4PTKA

Crystal structure of staphylococcal impase-i complex with 3mg2+ and phosphate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
262
structure length
262
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 71
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4ptkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ptkA02
1LBWA 1K9YA 2FBPA 4GWWA 4HE1A 1LBXA 5ET7A 1IMDA 5A5LA 3IFAA 1FPJA 5ET6A 2JJKA 2FVZA 1IMCA 5IZ3A 5EQAA 1XI6A 3IFCA 1FPLA 1FBFA 1IMEA 4GWSA 1YXIA 2Q8MA 4G61A 2CZHA 5EQ8A 5ESYA 5FBPA 3KBZA 1LBZA 1DK4A 1KA1A 1NV0A 2P3VA 1EYKA 5EYGA 1FBEA 2OWZA 1G0IA 1FRPA 1RDXA 5F24A 4HXVA 1NUYA 1Q9DA 2FIEA 2FIXA 4O7IA 1NUXA 2CZIA 1RDYA 5IZ1A 1NUZA 1YYZA 2WEFA 1FBHA 2Q74A 4GBWA 3RYDA 1FPGA 1LBVA 4PTKA 5LDZA 4GX6A 4I3EA 3RPLA 5DW8A 5EQ9A 1KA0A 1IMBA 2Y5LA 1FBPA 1NV4A 1FJ9A 4IR8A 2QVUA 1FPEA 1QGXA 4H46A 4N81A 2FHYA 3KC0A 2R8TA 2WBBA 5T3JA 4I3YA 2HHMA 5EQ7A 1K9ZA 1INPA 3QMFA 1LBYA 1VDWA 4QXDA 1AWBA 1FSAA 1NV7A 3LV0A 5J16A 2VT5A 4MJOA 2QVVA 4AS5A 1DBZA 1JP4A 2BJIA 4GX4A 1EYIA 3FBPA 1CNQA 1FPIA 3A29A 2CZKA 1FBCA 2QFLA 4GX3A 2WBDA 2F3BA 1NV6A 5ET8A 4HE0A 4KXPA 1NV2A 4FBPA 4AS4A 4GWZA 1NI9A 2F3DA 5EYHA 2PCRA 1LEVA 1D9QA 5ET5A 1DCUA 4GWXA 4H45A 1NV5A 1NUWA 3BIGA 3LUZA 2QVRA 1FTAA 4GWUA 1FPKA 3BIHA 1SPIA 1KZ8A 2GQ1A 4GWYA 4HE2A 1FPBA 3KC1A 1FJ6A 3T0JA 2DDKA 2OX3A 3D1RA 5IZ3B 1NV1A 1G0HA 5I3SA 4I40A 2Y5KA 1NV3A 1YZ0A 1FBDA 2P3NA 1IMFA 3B8BA 1FPFA 3ROJA 1EYJA 3RPLB 1FPDA 1RDZA 1BK4A 4GBVA 1IMAA 1FBGA
chains in the Genus database with same CATH superfamily
2O7UA 4YKIA 3MYUA 2CEYA 2F78A 1P1WA 1LBXA 2IEEA 1XI6A 4ZE8A 3GXAA 1FW0A 3FZVA 4G61A 3TYHA 4EXKA 4IO2A 2Y84A 4X8RA 4AB6A 4F3SA 2XXUA 1GTKA 4PFWA 1ELJA 1NKXA 3LR1A 1NH8A 3RY3A 3Q29A 3TPAA 5EHSA 1NUYA 1ZKBA 1IQ7A 4FEBA 1SW5A 4G77A 2Q74A 1MY3A 1MPCA 1FQDA 5CMBA 1XOCA 1QGXA 2P2AA 4F3GA 2HEUA 4N15A 4MX6A 2XX9A 2KQZA 4OHNA 4F31B 4AB5A 3FBPA 5H8HA 1MXVA 5FHMA 1M5CA 1FBCA 3ODBA 4HE0A 2NXOA 3HHGA 4LATA 3PUZE 1OMPA 5K2XA 1FQEA 2O84X 3LUZA 2DWHA 4PAKA 4DDDA 4X1DA 3SZPA 5JTYB 3MZBA 3NOHA 4O3CA 1G0HA 4F19A 2Y5KA 1YZ0A 4F29A 1FPFA 1B4HA 3IK6B 3OMBA 1WODA 2A5TB 2Q88A 4GWOA 4XEQA 1SYHA 2FBPA 4FJPA 1B0LA 5ET7A 1L5TA 3LC8A 1Q1KA 1FTJA 3K00A 4LZ5A 3QYTA 3GLBA 4P1EA 1FBFA 1M5EA 2B4LA 4R74A 3C32A 1O64A 4MLVA 3K6XA 5HBCA 3TTRA 1Y3QA 3TCFA 4F2OA 4LA9A 1YTVA 3MWBA 3KZGA 3V5AA 3FIRA 4PTKA 2OJTA 4P56A 1B7HA 1YAEA 4XKPA 1IMBA 3CVGA 5DEXB 1B5IA 3MC2A 3PD9A 2QRYA 4IR8A 3FJMA 2Y7PA 4FATA 1FPEA 4N81A 4OERA 5JTYA 1A40A 2XD3A 4KHZE 4AQ4A 3VVEA 1NV7A 5DEXA 4JVDA 2ONKE 3PMWA 2FNCA 2I58A 2UYEA 3K0VA 3SEWA 1B52A 5ET8A 1B4ZA 1NFTA 2XHDA 2DSFA 3R7XA 4QF9A 4X04A 2YPNA 1JEUA 4DI3D 4OVQA 3QSLA 1MM6A 5I58B 3KC1A 1FJ6A 1LCTA 1B46A 2OWTA 2DVCA 1URDA 1JVYA 4GLIA 4PAIA 5I3SA 4MNIA 4UACA 1LFHA 2VPOA 3ZS6A 3IO6A 3LBSA 4PGPA 1IXIA 2Y7IA 3UORA 1LBWA 3IX1A 4GL0A 2Q2AA 3T1BA 4IB2A 4N6KA 3N6TA 4DLDA 4G4PA 3SEVA 4O8MA 1FPLA 1MS7A 1MPBA 4QHQA 4QBAA 1FQFA 1M5BA 1DK4A 1IZ1A 1NV0A 3DP4A 1R6ZA 1MQDA 1NUZA 4THIA 1T0KA 1XHYA 2DXYA 4I3EA 3TTNA 5I57B 4KI0E 3FV2A 2ZNTA 3TTLA 1LBYA 3SEXA 3DP8A 3FJGA 3RTFB 4KYEA 5H8QB 1B5HA 3H03A 4XKQA 4ZDMA 4NQ8A 4MNPA 1MQJA 2MKZA 3L6GA 1RYXA 2VPNA 5EYHA 2CZLA 1Y3PA 1MXYA 1DCUA 4H45A 3TEPA 1B9JA 1XS5A 4PFTA 4OFLA 3SEUA 1FPBA 1BKAA 3T0JA 2I4BA 3H4ZA 3K6WA 2XWIA 4QFNA 3ZKLA 4P11A 4IO3A 4QSDA 1IMFA 2PT2A 2ZYKA 1P1QA 1LBCA 4F3PA 1GVCA 2UVJA 1RKMA 4PBQA 4ECFA 3OEMA 2RC9A 4GWWA 5IGAA 2CMOA 4EF1A 1S7YA 2FVZA 4JWYA 1R9QA 3VVFA 3OXNA 3CRBA 4KPTA 2F34A 2CZHA 4FORA 4M4GA 4GIZA 3ONMA 4U23A 3DELB 4YMAA 1FTKA 3H7MA 2KLFA 4OTEA 3CFXA 2O51A 1YCJA 5CI5A 2WEFA 2RC8A 3IO4A 5LDZA 4GX6A 4FECA 4OWDA 3W9WA 3TCHA 2B65A 2H25A 2R8TA 3MP1A 2HHMA 3T9HB 3VLWA 4PBHA 4NHBA 1MXXA 4XF5A 2WKYA 3FVOA 3LV0A 4MF3A 1JP4A 4ZECA 4GX4A 5KDTB 3CFZA 2I4CA 4JBZA 2XXHA 3RN8A 2XWVA 3CHGA 1OVTA 5AA1A 4GQOA 5ICQA 5B70A 2PFZA 5IAIA 3RTWB 1ZMGA 2A5TA 1P99A 1QKBA 3OO7A 4U4XA 1B0HA 3SEYA 3CG3A 3C34A 4FIMA 1XVXA 1A7LA 5HM4B 3FXUA 4KYDA 3VXCA 1B05A 1D9YA 2HXWA 4N07A 4OETA 3TODA 1MQIA 4HCYA 4NEDA 4WXJA 4XXUA 4F22A 2F7BA 4PE3A 2VD3A 2ABHA 1I6AA 3I3VA 2Q8MA 2GHAA 1O63A 3LSXA 4JDFA 1DTZA 4NG7A 2OLBA 2UVIA 1RDXA 2L5VA 5FTIA 1NL5A 4R6HA 4KYSA 5BUUA 5AA4B 2XWOA 4GBWA 4ZEIA 4YZZA 