5ET6A

Human muscle fructose-1,6-bisphosphatase in inactive t-state in complex with amp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
320
Chain Sequence
TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title T-to-R switch of muscle fructose-1,6-bisphosphatase involves fundamental changes of secondary and quaternary structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 320
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et6A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et6A02
1IMAA 1INPA 3T0JA 1AWBA 1EYIA 4H46A 3FBPA 2WBBA 3IFCA 4I40A 1LBYA 2GQ1A 1FPKA 2Y5KA 2DDKA 1FPGA 2P3NA 1NV4A 1YXIA 2QVUA 4GX4A 2F3BA 4QXDA 5EYHA 5ET8A 4I3YA 1IMCA 4HXVA 5DW8A 1NV1A 1K9ZA 2P3VA 1DCUA 4GBWA 2FIEA 4GWXA 4H45A 4I3EA 4GWYA 1SPIA 3RYDA 4KXPA 4IR8A 5FBPA 1FBHA 1FPEA 5J16A 3ROJA 1NUZA 2F3DA 2R8TA 4GWWA 3KC1A 1FRPA 1NV5A 2VT5A 4GWSA 1KA1A 1G0IA 4PTKA 1IMDA 1FPJA 1XI6A 1QGXA 4GWZA 2OX3A 4HE0A 5F24A 5LDZA 3KC0A 3D1RA 1LBVA 2QFLA 3KBZA 2WEFA 4GX6A 1NV6A 4HE1A 4HE2A 4AS4A 1FBGA 1FJ6A 3BIGA 1LBXA 5EQ7A 1FBEA 2JJKA 1BK4A 4FBPA 1FPLA 2Y5LA 2CZKA 1EYJA 1NV0A 1LBZA 1RDZA 1LBWA 4GBVA 2BJIA 4GWUA 5ET7A 2HHMA 5I3SA 2PCRA 1RDXA 1JP4A 3BIHA 2FHYA 5IZ1A 5EYGA 1NUXA 1EYKA 1LEVA 1FPDA 1FPBA 3QMFA 5EQAA 3LUZA 1RDYA 1FJ9A 1KA0A 1K9YA 3A29A 1FBCA 1FBDA 2OWZA 3B8BA 1FSAA 1YYZA 2QVVA 2QVRA 3LV0A 5A5LA 5ESYA 1DK4A 1NUWA 1DBZA 3IFAA 1FPFA 1FBPA 5IZ3A 1FTAA 4G61A 4GX3A 5EQ9A 1CNQA 1D9QA 2FBPA 4N81A 4O7IA 3RPLA 1KZ8A 4AS5A 5T3JA 1FBFA 1NV7A 2FIXA 2Q74A 1NV2A 2FVZA 5ET6A 5EQ8A 1NUYA 2CZIA 1NI9A 2CZHA 1VDWA 2Q8MA 5ET5A 1NV3A 1G0HA 2WBDA 5IZ3B 1IMEA 1IMFA 1Q9DA 1YZ0A 4MJOA 3RPLB 1IMBA 1FPIA
chains in the Genus database with same CATH superfamily
4QFPA 4H46A 1EYIA 5B70A 4WKMA 2XXTA 3FD3A 2DDKA 1S9TA 4IY5A 3G3GA 4HCWA 4R2BA 2XXHA 1ZU0A 5BWJA 3PPQA 1JQFA 4OEUA 2RC9A 2H4IA 2O84X 1MQIA 4OVPA 4KXPA 3O66A 3ROJA 4H5FA 3HFUA 1FPJA 4YKKA 3D1RA 3HO7A 1B32A 4EUOA 5KCJA 1B3GA 4GX6A 3ISPA 4YMBA 5IZZA 4G2ZA 1ZKBA 2QMWA 3LSWA 2QRYA 3MAMA 2WKYA 4EQ7A 3H6WA 5ET7A 1JP4A 3DP4A 3BIHA 1NUXA 5JEIA 3L6GA 1B3EA 3DLNA 4PFIA 4R6HA 3LUZA 1ZBMA 4R6YA 3EHTA 4OFLA 1IUDA 2ZZWA 4GWOA 1B4HA 2PFZA 4TLMB 1PC3A 4GXAA 4RA1A 1D4NA 1II5A 2YPNA 3CHGA 1CNQA 2D5WA 3U72A 3CR9A 4G68A 5ET6A 3Q25A 4IO3A 4RK9A 2XX7A 1Y9UA 3O2AA 1NH7A 1LBCA 3P7IA 5IZ3B 4F3SA 4LZ5A 1YZ0A 3PV0E 4I9DA 1UTHB 2CEXA 1UTBB 4F19A 2DSFA 3B6QA 2F5XA 1EZOA 4OEVA 4C0RA 2GHBA 2D3IA 4IO5A 2F3BA 3GZGA 1MRPA 1SVXB 4HXVA 4OVRA 3M3FA 3OSRA 1K9ZA 1B3LA 1IQ7A 3OEKA 3PPRA 4F29A 1MY2A 3K1PA 1N3WA 1FQCA 4NF6B 4F3GA 4KYEA 1P1OA 3T9HB 2F3DA 2Q88A 2VT5A 4NTLA 3RQTA 3KBRA 3UIFA 3MYUA 4HE1A 3NOHA 2DP8A 2XWVA 4LQ2A 4FBPA 3DP6A 3S9EA 1XVYA 2Y84A 3TCGA 1GGGA 4P1LA 3SEWA 1QULA 3CVGA 4NF4A 1JETA 3KEIA 3FASA 3H6TA 3CI8A 2Q2CA 3RNNA 1KA0A 1S50A 4Q8RA 4PE5B 5HBCA 1ZIUA 3PPNA 3B50A 1TT1A 1VFDA 4GIZA 2VP1A 2A5TA 3LSXA 3IO4A 4KI0E 4MNPA 2O68A 3HHFA 1VFEA 3RT8A 5KZTA 4X04A 4GLIA 4FORA 1LAHE 3ONMA 1SYIA 3OO9A 1G0HA 4IGRA 5TP9A 1IMEA 1H44A 3RPLB 2OJTA 3IOVA 2Z8DA 2R9JA 4HW8A 1B5JA 1FPKA 1B40A 4PBQA 3HPIA 3FUZA 1WVJA 4OFJA 1YXIA 1B0HA 2QVUA 2XXWA 2P2AA 1S7YA 2HXWA 5I56B 5IAIA 3SERA 4H0WA 5DW8A 3K6VA 5ICQA 4ELOA 3FXUA 3TMGA 4ESWA 4GQOA 2VD2A 3FXRA 5H8NA 3E79A 2QSXA 1NMUA 1P1WA 3CG3A 4O94A 2XXRA 3LR1A 3RLFE 3ILUB 2B4MA 2BJJX 4O8MA 2Y5LA 2CZKA 1RDZA 4GWUA 2VOZA 1JVYA 1PB8A 2PCRA 3LSFB 1XOCA 1M5CA 4ZEDA 1OMPA 2UVIA 2ZXTA 2X7QA 1FPBA 3IOUA 2XXQA 4FATA 4F1YA 5HM4B 2NWJA 1MXUA 3R7XA 2ZNUA 1DBZA 2DWIA 1B0LA 5I2NA 4U1OA 5J1DA 3IORA 1B2HA 1PB7A 4DIGA 2NUVA 1MY0A 3PUVE 2ZYNA 5TPAB 4PDDA 3C32A 3U65A 5A5XA 3MWBA 1M5DA 1TXFA 4JDFA 1IMBA 3UA8A 1JW4A 4ND9A 2Y5KA 1H45A 1MS7A 3CG1A 3KSJA 3CFZA 4RY1A 2F34A 5CI5A 1LFIA 3MQ9A 4KYSA 4F39A 4GWXA 2VD3A 3TODA 3RYDA 4G4PA 4U2RA 1MDP1 2DQVA 3BFUA 1FBHA 4G8MA 4GD5A 1I6BA 1OIBA 4FIMA 5FHOA 1ATGA 4HE0A 2OLBA 3LSLA 2XD2A 3K6WA 3A3UA 1B5IA 3TQLA 3N5LA 4ZZEA 5I3SA 4MBPA 3THIA 1MQHA 1XT8A 3E78A 1JVXA 4OESA 3PUYE 4F1UA 4MNIA 2W7YA 1DTGA 4OERA 2VPNA 3N26A 5H8FA 2G93A 3S9NC 2H25A 3B8BA 1YYZA 3CSGA 4XKRA 3K2DA 2ANJA 3LV0A 1B3HA 5TU0A 1FQDA 2UVHA 3IB1A 4N81A 5DEXB 4ZEFA 1IXGA 1FTMA 3TCHA 1NUYA 4RNSA 4BDNA 4NWCA 1NNFA 2O7UA 3I3VA 4IGTA 2HCAA 4TLLB 1YAEA 1LBYA 4U1ZA 1Y3NA 4I8CA 