5ET6A

Human muscle fructose-1,6-bisphosphatase in inactive t-state in complex with amp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
320
Chain Sequence
TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-to-R switch of muscle fructose-1,6-bisphosphatase involves fundamental changes of secondary and quaternary structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
total genus 110
structure length 320
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et6A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et6A02
5IZ1A 3FBPA 1K9YA 1IMDA 1EYKA 4GBVA 1XI6A 1INPA 1FPFA 1LBYA 1YYZA 4KXPA 1NUXA 3RPLA 1LBXA 4I3YA 3A29A 3T0JA 5EYGA 1FBFA 1FPEA 1LBVA 5ET6A 1K9ZA 4FBPA 5A5LA 1FBGA 1YZ0A 2QVRA 1IMFA 2QVUA 1NUWA 1DCUA 5IZ3B 1FBEA 4AS5A 1FJ9A 1FPIA 2R8TA 4MJOA 5IZ3A 1FTAA 1IMBA 4I3EA 2OWZA 1FPGA 1KA1A 4QXDA 4IR8A 3KBZA 4N81A 5I3SA 2CZIA 3LV0A 3RPLB 1DK4A 2Q74A 1KA0A 5EQ7A 1FPLA 4PTKA 5FBPA 4GX4A 1NV3A 3LUZA 2HHMA 4GWXA 4GWUA 2QFLA 1FBCA 4GX6A 4HE1A 3BIGA 2F3DA 5DW8A 1EYJA 2OX3A 2WEFA 1RDZA 1FPBA 4GWWA 2FBPA 5LDZA 3IFCA 4H45A 2P3VA 5EYHA 3KC0A 4HE2A 2Q8MA 5T3JA 1LEVA 1NV5A 1FRPA 5EQAA 1IMAA 4GBWA 5F24A 2CZHA 2F3BA 1NV0A 1IMCA 1NUZA 2WBDA 1NV4A 1FBHA 5EQ8A 2P3NA 5ET7A 1NI9A 2Y5KA 4GWZA 1LBWA 2GQ1A 1FPJA 1FPKA 1D9QA 5ET5A 1G0HA 1RDYA 3B8BA 1LBZA 4O7IA 2WBBA 1NV7A 2BJIA 4HXVA 1QGXA 1NV1A 2DDKA 1G0IA 1RDXA 3D1RA 2FIEA 1FBPA 1VDWA 3IFAA 4G61A 2FIXA 3KC1A 1Q9DA 1BK4A 4H46A 2JJKA 1NUYA 5EQ9A 1FPDA 3ROJA 2PCRA 4I40A 4GWYA 3BIHA 3RYDA 2Y5LA 4HE0A 1FSAA 1DBZA 1IMEA 1AWBA 1FJ6A 1KZ8A 1NV2A 2FVZA 1FBDA 3QMFA 4AS4A 1NV6A 4GX3A 1YXIA 4GWSA 1SPIA 2VT5A 2FHYA 5ET8A 1CNQA 1EYIA 5J16A 2QVVA 1JP4A 5ESYA 2CZKA
chains in the Genus database with same CATH superfamily
4N13A 3E9XA 4IY5A 4C1UA 3H6UA 4F39A 4N15A 4MIJA 2B3BA 2IA4A 3DELB 2E1SA 1AMFA 3DP4A 2IEEA 3R6UA 2I0CA 5JK4A 3MP8A 1FW0A 5F7VA 3I5OA 2QVUA 4PCDA 5A5XB 2RINA 1IMBA 3PMWA 5I58B 3KSXA 4N07A 3RPLB 5H8HB 5FTIA 2RCAA 2PX1A 1MY1A 4EDPA 1JEVA 4TOZA 3TPAA 2XXUA 3BIGA 1BLFA 3L6GA 4ESXA 4Q0CA 5EQAA 5F24A 1T0KA 1NUZA 4EXKA 1MPCA 1B51A 3FXUA 4LQ2A 3EPEA 4GWZA 3K1PA 3QUFA 4IY6A 3CFZA 5IAIA 3K6WA 1LFGA 4C0RA 1S9TA 1VE4A 3O2AA 1ZJLA 2DDKA 5DVIA 4NAPA 1MQGA 2FNCA 2P1SA 4UABA 3VVFA 1RYXA 3B50A 4WEPA 4RA1A 2QS3A 2XD3A 4HE0A 4GLIA 1YPNA 2KQZA 2P0SA 1NV6A 4PFTA 1XT8A 1DSNA 4FECA 2DS9A 4GL0A 5ELVA 5I2NB 2DP8A 3G7WA 4TQUQ 2H5YA 4WKMA 3S9MC 3TTLA 1NUXA 4OVSA 1NL5A 1P1UA 3ILUB 5I59A 2QVRA 1MRPA 4DE8A 3CHGA 2I4CA 3P7IA 2G29A 1MXZA 1N7XA 4OWDA 5AA4B 5I7IA 1AH5A 4LN5A 1P99A 3ECRA 4OFJA 3K02A 3WAFA 5H8NA 4MNPA 2ZNSA 3KN7A 2V93A 3CSGA 1LCFA 1FQBA 2G93A 1WDNA 2Q89A 2HXRA 2F3DA 1OVTA 4XFEA 2FBPA 4F1YA 4ND9A 3IFCA 1NNPA 3LSXA 1UQWA 1TWYA 2NOOA 1J1NA 2ZYKA 4LONB 2DYXA 3OEKA 1XOCA 3EHTA 1RDYA 1FTOA 1R1NA 1OQGA 3G3FA 3B7DA 4IO5A 4QSCA 1QGXA 1A8FA 4OQOA 3FD3A 3RUMA 5I2NA 4ZZAA 1P1NA 2Q2CA 2JJKA 5I58A 2DXRA 1NUYA 2VHAA 4NF4A 3ROJA 2PVUA 3MUQA 1TT1A 1IMEA 3MWBA 2XWOA 4BLAA 5BWJA 3V5AA 5K2XA 2Z8EA 5CMMA 5HPQA 1JVXA 3CI8A 1K9YA 4RYAA 4OVPA 1XI6A 5H8FA 1FQCA 2CEXA 3EN3A 4KXPA 1R9LA 3PV0E 1QKAA 3RPLA 1FTJA 3O29A 4F1UA 1IXIA 1FBFA 3IORA 3OELA 4XKPA 1FBEA 2O7UA 1SYIA 3VLVA 1FPIA 5A5XA 2R8TA 3B6WA 4YKIA 1KA0A 1IXGA 3KJ7A 4H67A 2H25A 4ZE9A 3H03A 3K6UA 1B32A 2GRVA 4XKRA 4H6DA 2XXXA 2F78A 2F6PA 1BKAA 4U22A 4HE1A 3FATA 3M3FA 1Y9UA 3HO7A 1A8EA 4I1DA 1NMUA 2P3VA 3QAXA 3T9XB 2ONRA 3MYUA 4NMYA 4POWA 2QS2A 2I49A 3U72A 4THIA 4H1XA 3C31A 4U1OA 1LBZA 1LAGE 2Q8JA 3RTFB 1G0IA 2UYFA 5KDTA 2DVZA 4QBAA 3KJTA 1SVXB 4PE5B 1SW2A 4I40A 3IR1A 3RYDA 2I58A 2ESNA 1YAEA 3TUSA 2XX9A 2NWJA 5I57B 2PBWA 4H0WA 4ELRA 2HXWA 4JSOA 4OENA 5L9SA 2XWKA 5CI5A 3MZ1A 4ZEDA 3GZGA 4FEBA 3IAZA 2H99A 2VD2A 3EHUA 2RC9A 3K2DA 1LCTA 4OESA 1FTAA 5K2YA 4MBPA 1IXHA 2QPQA 4GD5A 2Q74A 3DP6A 4MHFA 4HW8A 4OFLA 3UGWA 4JBZA 5L8DA 3K01A 3EF7A 5I56A 2RCBA 2DWIA 3Q28A 1FPBA 1UIVA 2PFYA 3IO6A 4ISUA 4JXIA 2ONKE 4HE2A 1ELJA 4MFIA 3MPLA 1OQHA 2PYYA 3RNNA 1OLAA 3VV5A 1NI9A 3U65A 4F31B 1UTHB 5ET5A 3S2VA 4MLVA 1MY0A 1FBPA 4R6KA 2X26A 2Q88A 4XIGQ 4YKJA 4NG7A 3VVDA 1YXIA 3TQWA 4P3LA 1USYE 5IZ1A 4MLQA 1IMDA 3THIA 4KCDA 1FPFA 5TPAA 1OLCA 2ABHA 3FVOA 1PB7A 1Q35A 3SESA 4Q5TA 1LAFE 4POXA 3GLBA 1PDAA 4AS5A 1DOTA 5CM6A 2OWZA 3OO8A 3KBZA 