3T9XB 3RPLA 1JW1A 2V3TA 3KC0A 5A5XA 4YB5A 1PBQA 5JEIA 3KN7A 5AA2A 4MJOA 2QVVA 4P9KA 4EXLA 5J1DA 2O68A 3N94A 4G8NA 2AYSA 4OFOA 2XXRA 2F8DA 3JV9A 4JSOA 4X48A 2RCBA 4EUOA 4GRKA 4R73A 4ZZAA 5I2KA 3H6WA 3IJOB 3FVGA 3LSFB 4OFJA 1DPEA 4NN3A 1UTHA 2QS1A 4PDDA 2WYPA 4H8JA 1BTJA 1PB7A 2DWAA 3U94A 4E0WA 4R75A 1N3WA 2HPGA 4BDQA 1NNFA 3CSBA 3PPRA 1LFIA 4G2ZA 3C36A 4DCYA 1MY2A 1SD3A 4PC9A 3B6TA 3R26A 4N8YA 2ZMBA 5ET6A 3PUWE 1QKAA 3THIA 4WEDA 3IB1A 1OVBA 3KBRA 4P1LA 4LONB 4PDHA 5EYFA 4Q30B 4DIGA 1EYKA 1DPPA 3TFLA 5LTCA 4LZ7A 5ITOA 2BJJX 5F24A 1MM7A 3TUSA 2ZYOA 1USYE 1Q9DA 2FIEA 4O7IA 1JEVA 4PFIA 3G7WA 2Y7KA 3IOUA 5DW8A 1LLSA 4ZEFA 1B3EA 5ISUA 1FBPA 2QVUA 2PFYA 3PU5A 5KCJA 3CI8A 4E0XA 2DWJA 2XWKA 4IY6A 3OELA 2NOOA 1UTHB 1B6HA 2F5XA 2QMWA 2PVUA 2XXQA 3PTYA 2Z22A 4LQ2A 1ZBMA 2ONRA 4IGRA 4OVPA 1B32A 5DVIA 2F3BA 2F6GA 1I69A 2E0SA 4GWXA 1MRPA 1B7ZA 3RT8A 3UP9A 2Z23A 2GQ1A 3FXBA 4N6DA 4ESXA 1MXUA 1PB8A 3EHSA 3HSTA 2GRVA 4LUBA 1NV3A 1MY1A 1B5JA 1PB9A 4RJZA 3CIJA 3I5OA 3VV5A 3MVXA 4MFIA 3O9PA 4BLAA 2HZKA 1FTMA 4GXAA 3W15C 2V25A 2V4CA 2ZZVA 4HE1A 1Y1ZA 1LAFE 3PPOA 2ESNA 1IMEA 5AA2D 4GWSA 1TFDA 2H9BA 2LAOA 5EQ8A 3IOWA 4NWDA 4JXIA 4U1ZA 2ONSA 2XXIA 3KBZA 4MMPA 4OVTA 2DE2A 4RYAA 5I2KB 1HSEA 4YU0A 3S2VA 3VLUA 3RT6B 2FIXA 1RYOA 4OQOA 4OXVA 4GOTA 4ND9A 3PMXA 3I6VA 4R9GA 3OO8A 4YICA 2GFEA 4O94A 4XKRA 3UIFA 4MEVA 5T3JA 4PE5B 1K9ZA 5A5XB 4N4UA 1B40A 3MBPA 4F1YA 1PBPA 4I9DA 1I6BA 1VSOA 3D4GA 4NWCA 3VDFA 3PGFA 4ZE9A 2CZKA 3PD8A 4OESA 3T66A 1UTBA 3TELA 5HPQA 5H8SA 1SPIA 1Y4CA 2XXKA 2THIA 3HCQA 3SESA 1B3GA 2OPEA 4NF5B 1ANFA 3LSWA 2H5YA 3GBAA 1FBDA 2HQ0A 3QUFA 2Q2CA 3U93A 4G68C 5IZZA 3LSLA 4POWA 1MG1A 3HFUA 1LFGA 2XXTA 1IXCA 1ZU0A 3AXFA 4OMBA 1VE4A 3F11A 4I8CA 5EQAA 3S9EA 3UA8A 2NUVA 3O66A 3KOTA 4NF4B 4HTGA 4RPOA 3KEIA 3OENA 2M8CA 2UYFA 5CRYA 2QS3A 3TKDA 3IB2A 4JB7A 2ANJA 2WYKA 4H8IA 2CZIA 1GR2A 5KCJB 3RPWA 4RK9A 1M5FA 1JW5A 4DI4B 4GVOA 5H8NA 2Y5LA 1NV4A 4DXUA 3IL1B 2OK2A 5CM6A 1MQGA 4P8BA 2NWJA 3FXQA 3FATA 5DT6A 3ILUB 3S9NC 1O7TA 1FSAA 2X26A 4H6DA 4PFRA 2XD2A 4OA4A 3TQLA 2F36A 4PQJA 4TOZA 3RQTA 2GHBA 2Z8FA 3MJNA 3MVWA 3S9LC 3C9HA 3FJ7A 1QUKA 2UVGA 3BIHA 2UVHA 3A3CA 4HE2A 3G3GA 5M2VA 1BLFA 3CSGA 4LP2B 1MH4A 1NV1A 3SDFA 3E78A 4EF2A 4F3BA 1EYJA 3SETA 4QSCA 4Q0CA 2ZYMA 3JZJA 1IMAA 2REGA 5FTHA 1LAXA 3QAXA 3WAEA 1HSJA 1IMDA 1LSTA 4TQUQ 5I56B 2ZZXA 5IZ3A 3IFCA 3N5LA 1B2HA 1IEJA 5TU0A 3VE1B 4DZ1A 3TTMA 3PPNA 1XVYA 3V8XB 2IA4A 1LBZA 4IO5A 1VFEA 3N6UA 4NAPA 1IXGA 4Z0IA 2AIXA 1NUXA 2Z8DA 4NGUA 1YYZA 3TTKA 2XXYA 3RYDA 2R6GE 5H8QA 4EQBA 5L9OA 1DTGA 5EQ9A 1URSA 3MVZA 1MPDA 3G3FA 3TQWA 5LOMA 2A5SA 4ESWA 4R6KA 1A99A 2OWSA 3B6WA 2XA5A 3T9VA 1B1XA 4MH5A 1BIYA 5I58A 3CG1A 1B3LA 4OZ9A 5FHNA 4NF6B 1I6QA 4BDNA 3QXMA 4HCWA 3K01A 3HHFA 2I6EA 4LZ8A 3S9MC 1MXWA 3MZ9A 3OSRA 1H45A 1D4NA 2VOZA 5IKBA 3GZGA 5DVFA 1R1NA 1FTAA 4QFOA 2DXRA 3PV0E 2DDKA 2F6PA 3OSQA 1FQCA 3EHTA 1EZPA 1AIVA 3KSXA 3M3FA 1BK4A 1FBGA 1R9LA 3EPEA 3E3KA 5I5PA 2ALUA 2JJKA 2XX8A 5H8NB 1II5A 4I62A 4DXCA 3E13X 3MP8A 1B58A 1MQHA 1FTLA 4H1XA 4PCDA 2CEXA 1B51A 1MDQA 4K3FA 4X1BA 1GGGA 3K6UA 4P3LA 1BP5A 2DE4A 3EN3A 4OYVA 1G0IA 1QUIA 3B6QA 1FQAA 3RUMA 4Z7EA 4R2BA 2OZZA 4GF8A 4RXLA 1H3DA 1XC1A 4NF4A 5L9MA 2RKMA 1Y1MA 4KD5A 1AH5A 1Y20A 4H0WA 2GH9A 2FA7A 5EQ7A 5IM2A 1LB8A 4NTLA 3W9VA 4F1UA 3G3IA 2W7YA 4R72A 3T96B 1OQGA 4AS5A 3G3HA 1DBZA 2BJIA 4O3AA 1DOTA 3K1NA 4XTCQ 3SKPA 3CFLA 3MPKA 4GX3A 3B50A 2Q8JA 3ISPA 4FBPA 1NI9A 5H8HB 4ELOA 1WVJA 4F1VA 2G93A 3FD3A 1ZTYA 3CR9A 3MPLA 3LUYA 1P1UA 1POY1 4POXA 3PUVE 2DYXA 5TPAA 2ZNSA 3H6VA 4H67A 2HAUA 3MUQA 4IO6A 4WEPA 4O3BA 3IOTA 2Y7WA 1FBEA 1NMUA 1K9YA 1S9TA 5CMKA 4DXBA 3ECRA 1FQBA 4GL8A 2HZLA 2DOJA 5CMMA 3U72A 1EZOA 1A8FA 3MQ9A 2Q9TA 5ESYA 5I59B 1TWYA 4LVQA 5TP9B 2V93A 2QPQA 1ATGA 2V3UA 2OWZA 4H65A 1TT1A 2RF1A 4HXVA 2PX1A 3D4CA 2AL5A 1CE2A 1ZLQA 4YKJA 2D3IA 1LBVA 2VHAA 4XFEA 3O2AA 2OBGA 2RINA 2XXVA 1A54A 1AL3A 4GD5A 2WBBA 1IITA 3FXRA 1JQFA 3HPIA 3OOAA 1J1NA 4RNSA 1LB9A 4OEVA 1URGA 2OCUA 4OVJA 3IORA 3M3KA 4ELRA 3WAFA 2Z8EA 1EYIA 5I59A 3TDJA 4TLLB 3FGSA 3MSTA 1ZIUA 4JSDA 3PMVA 2PYYA 2P1SA 5ET5A 4TLMB 3SERA 1Y4TA 1NNPA 3H06B 1JW4A 3O6IA 4G8MA 3H3GA 2XX7A 1OIBA 3D1RA 5IZ3B 2HAVA 4MAGA 5I56A 2YJPA 4N17A 3ROJA 1N76A 