4UA8A 4C1UA 2CMOA 3T9UA 4JVIA 3E9XA 1NV1A 5L9SA 1URGA 5JTYA 4NG7A 3WAEA 5I7IA 2KQZA 3MUQA 2H5YA 4N6KA 1EZ9A 5DT6A 5FHNA 3PTYA 4P1EA 4ZECA 4PBHA 1SW4A 1I6AA 1FRPA 1FTLA 5CC2A 1QJMA 5F24A 4R2FA 4N8YA 5IM2A 4GOTA 4PF8A 1POTA 3CFLA 3D4CA 4JB7A 4OHNA 4YAHX 4R75A 1PEBA 4MCOA 1R6ZA 3FZVA 1B4ZA 4BDOA 1B7UA 2F35A 3C4MA 3V83A 4N6DA 3TTNA 1IXCA 3TQWA 2MKZA 5IGAA 4EQ9A 1MXZA 4NWDA 3TTLA 3CFXA 4EF2A 1M5BA 1LLSA 2XXKA 2QL3A 1MY1A 3IFAA 4Q0CA 2F7AA 4U22A 4ZEBA 2V93A 4O7IA 3OSQA 3RTFB 4RJZA 1USYH 4GRKA 1EU8A 2NOOA 2WYPA 1MY3A 2XWKA 3RY3A 2P0SA 1O63A 2WBDA 3BBRA 2O1MA 3BFTA 4BDLA 4DDDA 1Z7ME 2R71A 3F11A 3K4UA 2AL5A 3MZBA 3C9HA 4GX4A 3G3JA 5AA2A 1IMCA 4OZ9A 4DXCA 1DCUA 4N15A 4OMBA 5I59A 5AA1A 3DELB 3AXFA 3FGSA 4GWYA 4O7MA 3UP9A 1BP5A 3QK6A 1BTJA 3CRBA 1ZJLA 3TFLA 4E0XA 2NVUB 3U8QA 4PCDA 3TYHA 1L5TA 1CE2A 5LDZA 3FV2A 3OO6A 4FE8A 2WEFA 3QXMA 4XEQA 5ISUA 1SI1A 4QBAA 2VGQA 2QS3A 5L9MA 1EYJA 1IXIA 3T93B 3VFJA 3MP8A 3EF7A 2NXOA 4RXLA 2XX8A 3LBSA 3JYRA 3T66A 2Z8FA 5KCJB 5EYFA 1EYKA 1QKBA 2X26A 1N7WA 4ONYA 3FVOA 4LATA 3KN7A 1K9YA 1WODA 2QVRA 2V4CA 5I84A 2RCAA 1D3KA 1PBPA 2Y7PA 4ELQA 1IZ1A 4N13A 3PU5A 1NV7A 2H98A 3QUJA 4H6DA 5ICTA 1UIVA 4TQUQ 1SI0A 4MAGA 1MXYA 4IO2A 5ET5A 3Q28A 4KPTA 1FTOA 3PUWE 2DXRA 4LONB 5AE4A 5KDTA 2OPEA 1P1UA 3EQ1A 1FJ9A 1FPIA 1IMAA 4JSOA 4G68B 2ONRA 4I40A 4MEVA 1Y1ZA 1HSJA 1AH5A 2Z22A 3B6WA 3FXQA 2R6GE 3MPLA 4KHZE 3OD7A 4BLAA 1NH8A 4F3PA 4QF9A 1B1XA 2OWSA 1SPIA 4DI3D 3VVEA 3KOTA 4LP2B 4QSDA 3MVZA 4OETA 3KC1A 4F31B 2M8CA 5AA4A 5CBRA 2HQ0A 4FECA 2PVUA 1H43A 3EKIA 3O6HA 3G3FA 2IA4A 2GHAA 5CMCA 1RDXA 4KCDA 4YZZA 4ECFA 3IB0A 2XHDA 3N94A 3O29A 4KQPA 5I2KA 1P1QA 3QMFA 1LAGE 2PMSA 3A29A 5DVJA 1FSAA 4ZE9A 3VLWA 4P3LA 1Y1MA 2XXYA 4NF4B 2QJEA 4PQJA 3W15C 2H9BA 4LN5A 3K1MA 2FA7A 4MLVA 2Q74A 4XTCQ 1NI9A 2OCUA 1H3DA 2FYIA 3IAZA 1IMFA 1SYHA 1GTKA 3ECRA 1DPPA 4G8HA 2A5TB 1INPA 4IO4A 3KJ7A 5DVIA 4DLDA 1FPGA 2DOJA 3KG2A 4QXDA 5TP9B 4KFQA 4PAFA 3U93A 3C34A 3A3CA 4JWOA 4FAJA 2Q2AA 3N6UA 2E1SA 1AMFA 1POY1 4WEPA 5L8DA 5J16A 1NUZA 2OWTA 3E4RA 2GH9A 4O3CA 2WYKA 4X1BA 3IK6B 4OXVA 2DXYA 2V3QA 1RKMA 5I5PA 2DE3A 3Q26A 1P1NA 4IY6A 5H8NB 1B3FA 1FPLA 1LAXA 4POWA 4GBVA 2O1LA 2HHMA 4X1DA 5EYGA 3MJNA 1FTJA 4G8NA 4MX6A 2OPDA 1WDNA 1GV8A 4YMAA 1IEJA 3ZKLA 2PT2A 3HN0A 2I3WA 5ESYA 1DK4A 4POXA 3C33A 3OO8A 4YKIA 5IKBA 2UYFA 5DTBA 2F7CA 3C31A 1D9YA 4YKPA 4LZ8A 1MQJA 1A8EA 2I4CA 2PYYA 3EN3A 5I2NB 3IO6A 3DP8A 5H8SA 4EXKA 1LSTA 3V8XB 1QW0A 1AL3A 4F2OA 4FEBA 2I0CA 1B9JA 3MVXA 3PD8A 4GFRA 4R74A 2QS4A 1GR2A 3M3KA 4OVQA 2YLNA 4M4GA 4OVJA 2Y7WA 2P3VA 2THIA 5LOMA 1TWYA 4UABA 5I58A 4OA4A 1VE4A 2XD3A 3T96B 1T0KA 1MXXA 1N04A 3KSXA 1US5A 3V5AA 1G0IA 4PGNA 1EZPA 4GVOA 1MXWA 3GXAA 3GLBA 1XHYA 1XVXA 3H6UA 5TPAA 1Q35A 1URSA 3IJXB 3O28A 4P11A 1VR5A 5H8QA 2ONKE 5JK4A 4KD5A 3H06B 1OVTA 1RYOA 1RYXA 2L5VA 4NX1A 3UORA 3OEMA 1MY4A 3Q27A 1NKXA 2V3UA 1RDYA 4JBZA 4U21A 3H7MA 1SD3A 3U94A 2UYEA 4P0GA 1XS5A 3ILTB 4AS5A 1USYE 2DWAA 2FIXA 4GL8A 5H8FB 4LQ5A 1NV2A 4BDMA 3TDJA 2DVCA 3MPKA 2DS9A 1OLCA 4BDRA 3FJGA 4N6PA 3OOAA 3MC2A 1JW5A 3PUXE 4O3BA 3PMWA 3KGCA 1NNPA 4ZEKA 1AWBA 3I5OA 3MBPA 1TFAA 5FHMA 4DI4B 2I6EA 3C35A 3OMBA 3VXBA 4QSCA 1LCTA 1Q1KA 4ELPA 3S2VA 4F3BA 1YTVA 3C36A 1JEUA 2AIXA 4MIJA 3RUMA 4R9FA 5ITOA 3W9VA 1A8FA 3LC8A 4GBWA 2GFEA 3PD9A 4MFIA 3FV1A 3VLVA 2FNCA 2V84A 4PDHA 4OENA 1B51A 3GYYA 4IR8A 1ELJA 2PBWA 4YB7A 2R8TA 1B6HA 1LBBA 2I49A 4GWWA 1SQYA 2XWOA 5H8HA 5I57A 1IMDA 4NGUA 3CIJA 4GWZA 4ISUA 4OWDA 3FATA 3MSTA 2DE4A 4N07A 4EXLA 4IB2A 2QPQA 3PPOA 4GXSB 2QS2A 5ITPA 4PFBA 5CMKA 2HXRA 2XA5A 4NF5A 4QHQA 1OLAA 3OO7A 1FPDA 2P1SA 1FQAA 1I69A 2HZLA 4QFKA 4LZ7A 3SEXA 1QVSA 3RN8A 2D21A 1I6QA 4PF6A 2OWZA 2F7BA 1R9LA 4G68C 2QVVA 4RYAA 1FTAA 4R9GA 2XXPA 4JXIA 4NHBA 4I62A 4KYDA 3MP1A 4YB5A 1HSEA 4JWXA 3JV9A 5EQ8A 3G3KA 1BKAA 1DSNA 2F78A 3M8UA 2ABHA 5M2VA 4NF8A 4HTGA 3SDFA 3IR1A 3OELA 3JZJA 1Y20A 1A40A 2ONSA 4XFEA 1ANFA 1FQFA 4P47A 3K1NA 4JVCA 2HEUA 3G7WA 3HHGA 1NV4A 5ET8A 3UGWA 4N4UA 3FVGA 3QUFA 2ZYOA 1OQHA 1J1NA 3KN8A 1PDAA 2O6AA 2Y7RA 1XC1A 4H45A 1FCKA 1QUJA 3GBAA 4Z0IA 2XXVA 5AA2B 1CB6A 1NV5A 4N8GA 5ELVA 2QS1A 4FEDA 3KBZA 4YU0A 1A99A 2XXXA 4AS4A 1FBGA 2LAOA 1LFGA 3VLUA 3H6VA 4P8BA 2ZNSA 1NV0A 3MVYA 3HCQA 1MQDA 1F9BA 4XXUA 4ZDMA 4R73A 1P99A 