4YZZA 4G8NA 3B6QA 5EQ7A 5EYFA 3PUYE 4GX4A 2FYIA 4I8CA 4P11A 4X1BA 2HEUA 4GVOA 3MQ9A 4IO6A 1S7YA 4QF9A 1VFEA 3CFLA 4E0XA 3PUWE 4P56A 3FXRA 4G8HA 3USDA 4OA4A 2WBDA 1H45A 5EQ8A 3SEYA 4M4GA 2XXIA 4YKPA 2I0BA 2ZYOA 4H8JA 4N8GA 3TMGA 4RY1A 1B1HA 4NF8A 3B8BA 4OVJA 1FQDA 4U4SA 1MH4A 2OWTA 2VP1A 4JSDA 4FATA 2UVIA 4MMPA 5F1QA 4G68A 2QRYA 5IKBA 4U23A 1NNKA 2ZZXA 3O9PA 4FJPA 2PCRA 4I9DA 4Q8RA 1SBPA 1PBQA 4ZECA 5J1DA 2B65A 2QMXA 1CE2A 1FQFA 4AS4A 1MS7A 4NF4B 4UACA 3MW0A 4H5FA 4RK2A 4DLDA 3SZPA 3C35A 2OJTA 3CRBA 1ZTYA 3TTKA 1QUKA 1TXFA 3U93A 4GBVA 4NF5B 2V3QA 1H44A 4IO7A 2ZNUA 4G8MA 4KR5A 1SD3A 4I3YA 3KN3A 3AXFA 3PTYA 1TFDA 2V25A 1H43A 4RPOA 4FE8A 2I6EA 2HQ0A 5I3SA 2PFZA 2R71A 3IB1A 1NKXA 1B5HA 3R7XA 3SEUA 4YB6A 3LUZA 1PC3A 1LFHA 3OSRA 3RQTA 3TKDA 4GWUA 1ZLQA 5AA2D 2QFLA 3KN8A 4EUOA 3E79A 2HAUA 4ONYA 4YICA 2D3IA 2WEFA 1QJMA 3JZJA 2XXYA 4X1DA 1IMAA 1UTBA 1IMCA 4Z7EA 5CMCA 5LOMA 3ONMA 1JEUA 2RKMA 3PGFA 3I3VA 2GH9A 4LP2B 1D4NA 2MKZA 4JB7A 2GFEA 2WYKA 3C34A 5ICTA 1B0LA 5FTHA 2VPOA 3C36A 4F22A 3O66A 5CMBA 5I5PA 3O6HA 4N6DA 3E3KA 1SI1A 1SW5A 4YU0A 1JETA 1MY4A 4JVDA 4MF3A 4N17A 3IL1B 4WXJA 2OK2A 2QS4A 2F6GA 3O6IA 4F2OA 3RLFE 4O7MA 3I6VA 1B7HA 1SW1A 1YYZA 1D3KA 4Z0IA 1DPEA 4G2ZA 5B7DA 1URDA 2Y7RA 5EYGA 4KPTA 2HFBA 3KOSA 5ET6A 1Y4TA 2XD2A 4L17A 1A55A 2F7AA 3M3KA 2P2AA 3MVZA 3K0VA 1XS5A 4IR8A 3HSTA 1GR2A 2Y7PA 1DK4A 2UXAA 1FQEA 3VXBA 3BFTA 4NX1A 2A5SA 4GWXA 3LSFB 1B3LA 1MXUA 2VPNA 2ZNTA 3CIJA 4HCYA 2DWHA 1D9VA 1B05A 4I62A 4P8BA 4KFQA 3GYYA 3TAJA 2QJEA 4NF6B 3KFMA 4H8IA 5L9MA 3TODA 4OERA 4KI0E 4LZ5A 3V83A 5DVJA 2OLBA 2R9JA 1ZIUA 2WBBA 1NV7A 3FVGA 2DVCA 2NUVA 1WODA 3MSTA 3EQ1A 1MPBA 3F11A 5FHMA 4P1EA 4R72A 2RC8A 4PGPA 3H7MA 2CZLA 1MM6A 1R6ZA 4P0IA 2F34A 2FHYA 4N8YA 5ESYA 3M3LA 3UORA 2Y7KA 2D21A 3IJOB 5FHNA 3PPRA 4F1VA 3CFXA 2XX8A 3DP8A 3T0JA 4OANA 1K9ZA 3OMBA 2F5XA 2B3FA 2Y7WA 1A40A 1NUWA 4IB2A 1JNFA 2WKYA 2UVHA 1FPGA 3PUVE 2B4MA 4PQJA 1PB9A 4P9KA 4KYSA 4R2BA 4K3FA 2F97A 1H76A 4TLMB 4PTKA 3K4UA 2XX7A 3LBSA 4YAHX 3R26A 4XKNA 1CB6A 1MQJA 4PFBA 2XXKA 1B2HA 3G3HA 3RT8A 3FGSA 3MVYA 1RDZA 2O68A 4U2RA 3C33A 2V84A 3VVEA 1I6QA 3C4MA 2Z8DA 1SW4A 3D4CA 5BUUA 1Y3NA 4N6KA 4ZEBA 2Y5KA 1XC1A 2NXOA 1FPKA 3SETA 3QXMA 3KG2A 4DDDA 1BTJA 1NNFA 1ATGA 4AB5A 1N7WA 2H9BA 4HTGA 4EF1A 1BP5A 4H46A 1B58A 2GHBA 1FPDA 4G68B 2QS1A 1N3WA 1LAHE 4GWOA 5CMKA 1LB8A 2XXRA 1DBZA 1KZ8A 1NV2A 3JYRA 3FUZA 3TZAA 1OMPA 4QFNA 1A99A 1DTZA 3KSJA 5KDTB 4GOTA 1LGBC 3OENA 4C1TA 3IJXB 4NEDA 1QW0A 3SERA 3A09A 1NFTA 4LA9A 3HN0A 3IB0A 5CC2A 3FVNA 2ZXTA 1NH7A 5JEIA 2DE2A 5IZ3B 1Y3PA 4PF6A 4PP0A 1LFIA 3CVGA 2QSXA 1VFDA 4PDDA 1JW1A 4PE3A 4F3PA 4OVQA 5HM4B 3PPNA 1MXWA 1FPLA 4OFOA 2PMSA 4NE4A 4HCWA 2LAOA 3TTMA 1B0HA 2AL4A 4O3BA 5DW8A 3QIMA 2HPGA 2XXWA 4F3SA 3H6WA 1MQIA 4R9GA 3T9UA 2O69A 2O51A 1LEVA 4YKKA 2Q9TA 4KYEA 3DLNA 3UN6A 5ITPA 4QFKA 4DXCA 5ICQA 1JW4A 4KHZE 3ISPA 3KOTA 1MDQA 4ECFA 4UA8A 1FCKA 4PF8A 1NV1A 4BDQA 4HS7A 2KR0A 1M5CA 3E4RA 3LSLA 3E78A 4JDFA 5I56B 4X04A 1LBBA 5HBCA 3O6GA 3VXCA 3FJGA 1UTBB 3MP1A 3IB2A 1POY1 1US4A 1Y20A 3T9VA 1M5FA 4IO2A 1I69A 2CZKA 1N0TA 3IX1A 4MX6A 1LAXA 2Y7IA 4BDNA 4NGUA 5TPAB 2Z22A 5DVFA 1N04A 4ESWA 2THIA 4MNCA 1XVXA 1MXYA 2Y84A 1IMFA 4PDHA 4F19A 1SDXA 4GL8A 4N91A 3TTNA 4FIMA 3OO6A 1N76A 2CEYA 3V8XB 3HV1A 1IEJA 1NV3A 2HHMA 4PFYA 3VDFA 2RC7A 3K1MA 3T9HB 3QK6A 3HPIA 4OYVA 2I3VA 3C32A 4G77A 5T3JA 5DTBA 2CZHA 1NV0A 2GHAA 4P0GA 3SDFA 3U1OA 4RXLA 1IZ1A 1URSA 1ZU0A 1FTMA 3TQLA 4DXUA 1GTKA 5CBSA 4HXVA 1Z7ME 5IZZA 4YB7A 1GV8A 3TDJA 2Z8FA 2F8DA 5B70A 3C9HA 2NVUB 3IFAA 4G61A 4DZ1A 2FIXA 3KC1A 1Q9DA 3VE1B 3FIRA 4GFRA 3A3UA 3BIHA 5LTCA 1MM7A 2YJPA 2FVZA 4IO3A 4NTLA 4PETA 2VT5A 2L5VA 3FXBA 1GVCA 4BDRA 2PT1A 3PMXA 1MQHA 4X8RA 2DWAA 2XA5A 1A7LA 1EU8A 2BJJX 2H98A 3TELA 1B46A 1OVBA 1D9YA 1QVSA 1YZ0A 4IGTA 3S9LC 2RF1A 3FVKA 3RPWA 4OTEA 1DCUA 1HSJA 5IZ3A 3PMVA 4XEQA 1Q1KA 3N5LA 2ALUA 4NHBA 3S9EA 1MDP1 2QMWA 4F3GA 4NF8B 3IO4A 4ZS9A 2AL5A 2O84X 1EH3A 4LUBA 4NF0A 3TCFA 1S50A 3VFJA 4GX6A 4LQ5A 2VOZA 3MAMA 5TP9B 3FZVA 5I59B 2ANJA 1DPPA 3OOAA 2Z23A 2HZLA 3ILTB 1NNTA 4H45A 3OO7A 3KC0A 1B7ZA 3N6UA 4PAKA 3LSWA 3U8QA 3PD8A 2F3BA 2ONSA 4QFLA 3T1BA 1XHYA 2D5WA 1JQFA 4JWXA 1FPJA 5AA2A 1IQ7A 3OD7A 1LB9A 1G0HA 2FA7A 2B4LA 1QULA 3RY3A 4EQBA 2Q2AA 