1TFAA 2O1MA 4M1VA 5AA3A 5DTBA 3HO7A 4U21A 3VFJA 4ELQA 3UN6A 3FASA 3O28A 2DQVA 1AMFA 1SW2A 3O6GA 4Q5TA 2DS9A 1IXHA 4QFLA 4U1OA 3UGWA 4EQ7A 1MY0A 1N84A 2DVZA 1N7XA 3GYYA 3TMGA 3IOVA 1POTA 1B1HA 3S4UA 3A09A 1A55A 5L9SA 4G68A 1OLCA 1FPGA 1US5A 5F1QA 3RNNA 3E79A 4O7MA 1KA0A 1SBPA 2E1SA 5I2NA 2FHYA 1D9VA 5EHMA 1KWHA 4YKKA 3Q28A 3RLFE 5KZTA 2VP1A 4F18A 1B7UA 4NE4A 1SW1A 2I3VA 3FVNA 5J16A 4GXSB 3DLNA 2VT5A 5ICTA 1SI0A 3IR1A 4MBPA 1NNKA 5BWJA 3K02A 4F2QA 2QL3A 1CNQA 4H5FA 4ZEKA 3A29A 4R2FA 1NV6A 2OPDA 3OO6A 4H5GA 4DCXA 4NX1A 4UA8A 2I0CA 1NV5A 1UIVA 3VLVA 3K2DA 5CMCA 1LAHE 3K6VA 1S50A 1QULA 2HFBA 2X7QA 4QSEA 3KG2A 2RC7A 4JVCA 3IB0A 4WKMA 1FPDA 2Y7RA 1RDZA 5AA2B 1M5DA 1OQHA 4GBVA 4YAHX 3M3LA 5B7DA 3P7IA 4JWOA 3O6HA 4UABA 4RPNA 1IMCA 1CB6A 1USYH 4QFPA 2ZXTA 3DP6A 2ZZWA 3PPQA 3VXBA 3UK4A 1F9BA 5AA4A 3BFTA 3U92A 2P3VA 1SI1A 5EYGA 2WX9A 3KJ7A 2FYIA 1H44A 1Q35A 3GBBA 3KN8A 3FUZA 3KOSA 4JVIA 4KCCA 4PF6A 1US4A 2O6AA 1FJ9A 4I3YA 4BDOA 2PMSA 1GV8A 2R71A 3MZ1A 3QUJA 3Q25A 1NNTA 3U1OA 3QK6A 3KFMA 4QXDA 2ZYNA 1AWBA 4PFUA 4U2RA 2DE3A 2H98A 1SVXB 3B7DA 4OENA 1EU8A 5H8FB 4BDLA 4JWXA 2WBDA 1NV2A 1LCFA 2D5WA 3FV1A 4OVSA 4RK2A 3DM0A 3O29A 3IJXB 3BBRA 1KZ8A 1DMBA 3M8UA 4I40A 3HV1A 1ZJLA 1SQYA 5KDTA 4C1TA 1QVSA 4OVRA 3B8BA 1OLAA 4KQPA 3U8QA 1YPNA 3U65A 4NF8B 2F97A 4KCDA 3KSJA 1XT8A 4R6YA 3PPPA 4P47A 1MDP1 3VVDA 4ZZEA 4PETA 3C31A 5ELVA 5I2NB 2I3WA 1N04A 4XKNA 2F7CA 3C33A 4BDMA 3KN3A 1Z7NE 3TCGA 1B3HA 2X7PA 2RCAA 4PP0A 2H4IA 3QIMA 1MXZA 1KA1A 2HCAA 4KR5A 1FRPA 1LAGE 2AL4A 4PFYA 4BDRA 2REJA 4QFKA 4HS7A 2I48A 5ITPA 1Z7ME 1LBBA 1IIWA 5I84A 3N26A 5CBRA 5DVJA 5CBSA 1VR5A 5F7VA 2O7IA 1JVXA 4LQ5A 1N7WA 1LGBC 1Y9UA 1P1NA 3IAZA 4KXPA 3Q27A 4AS4A 4GWZA 1AOVA 5H8FA 1D9QA 2B3FA 3BIGA 3R6UA 2B4MA 4NF0A 3KJTA 4C1UA 4ISUA 2H99A 1PEBA 5DYHA 5I7IA 3MP6A 3V83A 4P0IA 3T93B 4KFQA 2B3BA 4OEUA 4NF5A 3T9UA 3RPLB 3BKIB 4L17A 1QUJA 4C0RA 5CC2A 1SYIA 3Q26A 3H6UA 3ZSFA 1UTBB 2DP8A 1H76A 1FPJA 2QSXA 3G3KA 3PUYE 4GFRA 2O69A 1MY4A 4IO7A 4FAJA 3G3JA 4X9TA 2I49A 4LN5A 2F7AA 4RA1A 5JK4A 4MLQA 4EQ9A 3FVKA 1EH3A 4EDPA 2YLNA 5TP9A 1N0TA 3EQ1A 1RDYA 3RGYA 1FBHA 4G8HA 4PFBA 1HSLA 1MH3A 2F35A 2DWIA 3QMFA 1B3FA 5FHOA 3OD7A 2VGQA 3PUXE 2XXPA 1VFDA 1PC3A 3K4UA 3O97A 4NMYA 2ZNUA 3KGCA 1UIUA 4YB6A 4MIJA 4FE8A 3ILTB 5TPAB 2QMXA 3ZKKA 3MAMA 4QRZA 1LEVA 4MNCA 1H43A 4N6PA 4XIGQ 2G29A 2NVUB 4YKPA 4ONYA 4GWYA 1TXFA 3BFUA 3JYRA 3TAJA 2OX3A 4YMBA 4ZEBA 5L8DA 3EF7A 4OANA 1FTOA 2P3NA 4I1DA 4N13A 3OEKA 4PF8A 3L6HA 5A5LA 2XXWA 3IFAA 4DE8A 1P1OA 1QW0A 2HXRA 2O1LA 4IGTA 2V84A 3MVYA 1YXIA 5FBPA 1FCKA 2KR0A 2PBWA 2P0SA 3USDA 1JETA 4MCOA 5AE4A 3H6TA 1SDXA 2R9JA 5IZ1A 3E9XA 1UQWA 2QS4A 3HN0A 3C4MA 3OO9A 3E4RA 3K1MA 2I0BA 2VD2A 1IUDA 1A8EA 2V3QA 1N3XA 3EHUA 4PGNA 4H46A 1D3KA 4R9FA 4FEDA 1INPA 4HW8A 2QS2A 3T22A 4F39A 1VDWA 4IO4A 1PDAA 2D21A 2PT1A 2UXAA 5K2YA 3TZAA 1JNFA 4IY5A 1SW4A 3A3UA 4ELPA 4Q8RA 1Y3NA 1FPIA 3K1PA 4G68B 3EKIA 3MW0A 2QFLA 2Q89A 4U22A 2QJEA 3C35A 1WDNA 2F3DA 2PCRA 4RY1A 1NH7A 1NUWA 4U4SA 4YB7A 2QVRA 4GWUA 1FPKA 1EZ9A 4NF8A 4P0GA 1QJMA 1DSNA 4ZEDA 2XXXA 4ZS9A 4N91A 5I57A 4N8GA 4PAFA 4MHFA 3V89B 4NF6A
chains in the Genus database with same CATH topology
2HZKA 3HFUA 1LBWA 4PF8A 4PBQA 1K9YA 3MYUA 2CEYA 4HCYA 4XEQA 2FBPA 4GWWA 2V4CA 2ZZVA 4PC9A 4P47A 4HE1A 4N8YA 5IGAA 1LBXA 5ET7A 1IMDA 5A5LA 3IFAA 1FPJA 5ET6A 2JJKA 2FVZA 4N6KA 4PE3A 1IMCA 4PETA 2ZZXA 5I5PA 5IZ3A 2HXRA 2HZLA 5EQAA 1XI6A 4O8MA 3IFCA 1FPLA 4P1EA 1FBFA 1IMEA 2ZZWA 2B4LA 4GWSA 1YXIA 2Q8MA 4G61A 2CZHA 5EQ8A 2Q9TA 5ESYA 4QBAA 5FBPA 4P1LA 4PCDA 4X8RA 2CEXA 2KR0A 4PDHA 4X9TA 3KBZA 4MMPA 4LN5A 2DVZA 4OVTA 2DE2A 1LBZA 1DK4A 1KA1A 1NV0A 2P3VA 4MCOA 2QPQA 3GYYA 1EYKA 4P3LA 2DE4A 5EYGA 5JK4A 4NG7A 4NAPA 1FBEA 2OWZA 1G0IA 2WX9A 5LTCA 1FRPA 1RDXA 4M1VA 5F24A 4HXVA 1NUYA 1Q9DA 2FIEA 2FIXA 4O7IA 1NUXA 2L5VA 2WYKA 2CZIA 1RDYA 5IZ1A 4NGUA 1NUZA 1YYZA 4PFIA 2WEFA 1FBHA 2XWOA 2Q74A 4GBWA 3RYDA 4PFBA 1FPGA 1LBVA 4PTKA 5LDZA 4YZZA 4GX6A 4I3EA 4DI4B 3RPLA 4JVIA 5DW8A 3E79A 4P56A 4PF6A 5EQ9A 1KA0A 4O7MA 4XFEA 1IMBA 4YICA 2Y5LA 1FBPA 1NV4A 1FJ9A 4O94A 3W9WA 4IR8A 2V3QA 4PGNA 2QVUA 2PFYA 1FPEA 1QGXA 4H46A 4N81A 2FHYA 5CM6A 3KC0A 2R8TA 2WBBA 4MEVA 5T3JA 4I3YA 2XWKA 2HHMA 4PBHA 2XA5A 4P8BA 