3PPPA 5EQAA 3QIMA 3RTWB 2CZLA 3SESA 1M5EA 1ZLQA 4WEDA 1EH3A 4H67A 3S9MC 4HCYA 5EQ9A 3PUZE 4PC9A 5T3JA 4H5GA 4H8JA 1FBFA 3I6VA 3OENA 2CZIA 3TZAA 4K3FA 4DCXA 5HPQA 3BKIB 3KZGA 4QFNA 3A09A 1GVCA 2HFBA 4OFOA 4P9KA 1DOTA 5AA3A 4OYVA 2DWJA 3HSTA 2ALUA 5KDTB 3ZS6A 3FJ7A 3K00A 4LA9A 4XKPA 3QAXA 4I3EA 1Y4CA 1B46A 4Z7EA 4ZS9A 3E3KA 5AA2D 4GWSA 1R9QA 4H1XA 4XF5A 5FTHA 1LBVA 3IJOB 1FQEA 1DTZA 1MH3A 4HE2A 4EDPA 3TPAA 1FBEA 1B7ZA 3CSBA 3TTMA 1LBZA 1LBWA 5CMMA 3RGYA 5AA4B 1US4A 2B65A 3TAJA 3OXNA 1SW2A 3TEPA 3G3IA 2RC7A 4M1VA 3K02A 2F6PA 2AL4A 4R6KA 1UIUA 2IEEA 1LFHA 2UVGA 1MM6A 2DVZA 4OVSA 1QUIA 3R26A 3MP6A 3SEYA 2WX9A 4DE8A 5LTCA 2RC8A 4C1TA 1NUWA 4AB6A 4H8IA 3K01A 4ZEIA 5IZ3A 1OQGA 1MM7A 5I2KB 3ZKKA 3H03A 1UTHA 1Y3PA 4X8RA 1UQWA 5K2XA 1YCJA 4TOZA 1UTBA 3HV1A 1NL5A 3U1OA 2DE2A 3K0VA 1VDWA 5CBSA 3EPEA 3ODBA 4MJOA 2I3VA 2YJPA 4PAIA 3T0JA 3K6UA 2E0SA 2GRVA 4NF6A 2XWIA 1JEVA 4H65A 2DWHA 2Y7IA 3O9PA 4THIA 2FIEA 4NAPA 2V25A 3T1BA 4ZE8A 5L9OA 3MVWA 2ZZXA 4NF0A 5K2YA 4OTEA 5FTIA 1KA1A 4OQOA 2G29A 4MF3A 3KC0A 4PE3A 2OZZA 4NMYA 4NE4A 4MHFA 3BIGA 2ESNA 5DYHA 4N91A 1N0TA 3FVKA 2BJIA 3H4ZA 1FQBA 4UACA 2DYXA 3KN3A 4F22A 2Q89A 5CMBA 2B4LA 3PGFA 4MNCA 2OK2A 3IOTA 1FBCA 3UK4A 5A5LA 1N76A 5CM6A 4IO6A 4IO7A 4PFTA 1FBPA 4PGPA 1B52A 1MG1A 4RPOA 4GX3A 3VE1B 3RPLA 1D9QA 2O51A 1KZ8A 2HAUA 3VXCA 1IITA 4P0IA 1BLFA 1DPEA 1LAFE 2CZHA 4RK2A 2PT1A 4X48A 4DCYA 3EHUA 5I56A 2OBGA 2VPOA 3KJTA 2UVJA 2WBBA 2GQ1A 3R6UA 3EHSA 1MPCA 4I3YA 3W9WA 3MZ1A 3T9VA 3O6GA 4ZZAA 4ELRA 1MXVA 2ZNTA 3TUSA 2X7PA 4PFUA 1LB8A 3KOSA 1H76A 3KFMA 2CEYA 1FPEA 4X9TA 4AB5A 1B05A 3WAFA 4BDQA 4PTKA 5F1QA 1QGXA 5A5XB 5I58B 4F2QA 1LCFA 3TTRA 1VSOA 1KWHA 3IL1B 3SEUA 3SETA 1FJ6A 3TELA 1LBXA 5EQ7A 1MPDA 2F36A 3VDFA 3IB2A 3S4UA 4MMPA 4KR5A 1LEVA 4F1VA 4QRZA 3D4GA 3VV5A 3SZPA 5H8QB 1Y3QA 1FBDA 2RF1A 4XKNA 1NNTA 2F6GA 4XIGQ 3T22A 2HAVA 2KR0A 3B6TA 2REJA 2XXIA 4Q30B 1NV3A 4PP0A 4PAKA 4I1DA 2F97A 3PMXA 2ZMBA 2A5SA 1OVBA 1A55A 5EHMA 4NEDA 3IX1A 3PMVA 4U4XA 3IOWA 4YKJA 3MW0A 3VVFA 4GL0A 5B7DA 3GBBA 4P56A 3VVDA 2QMXA 3SKPA 2Z8EA 3TCFA 1NFTA 4OANA 1N84A 1SW5A 2RKMA 1Y4TA 3Q29A 1B7HA 1ZMGA 1IIWA 1MH4A 4QSEA 1HSLA 3O97A 5F7VA 4JSDA 1LGBC 2REGA 2VHAA 2PX1A 2I4BA 4G77A 1XI6A 1PB9A 2V3TA 2OX3A 3USDA 3TTKA 4DXUA 4Q5TA 2B3BA 3K6XA 1O7TA 3O6IA 2JJKA 1ZTYA 2PFYA 3FVNA 5H8HB 5I57B 4U23A 2Y7KA 4PETA 1IXHA 4DXBA 3MZ9A 3T9XB 2I0BA 4F18A 2FHYA 4ESXA 1A7LA 4GF8A 1N3XA 3LUYA 5JTYB 4N17A 5DEXA 3QYTA 3QSLA 2Q9TA 2ZZVA 5CRYA 1FPFA 2Q8JA 1JNFA 5BUUA 4G61A 4NF5B 2FBPA 3U92A 4AQ4A 2RINA 2AYSA 4QFOA 4PFWA 3M3LA 2RCBA 2ZYKA 1QKAA 4KCCA 5DVFA 2Q8MA 1AIVA 1Q9DA 3V89B 4E0WA 3FBPA 3IFCA 1R1NA 2I58A 1URDA 1MQGA 3UN6A 4NQ8A 4LUBA 2P3NA 3SEVA 4PFRA 5EYHA 1M5FA 2O69A 4NF8B 1LB9A 2XX9A 1Z7NE 1B58A 3L6HA 3TKDA 1O64A 2UXAA 1FW0A 3FIRA 3RT6B 3G3HA 5FBPA 4DZ1A 4YICA 2ZYMA 3FXBA 1SDXA 1MPBA 2QFLA 4U4SA 1NV6A 4QFLA 3DM0A 4XKQA 4OVTA 1BK4A 4EQBA 1B1HA 1SW1A 4O3AA 4FJPA 2KLFA 3FJMA 1SBPA 5IZ1A 4YB6A 3S9LC 4L17A 1FTKA 1B5HA 1NNKA 4MLQA 1AOVA 5I59B 1QUKA 1PBQA 3RPWA 4WXJA 2I48A 4PFYA 1MDQA 1D9VA 3N6TA 2HPGA 1TFDA 1YPNA 2XXUA 2H99A 1A54A 4LVQA 3H3GA 3E13X 4R72A 2HZKA 1N7XA 1BIYA 3ZSFA 2Z23A 3B7DA 4JWYA 4RPNA 2FVZA 4NN3A 5EHSA 4MH5A 2O7IA 1DMBA 4EF1A 4HS7A 1JW1A 2B3FA 4JVDA 2F8DA
chains in the Genus database with same CATH topology
3T0JA 4H46A 1EYIA 1LBYA 2DDKA 4HCWA 2XWIA 4JVIA 4OVQA 1NV1A 2P3VA 4NG7A 4UABA 5I7IA 2FIEA 4NAPA 2KQZA 4OA4A 4N6KA 3T1BA 4OVPA 3PTYA 4P1EA 4KXPA 4PBHA 2ZZXA 3ROJA 4NF0A 1FRPA 1KA1A 1G0IA 3HFUA 4PGNA 1FPJA 5F24A 4N8YA 5IM2A 3KC0A 3D1RA 4PF8A 4PE3A 4GX6A 4MHFA 3ISPA 5IZZA 3BIGA 4MCOA 4N91A 5ET7A 2BJIA 1JP4A 5JK4A 3BIHA 1NUXA 2L5VA 4N6DA 4NX1A 2MKZA 4PFIA 5IGAA 2B4LA 4MNCA 3LUZA 1RDYA 1FBCA 2ZZWA 2XXKA 2PFZA 5A5LA 5CM6A 3IFAA 1FBPA 4PGPA 4GX3A 3CHGA 1CNQA 1D9QA 4O7IA 3RPLA 4AS5A 1KZ8A 2FIXA 2WYPA 1NV2A 2XWKA 5ET6A 2CZHA 2WBDA 5IZ3B 1YZ0A 2VPOA 1AWBA 2CEXA 2WBBA 4F19A 2GQ1A 4DI4B 2F5XA 4GX4A 2F3BA 4I3YA 3W9WA 1IMCA 4HXVA 4MIJA 4OVRA 1K9ZA 3W9VA 1DCUA 4N15A 4GBWA 4PDHA 3GYYA 4GWYA 4IR8A 4O7MA 2CEYA 1FPEA 4X9TA 2F3DA 2R8TA 2XWOA 4GWWA 2VT5A 4PCDA 4PTKA 1IMDA 4NGUA 1QGXA 4GWZA 5LDZA 3MSTA 3MYUA 2DE4A 2QPQA 2WEFA 4HE1A 4XEQA 4QBAA 1FJ6A 1LBXA 5EQ7A 3NOHA 2XWVA 4FBPA 4PFBA 