4RK9A 4MCOA 4BDLA 1EZOA 3KZGA 4OVRA 4FAJA 3W9VA 4NN3A 4P1LA 5M2VA 2V4CA 5JTYB 4MEVA 1M5EA 2XXVA 4GF8A 4O3AA 4R73A 1SYHA 3K6VA 4GRKA 4JVIA 2WX9A 4LVQA 4MNIA 1B9JA 4XF5A 4FEDA 2DWJA 1MH3A 3H3GA 4GIZA 3FBPA 3K1NA 3KEIA 1EYKA 3TEPA 1LBYA 1EZPA 2XWVA 3MBPA 1B3HA 3IK6B 5H8FB 4PFWA 1RKMA 5A5LA 4MAGA 4DXBA 5KCJB 1MXXA 3G3JA 4R6HA 2W7YA 4IO4A 4I3EA 3PU5A 4N81A 1SQYA 1IITA 3V89B 1NH8A 5CBRA 3U92A 2F36A 5I2KA 1URGA 4OMBA 3CG3A 3GBBA 5H8QA 2F35A 1UTHA 5AA2B 3HCQA 4LATA 2F7CA 2OX3A 4PBHA 4GWWA 3Q27A 1B3FA 3S9NC 3H06B 3EHSA 4OETA 2ZYNA 4OZ9A 1NV5A 4GBWA 1N84A 5KCJA 1ZBMA 1LLSA 4G4PA 3LUYA 5JTYA 1QKBA 1YCJA 2CMOA 5FHOA 4O94A 2V3UA 2E0SA 1VR5A 1DMBA 4RNSA 1Y1MA 4Q30B 5I2KB 3T66A 4PAIA 5EHSA 4ELOA 2O1LA 4PFIA 5H8HA 3TTRA 3A3CA 2F7BA 4O3CA 4ELPA 1II5A 2XXPA 3D1RA 2OBGA 4ELQA 1MY3A 3ZS6A 3MJNA 5I57A 3H6TA 5DEXA 4PC9A 1AWBA 1P1QA 1O64A 1FBDA 3KGCA 4KD5A 3PUXE 3G3GA 2OZZA 3FV2A 1I6BA 4KQPA 3K6XA 4DI3D 1CNQA 4RPNA 3O28A 3QYTA 2UYEA 3WAEA 4BDMA 2X7QA 4QHQA 4ZEKA 4KYDA 1LBCA 1EZ9A 4N6PA 2OCUA 5DYHA 3FASA 1FPEA 4ZZEA 1MY2A 1QUIA 4PGNA 2I48A 3LC8A 4R9FA 4DIGA 3LV0A 2ZZVA 3S4UA 2DSFA 3PUZE 2PT2A 1QUJA 2A5TA 1IXCA 3Q25A 4FORA 4DCXA 4PFRA 3KBRA 3T22A 1EYJA 5LDZA 4EQ7A 1ANFA 3RGYA 3BBRA 3MZBA 3K00A 5ET7A 1LBWA 2GQ1A 2AIXA 4ZEIA 1B7UA 1P1WA 1B3GA 4NQ8A 2BJIA 3GXAA 3MVWA 5I84A 4QFOA 3NOHA 1IIWA 1BK4A 1Y4CA 4X9TA 4YMBA 3MP6A 1FQAA 1M5BA 3FJ7A 1ZKBA 3BKIB 3HHFA 3IOTA 3VLUA 4WEDA 4GX3A 1TFAA 1EYIA 3M8UA 3OEMA 2QVVA 4ZDMA 1JP4A 4ZE8A 1AL3A 5DEXB 1R9QA 3IOWA 3QSLA 2DE4A 2YPNA 4EXLA 1MXVA 3MVXA 1POTA 5AA4A 4BDOA 4PBQA 4OHNA 5H8SA 1FBGA 2M8CA 2XHDA 3T96B 4XTCQ 3MPKA 3N6TA 1L5TA 1KA1A 4QXDA 4PAFA 2DE3A 1DTGA 1B52A 4OEUA 2HAVA 3RT6B 5FBPA 3G3IA 3HHGA 3L6HA 1H3DA 3PPQA 1YTVA 2XXQA 3UIFA 4F29A 4XKQA 1B4HA 4OVTA 4QSEA 3Q29A 3OO9A 2WYPA 3FXQA 2XXHA 4PFUA 1A54A 1NV4A 4H65A 1HSLA 4QRZA 3ZKKA 4GXAA 1ZMGA 2O6AA 4H5GA 4AQ4A 1D9QA 1B3EA 4O7IA 4O8MA 1PBPA 1RDXA 2UVGA 4M1VA 3O97A 2FIEA 4G68C 4YMAA 4XXUA 3OXNA 1US5A 4R75A 2DOJA 3CG1A 4ZEFA 2Y5LA 1BIYA 3UA8A 1FJ6A 2OPDA 4R74A 3W9WA 2DQVA 4GWSA 1SPIA 1O63A 1B6HA 5J16A 1B5IA 3ZSFA 2R6GE 3SKPA 1IUDA 1JW5A 4QFPA 3MZ9A 4AB6A 5H8QB 4NWDA 1INPA 4F18A 2ZZWA 4X48A 2X7PA 1AIVA 3PPPA 2YLNA 3LR1A 2V3TA 1P1OA 1LBVA 3SEXA 5TP9A 2OPEA 3BFUA 1B1XA 3SEVA 4KCCA 1FJ9A 4MJOA 3PPOA 4R6YA 1XVYA 3OSQA 2ZYMA 2CZIA 3VLWA 1PEBA 4QSDA 1O7TA 3MC2A 2REJA 4YB5A 2HZKA 2DXYA 4EQ9A 5IM2A 1Y1ZA 3RTWB 1Z7NE 1GGGA 5ISUA 3TCGA 5EYHA 2Q8MA 3U94A 3D4GA 4NF5A 4F3BA 3QUJA 4LZ8A 1HSEA 1FBHA 4P47A 4IGRA 1USYH 4GXSB 4GQOA 4NF6A 3G3KA 2A5TB 3E13X 2REGA 5H8NB 3TYHA 4R2FA 3H6VA 4U21A 5CRYA 3N94A 1VDWA 1I6AA 5EQ9A 3H4ZA 4MH5A 4GWYA 1FSAA 2HCAA 3QMFA 3UP9A 4OEVA 5ET8A 1MG1A 3ODBA 4U1ZA 2O1MA 5TU0A 5ITOA 1OIBA 4NWCA 1N3XA 1PB8A 2I3WA 3RN8A 1SI0A 3CSBA 3TFLA 2ZMBA 3PD9A 5KZTA 5L9OA 4JWOA 1LBXA 2O7IA 1B4ZA 5IGAA 3A29A 4LZ7A 3DM0A 1RYOA 3Q26A 4FBPA 2OWSA 2VD3A 1VSOA 4DCYA 5AA3A 5EHMA 2AYSA 1M5DA 1B40A 5AA1A 2UVJA 2XWIA 4RJZA 4DI4B 3CR9A 1FBCA 3N26A 3ZKLA 1MQDA 2KLFA 1AOVA 3HFUA 3IOVA 1LSTA 2H4IA 1WVJA 1FRPA 5AE4A 3JV9A 4TLLB 4U4XA 1KWHA 2P3NA 3W15C 3B6TA 4JVCA 1JVYA 1UIUA 1FTKA 3IOUA 4N4UA 1FTLA 3FV1A 3FJMA 4OXVA 2VGQA 4EF2A 3T93B 1Y3QA 5DT6A 1MPDA 3UK4A 2XXTA 4JWYA 3TCHA 3EKIA 1B5JA 2I4BA 4E0WA 2QL3A 3GBAA 3SEWA 4F2QA 1F9BA
chains in the Genus database with same CATH topology
5IZ1A 3FBPA 1K9YA 1IMDA 2DE4A 4MX6A 4OVPA 1EYKA 4GBVA 1XI6A 2V3QA 1INPA 4O7MA 2CEXA 1FPFA 4X8RA 4F18A 4NGUA 2XA5A 2ZZWA 1LBYA 1YYZA 4KXPA 5LTCA 2XWVA 2XWKA 4MIJA 1NUXA 4N15A 3RPLA 4F1VA 1LBXA 4I3YA 4OVSA 5IGAA 4F1UA 4PBQA 3A29A 3T0JA 4OANA 5EYGA 4MNCA 1FBFA 1FPEA 1LBVA 5ET6A 5JK4A 1K9ZA 3PTYA 4FBPA 5A5LA 1FBGA 2F5XA 4MAGA 1YZ0A 2QVRA 1IMFA 2QVUA 4PGNA 4PCDA 1NUWA 4PDHA 1DCUA 5IZ3B 2DE2A 1FBEA 4AS5A 4PF6A 4F19A 1FJ9A 1FPIA 2R8TA 4MJOA 5IZ3A 3CHGA 1FTAA 1IMBA 4N91A 4XEQA 5CM6A 4I3EA 2OWZA 1FPGA 1KA1A 4QXDA 4NHBA 4IR8A 2QPQA 3KBZA 4N81A 5I3SA 2CZIA 3LV0A 3RPLB 2PFZA 1DK4A 2B4MA 2DE3A 2ZZVA 4PDDA 2Q74A 2CEYA 4YZZA 4P9KA 4LN5A 4PE3A 4OVQA 1KA0A 4MHFA 5EQ7A 4MNPA 1FPLA 4PTKA 5FBPA 4GX4A 1NV3A 4NF0A 3LUZA 2XWIA 4NX1A 4HCWA 2HHMA 4DI4B 2HZKA 4GWXA 4GWUA 2QFLA 1FBCA 4PFRA 4GX6A 2VPNA 4PFBA 4HE1A 2XXKA 5IM2A 3E79A 4P1LA 2HXRA 3BIGA 2F3DA 5DW8A 1EYJA 4HCYA 4YICA 