5EQ7A 4N15A 1K9ZA 1INPA 4MX6A 3QMFA 5IM2A 2F5XA 4N4UA 4NHBA 3W9VA 4F1UA 1LBYA 4XF5A 4F18A 2KQZA 1VDWA 4QXDA 1AWBA 1FSAA 1NV7A 3LV0A 5J16A 4JVDA 2VT5A 4MJOA 2QVVA 4AS5A 4P9KA 1DBZA 2DE3A 1JP4A 4PFRA 3PTYA 2BJIA 4GX4A 4HCWA 1EYIA 4OA4A 5J1DA 4MIJA 3FBPA 4NQ8A 3MSTA 1CNQA 1FPIA 3A29A 4OVPA 4MNPA 3EKIA 2CZKA 1FBCA 2QFLA 4GX3A 2MKZA 3B50A 2WBDA 2F3BA 1NV6A 5ET8A 4HE0A 4KXPA 1NV2A 4FBPA 4AS4A 4GWZA 2XWVA 1NI9A 2VPNA 3CHGA 3ISPA 4UABA 2F3DA 5EYHA 4NX1A 2PCRA 1LEVA 1D9QA 4F1VA 5ET5A 4MNCA 1DCUA 4GWXA 4H45A 4OVSA 4X04A 1NV5A 2PFZA 1NUWA 3BIGA 3LUZA 2QVRA 4DI3D 1FTAA 4OVQA 4GWUA 1FPKA 3BIHA 4PAKA 1SPIA 2XXKA 2B4MA 1KZ8A 4NF0A 2GQ1A 4GWYA 4HE2A 3FXBA 4NN3A 1FPBA 3KC1A 3SZPA 4PDDA 1FJ6A 3T0JA 2WYPA 5I7IA 2DDKA 4N6DA 2OX3A 3NOHA 3T1BA 3D1RA 5IZ3B 1NV1A 2XWIA 1G0HA 4PAIA 5I3SA 4I40A 4MNIA 4MAGA 4JVCA 3E78A 4F19A 2Y5KA 4OANA 1NV3A 1YZ0A 4N17A 1FBDA 2P3NA 1IMFA 3B8BA 4OVRA 1FPFA 4N91A 3ROJA 1EYJA 3RPLB 2HPGA 1FPDA 2VPOA 4N8GA 1RDZA 4PAFA 4MHFA 4PGPA 5IZZA 1BK4A 4GBVA 1IMAA 1FBGA 3U65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBW A;  1K9Y A;  2FBP A;  4GWW A;  4HE1 A;  1LBX A;  5ET7 A;  1IMD A;  5A5L A;  3IFA A;  1FPJ A;  5ET6 A;  2JJK A;  2FVZ A;  1IMC A;  5IZ3 A;  5EQA A;  1XI6 A;  3IFC A;  1FPL A;  1FBF A;  1IME A;  4GWS A;  1YXI A;  2Q8M A;  4G61 A;  2CZH A;  5EQ8 A;  5ESY A;  5FBP A;  3KBZ A;  1LBZ A;  1DK4 A;  1KA1 A;  1NV0 A;  2P3V A;  1EYK A;  5EYG A;  1FBE A;  2OWZ A;  1G0I A;  1FRP A;  1RDX A;  5F24 A;  4HXV A;  1NUY A;  1Q9D A;  2FIE A;  2FIX A;  4O7I A;  1NUX A;  2CZI A;  1RDY A;  5IZ1 A;  1NUZ A;  1YYZ A;  2WEF A;  1FBH A;  2Q74 A;  4GBW A;  3RYD A;  1FPG A;  1LBV A;  4PTK A;  5LDZ A;  4GX6 A;  4I3E A;  3RPL A;  5DW8 A;  5EQ9 A;  1KA0 A;  1IMB A;  2Y5L A;  1FBP A;  1NV4 A;  1FJ9 A;  4IR8 A;  2QVU A;  1FPE A;  1QGX A;  4H46 A;  4N81 A;  2FHY A;  3KC0 A;  2R8T A;  2WBB A;  5T3J A;  4I3Y A;  2HHM A;  5EQ7 A;  1K9Z A;  1INP A;  3QMF A;  1LBY A;  1VDW A;  4QXD A;  1AWB A;  1FSA A;  1NV7 A;  3LV0 A;  5J16 A;  2VT5 A;  4MJO A;  2QVV A;  4AS5 A;  1DBZ A;  1JP4 A;  2BJI A;  4GX4 A;  1EYI A;  3FBP A;  1CNQ A;  1FPI A;  3A29 A;  2CZK A;  1FBC A;  2QFL A;  4GX3 A;  2WBD A;  2F3B A;  1NV6 A;  5ET8 A;  4HE0 A;  4KXP A;  1NV2 A;  4FBP A;  4AS4 A;  4GWZ A;  1NI9 A;  2F3D A;  5EYH A;  2PCR A;  1LEV A;  1D9Q A;  5ET5 A;  1DCU A;  4GWX A;  4H45 A;  1NV5 A;  1NUW A;  3BIG A;  3LUZ A;  2QVR A;  1FTA A;  4GWU A;  1FPK A;  3BIH A;  1SPI A;  1KZ8 A;  2GQ1 A;  4GWY A;  4HE2 A;  1FPB A;  3KC1 A;  1FJ6 A;  3T0J A;  2DDK A;  2OX3 A;  3D1R A;  5IZ3 B;  1NV1 A;  1G0H A;  5I3S A;  4I40 A;  2Y5K A;  1NV3 A;  1YZ0 A;  1FBD A;  2P3N A;  1IMF A;  3B8B A;  1FPF A;  3ROJ A;  1EYJ A;  3RPL B;  1FPD A;  1RDZ A;  1BK4 A;  4GBV A;  1IMA A;  1FBG A; 
#chains in the Genus database with same CATH topology
 2O7U A;  4YKI A;  3MYU A;  2CEY A;  2F78 A;  1P1W A;  1LBX A;  2IEE A;  1XI6 A;  4ZE8 A;  3GXA A;  1FW0 A;  3FZV A;  4G61 A;  3TYH A;  4EXK A;  4IO2 A;  2Y84 A;  4X8R A;  4AB6 A;  4F3S A;  2XXU A;  1GTK A;  4PFW A;  1ELJ A;  1NKX A;  3LR1 A;  1NH8 A;  3RY3 A;  3Q29 A;  3TPA A;  5EHS A;  1NUY A;  1ZKB A;  1IQ7 A;  4FEB A;  1SW5 A;  4G77 A;  2Q74 A;  1MY3 A;  1MPC A;  1FQD A;  5CMB A;  1XOC A;  1QGX A;  2P2A A;  4F3G A;  2HEU A;  4N15 A;  4MX6 A;  2XX9 A;  2KQZ A;  4OHN A;  4F31 B;  4AB5 A;  3FBP A;  5H8H A;  1MXV A;  5FHM A;  1M5C A;  1FBC A;  3ODB A;  4HE0 A;  2NXO A;  3HHG A;  4LAT A;  3PUZ E;  1OMP A;  5K2X A;  1FQE A;  2O84 X;  3LUZ A;  2DWH A;  4PAK A;  4DDD A;  4X1D A;  3SZP A;  5JTY B;  3MZB A;  3NOH A;  4O3C A;  1G0H A;  4F19 A;  2Y5K A;  1YZ0 A;  4F29 A;  1FPF A;  1B4H A;  3IK6 B;  3OMB A;  1WOD A;  2A5T B;  2Q88 A;  4GWO A;  4XEQ A;  1SYH A;  2FBP A;  4FJP A;  1B0L A;  5ET7 A;  1L5T A;  3LC8 A;  1Q1K A;  1FTJ A;  3K00 A;  4LZ5 A;  3QYT A;  3GLB A;  4P1E A;  1FBF A;  1M5E A;  2B4L A;  4R74 A;  3C32 A;  1O64 A;  4MLV A;  3K6X A;  5HBC A;  3TTR A;  1Y3Q A;  3TCF A;  4F2O A;  4LA9 A;  1YTV A;  3MWB A;  3KZG A;  3V5A A;  3FIR A;  4PTK A;  2OJT A;  4P56 A;  1B7H A;  1YAE A;  4XKP A;  1IMB A;  3CVG A;  5DEX B;  1B5I A;  3MC2 A;  3PD9 A;  2QRY A;  4IR8 A;  3FJM A;  2Y7P A;  