4PTKA

Crystal structure of staphylococcal impase-i complex with 3mg2+ and phosphate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
262
structure length
262
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 71
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4ptkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ptkA02
2P3NA 1FPEA 3LUZA 1FRPA 1NI9A 2F3DA 2F3BA 1NUYA 1FPFA 1FPBA 2FHYA 2FIXA 1KZ8A 1YXIA 3KC1A 4G61A 4GWSA 1DBZA 1FJ9A 4GWYA 4N81A 1NV4A 2Y5LA 2R8TA 1FTAA 1FJ6A 1Q9DA 4H45A 4HE0A 3KBZA 1DK4A 1FPIA 2WBBA 3A29A 1FSAA 4GWWA 1KA0A 3BIGA 2QVVA 4I3YA 4PTKA 1IMEA 2DDKA 4GWXA 2QFLA 1INPA 2FVZA 5EQ7A 5IZ3B 1NV6A 1EYIA 5EQ8A 1VDWA 1IMFA 2QVRA 4HXVA 1YZ0A 4MJOA 2CZIA 5ET7A 1NV5A 1FBEA 4QXDA 2Y5KA 1FPDA 1RDZA 2VT5A 5ET6A 3FBPA 4HE1A 1LBYA 5A5LA 5I3SA 1KA1A 1FPLA 5EQAA 1JP4A 1LBXA 2HHMA 2BJIA 1FPKA 2WEFA 4H46A 2P3VA 3RYDA 1AWBA 2GQ1A 1NV7A 1NV2A 2PCRA 1NUZA 1G0HA 4I3EA 4IR8A 5ET8A 1FBGA 2JJKA 2WBDA 4GX4A 3RPLA 4GX6A 4HE2A 4KXPA 4AS5A 4FBPA 5ET5A 1NV3A 2CZHA 1DCUA 1G0IA 1LEVA 2CZKA 4GBVA 1IMCA 1QGXA 1RDYA 1FBPA 1FPGA 1CNQA 1K9YA 2FIEA 2OWZA 1FBHA 1EYKA 5DW8A 3D1RA 5EYHA 4GX3A 2Q8MA 2Q74A 5T3JA 4I40A 1LBVA 4O7IA 4GWZA 2OX3A 1IMBA 5EQ9A 1BK4A 3BIHA 5IZ1A 1FBDA 3QMFA 5EYGA 4AS4A 1NV1A 2QVUA 1NUXA 3IFAA 3RPLB 3ROJA 5FBPA 1EYJA 5F24A 5J16A 5LDZA 1FBCA 1FBFA 1IMDA 3LV0A 5IZ3A 3IFCA 3B8BA 1SPIA 4GBWA 1D9QA 1FPJA 1XI6A 3KC0A 1YYZA 2FBPA 4GWUA 1IMAA 1K9ZA 1NV0A 3T0JA 1NUWA 5ESYA 1LBWA 1RDXA 1LBZA
chains in the Genus database with same CATH superfamily
3H06B 3RT6B 1H45A 3CR9A 2Q2AA 4LQ2A 2Y5LA 1FTAA 3FXRA 2VD2A 4G4PA 4OVSA 3KGCA 4BDRA 3DP8A 4O3AA 1B52A 2QVVA 4QSEA 2QSXA 1LAXA 3USDA 3HSTA 3F11A 4TQUQ 2DXRA 3K00A 4FEDA 2ONKE 3CFXA 2I4BA 1MH4A 3EHSA 4ZEFA 5KZTA 1LBXA 1B40A 4IO3A 2DE3A 2V4CA 1R1NA 2H5YA 3MC2A 4LZ8A 5IKBA 1FTMA 1MQIA 2AIXA 5EYFA 3UA8A 4PC9A 3TELA 3V89B 1G0IA 1SW4A 2NUVA 4DZ1A 2D21A 1FTOA 3PPPA 1OVBA 4N17A 1SW2A 5FHOA 4ELQA 3H7MA 4MLVA 2Q8MA 5I84A 2Q74A 2I0BA 4O7IA 1B3LA 4P3LA 2OX3A 1TT1A 1B0HA 1WVJA 4MNPA 2UVIA 3IFAA 3K0VA 3G3HA 4PCDA 1MXXA 1VFDA 3MW0A 4R6YA 5I59A 4F29A 1SPIA 1SI1A 2XXRA 5LOMA 4YU0A 2O69A 3PPRA 4IB2A 1NH8A 1FRPA 2AYSA 5DVJA 4EXLA 1DMBA 3UGWA 4FATA 3KC1A 4GWSA 1FJ9A 2G29A 4N91A 3RTWB 4G68C 4RK2A 3A29A 1I6BA 1FCKA 5I59B 5I2NB 1MS7A 1EYIA 4OETA 1Y9UA 4N4UA 5CMMA 3V83A 3PUYE 4U23A 2DWHA 3HO7A 3BFTA 3E4RA 4XKQA 1GR2A 3EN3A 3H3GA 1NNKA 3TAJA 2WYPA 4XXUA 1MXYA 4DDDA 3MVWA 1N76A 2AL5A 4AS5A 1EZOA 5FHMA 3E78A 3K6UA 4FBPA 1CB6A 1JW5A 4WEPA 3CI8A 3H4ZA 3IB2A 1FPGA 2DVZA 4MNIA 3JZJA 4ISUA 2OWZA 3TYHA 2QPQA 1AL3A 1TFAA 1I6AA 3TODA 4PBHA 3TMGA 1P1OA 2HPGA 2QVUA 3O97A 5FTIA 1M5FA 4TLLB 2I4CA 2XHDA 3G3GA 1USYH 1DTGA 5IAIA 3PPOA 4MF3A 1ANFA 1AIVA 2O1MA 4POXA 3VLUA 4XEQA 2Q89A 3T1BA 1NUYA 1DSNA 4NF4A 2ONRA 4U1ZA 3UP9A 3T9UA 3PD8A 1IQ7A 3ISPA 4R73A 2WBBA 1QJMA 1KA0A 2V84A 2XWKA 3QUFA 2RCAA 5IM2A 1MDP1 2XD2A 4MIJA 1GV8A 4BDNA 1FPDA 2O84X 5ITOA 4NF4B 2VGQA 4NX1A 4RXLA 1MY3A 4MX6A 4ZS9A 2HHMA 2I58A 4DCYA 4QSCA 5ITPA 2REGA 2NVUB 3ZSFA 4OVRA 2Y7WA 3PPNA 4QSDA 3TTMA 5H8QA 3TTNA 1KWHA 1MRPA 1PDAA 1QGXA 3O9PA 1OQGA 3UK4A 3RUMA 1JQFA 2V3TA 1N7WA 5T3JA 4DI3D 1YTVA 5EQ9A 1MPDA 3QMFA 1NV1A 1B46A 1LB9A 1Y4TA 3U93A 2QS3A 3IOUA 4C0RA 5IZ3A 4FEBA 2H99A 3HV1A 5ESYA 4OYVA 4WKMA 3D4CA 4YKKA 1JEUA 4OZ9A 2ALUA 4G61A 3PMWA 4NG7A 3HCQA 5AA1A 4PFRA 5I58A 2F97A 3IO6A 4KCDA 1BKAA 5TU0A 1M5BA 3T96B 2UVHA 4LA9A 4ECFA 2ZMBA 5IZ3B 4X04A 4GQOA 2A5SA 1RYXA 1QW0A 1MQDA 1OIBA 3KJTA 2F35A 3EHUA 2G93A 2DE4A 3O6GA 3MVZA 2X7PA 1VFEA 1S9TA 4C1UA 5I58B 3DP4A 5KCJA 2IA4A 4ELRA 4JXIA 3H6TA 1NUZA 1FTLA 2ZYOA 1YPNA 3IO4A 4HE2A 2PT1A 5I57A 2ZYMA 1OQHA 4NF0A 4KYEA 3QXMA 1A55A 4HW8A 3H6WA 3H6VA 4PGNA 1D3KA 2OBGA 1POY1 5CMCA 4LUBA 5EYHA 3TCHA 3PD9A 5KCJB 1R6ZA 2I6EA 4GF8A 3CHGA 5I57B 1GGGA 4N6KA 5J1DA 4DI4B 1B5IA 1JW1A 1B5HA 4BDMA 1LLSA 4AB5A 2F3BA 1FPFA 2XXKA 1FTJA 3FJMA 3DP6A 3OMBA 5CBSA 2RF1A 3CSBA 1MDQA 2UVJA 4GWWA 3GBBA 2V93A 4RK9A 1Y3PA 5EQ8A 1D9YA 3L6HA 4QBAA 4PQJA 1Y1MA 1KA1A 2Q8JA 4GXAA 4XFEA 2F7AA 1A7LA 3U1OA 1P99A 1NV2A 4QHQA 3IOVA 3N6UA 4GX6A 4EF1A 3EF7A 3I6VA 2CZKA 4ELPA 3OO7A 3MPLA 1Z7NE 5IZZA 3E9XA 3IR1A 3FXBA 1B6HA 4MH5A 1K9YA 2PFYA 5CMKA 2XXUA 3U92A 3E13X 