2HPGA 2OX3A 2WEFA 1RDZA 1FPBA 4GWWA 2FBPA 4PBHA 4XFEA 5LDZA 3IFCA 4P8BA 2HZLA 2PFYA 4H45A 2P3VA 5EYHA 4OVTA 3HFUA 3KC0A 4HE2A 4P56A 2Q8MA 4PAKA 5T3JA 1LEVA 1NV5A 1FRPA 5EQAA 1IMAA 4GBWA 5F24A 2CZHA 2F3BA 1NV0A 1IMCA 1NUZA 2Q9TA 2WYPA 3MYUA 4OA4A 4DI3D 2WBDA 1NV4A 1FBHA 3GYYA 4P47A 5EQ8A 3T1BA 4N6KA 2P3NA 5ET7A 1NI9A 4O94A 2Y5KA 4GWZA 1LBWA 4N8GA 3U65A 2GQ1A 4JVCA 1FPJA 1FPKA 1D9QA 5ET5A 3ISPA 1G0HA 1RDYA 4PAIA 2B4LA 4PAFA 3B8BA 1LBZA 4O7IA 4PFIA 4NQ8A 4MCOA 4O8MA 4N4UA 2WBBA 1NV7A 2BJIA 4HXVA 5IZZA 1QGXA 4PF8A 1NV1A 2DDKA 1G0IA 4MMPA 2MKZA 1RDXA 2KR0A 3D1RA 2DVZA 2WYKA 3MSTA 4OVRA 4M1VA 4NAPA 3W9VA 4QBAA 2FIEA 4UABA 4NN3A 3NOHA 1FBPA 1VDWA 3IFAA 4G61A 2FIXA 3KC1A 1Q9DA 1BK4A 2V4CA 4H46A 2ZZXA 2JJKA 4P1EA 4X9TA 3E78A 1NUYA 5EQ9A 2VPOA 3B50A 4MEVA 1FPDA 4PC9A 4X04A 3ROJA 5I7IA 2PCRA 4I40A 4GWYA 3BIHA 5I5PA 3RYDA 2Y5LA 4PGPA 4HE0A 1FSAA 4NG7A 5J1DA 1DBZA 1IMEA 4N6DA 1AWBA 1FJ6A 1KZ8A 2KQZA 2XWOA 1NV2A 2FVZA 1FBDA 3QMFA 4AS4A 3EKIA 3W9WA 4JVIA 1NV6A 4GX3A 1YXIA 4GWSA 1SPIA 2WX9A 4PETA 2VT5A 4JVDA 2FHYA 2L5VA 5ET8A 3FXBA 1CNQA 1EYIA 4MNIA 4N17A 4N8YA 5J16A 2QVVA 4XF5A 1JP4A 5ESYA 3SZPA 4P3LA 2CZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ1 A;  3FBP A;  1K9Y A;  1IMD A;  1EYK A;  4GBV A;  1XI6 A;  1INP A;  1FPF A;  1LBY A;  1YYZ A;  4KXP A;  1NUX A;  3RPL A;  1LBX A;  4I3Y A;  3A29 A;  3T0J A;  5EYG A;  1FBF A;  1FPE A;  1LBV A;  5ET6 A;  1K9Z A;  4FBP A;  5A5L A;  1FBG A;  1YZ0 A;  2QVR A;  1IMF A;  2QVU A;  1NUW A;  1DCU A;  5IZ3 B;  1FBE A;  4AS5 A;  1FJ9 A;  1FPI A;  2R8T A;  4MJO A;  5IZ3 A;  1FTA A;  1IMB A;  4I3E A;  2OWZ A;  1FPG A;  1KA1 A;  4QXD A;  4IR8 A;  3KBZ A;  4N81 A;  5I3S A;  2CZI A;  3LV0 A;  3RPL B;  1DK4 A;  2Q74 A;  1KA0 A;  5EQ7 A;  1FPL A;  4PTK A;  5FBP A;  4GX4 A;  1NV3 A;  3LUZ A;  2HHM A;  4GWX A;  4GWU A;  2QFL A;  1FBC A;  4GX6 A;  4HE1 A;  3BIG A;  2F3D A;  5DW8 A;  1EYJ A;  2OX3 A;  2WEF A;  1RDZ A;  1FPB A;  4GWW A;  2FBP A;  5LDZ A;  3IFC A;  4H45 A;  2P3V A;  5EYH A;  3KC0 A;  4HE2 A;  2Q8M A;  5T3J A;  1LEV A;  1NV5 A;  1FRP A;  5EQA A;  1IMA A;  4GBW A;  5F24 A;  2CZH A;  2F3B A;  1NV0 A;  1IMC A;  1NUZ A;  2WBD A;  1NV4 A;  1FBH A;  5EQ8 A;  2P3N A;  5ET7 A;  1NI9 A;  2Y5K A;  4GWZ A;  1LBW A;  2GQ1 A;  1FPJ A;  1FPK A;  1D9Q A;  5ET5 A;  1G0H A;  1RDY A;  3B8B A;  1LBZ A;  4O7I A;  2WBB A;  1NV7 A;  2BJI A;  4HXV A;  1QGX A;  1NV1 A;  2DDK A;  1G0I A;  1RDX A;  3D1R A;  2FIE A;  1FBP A;  1VDW A;  3IFA A;  4G61 A;  2FIX A;  3KC1 A;  1Q9D A;  1BK4 A;  4H46 A;  2JJK A;  1NUY A;  5EQ9 A;  1FPD A;  3ROJ A;  2PCR A;  4I40 A;  4GWY A;  3BIH A;  3RYD A;  2Y5L A;  4HE0 A;  1FSA A;  1DBZ A;  1IME A;  1AWB A;  1FJ6 A;  1KZ8 A;  1NV2 A;  2FVZ A;  1FBD A;  3QMF A;  4AS4 A;  1NV6 A;  4GX3 A;  1YXI A;  4GWS A;  1SPI A;  2VT5 A;  2FHY A;  5ET8 A;  1CNQ A;  1EYI A;  5J16 A;  2QVV A;  1JP4 A;  5ESY A;  2CZK A; 
#chains in the Genus database with same CATH topology
 4N13 A;  3E9X A;  4IY5 A;  4C1U A;  3H6U A;  4F39 A;  4N15 A;  4MIJ A;  2B3B A;  2IA4 A;  3DEL B;  2E1S A;  1AMF A;  3DP4 A;  2IEE A;  3R6U A;  2I0C A;  5JK4 A;  3MP8 A;  1FW0 A;  5F7V A;  3I5O A;  2QVU A;  4PCD A;  5A5X B;  2RIN A;  1IMB A;  3PMW A;  5I58 B;  3KSX A;  4N07 A;  3RPL B;  5H8H B;  5FTI A;  2RCA A;  2PX1 A;  1MY1 A;  4EDP A;  1JEV A;  4TOZ A;  3TPA A;  2XXU A;  3BIG A;  1BLF A;  3L6G A;  4ESX A;  4Q0C A;  5EQA A;  5F24 A;  1T0K A;  1NUZ A;  4EXK A;  1MPC A;  1B51 A;  3FXU A;  4LQ2 A;  3EPE A;  4GWZ A;  3K1P A;  3QUF A;  4IY6 A;  3CFZ A;  5IAI A;  3K6W A;  1LFG A;  4C0R A;  1S9T A;  1VE4 A;  3O2A A;  1ZJL A;  2DDK A;  5DVI A;  4NAP A;  1MQG A;  2FNC A;  2P1S A;  4UAB A;  3VVF A;  1RYX A;  3B50 A;  4WEP A;  4RA1 A;  2QS3 A;  2XD3 A;  4HE0 A;  4GLI A;  1YPN A;  2KQZ A;  2P0S A;  1NV6 A;  4PFT A;  1XT8 A;  1DSN A;  4FEC A;  2DS9 A;  4GL0 A;  5ELV A;  5I2N B;  2DP8 A;  3G7W A;  4TQU Q;  2H5Y A;  4WKM A;  3S9M C;  3TTL A;  1NUX A;  4OVS A;  1NL5 A;  1P1U A;  3ILU B;  5I59 A;  2QVR A;  1MRP A;  4DE8 A;  3CHG A;  2I4C A;  3P7I A;  2G29 A;  1MXZ A;  1N7X A;  4OWD A;  5AA4 B;  5I7I A;  1AH5 A;  4LN5 A;  1P99 A;  3ECR A;  4OFJ A;  3K02 A;  3WAF A;  5H8N A;  4MNP A;  2ZNS A;  