1EYJA 4MMPA 2HXRA 2XA5A 4P1LA 1EYKA 1LEVA 4F1VA 1FPDA 2HZLA 3SZPA 1KA0A 1K9YA 4PF6A 2OWZA 1FBDA 2QVVA 2QVRA 2V4CA 2KR0A 3B50A 1FTAA 4NHBA 1NV7A 4MNPA 4MAGA 5EQ8A 4X04A 5ET5A 1NV3A 1G0HA 4PAKA 1IMEA 3RPLB 1FJ9A 1FPIA 1IMAA 4XFEA 4I40A 4P47A 1FPKA 4MEVA 4JVCA 4PBQA 1NV4A 1YXIA 2QVUA 5ET8A 4P56A 4N4UA 5DW8A 4OANA 4H45A 1SPIA 4DI3D 3KC1A 3E79A 1NV5A 4N8GA 1XI6A 2OX3A 3KBZA 4O94A 3EKIA 4AS4A 1FBGA 2JJKA 2B4MA 2PFYA 4P8BA 4O8MA 2Y5LA 2CZKA 1NV0A 1RDZA 4GWUA 4PETA 2PCRA 1RDXA 4YZZA 4F18A 2FHYA 4N17A 1FPBA 3QMFA 5EQAA 3A29A 1FSAA 2Q9TA 4P3LA 2ZZVA 1DBZA 1FPFA 4G61A 4HCYA 5EQ9A 5J1DA 2FBPA 4LN5A 4PC9A 5T3JA 1FBFA 2Q74A 2CZIA 1NI9A 4PDDA 2Q8MA 3U65A 1IMFA 1Q9DA 1IMBA 1INPA 3FBPA 3IFCA 4P9KA 2Y5KA 4NQ8A 1FPGA 2P3NA 4PFRA 5EYHA 4QXDA 4PAFA 4GWXA 4I3EA 3RYDA 5FBPA 1FBHA 5J16A 1NUZA 4GWSA 4YICA 3FXBA 4HE0A 4XF5A 2WYKA 1LBVA 2QFLA 2V3QA 5I5PA 4HE2A 1NV6A 2DE3A 4OVTA 1FBEA 1BK4A 1FPLA 1LBZA 1LBWA 4GBVA 5I3SA 2HHMA 5IZ1A 3E78A 5EYGA 4M1VA 4MX6A 4F1UA 4MNIA 2VPNA 2DVZA 4OVSA 2WX9A 3B8BA 1YYZA 2HPGA 5LTCA 3LV0A 5ESYA 1DK4A 1NUWA 5IZ3A 2HZKA 4N81A 4X8RA 2FVZA 1NUYA 2DE2A 1VDWA 4NN3A 4MJOA 4JVDA 4PAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMA A;  1INP A;  3T0J A;  1AWB A;  1EYI A;  4H46 A;  3FBP A;  2WBB A;  3IFC A;  4I40 A;  1LBY A;  2GQ1 A;  1FPK A;  2Y5K A;  2DDK A;  1FPG A;  2P3N A;  1NV4 A;  1YXI A;  2QVU A;  4GX4 A;  2F3B A;  4QXD A;  5EYH A;  5ET8 A;  4I3Y A;  1IMC A;  4HXV A;  5DW8 A;  1NV1 A;  1K9Z A;  2P3V A;  1DCU A;  4GBW A;  2FIE A;  4GWX A;  4H45 A;  4I3E A;  4GWY A;  1SPI A;  3RYD A;  4KXP A;  4IR8 A;  5FBP A;  1FBH A;  1FPE A;  5J16 A;  3ROJ A;  1NUZ A;  2F3D A;  2R8T A;  4GWW A;  3KC1 A;  1FRP A;  1NV5 A;  2VT5 A;  4GWS A;  1KA1 A;  1G0I A;  4PTK A;  1IMD A;  1FPJ A;  1XI6 A;  1QGX A;  4GWZ A;  2OX3 A;  4HE0 A;  5F24 A;  5LDZ A;  3KC0 A;  3D1R A;  1LBV A;  2QFL A;  3KBZ A;  2WEF A;  4GX6 A;  1NV6 A;  4HE1 A;  4HE2 A;  4AS4 A;  1FBG A;  1FJ6 A;  3BIG A;  1LBX A;  5EQ7 A;  1FBE A;  2JJK A;  1BK4 A;  4FBP A;  1FPL A;  2Y5L A;  2CZK A;  1EYJ A;  1NV0 A;  1LBZ A;  1RDZ A;  1LBW A;  4GBV A;  2BJI A;  4GWU A;  5ET7 A;  2HHM A;  5I3S A;  2PCR A;  1RDX A;  1JP4 A;  3BIH A;  2FHY A;  5IZ1 A;  5EYG A;  1NUX A;  1EYK A;  1LEV A;  1FPD A;  1FPB A;  3QMF A;  5EQA A;  3LUZ A;  1RDY A;  1FJ9 A;  1KA0 A;  1K9Y A;  3A29 A;  1FBC A;  1FBD A;  2OWZ A;  3B8B A;  1FSA A;  1YYZ A;  2QVV A;  2QVR A;  3LV0 A;  5A5L A;  5ESY A;  1DK4 A;  1NUW A;  1DBZ A;  3IFA A;  1FPF A;  1FBP A;  5IZ3 A;  1FTA A;  4G61 A;  4GX3 A;  5EQ9 A;  1CNQ A;  1D9Q A;  2FBP A;  4N81 A;  4O7I A;  3RPL A;  1KZ8 A;  4AS5 A;  5T3J A;  1FBF A;  1NV7 A;  2FIX A;  2Q74 A;  1NV2 A;  2FVZ A;  5ET6 A;  5EQ8 A;  1NUY A;  2CZI A;  1NI9 A;  2CZH A;  1VDW A;  2Q8M A;  5ET5 A;  1NV3 A;  1G0H A;  2WBD A;  5IZ3 B;  1IME A;  1IMF A;  1Q9D A;  1YZ0 A;  4MJO A;  3RPL B;  1IMB A;  1FPI A; 
#chains in the Genus database with same CATH topology
 4QFP A;  4H46 A;  1EYI A;  5B70 A;  4WKM A;  2XXT A;  3FD3 A;  2DDK A;  1S9T A;  4IY5 A;  3G3G A;  4HCW A;  4R2B A;  2XXH A;  1ZU0 A;  5BWJ A;  3PPQ A;  1JQF A;  4OEU A;  2RC9 A;  2H4I A;  2O84 X;  1MQI A;  4OVP A;  4KXP A;  3O66 A;  3ROJ A;  4H5F A;  3HFU A;  1FPJ A;  4YKK A;  3D1R A;  3HO7 A;  1B32 A;  4EUO A;  5KCJ A;  1B3G A;  4GX6 A;  3ISP A;  4YMB A;  5IZZ A;  4G2Z A;  1ZKB A;  2QMW A;  3LSW A;  2QRY A;  3MAM A;  2WKY A;  4EQ7 A;  3H6W A;  5ET7 A;  1JP4 A;  3DP4 A;  3BIH A;  1NUX A;  5JEI A;  3L6G A;  1B3E A;  3DLN A;  4PFI A;  4R6H A;  3LUZ A;  1ZBM A;  4R6Y A;  3EHT A;  4OFL A;  1IUD A;  2ZZW A;  4GWO A;  1B4H A;  2PFZ A;  4TLM B;  1PC3 A;  4GXA A;  4RA1 A;  1D4N A;  1II5 A;  2YPN A;  3CHG A;  1CNQ A;  2D5W A;  3U72 A;  3CR9 A;  4G68 A;  5ET6 A;  3Q25 A;  4IO3 A;  4RK9 A;  2XX7 A;  1Y9U A;  3O2A A;  1NH7 A;  1LBC A;  3P7I A;  5IZ3 B;  4F3S A;  4LZ5 A;  1YZ0 A;  3PV0 E;  4I9D A;  1UTH B;  2CEX A;  1UTB B;  4F19 A;  2DSF A;  3B6Q A;  2F5X A;  1EZO A;  4OEV A;  4C0R A;  2GHB A;  2D3I A;  4IO5 A;  2F3B A;  3GZG A;  1MRP A;  1SVX B;  4HXV A;  4OVR A;  3M3F A;  3OSR A;  1K9Z A;  1B3L A;  1IQ7 A;  3OEK A;  3PPR A;  4F29 A;  1MY2 A;  3K1P A;  1N3W A;  1FQC A;  4NF6 B;  4F3G A;  4KYE A;  