4FAT A;  1FPE A;  4N81 A;  4OER A;  5JTY A;  1A40 A;  2XD3 A;  4KHZ E;  4AQ4 A;  3VVE A;  1NV7 A;  5DEX A;  4JVD A;  2ONK E;  3PMW A;  2FNC A;  2I58 A;  2UYE A;  3K0V A;  3SEW A;  1B52 A;  5ET8 A;  1B4Z A;  1NFT A;  2XHD A;  2DSF A;  3R7X A;  4QF9 A;  4X04 A;  2YPN A;  1JEU A;  4DI3 D;  4OVQ A;  3QSL A;  1MM6 A;  5I58 B;  3KC1 A;  1FJ6 A;  1LCT A;  1B46 A;  2OWT A;  2DVC A;  1URD A;  1JVY A;  4GLI A;  4PAI A;  5I3S A;  4MNI A;  4UAC A;  1LFH A;  2VPO A;  3ZS6 A;  3IO6 A;  3LBS A;  4PGP A;  1IXI A;  2Y7I A;  3UOR A;  1LBW A;  3IX1 A;  4GL0 A;  2Q2A A;  3T1B A;  4IB2 A;  4N6K A;  3N6T A;  4DLD A;  4G4P A;  3SEV A;  4O8M A;  1FPL A;  1MS7 A;  1MPB A;  4QHQ A;  4QBA A;  1FQF A;  1M5B A;  1DK4 A;  1IZ1 A;  1NV0 A;  3DP4 A;  1R6Z A;  1MQD A;  1NUZ A;  4THI A;  1T0K A;  1XHY A;  2DXY A;  4I3E A;  3TTN A;  5I57 B;  4KI0 E;  3FV2 A;  2ZNT A;  3TTL A;  1LBY A;  3SEX A;  3DP8 A;  3FJG A;  3RTF B;  4KYE A;  5H8Q B;  1B5H A;  3H03 A;  4XKQ A;  4ZDM A;  4NQ8 A;  4MNP A;  1MQJ A;  2MKZ A;  3L6G A;  1RYX A;  2VPN A;  5EYH A;  2CZL A;  1Y3P A;  1MXY A;  1DCU A;  4H45 A;  3TEP A;  1B9J A;  1XS5 A;  4PFT A;  4OFL A;  3SEU A;  1FPB A;  1BKA A;  3T0J A;  2I4B A;  3H4Z A;  3K6W A;  2XWI A;  4QFN A;  3ZKL A;  4P11 A;  4IO3 A;  4QSD A;  1IMF A;  2PT2 A;  2ZYK A;  1P1Q A;  1LBC A;  4F3P A;  1GVC A;  2UVJ A;  1RKM A;  4PBQ A;  4ECF A;  3OEM A;  2RC9 A;  4GWW A;  5IGA A;  2CMO A;  4EF1 A;  1S7Y A;  2FVZ A;  4JWY A;  1R9Q A;  3VVF A;  3OXN A;  3CRB A;  4KPT A;  2F34 A;  2CZH A;  4FOR A;  4M4G A;  4GIZ A;  3ONM A;  4U23 A;  3DEL B;  4YMA A;  1FTK A;  3H7M A;  2KLF A;  4OTE A;  3CFX A;  2O51 A;  1YCJ A;  5CI5 A;  2WEF A;  2RC8 A;  3IO4 A;  5LDZ A;  4GX6 A;  4FEC A;  4OWD A;  3W9W A;  3TCH A;  2B65 A;  2H25 A;  2R8T A;  3MP1 A;  2HHM A;  3T9H B;  3VLW A;  4PBH A;  4NHB A;  1MXX A;  4XF5 A;  2WKY A;  3FVO A;  3LV0 A;  4MF3 A;  1JP4 A;  4ZEC A;  4GX4 A;  5KDT B;  3CFZ A;  2I4C A;  4JBZ A;  2XXH A;  3RN8 A;  2XWV A;  3CHG A;  1OVT A;  5AA1 A;  4GQO A;  5ICQ A;  5B70 A;  2PFZ A;  5IAI A;  3RTW B;  1ZMG A;  2A5T A;  1P99 A;  1QKB A;  3OO7 A;  4U4X A;  1B0H A;  3SEY A;  3CG3 A;  3C34 A;  4FIM A;  1XVX A;  1A7L A;  5HM4 B;  3FXU A;  4KYD A;  3VXC A;  1B05 A;  1D9Y A;  2HXW A;  4N07 A;  4OET A;  3TOD A;  1MQI A;  4HCY A;  4NED A;  4WXJ A;  4XXU A;  4F22 A;  2F7B A;  4PE3 A;  2VD3 A;  2ABH A;  1I6A A;  3I3V A;  2Q8M A;  2GHA A;  1O63 A;  3LSX A;  4JDF A;  1DTZ A;  4NG7 A;  2OLB A;  2UVI A;  1RDX A;  2L5V A;  5FTI A;  1NL5 A;  4R6H A;  4KYS A;  5BUU A;  5AA4 B;  2XWO A;  4GBW A;  4ZEI A;  4YZZ A;  3T9X B;  3RPL A;  1JW1 A;  2V3T A;  3KC0 A;  5A5X A;  4YB5 A;  1PBQ A;  5JEI A;  3KN7 A;  5AA2 A;  4MJO A;  2QVV A;  4P9K A;  4EXL A;  5J1D A;  2O68 A;  3N94 A;  4G8N A;  2AYS A;  4OFO A;  2XXR A;  2F8D A;  3JV9 A;  4JSO A;  4X48 A;  2RCB A;  4EUO A;  4GRK A;  4R73 A;  4ZZA A;  5I2K A;  3H6W A;  3IJO B;  3FVG A;  3LSF B;  4OFJ A;  1DPE A;  4NN3 A;  1UTH A;  2QS1 A;  4PDD A;  2WYP A;  4H8J A;  1BTJ A;  1PB7 A;  2DWA A;  3U94 A;  4E0W A;  4R75 A;  1N3W A;  2HPG A;  4BDQ A;  1NNF A;  3CSB A;  3PPR A;  1LFI A;  4G2Z A;  3C36 A;  4DCY A;  1MY2 A;  1SD3 A;  4PC9 A;  3B6T A;  3R26 A;  4N8Y A;  2ZMB A;  5ET6 A;  3PUW E;  1QKA A;  3THI A;  4WED A;  3IB1 A;  1OVB A;  3KBR A;  4P1L A;  4LON B;  4PDH A;  5EYF A;  4Q30 B;  4DIG A;  1EYK A;  1DPP A;  3TFL A;  5LTC A;  4LZ7 A;  5ITO A;  2BJJ X;  5F24 A;  1MM7 A;  3TUS A;  2ZYO A;  1USY E;  1Q9D A;  2FIE A;  4O7I A;  1JEV A;  4PFI A;  3G7W A;  2Y7K A;  3IOU A;  5DW8 A;  1LLS A;  4ZEF A;  1B3E A;  5ISU A;  1FBP A;  2QVU A;  2PFY A;  3PU5 A;  5KCJ A;  3CI8 A;  4E0X A;  2DWJ A;  2XWK A;  4IY6 A;  3OEL A;  2NOO A;  1UTH B;  1B6H A;  2F5X A;  2QMW A;  2PVU A;  2XXQ A;  3PTY A;  2Z22 A;  4LQ2 A;  1ZBM A;  2ONR A;  4IGR A;  4OVP A;  1B32 A;  5DVI A;  2F3B A;  2F6G A;  1I69 A;  2E0S A;  4GWX A;  1MRP A;  1B7Z A;  3RT8 A;  3UP9 A;  2Z23 A;  2GQ1 A;  3FXB A;  4N6D A;  4ESX A;  1MXU A;  1PB8 A;  3EHS A;  3HST A;  2GRV A;  4LUB A;  1NV3 A;  1MY1 A;  1B5J A;  1PB9 A;  4RJZ A;  3CIJ A;  3I5O A;  3VV5 A;  3MVX A;  4MFI A;  3O9P A;  4BLA A;  2HZK A;  1FTM A;  4GXA A;  