3KN7 A;  2V93 A;  3CSG A;  1LCF A;  1FQB A;  2G93 A;  1WDN A;  2Q89 A;  2HXR A;  2F3D A;  1OVT A;  4XFE A;  2FBP A;  4F1Y A;  4ND9 A;  3IFC A;  1NNP A;  3LSX A;  1UQW A;  1TWY A;  2NOO A;  1J1N A;  2ZYK A;  4LON B;  2DYX A;  3OEK A;  1XOC A;  3EHT A;  1RDY A;  1FTO A;  1R1N A;  1OQG A;  3G3F A;  3B7D A;  4IO5 A;  4QSC A;  1QGX A;  1A8F A;  4OQO A;  3FD3 A;  3RUM A;  5I2N A;  4ZZA A;  1P1N A;  2Q2C A;  2JJK A;  5I58 A;  2DXR A;  1NUY A;  2VHA A;  4NF4 A;  3ROJ A;  2PVU A;  3MUQ A;  1TT1 A;  1IME A;  3MWB A;  2XWO A;  4BLA A;  5BWJ A;  3V5A A;  5K2X A;  2Z8E A;  5CMM A;  5HPQ A;  1JVX A;  3CI8 A;  1K9Y A;  4RYA A;  4OVP A;  1XI6 A;  5H8F A;  1FQC A;  2CEX A;  3EN3 A;  4KXP A;  1R9L A;  3PV0 E;  1QKA A;  3RPL A;  1FTJ A;  3O29 A;  4F1U A;  1IXI A;  1FBF A;  3IOR A;  3OEL A;  4XKP A;  1FBE A;  2O7U A;  1SYI A;  3VLV A;  1FPI A;  5A5X A;  2R8T A;  3B6W A;  4YKI A;  1KA0 A;  1IXG A;  3KJ7 A;  4H67 A;  2H25 A;  4ZE9 A;  3H03 A;  3K6U A;  1B32 A;  2GRV A;  4XKR A;  4H6D A;  2XXX A;  2F78 A;  2F6P A;  1BKA A;  4U22 A;  4HE1 A;  3FAT A;  3M3F A;  1Y9U A;  3HO7 A;  1A8E A;  4I1D A;  1NMU A;  2P3V A;  3QAX A;  3T9X B;  2ONR A;  3MYU A;  4NMY A;  4POW A;  2QS2 A;  2I49 A;  3U72 A;  4THI A;  4H1X A;  3C31 A;  4U1O A;  1LBZ A;  1LAG E;  2Q8J A;  3RTF B;  1G0I A;  2UYF A;  5KDT A;  2DVZ A;  4QBA A;  3KJT A;  1SVX B;  4PE5 B;  1SW2 A;  4I40 A;  3IR1 A;  3RYD A;  2I58 A;  2ESN A;  1YAE A;  3TUS A;  2XX9 A;  2NWJ A;  5I57 B;  2PBW A;  4H0W A;  4ELR A;  2HXW A;  4JSO A;  4OEN A;  5L9S A;  2XWK A;  5CI5 A;  3MZ1 A;  4ZED A;  3GZG A;  4FEB A;  3IAZ A;  2H99 A;  2VD2 A;  3EHU A;  2RC9 A;  3K2D A;  1LCT A;  4OES A;  1FTA A;  5K2Y A;  4MBP A;  1IXH A;  2QPQ A;  4GD5 A;  2Q74 A;  3DP6 A;  4MHF A;  4HW8 A;  4OFL A;  3UGW A;  4JBZ A;  5L8D A;  3K01 A;  3EF7 A;  5I56 A;  2RCB A;  2DWI A;  3Q28 A;  1FPB A;  1UIV A;  2PFY A;  3IO6 A;  4ISU A;  4JXI A;  2ONK E;  4HE2 A;  1ELJ A;  4MFI A;  3MPL A;  1OQH A;  2PYY A;  3RNN A;  1OLA A;  3VV5 A;  1NI9 A;  3U65 A;  4F31 B;  1UTH B;  5ET5 A;  3S2V A;  4MLV A;  1MY0 A;  1FBP A;  4R6K A;  2X26 A;  2Q88 A;  4XIG Q;  4YKJ A;  4NG7 A;  3VVD A;  1YXI A;  3TQW A;  4P3L A;  1USY E;  5IZ1 A;  4MLQ A;  1IMD A;  3THI A;  4KCD A;  1FPF A;  5TPA A;  1OLC A;  2ABH A;  3FVO A;  1PB7 A;  1Q35 A;  3SES A;  4Q5T A;  1LAF E;  4POX A;  3GLB A;  1PDA A;  4AS5 A;  1DOT A;  5CM6 A;  2OWZ A;  3OO8 A;  3KBZ A;  4YZZ A;  4G8N A;  3B6Q A;  5EQ7 A;  5EYF A;  3PUY E;  4GX4 A;  2FYI A;  4I8C A;  4P11 A;  4X1B A;  2HEU A;  4GVO A;  3MQ9 A;  4IO6 A;  1S7Y A;  4QF9 A;  1VFE A;  3CFL A;  4E0X A;  3PUW E;  4P56 A;  3FXR A;  4G8H A;  3USD A;  4OA4 A;  2WBD A;  1H45 A;  5EQ8 A;  3SEY A;  4M4G A;  2XXI A;  4YKP A;  2I0B A;  2ZYO A;  4H8J A;  4N8G A;  3TMG A;  4RY1 A;  1B1H A;  4NF8 A;  3B8B A;  4OVJ A;  1FQD A;  4U4S A;  1MH4 A;  2OWT A;  2VP1 A;  4JSD A;  4FAT A;  2UVI A;  4MMP A;  5F1Q A;  4G68 A;  2QRY A;  5IKB A;  4U23 A;  1NNK A;  2ZZX A;  3O9P A;  4FJP A;  2PCR A;  4I9D A;  4Q8R A;  1SBP A;  1PBQ A;  4ZEC A;  5J1D A;  2B65 A;  2QMX A;  1CE2 A;  1FQF A;  4AS4 A;  1MS7 A;  4NF4 B;  4UAC A;  3MW0 A;  4H5F A;  4RK2 A;  4DLD A;  3SZP A;  3C35 A;  2OJT A;  3CRB A;  1ZTY A;  3TTK A;  1QUK A;  1TXF A;  3U93 A;  4GBV A;  4NF5 B;  2V3Q A;  1H44 A;  4IO7 A;  2ZNU A;  4G8M A;  4KR5 A;  1SD3 A;  4I3Y A;  3KN3 A;  3AXF A;  3PTY A;  1TFD A;  2V25 A;  1H43 A;  4RPO A;  4FE8 A;  2I6E A;  2HQ0 A;  5I3S A;  2PFZ A;  2R71 A;  3IB1 A;  1NKX A;  1B5H A;  3R7X A;  3SEU A;  4YB6 A;  3LUZ A;  1PC3 A;  1LFH A;  3OSR A;  3RQT A;  3TKD A;  4GWU A;  1ZLQ A;  5AA2 D;  2QFL A;  3KN8 A;  4EUO A;  3E79 A;  2HAU A;  4ONY A;  4YIC A;  2D3I A;  2WEF A;  1QJM A;  3JZJ A;  2XXY A;  4X1D A;  1IMA A;  1UTB A;  1IMC A;  4Z7E A;  5CMC A;  5LOM A;  3ONM A;  1JEU A;  2RKM A;  3PGF A;  3I3V A;  2GH9 A;  4LP2 B;  1D4N A;  2MKZ A;  4JB7 A;  2GFE A;  2WYK A;  3C34 A;  5ICT A;  1B0L A;  5FTH A;  2VPO A;  3C36 A;  4F22 A;  3O66 A;  5CMB A;  5I5P A;  3O6H A;  4N6D A;  3E3K A;  1SI1 A;  1SW5 A;  4YU0 A;  1JET A;  1MY4 A;  4JVD A;  4MF3 A;  4N17 A;  3IL1 B;  4WXJ A;  2OK2 A;  2QS4 A;  2F6G A;  3O6I A;  4F2O A;  3RLF E;  4O7M A;  3I6V