1P1O A;  3T9H B;  2F3D A;  2Q88 A;  2VT5 A;  4NTL A;  3RQT A;  3KBR A;  3UIF A;  3MYU A;  4HE1 A;  3NOH A;  2DP8 A;  2XWV A;  4LQ2 A;  4FBP A;  3DP6 A;  3S9E A;  1XVY A;  2Y84 A;  3TCG A;  1GGG A;  4P1L A;  3SEW A;  1QUL A;  3CVG A;  4NF4 A;  1JET A;  3KEI A;  3FAS A;  3H6T A;  3CI8 A;  2Q2C A;  3RNN A;  1KA0 A;  1S50 A;  4Q8R A;  4PE5 B;  5HBC A;  1ZIU A;  3PPN A;  3B50 A;  1TT1 A;  1VFD A;  4GIZ A;  2VP1 A;  2A5T A;  3LSX A;  3IO4 A;  4KI0 E;  4MNP A;  2O68 A;  3HHF A;  1VFE A;  3RT8 A;  5KZT A;  4X04 A;  4GLI A;  4FOR A;  1LAH E;  3ONM A;  1SYI A;  3OO9 A;  1G0H A;  4IGR A;  5TP9 A;  1IME A;  1H44 A;  3RPL B;  2OJT A;  3IOV A;  2Z8D A;  2R9J A;  4HW8 A;  1B5J A;  1FPK A;  1B40 A;  4PBQ A;  3HPI A;  3FUZ A;  1WVJ A;  4OFJ A;  1YXI A;  1B0H A;  2QVU A;  2XXW A;  2P2A A;  1S7Y A;  2HXW A;  5I56 B;  5IAI A;  3SER A;  4H0W A;  5DW8 A;  3K6V A;  5ICQ A;  4ELO A;  3FXU A;  3TMG A;  4ESW A;  4GQO A;  2VD2 A;  3FXR A;  5H8N A;  3E79 A;  2QSX A;  1NMU A;  1P1W A;  3CG3 A;  4O94 A;  2XXR A;  3LR1 A;  3RLF E;  3ILU B;  2B4M A;  2BJJ X;  4O8M A;  2Y5L A;  2CZK A;  1RDZ A;  4GWU A;  2VOZ A;  1JVY A;  1PB8 A;  2PCR A;  3LSF B;  1XOC A;  1M5C A;  4ZED A;  1OMP A;  2UVI A;  2ZXT A;  2X7Q A;  1FPB A;  3IOU A;  2XXQ A;  4FAT A;  4F1Y A;  5HM4 B;  2NWJ A;  1MXU A;  3R7X A;  2ZNU A;  1DBZ A;  2DWI A;  1B0L A;  5I2N A;  4U1O A;  5J1D A;  3IOR A;  1B2H A;  1PB7 A;  4DIG A;  2NUV A;  1MY0 A;  3PUV E;  2ZYN A;  5TPA B;  4PDD A;  3C32 A;  3U65 A;  5A5X A;  3MWB A;  1M5D A;  1TXF A;  4JDF A;  1IMB A;  3UA8 A;  1JW4 A;  4ND9 A;  2Y5K A;  1H45 A;  1MS7 A;  3CG1 A;  3KSJ A;  3CFZ A;  4RY1 A;  2F34 A;  5CI5 A;  1LFI A;  3MQ9 A;  4KYS A;  4F39 A;  4GWX A;  2VD3 A;  3TOD A;  3RYD A;  4G4P A;  4U2R A;  1MDP 1;  2DQV A;  3BFU A;  1FBH A;  4G8M A;  4GD5 A;  1I6B A;  1OIB A;  4FIM A;  5FHO A;  1ATG A;  4HE0 A;  2OLB A;  3LSL A;  2XD2 A;  3K6W A;  3A3U A;  1B5I A;  3TQL A;  3N5L A;  4ZZE A;  5I3S A;  4MBP A;  3THI A;  1MQH A;  1XT8 A;  3E78 A;  1JVX A;  4OES A;  3PUY E;  4F1U A;  4MNI A;  2W7Y A;  1DTG A;  4OER A;  2VPN A;  3N26 A;  5H8F A;  2G93 A;  3S9N C;  2H25 A;  3B8B A;  1YYZ A;  3CSG A;  4XKR A;  3K2D A;  2ANJ A;  3LV0 A;  1B3H A;  5TU0 A;  1FQD A;  2UVH A;  3IB1 A;  4N81 A;  5DEX B;  4ZEF A;  1IXG A;  1FTM A;  3TCH A;  1NUY A;  4RNS A;  4BDN A;  4NWC A;  1NNF A;  2O7U A;  3I3V A;  4IGT A;  2HCA A;  4TLL B;  1YAE A;  1LBY A;  4U1Z A;  1Y3N A;  4I8C A;  4UA8 A;  4C1U A;  2CMO A;  3T9U A;  4JVI A;  3E9X A;  1NV1 A;  5L9S A;  1URG A;  5JTY A;  4NG7 A;  3WAE A;  5I7I A;  2KQZ A;  3MUQ A;  2H5Y A;  4N6K A;  1EZ9 A;  5DT6 A;  5FHN A;  3PTY A;  4P1E A;  4ZEC A;  4PBH A;  1SW4 A;  1I6A A;  1FRP A;  1FTL A;  5CC2 A;  1QJM A;  5F24 A;  4R2F A;  4N8Y A;  5IM2 A;  4GOT A;  4PF8 A;  1POT A;  3CFL A;  3D4C A;  4JB7 A;  4OHN A;  4YAH X;  4R75 A;  1PEB A;  4MCO A;  1R6Z A;  3FZV A;  1B4Z A;  4BDO A;  1B7U A;  2F35 A;  3C4M A;  3V83 A;  4N6D A;  3TTN A;  1IXC A;  3TQW A;  2MKZ A;  5IGA A;  4EQ9 A;  1MXZ A;  4NWD A;  3TTL A;  3CFX A;  4EF2 A;  1M5B A;  1LLS A;  2XXK A;  2QL3 A;  1MY1 A;  3IFA A;  4Q0C A;  2F7A A;  4U22 A;  4ZEB A;  2V93 A;  4O7I A;  3OSQ A;  3RTF B;  4RJZ A;  1USY H;  4GRK A;  1EU8 A;  2NOO A;  2WYP A;  1MY3 A;  2XWK A;  3RY3 A;  2P0S A;  1O63 A;  2WBD A;  3BBR A;  2O1M A;  3BFT A;  4BDL A;  4DDD A;  1Z7M E;  2R71 A;  3F11 A;  3K4U A;  2AL5 A;  3MZB A;  3C9H A;  4GX4 A;  3G3J A;  5AA2 A;  1IMC A;  4OZ9 A;  4DXC A;  1DCU A;  4N15 A;  4OMB A;  5I59 A;  5AA1 A;  3DEL B;  3AXF A;  3FGS A;  4GWY A;  4O7M A;  3UP9 A;  1BP5 A;  3QK6 A;  1BTJ A;  3CRB A;  1ZJL A;  3TFL A;  4E0X A;  2NVU B;  3U8Q A;  4PCD A;  3TYH A;  1L5T A;  1CE2 A;  5LDZ A;  3FV2 A;  3OO6 A;  4FE8 A;  2WEF A;  3QXM A;  4XEQ A;  5ISU A;  1SI1 A;  4QBA A;  2VGQ A;  2QS3 A;  5L9M A;  1EYJ A;  1IXI A;  3T93 B;  3VFJ A;  3MP8 A;  3EF7 A;  2NXO A;  4RXL A;  2XX8 A;  3LBS A;  3JYR A;  3T66 A;  2Z8F A;  5KCJ B;  5EYF A;  1EYK A;  1QKB A;  2X26 A;  1N7W A;  4ONY A;  3FVO A;  4LAT A;  3KN7 A;  1K9Y A;  1WOD A;  2QVR A;  2V4C A;  5I84 A;  2RCA A;  1D3K A;  1PBP A;  2Y7P A;  4ELQ A;  1IZ1 A;  4N13 A;  3PU5 A;  1NV7 A;  2H98 A;  3QUJ A;  4H6D