1CE2A 2Y7RA 4I1DA 3BIHA 5AA4A 4P0GA 3U8QA 1IXGA 4R2FA 1PC3A 1QKBA 2ABHA 1MQHA 3TDJA 4R74A 4N8YA 3OSQA 4NMYA 1ATGA 1A8FA 4Q0CA 2RC8A 1NH7A 2OJTA 3ILTB 4PGPA 4U22A 4OANA 2FBPA 5EHMA 5L9SA 1MQGA 1DTZA 2HAUA 2XX7A 2Y7IA 2GRVA 1PB7A 3PUZE 3TKDA 2E1SA 4N13A 3T9VA 4PP0A 1Y4CA 4KYDA 3QIMA 4N81A 5AA4B 2X7QA 2O7UA 3QK6A 1DK4A 3BBRA 1N3XA 1O7TA 1N0TA 1UTBA 4LN5A 3BIGA 2DDKA 2QFLA 4ESXA 4R9FA 1INPA 1ZIUA 2FVZA 1NNPA 5EQ7A 3ECRA 4O94A 2Q9TA 1IMFA 2QVRA 4MJOA 3FATA 1MM6A 3TQWA 3RGYA 1UIUA 4G2ZA 4OFJA 5L9MA 5CMBA 3G3IA 1FPLA 5EQAA 3QSLA 4H1XA 2VHAA 3C31A 2WEFA 4H46A 4NF5A 1Z7ME 1ZKBA 4DCXA 1UIVA 5L9OA 4PFBA 1NV7A 3Q26A 1UTBB 4FAJA 1ZLQA 1Y3QA 4YAHX 4IGRA 4P8BA 1R9LA 4PFTA 3V8XB 2A5TA 2HEUA 1MG1A 1YAEA 1SQYA 3M3KA 3MP6A 1N3WA 5I56A 1IMCA 2E0SA 1ZMGA 2O68A 4KYSA 4F18A 2ZNUA 5M2VA 2QS4A 4GX3A 5AA3A 5ICTA 4NF5B 2HZLA 4FECA 5IGAA 2I49A 4MBPA 3ROJA 1POTA 2QS1A 3GXAA 3PPQA 2PX1A 3SETA 2A5TB 4PF8A 3C34A 4F19A 4GBWA 1Q35A 2XXXA 3L6GA 1D9QA 1FPJA 2PYYA 4DLDA 5I56B 1PEBA 4OFLA 3TCFA 3FJ7A 4ZEDA 3C32A 2B65A 3W9VA 3MP1A 1YXIA 4GVOA 3V5AA 1DBZA 1R9QA 3ODBA 3UN6A 3HHFA 4IY6A 4BDOA 4H67A 4ZECA 3C4MA 1EZPA 3KG2A 3N94A 3W15C 1MPCA 4EDPA 3K02A 1US4A 5CM6A 2XA5A 4GRKA 4YZZA 5ET7A 4XKRA 2P2AA 1RDZA 1XT8A 2VT5A 5ET6A 4O3CA 2XWOA 4IO6A 3SKPA 2ESNA 1UQWA 3T22A 3MQ9A 5KDTA 4PFWA 3MVYA 2XXVA 4F3GA 2XXPA 1FBGA 1JETA 1WDNA 2REJA 4NHBA 2FYIA 1B5JA 3HHGA 3N26A 1EU8A 4F2OA 3IORA 4ZE9A 2F36A 2UXAA 3RLFE 4GL0A 3G3KA 3KN3A 4K3FA 5KDTB 1L5TA 2QS2A 2PMSA 4MNCA 4YICA 3GYYA 2H98A 4PDHA 3R26A 3FVGA 2OLBA 2UYFA 3KSJA 3GBAA 3UORA 1EYJA 1FQAA 5F24A 4F3SA 1USYE 3B50A 5LDZA 4OEUA 2HAVA 3TEPA 2YPNA 2DXYA 4BLAA 4F2QA 3IJOB 1K9ZA 1NUWA 1IXHA 4GFRA 4LZ7A 2FIXA 4QRZA 2X26A 3IJXB 4P0IA 3TPAA 4AB6A 1HSJA 1NKXA 4F3PA 3KBZA 2ZNSA 1P1UA 4KFQA 2ZYKA 1B7ZA 4FORA 1MY2A 4OERA 4XKNA 3C9HA 1B3HA 1LAFE 5K2YA 4I9DA 3FXUA 4OQOA 1SVXB 2HXWA 1MXZA 3PV0E 3OENA 3IOWA 3E3KA 3G3JA 2BJIA 1FPKA 1FQEA 2P3VA 4EF2A 2GQ1A 3MZ9A 1SW5A 1XHYA 1G0HA 3H03A 2WBDA 5BUUA 4ESWA 1OLAA 2Y7KA 2F8DA 3WAEA 3K4UA 3LSFB 2O51A 3SDFA 4R9GA 1P1QA 4N6DA 3PMXA 1FQBA 4F3BA 1JVXA 3A09A 1VE4A 3KN8A 1FBHA 4RPOA 3D1RA 3A3UA 1DPEA 4TLMB 3SEVA 1QUKA 4U2RA 4G8NA 1SD3A 2F6GA 2XXHA 3I5OA 3QUJA 4X1BA 1FBCA 2DE2A 4N6PA 4NQ8A 2HFBA 4ZEKA 4GWOA 4RNSA 1B58A 4OVTA 4DE8A 3OEMA 1Y1ZA 1QUIA 3M3FA 3S9MC 4TOZA 1B1HA 4ZZAA 4ZEIA 3S2VA 1OVTA 3VLVA 2PBWA 2QJEA 4L17A 1DPPA 4QF9A 3EPEA 5H8QB 4OTEA 1URGA 1JW4A 1US5A 4X9TA 4HCWA 1IMEA 3SEWA 1ZTYA 1OMPA 4QFNA 2Y7PA 2O6AA 1VDWA 1ZU0A 1TWYA 3CG1A 2Z8EA 4YB7A 5DT6A 1IITA 3FBPA 4YKJA 5A5LA 1IXCA 4YMBA 2KQZA 3VXBA 1H3DA 3FXQA 1II5A 1XC1A 3LSLA 4OMBA 2XXIA 2L5VA 3MAMA 4KR5A 1NMUA 4R6HA 2Z8FA 4PAKA 1NV3A 4KHZE 5ICQA 5I2KA 4OWDA 4RJZA 3O28A 3R7XA 3MPKA 2H4IA 4PAIA 3K6VA 4JWYA 4I40A 1LBVA 1NL5A 4C1TA 2QMXA 5IZ1A 2ONSA 1B05A 3RNNA 1VR5A 1MPBA 5HPQA 4QFKA 3VFJA 1B51A 4G77A 5JEIA 3EKIA 3B8BA 2WX9A 4JWXA 1XI6A 5I2KB 3T0JA 1A99A 4MAGA 3LC8A 1LBZA 1N84A 4U4SA 4JVIA 2CEXA 3HFUA 2OCUA 3OOAA 4N8GA 5DVFA 1XOCA 3CG3A 5CC2A 4P9KA 4PE3A 3OD7A 3QYTA 5DEXA 5TP9A 3UIFA 3O66A 5HBCA 3MVXA 3N5LA 1GTKA 1TXFA 2F7CA 5CBRA 1QULA 4XF5A 4HXVA 1YZ0A 2CZIA 3MZ1A 4I62A 4UABA 3O2AA 1TFDA 4HE1A 2HXRA 2NWJA 2RINA 2YLNA 4ZEBA 1LFIA 3OO8A 1Q1KA 3Q29A 5DEXB 5TP9B 3TTKA 4Q30B 4I3EA 3FJGA 3IL1B 4POWA 3TZAA 4NF6A 4XKPA 1MH3A 5H8SA 1LEVA 1URDA 5AA2A 4EQ7A 2RCBA 2O1LA 1FBPA 3H6UA 3LR1A 4QFLA 4R75A 3KBRA 4X48A 2CEYA 4Z7EA 1IMBA 4PBQA 3O29A 1D9VA 3MP8A 1URSA 4JBZA 1PB9A 3LUYA 2OK2A 4NF6B 2OPEA 5AE4A 2PVUA 1B3GA 3G3FA 4PDDA 1A54A 4GWUA 5AA2B 3IB1A 1P1WA 2P3NA 4THIA 3VVEA 1FPBA 4EUOA 3IOTA 4GL8A 4OVQA 4Q8RA 3ONMA 2Y84A 3FD3A 4NGUA 2ZZWA 4PTKA 4GWXA 1P1NA 2UYEA 2DQVA 5AA2D 4H65A 4F1VA 4QXDA 3O6IA 2ZYNA 4O3BA 1LBBA 4LP2B 1LBYA 2Z23A 3FZVA 2DS9A 1JP4A 1D4NA 3VVDA 1B9JA 3WAFA 3VDFA 2PCRA 4MCOA 4NF8A 3FIRA 1I6QA 2JJKA 4FE8A 2GHAA 3E79A 3VLWA 2R9JA 2QRYA 1ZJLA 2CZHA 3Q28A 3RY3A 3U72A 1LAHE 4IO5A 1GVCA 2FIEA 1H76A 5DW8A 3TTLA 5BWJA 4GWZA 3IB0A 3FV2A 2KR0A 1YCJA 4NF8B 2IEEA 1BK4A 1FBDA 1SYIA 4PFYA 1QKAA 5ISUA 4HCYA 3SESA 1IEJA 2XXTA 2P0SA 1SI0A 4JB7A 1O63A 3PMVA 1FBFA 4E0WA 3OXNA 2OPDA 3T93B 2V25A 3A3CA 1IMAA 3RPWA 2CMOA 3BFUA 2HQ0A 3MSTA 3T9XB 4ZDMA 1Y20A 2RC9A 3KOSA 2R8TA 1FJ6A 1H43A 