A;  1B7H A;  1SW1 A;  1YYZ A;  1D3K A;  4Z0I A;  1DPE A;  4G2Z A;  5B7D A;  1URD A;  2Y7R A;  5EYG A;  4KPT A;  2HFB A;  3KOS A;  5ET6 A;  1Y4T A;  2XD2 A;  4L17 A;  1A55 A;  2F7A A;  3M3K A;  2P2A A;  3MVZ A;  3K0V A;  1XS5 A;  4IR8 A;  3HST A;  1GR2 A;  2Y7P A;  1DK4 A;  2UXA A;  1FQE A;  3VXB A;  3BFT A;  4NX1 A;  2A5S A;  4GWX A;  3LSF B;  1B3L A;  1MXU A;  2VPN A;  2ZNT A;  3CIJ A;  4HCY A;  2DWH A;  1D9V A;  1B05 A;  4I62 A;  4P8B A;  4KFQ A;  3GYY A;  3TAJ A;  2QJE A;  4NF6 B;  3KFM A;  4H8I A;  5L9M A;  3TOD A;  4OER A;  4KI0 E;  4LZ5 A;  3V83 A;  5DVJ A;  2OLB A;  2R9J A;  1ZIU A;  2WBB A;  1NV7 A;  3FVG A;  2DVC A;  2NUV A;  1WOD A;  3MST A;  3EQ1 A;  1MPB A;  3F11 A;  5FHM A;  4P1E A;  4R72 A;  2RC8 A;  4PGP A;  3H7M A;  2CZL A;  1MM6 A;  1R6Z A;  4P0I A;  2F34 A;  2FHY A;  4N8Y A;  5ESY A;  3M3L A;  3UOR A;  2Y7K A;  2D21 A;  3IJO B;  5FHN A;  3PPR A;  4F1V A;  3CFX A;  2XX8 A;  3DP8 A;  3T0J A;  4OAN A;  1K9Z A;  3OMB A;  2F5X A;  2B3F A;  2Y7W A;  1A40 A;  1NUW A;  4IB2 A;  1JNF A;  2WKY A;  2UVH A;  1FPG A;  3PUV E;  2B4M A;  4PQJ A;  1PB9 A;  4P9K A;  4KYS A;  4R2B A;  4K3F A;  2F97 A;  1H76 A;  4TLM B;  4PTK A;  3K4U A;  2XX7 A;  3LBS A;  4YAH X;  3R26 A;  4XKN A;  1CB6 A;  1MQJ A;  4PFB A;  2XXK A;  1B2H A;  3G3H A;  3RT8 A;  3FGS A;  3MVY A;  1RDZ A;  2O68 A;  4U2R A;  3C33 A;  2V84 A;  3VVE A;  1I6Q A;  3C4M A;  2Z8D A;  1SW4 A;  3D4C A;  5BUU A;  1Y3N A;  4N6K A;  4ZEB A;  2Y5K A;  1XC1 A;  2NXO A;  1FPK A;  3SET A;  3QXM A;  3KG2 A;  4DDD A;  1BTJ A;  1NNF A;  1ATG A;  4AB5 A;  1N7W A;  2H9B A;  4HTG A;  4EF1 A;  1BP5 A;  4H46 A;  1B58 A;  2GHB A;  1FPD A;  4G68 B;  2QS1 A;  1N3W A;  1LAH E;  4GWO A;  5CMK A;  1LB8 A;  2XXR A;  1DBZ A;  1KZ8 A;  1NV2 A;  3JYR A;  3FUZ A;  3TZA A;  1OMP A;  4QFN A;  1A99 A;  1DTZ A;  3KSJ A;  5KDT B;  4GOT A;  1LGB C;  3OEN A;  4C1T A;  3IJX B;  4NED A;  1QW0 A;  3SER A;  3A09 A;  1NFT A;  4LA9 A;  3HN0 A;  3IB0 A;  5CC2 A;  3FVN A;  2ZXT A;  1NH7 A;  5JEI A;  2DE2 A;  5IZ3 B;  1Y3P A;  4PF6 A;  4PP0 A;  1LFI A;  3CVG A;  2QSX A;  1VFD A;  4PDD A;  1JW1 A;  4PE3 A;  4F3P A;  4OVQ A;  5HM4 B;  3PPN A;  1MXW A;  1FPL A;  4OFO A;  2PMS A;  4NE4 A;  4HCW A;  2LAO A;  3TTM A;  1B0H A;  2AL4 A;  4O3B A;  5DW8 A;  3QIM A;  2HPG A;  2XXW A;  4F3S A;  3H6W A;  1MQI A;  4R9G A;  3T9U A;  2O69 A;  2O51 A;  1LEV A;  4YKK A;  2Q9T A;  4KYE A;  3DLN A;  3UN6 A;  5ITP A;  4QFK A;  4DXC A;  5ICQ A;  1JW4 A;  4KHZ E;  3ISP A;  3KOT A;  1MDQ A;  4ECF A;  4UA8 A;  1FCK A;  4PF8 A;  1NV1 A;  4BDQ A;  4HS7 A;  2KR0 A;  1M5C A;  3E4R A;  3LSL A;  3E78 A;  4JDF A;  5I56 B;  4X04 A;  1LBB A;  5HBC A;  3O6G A;  3VXC A;  3FJG A;  1UTB B;  3MP1 A;  3IB2 A;  1POY 1;  1US4 A;  1Y20 A;  3T9V A;  1M5F A;  4IO2 A;  1I69 A;  2CZK A;  1N0T A;  3IX1 A;  4MX6 A;  1LAX A;  2Y7I A;  4BDN A;  4NGU A;  5TPA B;  2Z22 A;  5DVF A;  1N04 A;  4ESW A;  2THI A;  4MNC A;  1XVX A;  1MXY A;  2Y84 A;  1IMF A;  4PDH A;  4F19 A;  1SDX A;  4GL8 A;  4N91 A;  3TTN A;  4FIM A;  3OO6 A;  1N76 A;  2CEY A;  3V8X B;  3HV1 A;  1IEJ A;  1NV3 A;  2HHM A;  4PFY A;  3VDF A;  2RC7 A;  3K1M A;  3T9H B;  3QK6 A;  3HPI A;  4OYV A;  2I3V A;  3C32 A;  4G77 A;  5T3J A;  5DTB A;  2CZH A;  1NV0 A;  2GHA A;  4P0G A;  3SDF A;  3U1O A;  4RXL A;  1IZ1 A;  1URS A;  1ZU0 A;  1FTM A;  3TQL A;  4DXU A;  1GTK A;  5CBS A;  4HXV A;  1Z7M E;  5IZZ A;  4YB7 A;  1GV8 A;  3TDJ A;  2Z8F A;  2F8D A;  5B70 A;  3C9H A;  2NVU B;  3IFA A;  4G61 A;  4DZ1 A;  2FIX A;  3KC1 A;  1Q9D A;  3VE1 B;  3FIR A;  4GFR A;  3A3U A;  3BIH A;  5LTC A;  1MM7 A;  2YJP A;  2FVZ A;  4IO3 A;  4NTL A;  4PET A;  2VT5 A;  2L5V A;  3FXB A;  1GVC A;  4BDR A;  2PT1 A;  3PMX A;  1MQH A;  4X8R A;  2DWA A;  2XA5 A;  1A7L A;  1EU8 A;  2BJJ X;  2H98 A;  3TEL A;  1B46 A;  1OVB A;  1D9Y A;  1QVS A;  1YZ0 A;  4IGT A;  3S9L C;  2RF1 A;  3FVK A;  3RPW A;  4OTE A;  1DCU A;  1HSJ A;  5IZ3 A;  3PMV A;  4XEQ A;  1Q1K A;  3N5L A;  2ALU A;  4NHB A;  3S9E A;  1MDP 1;  2QMW A;  4F3G A;  4NF8 B;  3IO4 A;  4ZS9 A;  2AL5 A;  2O84 X;  1EH3 A;  4LUB A;  4NF0 A;  3TCF A;  1S50 A;  3VFJ A;  4GX6 A;  4LQ5 A;  2VOZ A;  3MAM A;  5TP9 B;  3FZV A;  5I59 B;  