A;  5ICT A;  1UIV A;  4TQU Q;  1SI0 A;  4MAG A;  1MXY A;  4IO2 A;  5ET5 A;  3Q28 A;  4KPT A;  1FTO A;  3PUW E;  2DXR A;  4LON B;  5AE4 A;  5KDT A;  2OPE A;  1P1U A;  3EQ1 A;  1FJ9 A;  1FPI A;  1IMA A;  4JSO A;  4G68 B;  2ONR A;  4I40 A;  4MEV A;  1Y1Z A;  1HSJ A;  1AH5 A;  2Z22 A;  3B6W A;  3FXQ A;  2R6G E;  3MPL A;  4KHZ E;  3OD7 A;  4BLA A;  1NH8 A;  4F3P A;  4QF9 A;  1B1X A;  2OWS A;  1SPI A;  4DI3 D;  3VVE A;  3KOT A;  4LP2 B;  4QSD A;  3MVZ A;  4OET A;  3KC1 A;  4F31 B;  2M8C A;  5AA4 A;  5CBR A;  2HQ0 A;  4FEC A;  2PVU A;  1H43 A;  3EKI A;  3O6H A;  3G3F A;  2IA4 A;  2GHA A;  5CMC A;  1RDX A;  4KCD A;  4YZZ A;  4ECF A;  3IB0 A;  2XHD A;  3N94 A;  3O29 A;  4KQP A;  5I2K A;  1P1Q A;  3QMF A;  1LAG E;  2PMS A;  3A29 A;  5DVJ A;  1FSA A;  4ZE9 A;  3VLW A;  4P3L A;  1Y1M A;  2XXY A;  4NF4 B;  2QJE A;  4PQJ A;  3W15 C;  2H9B A;  4LN5 A;  3K1M A;  2FA7 A;  4MLV A;  2Q74 A;  4XTC Q;  1NI9 A;  2OCU A;  1H3D A;  2FYI A;  3IAZ A;  1IMF A;  1SYH A;  1GTK A;  3ECR A;  1DPP A;  4G8H A;  2A5T B;  1INP A;  4IO4 A;  3KJ7 A;  5DVI A;  4DLD A;  1FPG A;  2DOJ A;  3KG2 A;  4QXD A;  5TP9 B;  4KFQ A;  4PAF A;  3U93 A;  3C34 A;  3A3C A;  4JWO A;  4FAJ A;  2Q2A A;  3N6U A;  2E1S A;  1AMF A;  1POY 1;  4WEP A;  5L8D A;  5J16 A;  1NUZ A;  2OWT A;  3E4R A;  2GH9 A;  4O3C A;  2WYK A;  4X1B A;  3IK6 B;  4OXV A;  2DXY A;  2V3Q A;  1RKM A;  5I5P A;  2DE3 A;  3Q26 A;  1P1N A;  4IY6 A;  5H8N B;  1B3F A;  1FPL A;  1LAX A;  4POW A;  4GBV A;  2O1L A;  2HHM A;  4X1D A;  5EYG A;  3MJN A;  1FTJ A;  4G8N A;  4MX6 A;  2OPD A;  1WDN A;  1GV8 A;  4YMA A;  1IEJ A;  3ZKL A;  2PT2 A;  3HN0 A;  2I3W A;  5ESY A;  1DK4 A;  4POX A;  3C33 A;  3OO8 A;  4YKI A;  5IKB A;  2UYF A;  5DTB A;  2F7C A;  3C31 A;  1D9Y A;  4YKP A;  4LZ8 A;  1MQJ A;  1A8E A;  2I4C A;  2PYY A;  3EN3 A;  5I2N B;  3IO6 A;  3DP8 A;  5H8S A;  4EXK A;  1LST A;  3V8X B;  1QW0 A;  1AL3 A;  4F2O A;  4FEB A;  2I0C A;  1B9J A;  3MVX A;  3PD8 A;  4GFR A;  4R74 A;  2QS4 A;  1GR2 A;  3M3K A;  4OVQ A;  2YLN A;  4M4G A;  4OVJ A;  2Y7W A;  2P3V A;  2THI A;  5LOM A;  1TWY A;  4UAB A;  5I58 A;  4OA4 A;  1VE4 A;  2XD3 A;  3T96 B;  1T0K A;  1MXX A;  1N04 A;  3KSX A;  1US5 A;  3V5A A;  1G0I A;  4PGN A;  1EZP A;  4GVO A;  1MXW A;  3GXA A;  3GLB A;  1XHY A;  1XVX A;  3H6U A;  5TPA A;  1Q35 A;  1URS A;  3IJX B;  3O28 A;  4P11 A;  1VR5 A;  5H8Q A;  2ONK E;  5JK4 A;  4KD5 A;  3H06 B;  1OVT A;  1RYO A;  1RYX A;  2L5V A;  4NX1 A;  3UOR A;  3OEM A;  1MY4 A;  3Q27 A;  1NKX A;  2V3U A;  1RDY A;  4JBZ A;  4U21 A;  3H7M A;  1SD3 A;  3U94 A;  2UYE A;  4P0G A;  1XS5 A;  3ILT B;  4AS5 A;  1USY E;  2DWA A;  2FIX A;  4GL8 A;  5H8F B;  4LQ5 A;  1NV2 A;  4BDM A;  3TDJ A;  2DVC A;  3MPK A;  2DS9 A;  1OLC A;  4BDR A;  3FJG A;  4N6P A;  3OOA A;  3MC2 A;  1JW5 A;  3PUX E;  4O3B A;  3PMW A;  3KGC A;  1NNP A;  4ZEK A;  1AWB A;  3I5O A;  3MBP A;  1TFA A;  5FHM A;  4DI4 B;  2I6E A;  3C35 A;  3OMB A;  3VXB A;  4QSC A;  1LCT A;  1Q1K A;  4ELP A;  3S2V A;  4F3B A;  1YTV A;  3C36 A;  1JEU A;  2AIX A;  4MIJ A;  3RUM A;  4R9F A;  5ITO A;  3W9V A;  1A8F A;  3LC8 A;  4GBW A;  2GFE A;  3PD9 A;  4MFI A;  3FV1 A;  3VLV A;  2FNC A;  2V84 A;  4PDH A;  4OEN A;  1B51 A;  3GYY A;  4IR8 A;  1ELJ A;  2PBW A;  4YB7 A;  2R8T A;  1B6H A;  1LBB A;  2I49 A;  4GWW A;  1SQY A;  2XWO A;  5H8H A;  5I57 A;  1IMD A;  4NGU A;  3CIJ A;  4GWZ A;  4ISU A;  4OWD A;  3FAT A;  3MST A;  2DE4 A;  4N07 A;  4EXL A;  4IB2 A;  2QPQ A;  3PPO A;  4GXS B;  2QS2 A;  5ITP A;  4PFB A;  5CMK A;  2HXR A;  2XA5 A;  4NF5 A;  4QHQ A;  1OLA A;  3OO7 A;  1FPD A;  2P1S A;  1FQA A;  1I69 A;  2HZL A;  4QFK A;  4LZ7 A;  3SEX A;  1QVS A;  3RN8 A;  2D21 A;  1I6Q A;  4PF6 A;  2OWZ A;  2F7B A;  1R9L A;  4G68 C;  2QVV A;  4RYA A;  1FTA A;  4R9G A;  2XXP A;  4JXI A;  4NHB A;  4I62 A;  4KYD A;  3MP1 A;  4YB5 A;  1HSE A;  4JWX A;  3JV9 A;  5EQ8 A;  3G3K A;  1BKA A;  1DSN A;  2F78 A;  3M8U A;  2ABH A;  5M2V A;  4NF8 A;  4HTG A;  3SDF A;  3IR1 A;  3OEL A;  3JZJ A;  1Y20 A;  1A40 A;  2ONS A;  4XFE A;  1ANF A;  1FQF A;  4P47 A;  3K1N A;  4JVC A;  2HEU A;  3G7W A;  3HHG A;  1NV4 A;  5ET8 A;  3UGW A;  4N4U A;  3FVG A;  3QUF A;  2ZYO A;  1OQH A;  1J1N A;  