4KI0E 3S4UA 4M4GA 1ZBMA 4YB5A 4RYAA 1LSTA 1J1NA 4GOTA 3D4GA 5F7VA 1AH5A 2H25A 3TTRA 5B7DA 3KEIA 4OEVA 1B32A 3S9NC 3U94A 4GXSB 4NE4A 3NOHA 2ZNTA 3MJNA 1O64A 3I3VA 3U65A 2CZLA 4JVCA 2W7YA 4DXUA 2F5XA 3QAXA 1VSOA 4LONB 1OLCA 4GX4A 3LSWA 2FNCA 3C35A 3FUZA 4GLIA 1M5DA 2OZZA 1I69A 2WYKA 4GBVA 3CFZA 4YMAA 5I2NA 5I5PA 1B3EA 4MEVA 4WEDA 4FIMA 4U21A 2F34A 3ZKLA 4OVJA 4OESA 2GH9A 1MY1A 4G8MA 1M5EA 1IUDA 4NWCA 4BDQA 3OO6A 4F31B 2I3WA 3VE1B 1B4ZA 1T0KA 2R71A 3TCGA 4H0WA 1NV0A 2XD3A 2GHBA 1LBWA 4JDFA 2NOOA 2GFEA 1NI9A 4NWDA 3K2DA 4H6DA 2OWSA 4OXVA 4R6KA 4U4XA 4UA8A 3OELA 4PFIA 4HE0A 1A8EA 1BLFA 1LBCA 3B6TA 1FSAA 4AQ4A 3GZGA 3BKIB 3PUXE 1NV6A 3KJ7A 1Y3NA 2AL4A 1NV5A 2Y5KA 3AXFA 3THIA 3EHTA 4JVDA 3P7IA 1XVXA 1MXUA 1S7YA 3PU5A 2ANJA 4YKIA 4JSDA 2PT2A 5ET8A 3K6WA 4ONYA 4MFIA 3SERA 4DXCA 4OA4A 1LFHA 4KCCA 2DWAA 1NNFA 1B3FA 2HCAA 4E0XA 5CRYA 1XVYA 3W9WA 4I8CA 4P47A 5TPAA 1HSEA 3PUWE 1B7HA 4NAPA 1MXVA 4P1EA 4MLQA 4M1VA 1UTHA 4JSOA 3RN8A 1MY0A 1PBPA 1SYHA 2DOJA 3CSGA 2F6PA 4DIGA 5EYGA 4AS4A 3GLBA 1NUXA 4O8MA 2XWIA 4IGTA 4NN3A 2XWVA 5K2XA 4HS7A 5FTHA 3IAZA 4PAFA 2DSFA 1QVSA 3PGFA 4KD5A 3IFCA 3FV1A 5FHNA 5TPAB 3PTYA 3DLNA 4LATA 3M8UA 2B3BA 5F1QA 3Q25A 2QL3A 4EXKA 1UTHB 1IZ1A 3LSXA 1FTKA 1N7XA 3VV5A 4H45A 1FPIA 3C33A 2D3IA 2PFZA 2ZZXA 3OEKA 3OO9A 3FVKA 5B70A 2MKZA 4H8IA 5L8DA 2Z8DA 2I48A 4ELOA 4NEDA 3VVFA 3RT8A 4JWOA 1WODA 2NXOA 4QFOA 4H8JA 3RYDA 3KOTA 3C36A 3EQ1A 4OFOA 5DTBA 2B4MA 3N6TA 3RPLA 1RKMA 4P56A 4LZ5A 2P1SA 3CFLA 4R2BA 1JEVA 1JVYA 4F1UA 2I0CA 4ZZEA 2O7IA 1RYOA 4P11A 1RDYA 1BIYA 1CNQA 4OVPA 3RTFB 3K1NA 3S9EA 3KZGA 1LB8A 3G7WA 3DM0A 2XXWA 4RY1A 4MMPA 1EZ9A 4NTLA 4P1LA 3RPLB 2OWTA 4WXJA 3T66A 5J16A 1IXIA 2DWJA 3VXCA 2BJJX 3MZBA 4ZE8A 5JTYA 4LVQA 3HPIA 1YYZA 3MWBA 5I7IA 2QMWA 1FPEA 1LFGA 4X1DA 2FHYA 4XTCQ 1KZ8A 2XXYA 4GWYA 3JYRA 3HN0A 1PB8A 1NV4A 2DVCA 4HTGA 3KN7A 4KPTA 4KQPA 5ELVA 3B6WA 1BTJA 4N15A 1HSLA 3SEUA 4QFPA 1B1XA 3TFLA 5JTYB 4UACA 3S9LC 2Q2CA 3FVNA 2VPNA 4PFUA 1FBEA 2KLFA 4YB6A 3MYUA 3SEYA 4F39A 3T9HB 4IY5A 4Z0IA 2RKMA 2LAOA 3IK6B 2B3FA 1LCTA 2V3QA 3K1PA 4U1OA 5LTCA 3KSXA 2THIA 2Z22A 4IR8A 1AOVA 1NFTA 3K01A 1JNFA 2B4LA 4FJPA 4RA1A 1N04A 5H8FA 1M5CA 3KFMA 4GD5A 5DYHA 3CVGA 1XS5A 2Q88A 2R6GE 4X8RA 4O7MA 4R72A 3MBPA 1FQCA 1QUJA 4G8HA 2D5WA 4H5GA 3CRBA 2XXQA 5EHSA 1SBPA 4YKPA 4BDLA 5FBPA 1DOTA 1B7UA 2V3UA 3MUQA 1PBQA 5H8FB 5A5XA 3FVOA 2XX8A 2RC7A 4IO4A 4OENA 4OHNA 4EQBA 3OSRA 4IO7A 3KC0A 3B6QA 2DP8A 4PE5B 3RQTA 1NNTA 1B0LA 3LUZA 2F3DA 1AMFA 1F9BA 3O6HA 2M8CA 3FASA 4H5FA 1Q9DA 2F78A 2VD3A 4EQ9A 1A40A 1MY4A 4XIGQ 4I3YA 5A5XB 2H9BA 2VPOA 5CI5A 4PETA 3B7DA 4LQ5A 4F1YA 2I3VA 4G68A 1FW0A 4ND9A 3K6XA 1IIWA 1MQJA 1FQFA 3CIJA 3LBSA 5H8HA 5H8NA 1ELJA 1SW1A 3R6UA 5I3SA 2DWIA 3ILUB 3SEXA 4Q5TA 3TQLA 5HM4B 3Q27A 1AWBA 4RPNA 3FGSA 2HZKA 1B2HA 3IX1A 4F22A 4KXPA 1EH3A 3SZPA 5ET5A 2DYXA 4G68B 1DCUA 2UVGA 1BP5A 4GIZA 3ZS6A 4DXBA 3JV9A 1LAGE 2ZZVA 1MXWA 1B4HA 5H8HB 5H8NB 1S50A 1EYKA 1LCFA 4MHFA 1SDXA 3PUVE 2YJPA 2F7BA 1MM7A 2VOZA 2XX9A 1FQDA 4N07A 5JK4A 2WKYA 3TUSA 3ZKKA 3DELB 4IO2A 3LV0A 1IMDA 2ZXTA 3K1MA 2FA7A 4PF6A 1H44A 3M3LA 2VP1A 1LGBC 5DVIA 1RDXA
chains in the Genus database with same CATH topology
1NI9A 2F3BA 1FPFA 2XXKA 4PFIA 2Y5LA 1FTAA 4HE0A 4OVSA 4X9TA 1FSAA 4GWWA 4HCWA 2QVVA 1IMEA 1NV6A 5EQ8A 1VDWA 1NV5A 2Y5KA 3FBPA 4JVDA 4QBAA 5A5LA 1KA1A 2KQZA 1LBXA 4XFEA 1NV2A 2DE3A 2V4CA 5ET8A 2L5VA 4GX6A 4OA4A 4PAKA 4PC9A 1NV3A 3W9WA 1G0IA 2CZKA 4P47A 5IZZA 4NAPA 3FXBA 4P1EA 1K9YA 4N17A 2PFYA 4M1VA 4PAIA 2Q8MA 2Q74A 4I40A 1LBVA 4O7IA 4P3LA 2OX3A 3BIHA 5IZ1A 5EYGA 4AS4A 4MNPA 1NUXA 3IFAA 4O8MA 2XWIA 4PCDA 4NN3A 2XWVA 4PAFA 4N8YA 3EKIA 3IFCA 3B8BA 1SPIA 4PGPA 2WX9A 3PTYA 1XI6A 4OANA 2FBPA 3T0JA 4MAGA 1LBZA 4JVIA 1FRPA 2CEXA 3HFUA 4N8GA 3KC1A 4GWSA 1FJ9A 4N91A 4N81A 4P9KA 4H45A 4PE3A 1DK4A 1FPIA 3A29A 4LN5A 3BIGA 2PFZA 2DDKA 2QFLA 2ZZXA 1INPA 2FVZA 5EQ7A 1EYIA 4O94A 4N4UA 2Q9TA 1IMFA 2QVRA 4XF5A 4HXVA 1YZ0A 4MJOA 2CZIA 2MKZA 4UABA 4HE1A 2HXRA 1FPLA 5EQAA 2WEFA 4H46A 3RYDA 4PFBA 1NV7A 2WYPA 4I3EA 2B4MA 3RPLA 4AS5A 4P56A 4P8BA 3E78A 4FBPA 4F1UA 1LEVA 1IMCA 1RDYA 1FBPA 1FPGA 2DVZA 4MNIA 1CNQA 4OVPA 4F18A 2OWZA 4GX3A 2QPQA 2CEYA 4PBHA 2HZLA 1IMBA 4MMPA 4PBQA 2HPGA 2QVUA 5IGAA 