2ANJ A;  1DPP A;  3OOA A;  2Z23 A;  2HZL A;  3ILT B;  1NNT A;  4H45 A;  3OO7 A;  3KC0 A;  1B7Z A;  3N6U A;  4PAK A;  3LSW A;  3U8Q A;  3PD8 A;  2F3B A;  2ONS A;  4QFL A;  3T1B A;  1XHY A;  2D5W A;  1JQF A;  4JWX A;  1FPJ A;  5AA2 A;  1IQ7 A;  3OD7 A;  1LB9 A;  1G0H A;  2FA7 A;  2B4L A;  1QUL A;  3RY3 A;  4EQB A;  2Q2A A;  4RK9 A;  4MCO A;  4BDL A;  1EZO A;  3KZG A;  4OVR A;  4FAJ A;  3W9V A;  4NN3 A;  4P1L A;  5M2V A;  2V4C A;  5JTY B;  4MEV A;  1M5E A;  2XXV A;  4GF8 A;  4O3A A;  4R73 A;  1SYH A;  3K6V A;  4GRK A;  4JVI A;  2WX9 A;  4LVQ A;  4MNI A;  1B9J A;  4XF5 A;  4FED A;  2DWJ A;  1MH3 A;  3H3G A;  4GIZ A;  3FBP A;  3K1N A;  3KEI A;  1EYK A;  3TEP A;  1LBY A;  1EZP A;  2XWV A;  3MBP A;  1B3H A;  3IK6 B;  5H8F B;  4PFW A;  1RKM A;  5A5L A;  4MAG A;  4DXB A;  5KCJ B;  1MXX A;  3G3J A;  4R6H A;  2W7Y A;  4IO4 A;  4I3E A;  3PU5 A;  4N81 A;  1SQY A;  1IIT A;  3V89 B;  1NH8 A;  5CBR A;  3U92 A;  2F36 A;  5I2K A;  1URG A;  4OMB A;  3CG3 A;  3GBB A;  5H8Q A;  2F35 A;  1UTH A;  5AA2 B;  3HCQ A;  4LAT A;  2F7C A;  2OX3 A;  4PBH A;  4GWW A;  3Q27 A;  1B3F A;  3S9N C;  3H06 B;  3EHS A;  4OET A;  2ZYN A;  4OZ9 A;  1NV5 A;  4GBW A;  1N84 A;  5KCJ A;  1ZBM A;  1LLS A;  4G4P A;  3LUY A;  5JTY A;  1QKB A;  1YCJ A;  2CMO A;  5FHO A;  4O94 A;  2V3U A;  2E0S A;  1VR5 A;  1DMB A;  4RNS A;  1Y1M A;  4Q30 B;  5I2K B;  3T66 A;  4PAI A;  5EHS A;  4ELO A;  2O1L A;  4PFI A;  5H8H A;  3TTR A;  3A3C A;  2F7B A;  4O3C A;  4ELP A;  1II5 A;  2XXP A;  3D1R A;  2OBG A;  4ELQ A;  1MY3 A;  3ZS6 A;  3MJN A;  5I57 A;  3H6T A;  5DEX A;  4PC9 A;  1AWB A;  1P1Q A;  1O64 A;  1FBD A;  3KGC A;  4KD5 A;  3PUX E;  3G3G A;  2OZZ A;  3FV2 A;  1I6B A;  4KQP A;  3K6X A;  4DI3 D;  1CNQ A;  4RPN A;  3O28 A;  3QYT A;  2UYE A;  3WAE A;  4BDM A;  2X7Q A;  4QHQ A;  4ZEK A;  4KYD A;  1LBC A;  1EZ9 A;  4N6P A;  2OCU A;  5DYH A;  3FAS A;  1FPE A;  4ZZE A;  1MY2 A;  1QUI A;  4PGN A;  2I48 A;  3LC8 A;  4R9F A;  4DIG A;  3LV0 A;  2ZZV A;  3S4U A;  2DSF A;  3PUZ E;  2PT2 A;  1QUJ A;  2A5T A;  1IXC A;  3Q25 A;  4FOR A;  4DCX A;  4PFR A;  3KBR A;  3T22 A;  1EYJ A;  5LDZ A;  4EQ7 A;  1ANF A;  3RGY A;  3BBR A;  3MZB A;  3K00 A;  5ET7 A;  1LBW A;  2GQ1 A;  2AIX A;  4ZEI A;  1B7U A;  1P1W A;  1B3G A;  4NQ8 A;  2BJI A;  3GXA A;  3MVW A;  5I84 A;  4QFO A;  3NOH A;  1IIW A;  1BK4 A;  1Y4C A;  4X9T A;  4YMB A;  3MP6 A;  1FQA A;  1M5B A;  3FJ7 A;  1ZKB A;  3BKI B;  3HHF A;  3IOT A;  3VLU A;  4WED A;  4GX3 A;  1TFA A;  1EYI A;  3M8U A;  3OEM A;  2QVV A;  4ZDM A;  1JP4 A;  4ZE8 A;  1AL3 A;  5DEX B;  1R9Q A;  3IOW A;  3QSL A;  2DE4 A;  2YPN A;  4EXL A;  1MXV A;  3MVX A;  1POT A;  5AA4 A;  4BDO A;  4PBQ A;  4OHN A;  5H8S A;  1FBG A;  2M8C A;  2XHD A;  3T96 B;  4XTC Q;  3MPK A;  3N6T A;  1L5T A;  1KA1 A;  4QXD A;  4PAF A;  2DE3 A;  1DTG A;  1B52 A;  4OEU A;  2HAV A;  3RT6 B;  5FBP A;  3G3I A;  3HHG A;  3L6H A;  1H3D A;  3PPQ A;  1YTV A;  2XXQ A;  3UIF A;  4F29 A;  4XKQ A;  1B4H A;  4OVT A;  4QSE A;  3Q29 A;  3OO9 A;  2WYP A;  3FXQ A;  2XXH A;  4PFU A;  1A54 A;  1NV4 A;  4H65 A;  1HSL A;  4QRZ A;  3ZKK A;  4GXA A;  1ZMG A;  2O6A A;  4H5G A;  4AQ4 A;  1D9Q A;  1B3E A;  4O7I A;  4O8M A;  1PBP A;  1RDX A;  2UVG A;  4M1V A;  3O97 A;  2FIE A;  4G68 C;  4YMA A;  4XXU A;  3OXN A;  1US5 A;  4R75 A;  2DOJ A;  3CG1 A;  4ZEF A;  2Y5L A;  1BIY A;  3UA8 A;  1FJ6 A;  2OPD A;  4R74 A;  3W9W A;  2DQV A;  4GWS A;  1SPI A;  1O63 A;  1B6H A;  5J16 A;  1B5I A;  3ZSF A;  2R6G E;  3SKP A;  1IUD A;  1JW5 A;  4QFP A;  3MZ9 A;  4AB6 A;  5H8Q B;  4NWD A;  1INP A;  4F18 A;  2ZZW A;  4X48 A;  2X7P A;  1AIV A;  3PPP A;  2YLN A;  3LR1 A;  2V3T A;  1P1O A;  1LBV A;  3SEX A;  5TP9 A;  2OPE A;  3BFU A;  1B1X A;  3SEV A;  4KCC A;  1FJ9 A;  4MJO A;  3PPO A;  4R6Y A;  1XVY A;  3OSQ A;  2ZYM A;  2CZI A;  3VLW A;  1PEB A;  4QSD A;  1O7T A;  3MC2 A;  2REJ A;  4YB5 A;  2HZK A;  2DXY A;  4EQ9 A;  5IM2 A;  1Y1Z A;  3RTW B;  1Z7N E;  1GGG A;  5ISU A;  3TCG A;  5EYH A;  2Q8M A;  3U94 A;  3D4G A;  4NF5 A;  4F3B A;  3QUJ A;  4LZ8 A;  1HSE A;  1FBH A;  4P47 A;  4IGR A;  1USY H;  4GXS B;  4GQO A;  4NF6 A;  3G3K A;  2A5T B;  3E13 X;  2REG A;  5H8N B;  3TYH A;  4R2F A;  3H6V A;  4U21 A;  