3KN8 A;  1PDA A;  2O6A A;  2Y7R A;  1XC1 A;  4H45 A;  1FCK A;  1QUJ A;  3GBA A;  4Z0I A;  2XXV A;  5AA2 B;  1CB6 A;  1NV5 A;  4N8G A;  5ELV A;  2QS1 A;  4FED A;  3KBZ A;  4YU0 A;  1A99 A;  2XXX A;  4AS4 A;  1FBG A;  2LAO A;  1LFG A;  3VLU A;  3H6V A;  4P8B A;  2ZNS A;  1NV0 A;  3MVY A;  3HCQ A;  1MQD A;  1F9B A;  4XXU A;  4ZDM A;  4R73 A;  1P99 A;  3PPP A;  5EQA A;  3QIM A;  3RTW B;  2CZL A;  3SES A;  1M5E A;  1ZLQ A;  4WED A;  1EH3 A;  4H67 A;  3S9M C;  4HCY A;  5EQ9 A;  3PUZ E;  4PC9 A;  5T3J A;  4H5G A;  4H8J A;  1FBF A;  3I6V A;  3OEN A;  2CZI A;  3TZA A;  4K3F A;  4DCX A;  5HPQ A;  3BKI B;  3KZG A;  4QFN A;  3A09 A;  1GVC A;  2HFB A;  4OFO A;  4P9K A;  1DOT A;  5AA3 A;  4OYV A;  2DWJ A;  3HST A;  2ALU A;  5KDT B;  3ZS6 A;  3FJ7 A;  3K00 A;  4LA9 A;  4XKP A;  3QAX A;  4I3E A;  1Y4C A;  1B46 A;  4Z7E A;  4ZS9 A;  3E3K A;  5AA2 D;  4GWS A;  1R9Q A;  4H1X A;  4XF5 A;  5FTH A;  1LBV A;  3IJO B;  1FQE A;  1DTZ A;  1MH3 A;  4HE2 A;  4EDP A;  3TPA A;  1FBE A;  1B7Z A;  3CSB A;  3TTM A;  1LBZ A;  1LBW A;  5CMM A;  3RGY A;  5AA4 B;  1US4 A;  2B65 A;  3TAJ A;  3OXN A;  1SW2 A;  3TEP A;  3G3I A;  2RC7 A;  4M1V A;  3K02 A;  2F6P A;  2AL4 A;  4R6K A;  1UIU A;  2IEE A;  1LFH A;  2UVG A;  1MM6 A;  2DVZ A;  4OVS A;  1QUI A;  3R26 A;  3MP6 A;  3SEY A;  2WX9 A;  4DE8 A;  5LTC A;  2RC8 A;  4C1T A;  1NUW A;  4AB6 A;  4H8I A;  3K01 A;  4ZEI A;  5IZ3 A;  1OQG A;  1MM7 A;  5I2K B;  3ZKK A;  3H03 A;  1UTH A;  1Y3P A;  4X8R A;  1UQW A;  5K2X A;  1YCJ A;  4TOZ A;  1UTB A;  3HV1 A;  1NL5 A;  3U1O A;  2DE2 A;  3K0V A;  1VDW A;  5CBS A;  3EPE A;  3ODB A;  4MJO A;  2I3V A;  2YJP A;  4PAI A;  3T0J A;  3K6U A;  2E0S A;  2GRV A;  4NF6 A;  2XWI A;  1JEV A;  4H65 A;  2DWH A;  2Y7I A;  3O9P A;  4THI A;  2FIE A;  4NAP A;  2V25 A;  3T1B A;  4ZE8 A;  5L9O A;  3MVW A;  2ZZX A;  4NF0 A;  5K2Y A;  4OTE A;  5FTI A;  1KA1 A;  4OQO A;  2G29 A;  4MF3 A;  3KC0 A;  4PE3 A;  2OZZ A;  4NMY A;  4NE4 A;  4MHF A;  3BIG A;  2ESN A;  5DYH A;  4N91 A;  1N0T A;  3FVK A;  2BJI A;  3H4Z A;  1FQB A;  4UAC A;  2DYX A;  3KN3 A;  4F22 A;  2Q89 A;  5CMB A;  2B4L A;  3PGF A;  4MNC A;  2OK2 A;  3IOT A;  1FBC A;  3UK4 A;  5A5L A;  1N76 A;  5CM6 A;  4IO6 A;  4IO7 A;  4PFT A;  1FBP A;  4PGP A;  1B52 A;  1MG1 A;  4RPO A;  4GX3 A;  3VE1 B;  3RPL A;  1D9Q A;  2O51 A;  1KZ8 A;  2HAU A;  3VXC A;  1IIT A;  4P0I A;  1BLF A;  1DPE A;  1LAF E;  2CZH A;  4RK2 A;  2PT1 A;  4X48 A;  4DCY A;  3EHU A;  5I56 A;  2OBG A;  2VPO A;  3KJT A;  2UVJ A;  2WBB A;  2GQ1 A;  3R6U A;  3EHS A;  1MPC A;  4I3Y A;  3W9W A;  3MZ1 A;  3T9V A;  3O6G A;  4ZZA A;  4ELR A;  1MXV A;  2ZNT A;  3TUS A;  2X7P A;  4PFU A;  1LB8 A;  3KOS A;  1H76 A;  3KFM A;  2CEY A;  1FPE A;  4X9T A;  4AB5 A;  1B05 A;  3WAF A;  4BDQ A;  4PTK A;  5F1Q A;  1QGX A;  5A5X B;  5I58 B;  4F2Q A;  1LCF A;  3TTR A;  1VSO A;  1KWH A;  3IL1 B;  3SEU A;  3SET A;  1FJ6 A;  3TEL A;  1LBX A;  5EQ7 A;  1MPD A;  2F36 A;  3VDF A;  3IB2 A;  3S4U A;  4MMP A;  4KR5 A;  1LEV A;  4F1V A;  4QRZ A;  3D4G A;  3VV5 A;  3SZP A;  5H8Q B;  1Y3Q A;  1FBD A;  2RF1 A;  4XKN A;  1NNT A;  2F6G A;  4XIG Q;  3T22 A;  2HAV A;  2KR0 A;  3B6T A;  2REJ A;  2XXI A;  4Q30 B;  1NV3 A;  4PP0 A;  4PAK A;  4I1D A;  2F97 A;  3PMX A;  2ZMB A;  2A5S A;  1OVB A;  1A55 A;  5EHM A;  4NED A;  3IX1 A;  3PMV A;  4U4X A;  3IOW A;  4YKJ A;  3MW0 A;  3VVF A;  4GL0 A;  5B7D A;  3GBB A;  4P56 A;  3VVD A;  2QMX A;  3SKP A;  2Z8E A;  3TCF A;  1NFT A;  4OAN A;  1N84 A;  1SW5 A;  2RKM A;  1Y4T A;  3Q29 A;  1B7H A;  1ZMG A;  1IIW A;  1MH4 A;  4QSE A;  1HSL A;  3O97 A;  5F7V A;  4JSD A;  1LGB C;  2REG A;  2VHA A;  2PX1 A;  2I4B A;  4G77 A;  1XI6 A;  1PB9 A;  2V3T A;  2OX3 A;  3USD A;  3TTK A;  4DXU A;  4Q5T A;  2B3B A;  3K6X A;  1O7T A;  3O6I A;  2JJK A;  1ZTY A;  2PFY A;  3FVN A;  5H8H B;  5I57 B;  4U23 A;  2Y7K A;  4PET A;  1IXH A;  4DXB A;  3MZ9 A;  3T9X B;  2I0B A;  4F18 A;  2FHY A;  4ESX A;  1A7L A;  4GF8 A;  1N3X A;  3LUY A;  5JTY B;  4N17 A;  5DEX A;  3QYT A;  3QSL A;  2Q9T A;  2ZZV A;  5CRY A;  1FPF A;  2Q8J A;  1JNF A;  5BUU A;  4G61 A;  4NF5 B;  2FBP A;  3U92 A;  4AQ4 A;  2RIN A;  2AYS A;  4QFO A;  4PFW A;  3M3L A;  2RCB A;  2ZYK A;  1QKA