4P1LA 3RPLB 3ROJA 5J16A 4PF8A 4F19A 4GBWA 4PDDA 1D9QA 1FPJA 1YYZA 4GWUA 5I7IA 2P3NA 1FPEA 4XEQA 3T1BA 1NUYA 1FPBA 2FHYA 3W9VA 1KZ8A 1YXIA 4OVQA 4GWYA 1DBZA 1NV4A 4NGUA 3ISPA 2WBBA 1KA0A 4N15A 2ZZWA 4PTKA 4GWXA 2XWKA 5IM2A 5CM6A 2XA5A 2VPNA 4MIJA 4YZZA 5ET7A 4F1VA 1FBEA 4QXDA 1FPDA 3MYUA 1RDZA 2VT5A 5ET6A 2XWOA 1LBYA 4NX1A 1JP4A 2V3QA 4MX6A 2HHMA 5LTCA 2PCRA 4MCOA 4IR8A 1FBGA 2JJKA 4OVRA 3E79A 4NHBA 2B4LA 2CZHA 1QGXA 2FIEA 4X8RA 4O7MA 5DW8A 5T3JA 4MNCA 4YICA 3GYYA 4GWZA 4PDHA 2KR0A 4DI3D 5EQ9A 1BK4A 1FBDA 3QMFA 1NV1A 5FBPA 4HCYA 1EYJA 5F24A 3B50A 5LDZA 1FBFA 5IZ3A 3KC0A 1IMAA 1K9ZA 1NUWA 5ESYA 3MSTA 3LUZA 2F3DA 2FIXA 4G61A 4NG7A 2R8TA 1FJ6A 1Q9DA 3KBZA 4PFRA 4I3YA 2VPOA 5IZ3B 4PETA 4X04A 3NOHA 2DE4A 5I3SA 3U65A 4JVCA 2BJIA 1FPKA 2P3VA 2F5XA 1AWBA 2GQ1A 1NUZA 2HZKA 1G0HA 2WBDA 4GX4A 4HE2A 4KXPA 4NF0A 3SZPA 5ET5A 2WYKA 1DCUA 4N6DA 4PGNA 4GBVA 5I5PA 2ZZVA 4MEVA 1FBHA 1EYKA 3D1RA 5EYHA 4MHFA 5JK4A 3CHGA 4N6KA 1FBCA 2DE2A 4NQ8A 3LV0A 1IMDA 5J1DA 4DI4B 4PF6A 4OVTA 1NV0A 1LBWA 1RDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3N A;  1FPE A;  3LUZ A;  1FRP A;  1NI9 A;  2F3D A;  2F3B A;  1NUY A;  1FPF A;  1FPB A;  2FHY A;  2FIX A;  1KZ8 A;  1YXI A;  3KC1 A;  4G61 A;  4GWS A;  1DBZ A;  1FJ9 A;  4GWY A;  4N81 A;  1NV4 A;  2Y5L A;  2R8T A;  1FTA A;  1FJ6 A;  1Q9D A;  4H45 A;  4HE0 A;  3KBZ A;  1DK4 A;  1FPI A;  2WBB A;  3A29 A;  1FSA A;  4GWW A;  1KA0 A;  3BIG A;  2QVV A;  4I3Y A;  4PTK A;  1IME A;  2DDK A;  4GWX A;  2QFL A;  1INP A;  2FVZ A;  5EQ7 A;  5IZ3 B;  1NV6 A;  1EYI A;  5EQ8 A;  1VDW A;  1IMF A;  2QVR A;  4HXV A;  1YZ0 A;  4MJO A;  2CZI A;  5ET7 A;  1NV5 A;  1FBE A;  4QXD A;  2Y5K A;  1FPD A;  1RDZ A;  2VT5 A;  5ET6 A;  3FBP A;  4HE1 A;  1LBY A;  5A5L A;  5I3S A;  1KA1 A;  1FPL A;  5EQA A;  1JP4 A;  1LBX A;  2HHM A;  2BJI A;  1FPK A;  2WEF A;  4H46 A;  2P3V A;  3RYD A;  1AWB A;  2GQ1 A;  1NV7 A;  1NV2 A;  2PCR A;  1NUZ A;  1G0H A;  4I3E A;  4IR8 A;  5ET8 A;  1FBG A;  2JJK A;  2WBD A;  4GX4 A;  3RPL A;  4GX6 A;  4HE2 A;  4KXP A;  4AS5 A;  4FBP A;  5ET5 A;  1NV3 A;  2CZH A;  1DCU A;  1G0I A;  1LEV A;  2CZK A;  4GBV A;  1IMC A;  1QGX A;  1RDY A;  1FBP A;  1FPG A;  1CNQ A;  1K9Y A;  2FIE A;  2OWZ A;  1FBH A;  1EYK A;  5DW8 A;  3D1R A;  5EYH A;  4GX3 A;  2Q8M A;  2Q74 A;  5T3J A;  4I40 A;  1LBV A;  4O7I A;  4GWZ A;  2OX3 A;  1IMB A;  5EQ9 A;  1BK4 A;  3BIH A;  5IZ1 A;  1FBD A;  3QMF A;  5EYG A;  4AS4 A;  1NV1 A;  2QVU A;  1NUX A;  3IFA A;  3RPL B;  3ROJ A;  5FBP A;  1EYJ A;  5F24 A;  5J16 A;  5LDZ A;  1FBC A;  1FBF A;  1IMD A;  3LV0 A;  5IZ3 A;  3IFC A;  3B8B A;  1SPI A;  4GBW A;  1D9Q A;  1FPJ A;  1XI6 A;  3KC0 A;  1YYZ A;  2FBP A;  4GWU A;  1IMA A;  1K9Z A;  1NV0 A;  3T0J A;  1NUW A;  5ESY A;  1LBW A;  1RDX A;  1LBZ A; 
#chains in the Genus database with same CATH topology
 3H06 B;  3RT6 B;  1H45 A;  3CR9 A;  2Q2A A;  4LQ2 A;  2Y5L A;  1FTA A;  3FXR A;  2VD2 A;  4G4P A;  4OVS A;  3KGC A;  4BDR A;  3DP8 A;  4O3A A;  1B52 A;  2QVV A;  4QSE A;  2QSX A;  1LAX A;  3USD A;  3HST A;  3F11 A;  4TQU Q;  2DXR A;  3K00 A;  4FED A;  2ONK E;  3CFX A;  2I4B A;  1MH4 A;  3EHS A;  4ZEF A;  5KZT A;  1LBX A;  1B40 A;  4IO3 A;  2DE3 A;  2V4C A;  1R1N A;  2H5Y A;  3MC2 A;  4LZ8 A;  5IKB A;  1FTM A;  1MQI A;  2AIX A;  5EYF A;  3UA8 A;  4PC9 A;  3TEL A;  3V89 B;  1G0I A;  1SW4 A;  2NUV A;  4DZ1 A;  2D21 A;  1FTO A;  3PPP A;  1OVB A;  4N17 A;  1SW2 A;  5FHO A;  4ELQ A;  3H7M A;  4MLV A;  2Q8M A;  5I84 A;  2Q74 A;  2I0B A;  4O7I A;  1B3L A;  4P3L A;  2OX3 A;  1TT1 A;  1B0H A;  1WVJ A;  4MNP A;  2UVI A;  3IFA A;  3K0V A;  3G3H A;  4PCD A;  1MXX A;  1VFD A;  3MW0 A;  4R6Y A;  5I59 A;  4F29 A;  1SPI A;  1SI1 A;  2XXR A;  5LOM A;  4YU0 A;  2O69 A;  3PPR A;  4IB2 A;  1NH8 A;  1FRP A;  2AYS A;  5DVJ A;  4EXL A;  1DMB A;  3UGW A;  4FAT A;  3KC1 A;  4GWS A;  1FJ9 A;  2G29 A;  4N91 A;  3RTW B;  4G68 C;  4RK2 A;  3A29 A;  1I6B A;  1FCK A;  5I59 B;  5I2N B;  1MS7 A;  1EYI A;  4OET A;  1Y9U A;  4N4U A;  5CMM A;  3V83 A;  3PUY E;  4U23 A;  2DWH A;  3HO7 A;  3BFT A;  3E4R A;  4XKQ A;  1GR2 A;  3EN3 A;  3H3G A;  1NNK A;  3TAJ A;  2WYP A;  4XXU A;  1MXY A;  4DDD A;  3MVW A;  1N76 A;  