5CRY A;  3N94 A;  1VDW A;  1I6A A;  5EQ9 A;  3H4Z A;  4MH5 A;  4GWY A;  1FSA A;  2HCA A;  3QMF A;  3UP9 A;  4OEV A;  5ET8 A;  1MG1 A;  3ODB A;  4U1Z A;  2O1M A;  5TU0 A;  5ITO A;  1OIB A;  4NWC A;  1N3X A;  1PB8 A;  2I3W A;  3RN8 A;  1SI0 A;  3CSB A;  3TFL A;  2ZMB A;  3PD9 A;  5KZT A;  5L9O A;  4JWO A;  1LBX A;  2O7I A;  1B4Z A;  5IGA A;  3A29 A;  4LZ7 A;  3DM0 A;  1RYO A;  3Q26 A;  4FBP A;  2OWS A;  2VD3 A;  1VSO A;  4DCY A;  5AA3 A;  5EHM A;  2AYS A;  1M5D A;  1B40 A;  5AA1 A;  2UVJ A;  2XWI A;  4RJZ A;  4DI4 B;  3CR9 A;  1FBC A;  3N26 A;  3ZKL A;  1MQD A;  2KLF A;  1AOV A;  3HFU A;  3IOV A;  1LST A;  2H4I A;  1WVJ A;  1FRP A;  5AE4 A;  3JV9 A;  4TLL B;  4U4X A;  1KWH A;  2P3N A;  3W15 C;  3B6T A;  4JVC A;  1JVY A;  1UIU A;  1FTK A;  3IOU A;  4N4U A;  1FTL A;  3FV1 A;  3FJM A;  4OXV A;  2VGQ A;  4EF2 A;  3T93 B;  1Y3Q A;  5DT6 A;  1MPD A;  3UK4 A;  2XXT A;  4JWY A;  3TCH A;  3EKI A;  1B5J A;  2I4B A;  4E0W A;  2QL3 A;  3GBA A;  3SEW A;  4F2Q A;  1F9B A; 
#chains in the Genus database with same CATH homology
 5IZ1 A;  3FBP A;  1K9Y A;  1IMD A;  2DE4 A;  4MX6 A;  4OVP A;  1EYK A;  4GBV A;  1XI6 A;  2V3Q A;  1INP A;  4O7M A;  2CEX A;  1FPF A;  4X8R A;  4F18 A;  4NGU A;  2XA5 A;  2ZZW A;  1LBY A;  1YYZ A;  4KXP A;  5LTC A;  2XWV A;  2XWK A;  4MIJ A;  1NUX A;  4N15 A;  3RPL A;  4F1V A;  1LBX A;  4I3Y A;  4OVS A;  5IGA A;  4F1U A;  4PBQ A;  3A29 A;  3T0J A;  4OAN A;  5EYG A;  4MNC A;  1FBF A;  1FPE A;  1LBV A;  5ET6 A;  5JK4 A;  1K9Z A;  3PTY A;  4FBP A;  5A5L A;  1FBG A;  2F5X A;  4MAG A;  1YZ0 A;  2QVR A;  1IMF A;  2QVU A;  4PGN A;  4PCD A;  1NUW A;  4PDH A;  1DCU A;  5IZ3 B;  2DE2 A;  1FBE A;  4AS5 A;  4PF6 A;  4F19 A;  1FJ9 A;  1FPI A;  2R8T A;  4MJO A;  5IZ3 A;  3CHG A;  1FTA A;  1IMB A;  4N91 A;  4XEQ A;  5CM6 A;  4I3E A;  2OWZ A;  1FPG A;  1KA1 A;  4QXD A;  4NHB A;  4IR8 A;  2QPQ A;  3KBZ A;  4N81 A;  5I3S A;  2CZI A;  3LV0 A;  3RPL B;  2PFZ A;  1DK4 A;  2B4M A;  2DE3 A;  2ZZV A;  4PDD A;  2Q74 A;  2CEY A;  4YZZ A;  4P9K A;  4LN5 A;  4PE3 A;  4OVQ A;  1KA0 A;  4MHF A;  5EQ7 A;  4MNP A;  1FPL A;  4PTK A;  5FBP A;  4GX4 A;  1NV3 A;  4NF0 A;  3LUZ A;  2XWI A;  4NX1 A;  4HCW A;  2HHM A;  4DI4 B;  2HZK A;  4GWX A;  4GWU A;  2QFL A;  1FBC A;  4PFR A;  4GX6 A;  2VPN A;  4PFB A;  4HE1 A;  2XXK A;  5IM2 A;  3E79 A;  4P1L A;  2HXR A;  3BIG A;  2F3D A;  5DW8 A;  1EYJ A;  4HCY A;  4YIC A;  2HPG A;  2OX3 A;  2WEF A;  1RDZ A;  1FPB A;  4GWW A;  2FBP A;  4PBH A;  4XFE A;  5LDZ A;  3IFC A;  4P8B A;  2HZL A;  2PFY A;  4H45 A;  2P3V A;  5EYH A;  4OVT A;  3HFU A;  3KC0 A;  4HE2 A;  4P56 A;  2Q8M A;  4PAK A;  5T3J A;  1LEV A;  1NV5 A;  1FRP A;  5EQA A;  1IMA A;  4GBW A;  5F24 A;  2CZH A;  2F3B A;  1NV0 A;  1IMC A;  1NUZ A;  2Q9T A;  2WYP A;  3MYU A;  4OA4 A;  4DI3 D;  2WBD A;  1NV4 A;  1FBH A;  3GYY A;  4P47 A;  5EQ8 A;  3T1B A;  4N6K A;  2P3N A;  5ET7 A;  1NI9 A;  4O94 A;  2Y5K A;  4GWZ A;  1LBW A;  4N8G A;  3U65 A;  2GQ1 A;  4JVC A;  1FPJ A;  1FPK A;  1D9Q A;  5ET5 A;  3ISP A;  1G0H A;  1RDY A;  4PAI A;  2B4L A;  4PAF A;  3B8B A;  1LBZ A;  4O7I A;  4PFI A;  4NQ8 A;  4MCO A;  4O8M A;  4N4U A;  2WBB A;  1NV7 A;  2BJI A;  4HXV A;  5IZZ A;  1QGX A;  4PF8 A;  1NV1 A;  2DDK A;  1G0I A;  4MMP A;  2MKZ A;  1RDX A;  2KR0 A;  3D1R A;  2DVZ A;  2WYK A;  3MST A;  4OVR A;  4M1V A;  4NAP A;  3W9V A;  4QBA A;  2FIE A;  4UAB A;  4NN3 A;  3NOH A;  1FBP A;  1VDW A;  3IFA A;  4G61 A;  2FIX A;  3KC1 A;  1Q9D A;  1BK4 A;  2V4C A;  4H46 A;  2ZZX A;  2JJK A;  4P1E A;  4X9T A;  3E78 A;  1NUY A;  5EQ9 A;  2VPO A;  3B50 A;  4MEV A;  1FPD A;  4PC9 A;  4X04 A;  3ROJ A;  5I7I A;  2PCR A;  4I40 A;  4GWY A;  3BIH A;  5I5P A;  3RYD A;  2Y5L A;  4PGP A;  4HE0 A;  1FSA A;  4NG7 A;  5J1D A;  1DBZ A;  1IME A;  4N6D A;  1AWB A;  1FJ6 A;  1KZ8 A;  2KQZ A;  2XWO A;  1NV2 A;  2FVZ A;  1FBD A;  3QMF A;  4AS4 A;  3EKI A;  3W9W A;  4JVI A;  1NV6 A;  4GX3 A;  1YXI A;  4GWS A;  1SPI A;  2WX9 A;  4PET A;  2VT5 A;  4JVD A;  2FHY A;  2L5V A;  5ET8 A;  3FXB A;  1CNQ A;  1EYI A;  4MNI A;  4N17 A;  4N8Y A;  5J16 A;  2QVV A;  4XF5 A;  1JP4 A;  5ESY A;  3SZP A;  4P3L A;  2CZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...