A;  3SES A;  3E9X A;  5ICT A;  4R6H A;  1URD A;  4POW A;  3M3L A;  3TAJ A;  4Q30 B;  3RTF B;  1FTK A;  4QSD A;  3MVZ A;  1Z7N E;  3KFM A;  3K01 A;  4LA9 A;  1GR2 A;  1S7Y A;  5LOM A;  3LBS A;  2Y7W A;  3RPW A;  2IEE A;  1JEU A;  3OXN A;  1NV2 A;  1XVX A;  4JDF A;  5DEX B;  3Q28 A;  5M2V A;  5IZ1 A;  4F29 A;  2XA5 A;  4QSC A;  3A3C A;  1B51 A;  1LAG E;  3PMW A;  4FAT A;  1IXC A;  4GX3 A;  3MVX A;  3QYT A;  4JWO A;  2XHD A;  3SEU A;  2HEU A;  4QFL A;  5KDT B;  5HM4 B;  3FJ7 A;  4R75 A;  3ONM A;  4PE3 A;  1Y9U A;  2UVJ A;  3PD8 A;  2VPO A;  3IJO B;  3GBA A;  3PUY E;  3RLF E;  1PDA A;  4H5F A;  1JET A;  3IFC A;  1POT A;  3MP6 A;  4P47 A;  1B7Z A;  1OLA A;  3VXB A;  1QVS A;  2DS9 A;  5KCJ B;  4NF6 A;  3WAF A;  5IZ3 B;  1QUI A;  4XIG Q;  2NWJ A;  1P99 A;  5L9M A;  2FIE A;  1P1O A;  2P3V A;  4ELR A;  4THI A;  5JK4 A;  3DM0 A;  3GLB A;  1UTB B;  2DP8 A;  1K9Z A;  2ALU A;  4OVQ A;  4XKN A;  4KQP A;  1B1X A;  3QXM A;  3KGC A;  1Z7M E;  5ITO A;  1LBV A;  5K2X A;  4YIC A;  1B7U A;  3K2D A;  1NV1 A;  1J1N A;  5L8D A;  4DZ1 A;  1Y1Z A;  1FPE A;  4G2Z A;  1OIB A;  2PFZ A;  5L9O A;  2F7B A;  4O7I A;  1I6B A;  2DVC A;  2I4C A;  2QS1 A;  2RC7 A;  3OSR A;  2O7U A;  3Q25 A;  4HXV A;  4QXD A;  1IIT A;  4H6D A;  2NOO A;  1FTM A;  1MQJ A;  2Q9T A;  1B5I A;  2XXK A;  3M3F A;  3TCF A;  5AA2 D;  4MFI A;  3RPL B;  3T66 A;  4IR8 A;  4QFK A;  5I2K B;  5I58 B;  5EHS A;  1M5E A;  1RDZ A;  3FXU A;  2WKY A;  4HS7 A;  4PFU A;  4LON B;  3KC0 A;  4PGN A;  1MPB A;  4EF1 A;  2R71 A;  1A40 A;  5HPQ A;  5K2Y A;  3E78 A;  4YB5 A;  4XEQ A;  1PBP A;  2E0S A;  1LFG A;  4R9F A;  4U23 A;  1UTH B;  3G7W A;  1PB9 A;  4C1T A;  5IAI A;  5I56 A;  5ET6 A;  1MM6 A;  4ZZA A;  4LQ2 A;  4EQB A;  3VLV A;  1LB9 A;  2ONS A;  4OA4 A;  2O84 X;  1R9Q A;  1Y4T A;  4R6K A;  1FQC A;  3EKI A;  1JW4 A;  2FNC A;  2Y7I A;  2A5S A;  4H5G A;  3UOR A;  3WAE A;  3IL1 B;  3MYU A;  4PFY A;  5DEX A;  2B65 A;  4JSO A;  3LSL A;  3OEM A;  3S9L C;  1L5T A;  2HZK A;  