2AL5 A;  4AS5 A;  1EZO A;  5FHM A;  3E78 A;  3K6U A;  4FBP A;  1CB6 A;  1JW5 A;  4WEP A;  3CI8 A;  3H4Z A;  3IB2 A;  1FPG A;  2DVZ A;  4MNI A;  3JZJ A;  4ISU A;  2OWZ A;  3TYH A;  2QPQ A;  1AL3 A;  1TFA A;  1I6A A;  3TOD A;  4PBH A;  3TMG A;  1P1O A;  2HPG A;  2QVU A;  3O97 A;  5FTI A;  1M5F A;  4TLL B;  2I4C A;  2XHD A;  3G3G A;  1USY H;  1DTG A;  5IAI A;  3PPO A;  4MF3 A;  1ANF A;  1AIV A;  2O1M A;  4POX A;  3VLU A;  4XEQ A;  2Q89 A;  3T1B A;  1NUY A;  1DSN A;  4NF4 A;  2ONR A;  4U1Z A;  3UP9 A;  3T9U A;  3PD8 A;  1IQ7 A;  3ISP A;  4R73 A;  2WBB A;  1QJM A;  1KA0 A;  2V84 A;  2XWK A;  3QUF A;  2RCA A;  5IM2 A;  1MDP 1;  2XD2 A;  4MIJ A;  1GV8 A;  4BDN A;  1FPD A;  2O84 X;  5ITO A;  4NF4 B;  2VGQ A;  4NX1 A;  4RXL A;  1MY3 A;  4MX6 A;  4ZS9 A;  2HHM A;  2I58 A;  4DCY A;  4QSC A;  5ITP A;  2REG A;  2NVU B;  3ZSF A;  4OVR A;  2Y7W A;  3PPN A;  4QSD A;  3TTM A;  5H8Q A;  3TTN A;  1KWH A;  1MRP A;  1PDA A;  1QGX A;  3O9P A;  1OQG A;  3UK4 A;  3RUM A;  1JQF A;  2V3T A;  1N7W A;  5T3J A;  4DI3 D;  1YTV A;  5EQ9 A;  1MPD A;  3QMF A;  1NV1 A;  1B46 A;  1LB9 A;  1Y4T A;  3U93 A;  2QS3 A;  3IOU A;  4C0R A;  5IZ3 A;  4FEB A;  2H99 A;  3HV1 A;  5ESY A;  4OYV A;  4WKM A;  3D4C A;  4YKK A;  1JEU A;  4OZ9 A;  2ALU A;  4G61 A;  3PMW A;  4NG7 A;  3HCQ A;  5AA1 A;  4PFR A;  5I58 A;  2F97 A;  3IO6 A;  4KCD A;  1BKA A;  5TU0 A;  1M5B A;  3T96 B;  2UVH A;  4LA9 A;  4ECF A;  2ZMB A;  5IZ3 B;  4X04 A;  4GQO A;  2A5S A;  1RYX A;  1QW0 A;  1MQD A;  1OIB A;  3KJT A;  2F35 A;  3EHU A;  2G93 A;  2DE4 A;  3O6G A;  3MVZ A;  2X7P A;  1VFE A;  1S9T A;  4C1U A;  5I58 B;  3DP4 A;  5KCJ A;  2IA4 A;  4ELR A;  4JXI A;  3H6T A;  1NUZ A;  1FTL A;  2ZYO A;  1YPN A;  3IO4 A;  4HE2 A;  2PT1 A;  5I57 A;  2ZYM A;  1OQH A;  4NF0 A;  4KYE A;  3QXM A;  1A55 A;  4HW8 A;  3H6W A;  3H6V A;  4PGN A;  1D3K A;  2OBG A;  1POY 1;  5CMC A;  4LUB A;  5EYH A;  3TCH A;  3PD9 A;  5KCJ B;  1R6Z A;  2I6E A;  4GF8 A;  3CHG A;  5I57 B;  1GGG A;  4N6K A;  5J1D A;  4DI4 B;  1B5I A;  1JW1 A;  1B5H A;  4BDM A;  1LLS A;  4AB5 A;  2F3B A;  1FPF A;  2XXK A;  1FTJ A;  3FJM A;  3DP6 A;  3OMB A;  5CBS A;  2RF1 A;  3CSB A;  1MDQ A;  2UVJ A;  4GWW A;  3GBB A;  2V93 A;  4RK9 A;  1Y3P A;  5EQ8 A;  1D9Y A;  3L6H A;  4QBA A;  4PQJ A;  1Y1M A;  1KA1 A;  2Q8J A;  4GXA A;  4XFE A;  2F7A A;  1A7L A;  3U1O A;  1P99 A;  1NV2 A;  4QHQ A;  3IOV A;  3N6U A;  4GX6 A;  4EF1 A;  3EF7 A;  3I6V A;  2CZK A;  4ELP A;  3OO7 A;  3MPL A;  1Z7N E;  5IZZ A;  3E9X A;  3IR1 A;  3FXB A;  1B6H A;  4MH5 A;  1K9Y A;  2PFY A;  5CMK A;  2XXU A;  3U92 A;  3E13 X;  1CE2 A;  2Y7R A;  4I1D A;  3BIH A;  5AA4 A;  4P0G A;  3U8Q A;  1IXG A;  4R2F A;  1PC3 A;  1QKB A;  2ABH A;  1MQH A;  3TDJ A;  4R74 A;  4N8Y A;  3OSQ A;  4NMY A;  1ATG A;  1A8F A;  4Q0C A;  2RC8 A;  1NH7 A;  2OJT A;  3ILT B;  4PGP A;  4U22 A;  4OAN A;  2FBP A;  5EHM A;  5L9S A;  1MQG A;  1DTZ A;  2HAU A;  2XX7 A;  2Y7I A;  2GRV A;  1PB7 A;  3PUZ E;  3TKD A;  2E1S A;  4N13 A;  3T9V A;  4PP0 A;  1Y4C A;  4KYD A;  3QIM A;  4N81 A;  5AA4 B;  2X7Q A;  2O7U A;  3QK6 A;  1DK4 A;  3BBR A;  1N3X A;  1O7T A;  1N0T A;  1UTB A;  4LN5 A;  3BIG A;  2DDK A;  2QFL A;  4ESX A;  4R9F A;  1INP A;  1ZIU A;  2FVZ A;  1NNP A;  5EQ7 A;  3ECR A;  4O94 A;  2Q9T A;  1IMF A;  2QVR A;  4MJO A;  3FAT A;  1MM6 A;  3TQW A;  3RGY A;  1UIU A;  4G2Z A;  4OFJ A;  5L9M A;  5CMB A;  3G3I A;  1FPL A;  5EQA A;  3QSL A;  4H1X A;  2VHA A;  3C31 A;  2WEF A;  4H46 A;  4NF5 A;  1Z7M E;  1ZKB A;  4DCX A;  1UIV A;  5L9O A;  4PFB A;  1NV7 A;  3Q26 A;  1UTB B;  4FAJ A;  1ZLQ A;  1Y3Q A;  4YAH X;  4IGR A;  4P8B A;  1R9L A;  4PFT A;  3V8X B;  2A5T A;  2HEU A;  1MG1 A;  1YAE A;  1SQY A;  3M3K A;  3MP6 A;  1N3W A;  5I56 A;  1IMC A;  2E0S A;  1ZMG A;  2O68 A;  4KYS A;  4F18 A;  2ZNU A;  5M2V A;  2QS4 A;  4GX3 A;  5AA3 A;  5ICT A;  4NF5 B;  2HZL A;  4FEC A;  5IGA A;  2I49 A;  4MBP A;  3ROJ A;  1POT A;  2QS1 A;  3GXA A;  3PPQ A;  2PX1 A;  3SET A;  2A5T B;  4PF8 A;  3C34 A;  4F19 A;  4GBW A;  1Q35 A;  2XXX A;  3L6G A;  1D9Q A;  1FPJ A;  2PYY A;  4DLD A;  5I56 B;  1PEB A;  4OFL A;  3TCF A;  3FJ7 A;  4ZED A;  3C32 A;  2B65 A;  3W9V A;  3MP1 A;  