3W15 C;  2V25 A;  2V4C A;  2ZZV A;  4HE1 A;  1Y1Z A;  1LAF E;  3PPO A;  2ESN A;  1IME A;  5AA2 D;  4GWS A;  1TFD A;  2H9B A;  2LAO A;  5EQ8 A;  3IOW A;  4NWD A;  4JXI A;  4U1Z A;  2ONS A;  2XXI A;  3KBZ A;  4MMP A;  4OVT A;  2DE2 A;  4RYA A;  5I2K B;  1HSE A;  4YU0 A;  3S2V A;  3VLU A;  3RT6 B;  2FIX A;  1RYO A;  4OQO A;  4OXV A;  4GOT A;  4ND9 A;  3PMX A;  3I6V A;  4R9G A;  3OO8 A;  4YIC A;  2GFE A;  4O94 A;  4XKR A;  3UIF A;  4MEV A;  5T3J A;  4PE5 B;  1K9Z A;  5A5X B;  4N4U A;  1B40 A;  3MBP A;  4F1Y A;  1PBP A;  4I9D A;  1I6B A;  1VSO A;  3D4G A;  4NWC A;  3VDF A;  3PGF A;  4ZE9 A;  2CZK A;  3PD8 A;  4OES A;  3T66 A;  1UTB A;  3TEL A;  5HPQ A;  5H8S A;  1SPI A;  1Y4C A;  2XXK A;  2THI A;  3HCQ A;  3SES A;  1B3G A;  2OPE A;  4NF5 B;  1ANF A;  3LSW A;  2H5Y A;  3GBA A;  1FBD A;  2HQ0 A;  3QUF A;  2Q2C A;  3U93 A;  4G68 C;  5IZZ A;  3LSL A;  4POW A;  1MG1 A;  3HFU A;  1LFG A;  2XXT A;  1IXC A;  1ZU0 A;  3AXF A;  4OMB A;  1VE4 A;  3F11 A;  4I8C A;  5EQA A;  3S9E A;  3UA8 A;  2NUV A;  3O66 A;  3KOT A;  4NF4 B;  4HTG A;  4RPO A;  3KEI A;  3OEN A;  2M8C A;  2UYF A;  5CRY A;  2QS3 A;  3TKD A;  3IB2 A;  4JB7 A;  2ANJ A;  2WYK A;  4H8I A;  2CZI A;  1GR2 A;  5KCJ B;  3RPW A;  4RK9 A;  1M5F A;  1JW5 A;  4DI4 B;  4GVO A;  5H8N A;  2Y5L A;  1NV4 A;  4DXU A;  3IL1 B;  2OK2 A;  5CM6 A;  1MQG A;  4P8B A;  2NWJ A;  3FXQ A;  3FAT A;  5DT6 A;  3ILU B;  3S9N C;  1O7T A;  1FSA A;  2X26 A;  4H6D A;  4PFR A;  2XD2 A;  4OA4 A;  3TQL A;  2F36 A;  4PQJ A;  4TOZ A;  3RQT A;  2GHB A;  2Z8F A;  3MJN A;  3MVW A;  3S9L C;  3C9H A;  3FJ7 A;  1QUK A;  2UVG A;  3BIH A;  2UVH A;  3A3C A;  4HE2 A;  3G3G A;  5M2V A;  1BLF A;  3CSG A;  4LP2 B;  1MH4 A;  1NV1 A;  3SDF A;  3E78 A;  4EF2 A;  4F3B A;  1EYJ A;  3SET A;  4QSC A;  4Q0C A;  2ZYM A;  3JZJ A;  1IMA A;  2REG A;  5FTH A;  1LAX A;  3QAX A;  3WAE A;  1HSJ A;  1IMD A;  1LST A;  4TQU Q;  5I56 B;  2ZZX A;  5IZ3 A;  3IFC A;  3N5L A;  1B2H A;  1IEJ A;  5TU0 A;  3VE1 B;  4DZ1 A;  3TTM A;  3PPN A;  1XVY A;  3V8X B;  2IA4 A;  1LBZ A;  4IO5 A;  1VFE A;  3N6U A;  4NAP A;  1IXG A;  4Z0I A;  2AIX A;  1NUX A;  2Z8D A;  4NGU A;  1YYZ A;  3TTK A;  2XXY A;  3RYD A;  2R6G E;  5H8Q A;  4EQB A;  5L9O A;  1DTG A;  5EQ9 A;  1URS A;  3MVZ A;  1MPD A;  3G3F A;  3TQW A;  5LOM A;  2A5S A;  4ESW A;  4R6K A;  1A99 A;  2OWS A;  3B6W A;  2XA5 A;  3T9V A;  1B1X A;  4MH5 A;  1BIY A;  5I58 A;  3CG1 A;  1B3L A;  4OZ9 A;  5FHN A;  4NF6 B;  1I6Q A;  4BDN A;  3QXM A;  4HCW A;  3K01 A;  3HHF A;  2I6E A;  4LZ8 A;  3S9M C;  1MXW A;  3MZ9 A;  3OSR A;  1H45 A;  1D4N A;  2VOZ A;  5IKB A;  3GZG A;  5DVF A;  1R1N A;  1FTA A;  4QFO A;  2DXR A;  3PV0 E;  2DDK A;  2F6P A;  3OSQ A;  1FQC A;  3EHT A;  1EZP A;  1AIV A;  3KSX A;  3M3F A;  1BK4 A;  1FBG A;  1R9L A;  3EPE A;  3E3K A;  5I5P A;  2ALU A;  2JJK A;  2XX8 A;  5H8N B;  1II5 A;  4I62 A;  4DXC A;  3E13 X;  3MP8 A;  1B58 A;  1MQH A;  1FTL A;  4H1X A;  4PCD A;  2CEX A;  1B51 A;  1MDQ A;  4K3F A;  4X1B A;  1GGG A;  3K6U A;  4P3L A;  1BP5 A;  2DE4 A;  3EN3 A;  4OYV A;  1G0I A;  1QUI A;  3B6Q A;  1FQA A;  3RUM A;  4Z7E A;  4R2B A;  2OZZ A;  4GF8 A;  4RXL A;  1H3D A;  1XC1 A;  4NF4 A;  5L9M A;  2RKM A;  1Y1M A;  4KD5 A;  1AH5 A;  1Y20 A;  4H0W A;  2GH9 A;  2FA7 A;  5EQ7 A;  5IM2 A;  1LB8 A;  4NTL A;  3W9V A;  4F1U A;  3G3I A;  2W7Y A;  4R72 A;  3T96 B;  1OQG A;  4AS5 A;  3G3H A;  1DBZ A;  2BJI A;  4O3A A;  1DOT A;  3K1N A;  4XTC Q;  3SKP A;  3CFL A;  3MPK A;  4GX3 A;  3B50 A;  2Q8J A;  3ISP A;  4FBP A;  1NI9 A;  5H8H B;  4ELO A;  1WVJ A;  4F1V A;  2G93 A;  3FD3 A;  1ZTY A;  3CR9 A;  3MPL A;  3LUY A;  1P1U A;  1POY 1;  4POX A;  3PUV E;  2DYX A;  5TPA A;  2ZNS A;  3H6V A;  4H67 A;  2HAU A;  3MUQ A;  4IO6 A;  4WEP A;  4O3B A;  3IOT A;  2Y7W A;  1FBE A;  1NMU A;  1K9Y A;  1S9T A;  5CMK A;  4DXB A;  3ECR A;  1FQB A;  4GL8 A;  2HZL A;  2DOJ A;  5CMM A;  3U72 A;  1EZO A;  1A8F A;  3MQ9 A;  2Q9T A;  5ESY A;  5I59 B;  1TWY A;  4LVQ A;  5TP9 B;  2V93 A;  2QPQ A;  1ATG A;  2V3U A;  2OWZ A;  4H65 A;  1TT1 A;  2RF1 A;  4HXV A;  2PX1 A;  3D4C A;  2AL5 A;  1CE2 A;  1ZLQ A;  4YKJ A;  2D3I A;  1LBV A;  2VHA A;  4XFE A;  3O2A A;  2OBG A;  