4M1V A;  1DPP A;  4GWS A;  1T0K A;  1HSL A;  4KYE A;  4IGT A;  3TCH A;  2I48 A;  1FBC A;  3LSW A;  2Q88 A;  1EZO A;  1LBY A;  5KDT A;  3O6G A;  2I49 A;  4PAK A;  1GGG A;  5DVI A;  4FED A;  5FBP A;  1SD3 A;  1IMD A;  4OET A;  1DK4 A;  3TEL A;  4GWU A;  4HCW A;  1B3L A;  1XHY A;  4EQ9 A;  2V3U A;  1PB7 A;  2V4C A;  2F6G A;  4ZED A;  1XVY A;  5KCJ A;  4XKP A;  3U1O A;  2WEF A;  2CMO A;  4G68 C;  2O51 A;  2F3D A;  5IZ3 A;  3CFX A;  2RC9 A;  3O97 A;  3H3G A;  4OAN A;  1B52 A;  4NF8 B;  3USD A;  1EH3 A;  3TDJ A;  4KYD A;  1HSJ A;  5ET5 A;  2A5T B;  3EQ1 A;  1FPB A;  3OO6 A;  1UTB A;  3U94 A;  3FVK A;  2DYX A;  1RDY A;  3FUZ A;  3MWB A;  1FPD A;  2OX3 A;  1ZBM A;  1LBW A;  3QIM A;  2QFL A;  3I5O A;  4OFO A;  1FPI A;  1NNP A;  2F97 A;  1JW1 A;  1MXU A;  1A8F A;  3A09 A; 
#chains in the Genus database with same CATH homology
 2BJI A;  4H45 A;  4N81 A;  4P8B A;  1NUW A;  1VDW A;  4NAP A;  5EQ7 A;  1FBG A;  4X9T A;  4GX6 A;  4NG7 A;  1FBH A;  1FJ6 A;  1KA0 A;  4FBP A;  3RYD A;  1LBZ A;  2B4L A;  2DE3 A;  4QBA A;  2JJK A;  4MJO A;  3RPL A;  2L5V A;  4JVD A;  1NUX A;  1EYI A;  4NGU A;  4PGP A;  2XWK A;  4MX6 A;  4F18 A;  5I5P A;  4G61 A;  4OVT A;  1FPJ A;  3A29 A;  4PF8 A;  4HCY A;  2DE4 A;  1NV5 A;  1KZ8 A;  3LUZ A;  3B8B A;  5CM6 A;  4NX1 A;  4JVI A;  1LBX A;  1EYK A;  1YXI A;  4GBW A;  4JVC A;  4N6D A;  4GWW A;  4PC9 A;  3BIG A;  5EQ8 A;  4N17 A;  1IMC A;  2WX9 A;  2Q8M A;  1BK4 A;  1D9Q A;  4XFE A;  4F19 A;  1NV6 A;  2QVV A;  3T1B A;  2DE2 A;  2Y5K A;  4MEV A;  1IMF A;  2MKZ A;  1FBD A;  2VPN A;  4I3E A;  4PFR A;  4PTK A;  2QVR A;  4GWY A;  2FHY A;  4N8Y A;  5ESY A;  1FJ9 A;  2V3Q A;  2DDK A;  4OVS A;  1NV2 A;  4PBQ A;  4AS5 A;  4N91 A;  3LV0 A;  5IZ1 A;  2XA5 A;  3KBZ A;  2QPQ A;  4PFI A;  5IZZ A;  3ROJ A;  4DI4 B;  2VT5 A;  4GX3 A;  4PFB A;  4P3L A;  2XWI A;  4YZZ A;  1SPI A;  1FBF A;  4PE3 A;  5ET8 A;  2XWO A;  2VPO A;  4MAG A;  2PCR A;  3MST A;  3PTY A;  1XI6 A;  1CNQ A;  3W9W A;  1NI9 A;  