1YXI A;  4GVO A;  3V5A A;  1DBZ A;  1R9Q A;  3ODB A;  3UN6 A;  3HHF A;  4IY6 A;  4BDO A;  4H67 A;  4ZEC A;  3C4M A;  1EZP A;  3KG2 A;  3N94 A;  3W15 C;  1MPC A;  4EDP A;  3K02 A;  1US4 A;  5CM6 A;  2XA5 A;  4GRK A;  4YZZ A;  5ET7 A;  4XKR A;  2P2A A;  1RDZ A;  1XT8 A;  2VT5 A;  5ET6 A;  4O3C A;  2XWO A;  4IO6 A;  3SKP A;  2ESN A;  1UQW A;  3T22 A;  3MQ9 A;  5KDT A;  4PFW A;  3MVY A;  2XXV A;  4F3G A;  2XXP A;  1FBG A;  1JET A;  1WDN A;  2REJ A;  4NHB A;  2FYI A;  1B5J A;  3HHG A;  3N26 A;  1EU8 A;  4F2O A;  3IOR A;  4ZE9 A;  2F36 A;  2UXA A;  3RLF E;  4GL0 A;  3G3K A;  3KN3 A;  4K3F A;  5KDT B;  1L5T A;  2QS2 A;  2PMS A;  4MNC A;  4YIC A;  3GYY A;  2H98 A;  4PDH A;  3R26 A;  3FVG A;  2OLB A;  2UYF A;  3KSJ A;  3GBA A;  3UOR A;  1EYJ A;  1FQA A;  5F24 A;  4F3S A;  1USY E;  3B50 A;  5LDZ A;  4OEU A;  2HAV A;  3TEP A;  2YPN A;  2DXY A;  4BLA A;  4F2Q A;  3IJO B;  1K9Z A;  1NUW A;  1IXH A;  4GFR A;  4LZ7 A;  2FIX A;  4QRZ A;  2X26 A;  3IJX B;  4P0I A;  3TPA A;  4AB6 A;  1HSJ A;  1NKX A;  4F3P A;  3KBZ A;  2ZNS A;  1P1U A;  4KFQ A;  2ZYK A;  1B7Z A;  4FOR A;  1MY2 A;  4OER A;  4XKN A;  3C9H A;  1B3H A;  1LAF E;  5K2Y A;  4I9D A;  3FXU A;  4OQO A;  1SVX B;  2HXW A;  1MXZ A;  3PV0 E;  3OEN A;  3IOW A;  3E3K A;  3G3J A;  2BJI A;  1FPK A;  1FQE A;  2P3V A;  4EF2 A;  2GQ1 A;  3MZ9 A;  1SW5 A;  1XHY A;  1G0H A;  3H03 A;  2WBD A;  5BUU A;  4ESW A;  1OLA A;  2Y7K A;  2F8D A;  3WAE A;  3K4U A;  3LSF B;  2O51 A;  3SDF A;  4R9G A;  1P1Q A;  4N6D A;  3PMX A;  1FQB A;  4F3B A;  1JVX A;  3A09 A;  1VE4 A;  3KN8 A;  1FBH A;  4RPO A;  3D1R A;  3A3U A;  1DPE A;  4TLM B;  3SEV A;  1QUK A;  4U2R A;  4G8N A;  1SD3 A;  2F6G A;  2XXH A;  3I5O A;  3QUJ A;  4X1B A;  1FBC A;  2DE2 A;  4N6P A;  4NQ8 A;  2HFB A;  4ZEK A;  4GWO A;  4RNS A;  1B58 A;  4OVT A;  4DE8 A;  3OEM A;  1Y1Z A;  1QUI A;  3M3F A;  3S9M C;  4TOZ A;  1B1H A;  4ZZA A;  4ZEI A;  3S2V A;  1OVT A;  3VLV A;  2PBW A;  2QJE A;  4L17 A;  1DPP A;  4QF9 A;  3EPE A;  5H8Q B;  4OTE A;  1URG A;  1JW4 A;  1US5 A;  4X9T A;  4HCW A;  1IME A;  3SEW A;  1ZTY A;  1OMP A;  4QFN A;  2Y7P A;  2O6A A;  1VDW A;  1ZU0 A;  1TWY A;  3CG1 A;  2Z8E A;  4YB7 A;  5DT6 A;  1IIT A;  3FBP A;  4YKJ A;  5A5L A;  1IXC A;  4YMB A;  2KQZ A;  3VXB A;  1H3D A;  3FXQ A;  1II5 A;  1XC1 A;  3LSL A;  4OMB A;  2XXI A;  2L5V A;  3MAM A;  4KR5 A;  1NMU A;  4R6H A;  2Z8F A;  4PAK A;  1NV3 A;  4KHZ E;  5ICQ A;  5I2K A;  4OWD A;  4RJZ A;  3O28 A;  3R7X A;  3MPK A;  2H4I A;  4PAI A;  3K6V A;  4JWY A;  4I40 A;  1LBV A;  1NL5 A;  4C1T A;  2QMX A;  5IZ1 A;  2ONS A;  1B05 A;  3RNN A;  1VR5 A;  1MPB A;  5HPQ A;  4QFK A;  3VFJ A;  1B51 A;  4G77 A;  5JEI A;  3EKI A;  3B8B A;  2WX9 A;  4JWX A;  1XI6 A;  5I2K B;  3T0J A;  1A99 A;  4MAG A;  3LC8 A;  1LBZ A;  1N84 A;  4U4S A;  4JVI A;  2CEX A;  3HFU A;  2OCU A;  3OOA A;  4N8G A;  5DVF A;  1XOC A;  3CG3 A;  5CC2 A;  4P9K A;  4PE3 A;  3OD7 A;  3QYT A;  5DEX A;  5TP9 A;  3UIF A;  3O66 A;  5HBC A;  3MVX A;  3N5L A;  1GTK A;  1TXF A;  2F7C A;  5CBR A;  1QUL A;  4XF5 A;  4HXV A;  1YZ0 A;  2CZI A;  3MZ1 A;  4I62 A;  4UAB A;  3O2A A;  1TFD A;  4HE1 A;  2HXR A;  2NWJ A;  2RIN A;  2YLN A;  4ZEB A;  1LFI A;  3OO8 A;  1Q1K A;  3Q29 A;  5DEX B;  5TP9 B;  3TTK A;  4Q30 B;  4I3E A;  3FJG A;  3IL1 B;  4POW A;  3TZA A;  4NF6 A;  4XKP A;  1MH3 A;  5H8S A;  1LEV A;  1URD A;  5AA2 A;  4EQ7 A;  2RCB A;  2O1L A;  1FBP A;  3H6U A;  3LR1 A;  4QFL A;  4R75 A;  3KBR A;  4X48 A;  2CEY A;  4Z7E A;  1IMB A;  4PBQ A;  3O29 A;  1D9V A;  3MP8 A;  1URS A;  4JBZ A;  1PB9 A;  3LUY A;  2OK2 A;  4NF6 B;  2OPE A;  5AE4 A;  2PVU A;  1B3G A;  3G3F A;  4PDD A;  1A54 A;  4GWU A;  5AA2 B;  3IB1 A;  1P1W A;  2P3N A;  4THI A;  3VVE A;  1FPB A;  4EUO A;  3IOT A;  4GL8 A;  4OVQ A;  4Q8R A;  3ONM A;  2Y84 A;  3FD3 A;  4NGU A;  2ZZW A;  4PTK A;  4GWX A;  1P1N A;  2UYE A;  2DQV A;  5AA2 D;  4H65 A;  4F1V A;  4QXD A;  3O6I A;  2ZYN A;  4O3B A;  1LBB A;  4LP2 B;  1LBY A;  2Z23 A;  3FZV A;  2DS9 A;  1JP4 A;  1D4N A;  3VVD A;  1B9J A;  3WAF A;  3VDF A;  2PCR A;  4MCO A;  4NF8 A;  3FIR A;  1I6Q A;  2JJK A;  4FE8 A;  2GHA A;  3E79 A;  3VLW A;  2R9J A;  2QRY A;  1ZJL