2RIN A;  2XXV A;  1A54 A;  1AL3 A;  4GD5 A;  2WBB A;  1IIT A;  3FXR A;  1JQF A;  3HPI A;  3OOA A;  1J1N A;  4RNS A;  1LB9 A;  4OEV A;  1URG A;  2OCU A;  4OVJ A;  3IOR A;  3M3K A;  4ELR A;  3WAF A;  2Z8E A;  1EYI A;  5I59 A;  3TDJ A;  4TLL B;  3FGS A;  3MST A;  1ZIU A;  4JSD A;  3PMV A;  2PYY A;  2P1S A;  5ET5 A;  4TLM B;  3SER A;  1Y4T A;  1NNP A;  3H06 B;  1JW4 A;  3O6I A;  4G8M A;  3H3G A;  2XX7 A;  1OIB A;  3D1R A;  5IZ3 B;  2HAV A;  4MAG A;  5I56 A;  2YJP A;  4N17 A;  3ROJ A;  1N76 A;  1TFA A;  2O1M A;  4M1V A;  5AA3 A;  5DTB A;  3HO7 A;  4U21 A;  3VFJ A;  4ELQ A;  3UN6 A;  3FAS A;  3O28 A;  2DQV A;  1AMF A;  1SW2 A;  3O6G A;  4Q5T A;  2DS9 A;  1IXH A;  4QFL A;  4U1O A;  3UGW A;  4EQ7 A;  1MY0 A;  1N84 A;  2DVZ A;  1N7X A;  3GYY A;  3TMG A;  3IOV A;  1POT A;  1B1H A;  3S4U A;  3A09 A;  1A55 A;  5L9S A;  4G68 A;  1OLC A;  1FPG A;  1US5 A;  5F1Q A;  3RNN A;  3E79 A;  4O7M A;  1KA0 A;  1SBP A;  2E1S A;  5I2N A;  2FHY A;  1D9V A;  5EHM A;  1KWH A;  4YKK A;  3Q28 A;  3RLF E;  5KZT A;  2VP1 A;  4F18 A;  1B7U A;  4NE4 A;  1SW1 A;  2I3V A;  3FVN A;  5J16 A;  4GXS B;  3DLN A;  2VT5 A;  5ICT A;  1SI0 A;  3IR1 A;  4MBP A;  1NNK A;  5BWJ A;  3K02 A;  4F2Q A;  2QL3 A;  1CNQ A;  4H5F A;  4ZEK A;  3A29 A;  4R2F A;  1NV6 A;  2OPD A;  3OO6 A;  4H5G A;  4DCX A;  4NX1 A;  4UA8 A;  2I0C A;  1NV5 A;  1UIV A;  3VLV A;  3K2D A;  5CMC A;  1LAH E;  3K6V A;  1S50 A;  1QUL A;  2HFB A;  2X7Q A;  4QSE A;  3KG2 A;  2RC7 A;  4JVC A;  3IB0 A;  4WKM A;  1FPD A;  2Y7R A;  1RDZ A;  5AA2 B;  1M5D A;  1OQH A;  4GBV A;  4YAH X;  3M3L A;  5B7D A;  3P7I A;  4JWO A;  3O6H A;  4UAB A;  4RPN A;  1IMC A;  1CB6 A;  1USY H;  4QFP A;  2ZXT A;  3DP6 A;  2ZZW A;  3PPQ A;  3VXB A;  3UK4 A;  1F9B A;  5AA4 A;  3BFT A;  3U92 A;  2P3V A;  1SI1 A;  5EYG A;  2WX9 A;  3KJ7 A;  2FYI A;  1H44 A;  1Q35 A;  3GBB A;  3KN8 A;  3FUZ A;  3KOS A;  4JVI A;  4KCC A;  4PF6 A;  1US4 A;  2O6A A;  1FJ9 A;  4I3Y A;  4BDO A;  2PMS A;  1GV8 A;  2R71 A;  3MZ1 A;  3QUJ A;  3Q25 A;  1NNT A;  3U1O A;  3QK6 A;  3KFM A;  4QXD A;  2ZYN A;  1AWB A;  4PFU A;  4U2R A;  2DE3 A;  2H98 A;  1SVX B;  3B7D A;  4OEN A;  1EU8 A;  5H8F B;  4BDL A;  4JWX A;  2WBD A;  1NV2 A;  1LCF A;  2D5W A;  3FV1 A;  4OVS A;  4RK2 A;  3DM0 A;  3O29 A;  3IJX B;  3BBR A;  1KZ8 A;  1DMB A;  3M8U A;  4I40 A;  3HV1 A;  1ZJL A;  1SQY A;  5KDT A;  4C1T A;  1QVS A;  4OVR A;  3B8B A;  1OLA A;  4KQP A;  3U8Q A;  1YPN A;  3U65 A;  4NF8 B;  2F97 A;  4KCD A;  3KSJ A;  1XT8 A;  4R6Y A;  3PPP A;  4P47 A;  1MDP 1;  3VVD A;  4ZZE A;  4PET A;  3C31 A;  5ELV A;  5I2N B;  2I3W A;  1N04 A;  4XKN A;  2F7C A;  3C33 A;  4BDM A;  3KN3 A;  1Z7N E;  3TCG A;  1B3H A;  2X7P A;  2RCA A;  4PP0 A;  2H4I A;  3QIM A;  1MXZ A;  1KA1 A;  2HCA A;  4KR5 A;  1FRP A;  1LAG E;  2AL4 A;  4PFY A;  4BDR A;  2REJ A;  4QFK A;  4HS7 A;  2I48 A;  5ITP A;  1Z7M E;  1LBB A;  1IIW A;  5I84 A;  3N26 A;  5CBR A;  5DVJ A;  5CBS A;  1VR5 A;  5F7V A;  2O7I A;  1JVX A;  4LQ5 A;  1N7W A;  1LGB C;  1Y9U A;  1P1N A;  3IAZ A;  4KXP A;  3Q27 A;  4AS4 A;  4GWZ A;  1AOV A;  5H8F A;  1D9Q A;  2B3F A;  3BIG A;  3R6U A;  2B4M A;  4NF0 A;  3KJT A;  4C1U A;  4ISU A;  2H99 A;  1PEB A;  5DYH A;  5I7I A;  3MP6 A;  3V83 A;  4P0I A;  3T93 B;  4KFQ A;  2B3B A;  4OEU A;  4NF5 A;  3T9U A;  3RPL B;  3BKI B;  4L17 A;  1QUJ A;  4C0R A;  5CC2 A;  1SYI A;  3Q26 A;  3H6U A;  3ZSF A;  1UTB B;  2DP8 A;  1H76 A;  1FPJ A;  2QSX A;  3G3K A;  3PUY E;  4GFR A;  2O69 A;  1MY4 A;  4IO7 A;  4FAJ A;  3G3J A;  4X9T A;  2I49 A;  4LN5 A;  2F7A A;  4RA1 A;  5JK4 A;  4MLQ A;  4EQ9 A;  3FVK A;  1EH3 A;  4EDP A;  2YLN A;  5TP9 A;  1N0T A;  3EQ1 A;  1RDY A;  3RGY A;  1FBH A;  4G8H A;  4PFB A;  1HSL A;  1MH3 A;  2F35 A;  2DWI A;  3QMF A;  1B3F A;  5FHO A;  3OD7 A;  2VGQ A;  3PUX E;  2XXP A;  1VFD A;  1PC3 A;  3K4U A;  3O97 A;  4NMY A;  2ZNU A;  3KGC A;  1UIU A;  4YB6 A;  4MIJ A;  4FE8 A;  3ILT B;  5TPA B;  2QMX A;  3ZKK A;  3MAM A;  4QRZ A;  1LEV A;  4MNC A;  1H43 A;  4N6P A;  4XIG Q;  2G29 A;  2NVU B;  4YKP A;  4ONY A;  4GWY A;  1TXF A;  3BFU A;  3JYR A;  3TAJ A;  2OX3 A;  4YMB A;  4ZEB A;  5L8D A;  3EF7 A;  4OAN A;  1FTO A;  2P3N A;  4I1D A;  