3IFC A;  2CEY A;  4F1U A;  4PAI A;  4P47 A;  2FIX A;  1LEV A;  2HXR A;  2ZZV A;  5EYH A;  2B4M A;  1FPL A;  1K9Y A;  3BIH A;  4KXP A;  5IZ3 B;  4N4U A;  5LDZ A;  2FIE A;  2P3V A;  4HE0 A;  5JK4 A;  4O7M A;  4MCO A;  5DW8 A;  1KA1 A;  1K9Z A;  3FXB A;  4OVQ A;  1QGX A;  5I7I A;  4OVP A;  4X04 A;  5J1D A;  4O8M A;  5T3J A;  4PBH A;  2WYP A;  1LBV A;  4YIC A;  4N6K A;  1NV1 A;  3E79 A;  1FPE A;  2F3B A;  2PFZ A;  4DI3 D;  1RDX A;  1FPF A;  1NV0 A;  4O7I A;  5IM2 A;  2CEX A;  4XF5 A;  4UAB A;  4MHF A;  4N8G A;  1FRP A;  3GYY A;  4PAF A;  4GBV A;  4HXV A;  4QXD A;  4GWX A;  1IMB A;  1NV4 A;  1FPK A;  5EYG A;  2Q9T A;  2XXK A;  2KR0 A;  5IGA A;  1NUZ A;  4P1L A;  1AWB A;  3QMF A;  5ET7 A;  4I40 A;  4O94 A;  3RPL B;  4IR8 A;  1G0H A;  4H46 A;  2OWZ A;  1G0I A;  1NV3 A;  2KQZ A;  1RDZ A;  1YZ0 A;  2HHM A;  4GWZ A;  1YYZ A;  3KC0 A;  4PGN A;  2QVU A;  3SZP A;  3E78 A;  5EQA A;  1Q9D A;  1DBZ A;  3IFA A;  4XEQ A;  1EYJ A;  5J16 A;  2WBB A;  2HPG A;  1NV7 A;  5EQ9 A;  1INP A;  5ET6 A;  4PET A;  5A5L A;  4OA4 A;  3EKI A;  4F1V A;  2R8T A;  2FVZ A;  2DVZ A;  4OVR A;  3CHG A;  2WBD A;  4MNC A;  4LN5 A;  4MNP A;  3U65 A;  3MYU A;  5LTC A;  1JP4 A;  4NHB A;  4MMP A;  2GQ1 A;  4MNI A;  4HE2 A;  2FBP A;  3NOH A;  1FBE A;  3D1R A;  2CZI A;  2HZK A;  4P56 A;  2Y5L A;  4M1V A;  2F5X A;  2XWV A;  3B50 A;  4GWS A;  4P1E A;  4AS4 A;  2WYK A;  4I3Y A;  1IMA A;  2Q74 A;  4PDD A;  1FBC A;  1LBY A;  3FBP A;  4PAK A;  4P9K A;  5FBP A;  4PCD A;  2CZH A;  3ISP A;  1IMD A;  2ZZW A;  1DK4 A;  3W9V A;  4HE1 A;  4NQ8 A;  4GWU A;  2HZL A;  4HCW A;  4N15 A;  5I3S A;  1FTA A;  4GX4 A;  2V4C A;  1NUY A;  4NF0 A;  3KC1 A;  2CZK A;  2WEF A;  1IME A;  2F3D A;  2P3N A;  5IZ3 A;  3T0J A;  4NN3 A;  4OAN A;  4PDH A;  2ZZX A;  1FBP A;  5ET5 A;  1FPG A;  4PF6 A;  1FPB A;  4MIJ A;  1RDY A;  1FSA A;  3HFU A;  1FPD A;  2OX3 A;  1LBW A;  2PFY A;  2QFL A;  5F24 A;  1DCU A;  1FPI A;  4X8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...