A;  4KCC A;  5DVF A;  2Q8M A;  1AIV A;  1Q9D A;  3V89 B;  4E0W A;  3FBP A;  3IFC A;  1R1N A;  2I58 A;  1URD A;  1MQG A;  3UN6 A;  4NQ8 A;  4LUB A;  2P3N A;  3SEV A;  4PFR A;  5EYH A;  1M5F A;  2O69 A;  4NF8 B;  1LB9 A;  2XX9 A;  1Z7N E;  1B58 A;  3L6H A;  3TKD A;  1O64 A;  2UXA A;  1FW0 A;  3FIR A;  3RT6 B;  3G3H A;  5FBP A;  4DZ1 A;  4YIC A;  2ZYM A;  3FXB A;  1SDX A;  1MPB A;  2QFL A;  4U4S A;  1NV6 A;  4QFL A;  3DM0 A;  4XKQ A;  4OVT A;  1BK4 A;  4EQB A;  1B1H A;  1SW1 A;  4O3A A;  4FJP A;  2KLF A;  3FJM A;  1SBP A;  5IZ1 A;  4YB6 A;  3S9L C;  4L17 A;  1FTK A;  1B5H A;  1NNK A;  4MLQ A;  1AOV A;  5I59 B;  1QUK A;  1PBQ A;  3RPW A;  4WXJ A;  2I48 A;  4PFY A;  1MDQ A;  1D9V A;  3N6T A;  2HPG A;  1TFD A;  1YPN A;  2XXU A;  2H99 A;  1A54 A;  4LVQ A;  3H3G A;  3E13 X;  4R72 A;  2HZK A;  1N7X A;  1BIY A;  3ZSF A;  2Z23 A;  3B7D A;  4JWY A;  4RPN A;  2FVZ A;  4NN3 A;  5EHS A;  4MH5 A;  2O7I A;  1DMB A;  4EF1 A;  4HS7 A;  1JW1 A;  2B3F A;  4JVD A;  2F8D A; 
#chains in the Genus database with same CATH homology
 3T0J A;  4H46 A;  1EYI A;  1LBY A;  2DDK A;  4HCW A;  2XWI A;  4JVI A;  4OVQ A;  1NV1 A;  2P3V A;  4NG7 A;  4UAB A;  5I7I A;  2FIE A;  4NAP A;  2KQZ A;  4OA4 A;  4N6K A;  3T1B A;  4OVP A;  3PTY A;  4P1E A;  4KXP A;  4PBH A;  2ZZX A;  3ROJ A;  4NF0 A;  1FRP A;  1KA1 A;  1G0I A;  3HFU A;  4PGN A;  1FPJ A;  5F24 A;  4N8Y A;  5IM2 A;  3KC0 A;  3D1R A;  4PF8 A;  4PE3 A;  4GX6 A;  4MHF A;  3ISP A;  5IZZ A;  3BIG A;  4MCO A;  4N91 A;  5ET7 A;  2BJI A;  1JP4 A;  5JK4 A;  3BIH A;  1NUX A;  2L5V A;  4N6D A;  4NX1 A;  2MKZ A;  4PFI A;  5IGA A;  2B4L A;  4MNC A;  3LUZ A;  1RDY A;  1FBC A;  2ZZW A;  2XXK A;  2PFZ A;  5A5L A;  5CM6 A;  3IFA A;  1FBP A;  4PGP A;  4GX3 A;  3CHG A;  1CNQ A;  1D9Q A;  4O7I A;  3RPL A;  4AS5 A;  1KZ8 A;  2FIX A;  2WYP A;  1NV2 A;  2XWK A;  5ET6 A;  2CZH A;  2WBD A;  5IZ3 B;  1YZ0 A;  2VPO A;  1AWB A;  2CEX A;  2WBB A;  4F19 A;  2GQ1 A;  4DI4 B;  2F5X A;  4GX4 A;  2F3B A;  4I3Y A;  3W9W A;  1IMC A;  4HXV A;  4MIJ A;  4OVR A;  1K9Z A;  3W9V A;  1DCU A;  4N15 A;  4GBW A;  4PDH A;  3GYY A;  4GWY A;  4IR8 A;  4O7M A;  2CEY A;  1FPE A;  4X9T A;  2F3D A;  2R8T A;  2XWO A;  4GWW A;  2VT5 A;  4PCD A;  4PTK A;  1IMD A;  4NGU A;  1QGX A;  4GWZ A;  5LDZ A;  3MST A;  3MYU A;  2DE4 A;  2QPQ A;  2WEF A;  4HE1 A;  4XEQ A;  4QBA A;  1FJ6 A;  1LBX A;  5EQ7 A;  3NOH A;  2XWV A;  4FBP A;  4PFB A;  1EYJ A;  4MMP A;  2HXR A;  2XA5 A;  4P1L A;  1EYK A;  1LEV A;  4F1V A;  1FPD A;  2HZL A;  3SZP A;  1KA0 A;  1K9Y A;  4PF6 A;  2OWZ A;  1FBD A;  2QVV A;  2QVR A;  2V4C A;  2KR0 A;  3B50 A;  1FTA A;  4NHB A;  1NV7 A;  4MNP A;  4MAG A;  5EQ8 A;  4X04 A;  5ET5 A;  1NV3 A;  1G0H A;  4PAK A;  1IME A;  3RPL B;  1FJ9 A;  1FPI A;  1IMA A;  4XFE A;  4I40 A;  4P47 A;  1FPK A;  4MEV A;  4JVC A;  4PBQ A;  1NV4 A;  1YXI A;  2QVU A;  5ET8 A;  4P56 A;  4N4U A;  5DW8 A;  4OAN A;  4H45 A;  1SPI A;  4DI3 D;  3KC1 A;  3E79 A;  1NV5 A;  4N8G A;  1XI6 A;  2OX3 A;  3KBZ A;  4O94 A;  3EKI A;  4AS4 A;  1FBG A;  2JJK A;  2B4M A;  2PFY A;  4P8B A;  4O8M A;  2Y5L A;  2CZK A;  1NV0 A;  1RDZ A;  4GWU A;  4PET A;  2PCR A;  1RDX A;  4YZZ A;  4F18 A;  2FHY A;  4N17 A;  1FPB A;  3QMF A;  5EQA A;  3A29 A;  1FSA A;  2Q9T A;  4P3L A;  2ZZV A;  1DBZ A;  1FPF A;  4G61 A;  4HCY A;  5EQ9 A;  5J1D A;  2FBP A;  4LN5 A;  4PC9 A;  5T3J A;  1FBF A;  2Q74 A;  2CZI A;  1NI9 A;  4PDD A;  2Q8M A;  3U65 A;  1IMF A;  1Q9D A;  1IMB A;  1INP A;  3FBP A;  3IFC A;  4P9K A;  2Y5K A;  4NQ8 A;  1FPG A;  2P3N A;  4PFR A;  5EYH A;  4QXD A;  4PAF A;  4GWX A;  4I3E A;  3RYD A;  5FBP A;  1FBH A;  5J16 A;  1NUZ A;  4GWS A;  4YIC A;  3FXB A;  4HE0 A;  4XF5 A;  2WYK A;  1LBV A;  2QFL A;  2V3Q A;  5I5P A;  4HE2 A;  1NV6 A;  2DE3 A;  4OVT A;  1FBE A;  1BK4 A;  1FPL A;  1LBZ A;  1LBW A;  4GBV A;  5I3S A;  2HHM A;  5IZ1 A;  3E78 A;  5EYG A;  4M1V A;  4MX6 A;  4F1U A;  4MNI A;  2VPN A;  2DVZ A;  4OVS A;  2WX9 A;  3B8B A;  1YYZ A;  2HPG A;  5LTC A;  3LV0 A;  5ESY A;  1DK4 A;  1NUW A;  5IZ3 A;  2HZK A;  4N81 A;  4X8R A;  2FVZ A;  1NUY A;  2DE2 A;  1VDW A;  4NN3 A;  4MJO A;  4JVD A;  4PAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...