A;  2CZH A;  3Q28 A;  3RY3 A;  3U72 A;  1LAH E;  4IO5 A;  1GVC A;  2FIE A;  1H76 A;  5DW8 A;  3TTL A;  5BWJ A;  4GWZ A;  3IB0 A;  3FV2 A;  2KR0 A;  1YCJ A;  4NF8 B;  2IEE A;  1BK4 A;  1FBD A;  1SYI A;  4PFY A;  1QKA A;  5ISU A;  4HCY A;  3SES A;  1IEJ A;  2XXT A;  2P0S A;  1SI0 A;  4JB7 A;  1O63 A;  3PMV A;  1FBF A;  4E0W A;  3OXN A;  2OPD A;  3T93 B;  2V25 A;  3A3C A;  1IMA A;  3RPW A;  2CMO A;  3BFU A;  2HQ0 A;  3MST A;  3T9X B;  4ZDM A;  1Y20 A;  2RC9 A;  3KOS A;  2R8T A;  1FJ6 A;  1H43 A;  4KI0 E;  3S4U A;  4M4G A;  1ZBM A;  4YB5 A;  4RYA A;  1LST A;  1J1N A;  4GOT A;  3D4G A;  5F7V A;  1AH5 A;  2H25 A;  3TTR A;  5B7D A;  3KEI A;  4OEV A;  1B32 A;  3S9N C;  3U94 A;  4GXS B;  4NE4 A;  3NOH A;  2ZNT A;  3MJN A;  1O64 A;  3I3V A;  3U65 A;  2CZL A;  4JVC A;  2W7Y A;  4DXU A;  2F5X A;  3QAX A;  1VSO A;  4LON B;  1OLC A;  4GX4 A;  3LSW A;  2FNC A;  3C35 A;  3FUZ A;  4GLI A;  1M5D A;  2OZZ A;  1I69 A;  2WYK A;  4GBV A;  3CFZ A;  4YMA A;  5I2N A;  5I5P A;  1B3E A;  4MEV A;  4WED A;  4FIM A;  4U21 A;  2F34 A;  3ZKL A;  4OVJ A;  4OES A;  2GH9 A;  1MY1 A;  4G8M A;  1M5E A;  1IUD A;  4NWC A;  4BDQ A;  3OO6 A;  4F31 B;  2I3W A;  3VE1 B;  1B4Z A;  1T0K A;  2R71 A;  3TCG A;  4H0W A;  1NV0 A;  2XD3 A;  2GHB A;  1LBW A;  4JDF A;  2NOO A;  2GFE A;  1NI9 A;  4NWD A;  3K2D A;  4H6D A;  2OWS A;  4OXV A;  4R6K A;  4U4X A;  4UA8 A;  3OEL A;  4PFI A;  4HE0 A;  1A8E A;  1BLF A;  1LBC A;  3B6T A;  1FSA A;  4AQ4 A;  3GZG A;  3BKI B;  3PUX E;  1NV6 A;  3KJ7 A;  1Y3N A;  2AL4 A;  1NV5 A;  2Y5K A;  3AXF A;  3THI A;  3EHT A;  4JVD A;  3P7I A;  1XVX A;  1MXU A;  1S7Y A;  3PU5 A;  2ANJ A;  4YKI A;  4JSD A;  2PT2 A;  5ET8 A;  3K6W A;  4ONY A;  4MFI A;  3SER A;  4DXC A;  4OA4 A;  1LFH A;  4KCC A;  2DWA A;  1NNF A;  1B3F A;  2HCA A;  4E0X A;  5CRY A;  1XVY A;  3W9W A;  4I8C A;  4P47 A;  5TPA A;  1HSE A;  3PUW E;  1B7H A;  4NAP A;  1MXV A;  4P1E A;  4MLQ A;  4M1V A;  1UTH A;  4JSO A;  3RN8 A;  1MY0 A;  1PBP A;  1SYH A;  2DOJ A;  3CSG A;  2F6P A;  4DIG A;  5EYG A;  4AS4 A;  3GLB A;  1NUX A;  4O8M A;  2XWI A;  4IGT A;  4NN3 A;  2XWV A;  5K2X A;  4HS7 A;  5FTH A;  3IAZ A;  4PAF A;  2DSF A;  1QVS A;  3PGF A;  4KD5 A;  3IFC A;  3FV1 A;  5FHN A;  5TPA B;  3PTY A;  3DLN A;  4LAT A;  3M8U A;  2B3B A;  5F1Q A;  3Q25 A;  2QL3 A;  4EXK A;  1UTH B;  1IZ1 A;  3LSX A;  1FTK A;  1N7X A;  3VV5 A;  4H45 A;  1FPI A;  3C33 A;  2D3I A;  2PFZ A;  2ZZX A;  3OEK A;  3OO9 A;  3FVK A;  5B70 A;  2MKZ A;  4H8I A;  5L8D A;  2Z8D A;  2I48 A;  4ELO A;  4NED A;  3VVF A;  3RT8 A;  4JWO A;  1WOD A;  2NXO A;  4QFO A;  4H8J A;  3RYD A;  3KOT A;  3C36 A;  3EQ1 A;  4OFO A;  5DTB A;  2B4M A;  3N6T A;  3RPL A;  1RKM A;  4P56 A;  4LZ5 A;  2P1S A;  3CFL A;  4R2B A;  1JEV A;  1JVY A;  4F1U A;  2I0C A;  4ZZE A;  2O7I A;  1RYO A;  4P11 A;  1RDY A;  1BIY A;  1CNQ A;  4OVP A;  3RTF B;  3K1N A;  3S9E A;  3KZG A;  1LB8 A;  3G7W A;  3DM0 A;  2XXW A;  4RY1 A;  4MMP A;  1EZ9 A;  4NTL A;  4P1L A;  3RPL B;  2OWT A;  4WXJ A;  3T66 A;  5J16 A;  1IXI A;  2DWJ A;  3VXC A;  2BJJ X;  3MZB A;  4ZE8 A;  5JTY A;  4LVQ A;  3HPI A;  1YYZ A;  3MWB A;  5I7I A;  2QMW A;  1FPE A;  1LFG A;  4X1D A;  2FHY A;  4XTC Q;  1KZ8 A;  2XXY A;  4GWY A;  3JYR A;  3HN0 A;  1PB8 A;  1NV4 A;  2DVC A;  4HTG A;  3KN7 A;  4KPT A;  4KQP A;  5ELV A;  3B6W A;  1BTJ A;  4N15 A;  1HSL A;  3SEU A;  4QFP A;  1B1X A;  3TFL A;  5JTY B;  4UAC A;  3S9L C;  2Q2C A;  3FVN A;  2VPN A;  4PFU A;  1FBE A;  2KLF A;  4YB6 A;  3MYU A;  3SEY A;  4F39 A;  3T9H B;  4IY5 A;  4Z0I A;  2RKM A;  2LAO A;  3IK6 B;  2B3F A;  1LCT A;  2V3Q A;  3K1P A;  4U1O A;  5LTC A;  3KSX A;  2THI A;  2Z22 A;  4IR8 A;  1AOV A;  1NFT A;  3K01 A;  1JNF A;  2B4L A;  4FJP A;  4RA1 A;  1N04 A;  5H8F A;  1M5C A;  3KFM A;  4GD5 A;  5DYH A;  3CVG A;  1XS5 A;  2Q88 A;  2R6G E;  4X8R A;  4O7M A;  4R72 A;  3MBP A;  1FQC A;  1QUJ A;  4G8H A;  2D5W A;  4H5G A;  3CRB A;  2XXQ A;  5EHS A;  1SBP A;  4YKP A;  4BDL A;  5FBP A;  1DOT A;  1B7U A;  2V3U A;  3MUQ A;  1PBQ A;  5H8F B;  5A5X A;  3FVO A;  2XX8 A;  2RC7 A;  4IO4 A;  4OEN A;  4OHN A;  4EQB A;  3OSR A;  4IO7 A;  3KC0 A;  3B6Q A;  2DP8 A;  4PE5 B;  3RQT A;  1NNT