4N13 A;  3OEK A;  4PF8 A;  3L6H A;  5A5L A;  2XXW A;  3IFA A;  4DE8 A;  1P1O A;  1QW0 A;  2HXR A;  2O1L A;  4IGT A;  2V84 A;  3MVY A;  1YXI A;  5FBP A;  1FCK A;  2KR0 A;  2PBW A;  2P0S A;  3USD A;  1JET A;  4MCO A;  5AE4 A;  3H6T A;  1SDX A;  2R9J A;  5IZ1 A;  3E9X A;  1UQW A;  2QS4 A;  3HN0 A;  3C4M A;  3OO9 A;  3E4R A;  3K1M A;  2I0B A;  2VD2 A;  1IUD A;  1A8E A;  2V3Q A;  1N3X A;  3EHU A;  4PGN A;  4H46 A;  1D3K A;  4R9F A;  4FED A;  1INP A;  4HW8 A;  2QS2 A;  3T22 A;  4F39 A;  1VDW A;  4IO4 A;  1PDA A;  2D21 A;  2PT1 A;  2UXA A;  5K2Y A;  3TZA A;  1JNF A;  4IY5 A;  1SW4 A;  3A3U A;  4ELP A;  4Q8R A;  1Y3N A;  1FPI A;  3K1P A;  4G68 B;  3EKI A;  3MW0 A;  2QFL A;  2Q89 A;  4U22 A;  2QJE A;  3C35 A;  1WDN A;  2F3D A;  2PCR A;  4RY1 A;  1NH7 A;  1NUW A;  4U4S A;  4YB7 A;  2QVR A;  4GWU A;  1FPK A;  1EZ9 A;  4NF8 A;  4P0G A;  1QJM A;  1DSN A;  4ZED A;  2XXX A;  4ZS9 A;  4N91 A;  5I57 A;  4N8G A;  4PAF A;  4MHF A;  3V89 B;  4NF6 A; 
#chains in the Genus database with same CATH homology
 2HZK A;  3HFU A;  1LBW A;  4PF8 A;  4PBQ A;  1K9Y A;  3MYU A;  2CEY A;  4HCY A;  4XEQ A;  2FBP A;  4GWW A;  2V4C A;  2ZZV A;  4PC9 A;  4P47 A;  4HE1 A;  4N8Y A;  5IGA A;  1LBX A;  5ET7 A;  1IMD A;  5A5L A;  3IFA A;  1FPJ A;  5ET6 A;  2JJK A;  2FVZ A;  4N6K A;  4PE3 A;  1IMC A;  4PET A;  2ZZX A;  5I5P A;  5IZ3 A;  2HXR A;  2HZL A;  5EQA A;  1XI6 A;  4O8M A;  3IFC A;  1FPL A;  4P1E A;  1FBF A;  1IME A;  2ZZW A;  2B4L A;  4GWS A;  1YXI A;  2Q8M A;  4G61 A;  2CZH A;  5EQ8 A;  2Q9T A;  5ESY A;  4QBA A;  5FBP A;  4P1L A;  4PCD A;  4X8R A;  2CEX A;  2KR0 A;  4PDH A;  4X9T A;  3KBZ A;  4MMP A;  4LN5 A;  2DVZ A;  4OVT A;  2DE2 A;  1LBZ A;  1DK4 A;  1KA1 A;  1NV0 A;  2P3V A;  4MCO A;  2QPQ A;  3GYY A;  1EYK A;  4P3L A;  2DE4 A;  5EYG A;  5JK4 A;  4NG7 A;  4NAP A;  1FBE A;  2OWZ A;  1G0I A;  2WX9 A;  5LTC A;  1FRP A;  1RDX A;  4M1V A;  5F24 A;  4HXV A;  1NUY A;  1Q9D A;  2FIE A;  2FIX A;  4O7I A;  1NUX A;  2L5V A;  2WYK A;  2CZI A;  1RDY A;  5IZ1 A;  4NGU A;  1NUZ A;  1YYZ A;  4PFI A;  2WEF A;  1FBH A;  2XWO A;  2Q74 A;  4GBW A;  3RYD A;  4PFB A;  1FPG A;  1LBV A;  4PTK A;  5LDZ A;  4YZZ A;  4GX6 A;  4I3E A;  4DI4 B;  3RPL A;  4JVI A;  5DW8 A;  3E79 A;  4P56 A;  4PF6 A;  5EQ9 A;  1KA0 A;  4O7M A;  4XFE A;  1IMB A;  4YIC A;  2Y5L A;  1FBP A;  1NV4 A;  1FJ9 A;  4O94 A;  3W9W A;  4IR8 A;  2V3Q A;  4PGN A;  2QVU A;  2PFY A;  1FPE A;  1QGX A;  4H46 A;  4N81 A;  2FHY A;  5CM6 A;  3KC0 A;  2R8T A;  2WBB A;  4MEV A;  5T3J A;  4I3Y A;  2XWK A;  2HHM A;  4PBH A;  2XA5 A;  4P8B A;  5EQ7 A;  4N15 A;  1K9Z A;  1INP A;  4MX6 A;  3QMF A;  5IM2 A;  2F5X A;  4N4U A;  4NHB A;  3W9V A;  4F1U A;  1LBY A;  4XF5 A;  4F18 A;  2KQZ A;  1VDW A;  4QXD A;  1AWB A;  1FSA A;  1NV7 A;  3LV0 A;  5J16 A;  4JVD A;  2VT5 A;  4MJO A;  2QVV A;  4AS5 A;  4P9K A;  1DBZ A;  2DE3 A;  1JP4 A;  4PFR A;  3PTY A;  2BJI A;  4GX4 A;  4HCW A;  1EYI A;  4OA4 A;  5J1D A;  4MIJ A;  3FBP A;  4NQ8 A;  3MST A;  1CNQ A;  1FPI A;  3A29 A;  4OVP A;  4MNP A;  3EKI A;  2CZK A;  1FBC A;  2QFL A;  4GX3 A;  2MKZ A;  3B50 A;  2WBD A;  2F3B A;  1NV6 A;  5ET8 A;  4HE0 A;  4KXP A;  1NV2 A;  4FBP A;  4AS4 A;  4GWZ A;  2XWV A;  1NI9 A;  2VPN A;  3CHG A;  3ISP A;  4UAB A;  2F3D A;  5EYH A;  4NX1 A;  2PCR A;  1LEV A;  1D9Q A;  4F1V A;  5ET5 A;  4MNC A;  1DCU A;  4GWX A;  4H45 A;  4OVS A;  4X04 A;  1NV5 A;  2PFZ A;  1NUW A;  3BIG A;  3LUZ A;  2QVR A;  4DI3 D;  1FTA A;  4OVQ A;  4GWU A;  1FPK A;  3BIH A;  4PAK A;  1SPI A;  2XXK A;  2B4M A;  1KZ8 A;  4NF0 A;  2GQ1 A;  4GWY A;  4HE2 A;  3FXB A;  4NN3 A;  1FPB A;  3KC1 A;  3SZP A;  4PDD A;  1FJ6 A;  3T0J A;  2WYP A;  5I7I A;  2DDK A;  4N6D A;  2OX3 A;  3NOH A;  3T1B A;  3D1R A;  5IZ3 B;  1NV1 A;  2XWI A;  1G0H A;  4PAI A;  5I3S A;  4I40 A;  4MNI A;  4MAG A;  4JVC A;  3E78 A;  4F19 A;  2Y5K A;  4OAN A;  1NV3 A;  1YZ0 A;  4N17 A;  1FBD A;  2P3N A;  1IMF A;  3B8B A;  4OVR A;  1FPF A;  4N91 A;  3ROJ A;  1EYJ A;  3RPL B;  2HPG A;  1FPD A;  2VPO A;  4N8G A;  1RDZ A;  4PAF A;  4MHF A;  4PGP A;  5IZZ A;  1BK4 A;  4GBV A;  1IMA A;  1FBG A;  3U65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...