A;  1B0L A;  3LUZ A;  2F3D A;  1AMF A;  1F9B A;  3O6H A;  2M8C A;  3FAS A;  4H5F A;  1Q9D A;  2F78 A;  2VD3 A;  4EQ9 A;  1A40 A;  1MY4 A;  4XIG Q;  4I3Y A;  5A5X B;  2H9B A;  2VPO A;  5CI5 A;  4PET A;  3B7D A;  4LQ5 A;  4F1Y A;  2I3V A;  4G68 A;  1FW0 A;  4ND9 A;  3K6X A;  1IIW A;  1MQJ A;  1FQF A;  3CIJ A;  3LBS A;  5H8H A;  5H8N A;  1ELJ A;  1SW1 A;  3R6U A;  5I3S A;  2DWI A;  3ILU B;  3SEX A;  4Q5T A;  3TQL A;  5HM4 B;  3Q27 A;  1AWB A;  4RPN A;  3FGS A;  2HZK A;  1B2H A;  3IX1 A;  4F22 A;  4KXP A;  1EH3 A;  3SZP A;  5ET5 A;  2DYX A;  4G68 B;  1DCU A;  2UVG A;  1BP5 A;  4GIZ A;  3ZS6 A;  4DXB A;  3JV9 A;  1LAG E;  2ZZV A;  1MXW A;  1B4H A;  5H8H B;  5H8N B;  1S50 A;  1EYK A;  1LCF A;  4MHF A;  1SDX A;  3PUV E;  2YJP A;  2F7B A;  1MM7 A;  2VOZ A;  2XX9 A;  1FQD A;  4N07 A;  5JK4 A;  2WKY A;  3TUS A;  3ZKK A;  3DEL B;  4IO2 A;  3LV0 A;  1IMD A;  2ZXT A;  3K1M A;  2FA7 A;  4PF6 A;  1H44 A;  3M3L A;  2VP1 A;  1LGB C;  5DVI A;  1RDX A; 
#chains in the Genus database with same CATH homology
 1NI9 A;  2F3B A;  1FPF A;  2XXK A;  4PFI A;  2Y5L A;  1FTA A;  4HE0 A;  4OVS A;  4X9T A;  1FSA A;  4GWW A;  4HCW A;  2QVV A;  1IME A;  1NV6 A;  5EQ8 A;  1VDW A;  1NV5 A;  2Y5K A;  3FBP A;  4JVD A;  4QBA A;  5A5L A;  1KA1 A;  2KQZ A;  1LBX A;  4XFE A;  1NV2 A;  2DE3 A;  2V4C A;  5ET8 A;  2L5V A;  4GX6 A;  4OA4 A;  4PAK A;  4PC9 A;  1NV3 A;  3W9W A;  1G0I A;  2CZK A;  4P47 A;  5IZZ A;  4NAP A;  3FXB A;  4P1E A;  1K9Y A;  4N17 A;  2PFY A;  4M1V A;  4PAI A;  2Q8M A;  2Q74 A;  4I40 A;  1LBV A;  4O7I A;  4P3L A;  2OX3 A;  3BIH A;  5IZ1 A;  5EYG A;  4AS4 A;  4MNP A;  1NUX A;  3IFA A;  4O8M A;  2XWI A;  4PCD A;  4NN3 A;  2XWV A;  4PAF A;  4N8Y A;  3EKI A;  3IFC A;  3B8B A;  1SPI A;  4PGP A;  2WX9 A;  3PTY A;  1XI6 A;  4OAN A;  2FBP A;  3T0J A;  4MAG A;  1LBZ A;  4JVI A;  1FRP A;  2CEX A;  3HFU A;  4N8G A;  3KC1 A;  4GWS A;  1FJ9 A;  4N91 A;  4N81 A;  4P9K A;  4H45 A;  4PE3 A;  1DK4 A;  1FPI A;  3A29 A;  4LN5 A;  3BIG A;  2PFZ A;  2DDK A;  2QFL A;  2ZZX A;  1INP A;  2FVZ A;  5EQ7 A;  1EYI A;  4O94 A;  4N4U A;  2Q9T A;  1IMF A;  2QVR A;  4XF5 A;  4HXV A;  1YZ0 A;  4MJO A;  2CZI A;  2MKZ A;  4UAB A;  4HE1 A;  2HXR A;  1FPL A;  5EQA A;  2WEF A;  4H46 A;  3RYD A;  4PFB A;  1NV7 A;  2WYP A;  4I3E A;  2B4M A;  3RPL A;  4AS5 A;  4P56 A;  4P8B A;  3E78 A;  4FBP A;  4F1U A;  1LEV A;  1IMC A;  1RDY A;  1FBP A;  1FPG A;  2DVZ A;  4MNI A;  1CNQ A;  4OVP A;  4F18 A;  2OWZ A;  4GX3 A;  2QPQ A;  2CEY A;  4PBH A;  2HZL A;  1IMB A;  4MMP A;  4PBQ A;  2HPG A;  2QVU A;  5IGA A;  4P1L A;  3RPL B;  3ROJ A;  5J16 A;  4PF8 A;  4F19 A;  4GBW A;  4PDD A;  1D9Q A;  1FPJ A;  1YYZ A;  4GWU A;  5I7I A;  2P3N A;  1FPE A;  4XEQ A;  3T1B A;  1NUY A;  1FPB A;  2FHY A;  3W9V A;  1KZ8 A;  1YXI A;  4OVQ A;  4GWY A;  1DBZ A;  1NV4 A;  4NGU A;  3ISP A;  2WBB A;  1KA0 A;  4N15 A;  2ZZW A;  4PTK A;  4GWX A;  2XWK A;  5IM2 A;  5CM6 A;  2XA5 A;  2VPN A;  4MIJ A;  4YZZ A;  5ET7 A;  4F1V A;  1FBE A;  4QXD A;  1FPD A;  3MYU A;  1RDZ A;  2VT5 A;  5ET6 A;  2XWO A;  1LBY A;  4NX1 A;  1JP4 A;  2V3Q A;  4MX6 A;  2HHM A;  5LTC A;  2PCR A;  4MCO A;  4IR8 A;  1FBG A;  2JJK A;  4OVR A;  3E79 A;  4NHB A;  2B4L A;  2CZH A;  1QGX A;  2FIE A;  4X8R A;  4O7M A;  5DW8 A;  5T3J A;  4MNC A;  4YIC A;  3GYY A;  4GWZ A;  4PDH A;  2KR0 A;  4DI3 D;  5EQ9 A;  1BK4 A;  1FBD A;  3QMF A;  1NV1 A;  5FBP A;  4HCY A;  1EYJ A;  5F24 A;  3B50 A;  5LDZ A;  1FBF A;  5IZ3 A;  3KC0 A;  1IMA A;  1K9Z A;  1NUW A;  5ESY A;  3MST A;  3LUZ A;  2F3D A;  2FIX A;  4G61 A;  4NG7 A;  2R8T A;  1FJ6 A;  1Q9D A;  3KBZ A;  4PFR A;  4I3Y A;  2VPO A;  5IZ3 B;  4PET A;  4X04 A;  3NOH A;  2DE4 A;  5I3S A;  3U65 A;  4JVC A;  2BJI A;  1FPK A;  2P3V A;  2F5X A;  1AWB A;  2GQ1 A;  1NUZ A;  2HZK A;  1G0H A;  2WBD A;  4GX4 A;  4HE2 A;  4KXP A;  4NF0 A;  3SZP A;  5ET5 A;  2WYK A;  1DCU A;  4N6D A;  4PGN A;  4GBV A;  5I5P A;  2ZZV A;  4MEV A;  1FBH A;  1EYK A;  3D1R A;  5EYH A;  4MHF A;  5JK4 A;  3CHG A;  4N6K A;  1FBC A;  2DE2 A;  4NQ8 A;  3LV0 A;  1IMD A;  5J1D A;  4DI4 B;  4PF6 A;  4OVT A;  1NV0 A;  1LBW A;  1RDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...