1IMAA

Structural analysis of inositol monophosphatase complexes with substrates
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural analysis of inositol monophosphatase complexes with substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imaA02
1IMBA 1LBXA 1RDXA 1QGXA 1FBHA 1XI6A 2WBDA 3IFCA 4AS5A 3KBZA 1EYJA 4I3YA 1LBZA 1VDWA 1IMEA 1LBVA 3KC1A 2FIXA 2Y5LA 1NV4A 1NV6A 1FRPA 4IR8A 4N81A 4GWZA 1NV0A 5J16A 3D1RA 2QVRA 3BIHA 5IZ3A 4I40A 2F3BA 4HE0A 4AS4A 1FPGA 1FBDA 1DK4A 2CZHA 3B8BA 3RYDA 1KZ8A 1NV3A 1KA1A 5ET8A 2QVUA 1FJ9A 5FBPA 2Q8MA 1FPIA 1KA0A 2OWZA 2PCRA 1G0HA 1FJ6A 1NV5A 1EYIA 1FBPA 1K9ZA 3BIGA 2FHYA 5EQAA 1NUXA 2OX3A 1FBCA 5EQ8A 1FSAA 5F24A 1JP4A 1BK4A 5T3JA 4MJOA 1RDZA 2Y5KA 3LUZA 3A29A 1FPJA 1NI9A 2R8TA 5LDZA 4PTKA 5DW8A 1FBEA 4GX6A 2WBBA 4GX4A 1FPKA 4GWSA 5IZ1A 4G61A 3ROJA 1EYKA 2CZIA 4H45A 5EYHA 1YXIA 4I3EA 1IMFA 2Q74A 3RPLA 2DDKA 1NUWA 1IMCA 1IMDA 4QXDA 2P3VA 2FIEA 1DCUA 1DBZA 5EQ7A 1YYZA 2CZKA 1YZ0A 1NV1A 1LBYA 4KXPA 2QVVA 1LEVA 1FPEA 1IMAA 1FPFA 1SPIA 4HXVA 1INPA 2F3DA 3IFAA 5ESYA 3KC0A 4H46A 4GX3A 1FPLA 1FBGA 4GWWA 1FTAA 4GBVA 5ET7A 5EYGA 1NUZA 5ET5A 5IZ3B 2FVZA 4FBPA 4GWUA 4O7IA 1Q9DA 5ET6A 3QMFA 4HE2A 1FPDA 1LBWA 2VT5A 3RPLB 2BJIA 1D9QA 3T0JA 1G0IA 2HHMA 5EQ9A 2GQ1A 4GWYA 2FBPA 2P3NA 2JJKA 1CNQA 3LV0A 1NV2A 4GWXA 4GBWA 2QFLA 1NV7A 5I3SA 3FBPA 1RDYA 1FBFA 1AWBA 1FPBA 5A5LA 2WEFA 1NUYA 1K9YA 4HE1A
chains in the Genus database with same CATH superfamily
2ZMBA 3RTFB 4ELOA 3UK4A 2P2AA 4YKPA 4ZE9A 5L9SA 1YPNA 1HSEA 1XVXA 3KC1A 2XHDA 3S2VA 2Z8DA 3RGYA 4DCXA 3G7WA 3RNNA 1TFDA 3D1RA 2PBWA 4L17A 5IZ3A 4NF6B 3DP6A 3GBBA 1FBDA 2UVIA 3RQTA 1IXHA 3ONMA 1MM6A 2AL4A 2GH9A 3QK6A 3DLNA 1I69A 4P3LA 1JEVA 4PQJA 4N6DA 4PETA 4NHBA 3C34A 4GX6A 1XT8A 5LOMA 4YAHX 1N7WA 1M5EA 4F31B 2RCAA 3UORA 1ZKBA 3SEXA 4GL8A 4ZZAA 4N07A 4QXDA 1HSJA 2FIEA 1ATGA 1XS5A 4ZDMA 2CZKA 1P1OA 5HBCA 2KR0A 5JK4A 1N0TA 5ESYA 3QUJA 4GX3A 1FQFA 4P0IA 2V84A 4KHZE 5TP9B 1MXUA 1B1HA 5H8NB 1PBQA 3SEVA 4JDFA 5IZZA 1ZMGA 5A5XA 2DWAA 4QBAA 3A09A 3FASA 2YLNA 4G2ZA 1CB6A 4OQOA 1TXFA 4KQPA 3HCQA 3MVWA 3LUYA 3T9XB 3MJNA 3QYTA 3TTMA 1IMEA 3N6UA 2WYKA 1II5A 4OVRA 2HXRA 5H8SA 3IB0A 5I5PA 3GBAA 2O51A 1MQIA 5DTBA 3QXMA 2XX8A 5A5XB 3B8BA 1NV3A 3G3KA 1SW1A 4RA1A 3LSXA 4HCWA 1LGBC 1RDZA 1NH7A 2UVGA 1BLFA 1M5DA 3RPWA 2R8TA 3KOTA 1EZPA 2GFEA 1GV8A 4GWSA 2YJPA 3ROJA 2ESNA 3V5AA 1FQAA 4I1DA 4MNIA 4X1DA 4RNSA 4ELQA 2UVHA 5I59A 2OPDA 4GRKA 4QF9A 2VD3A 1UTHA 1FTKA 2BJJX 2PMSA 4EXLA 2HPGA 2Z8EA 4IO3A 2V3UA 4F2OA 3HV1A 1MDP1 3C36A 1JW4A 2XXVA 4H5FA 1P1QA 3KSJA 1GGGA 2XXUA 3QMFA 4HE2A 4X48A 3SERA 3HHFA 2I3VA 3T0JA 3IORA 4Q0CA 1MY2A 4ECFA 3OD7A 2H9BA 2P3NA 1LFGA 4GBWA 3ILTB 4G4PA 1J1NA 1FTLA 3KN8A 2WEFA 1D9VA 1OLCA 3MUQA 4G68C 1LBZA 4G8NA 4R6YA 1PEBA 4O3AA 1LAXA 4LUBA 4MFIA 3VVFA 3U93A 2ZYNA 2NXOA 4YICA 3H4ZA 1F9BA 3PUWE 2WX9A 2HXWA 2QS3A 1URDA 4O7MA 2QS2A 1KZ8A 2RINA 3MP8A 4MLVA 2Q8MA 2QL3A 1FJ6A 1NV5A 1QJMA 1EZOA 3KN7A 4DIGA 2OX3A 3OMBA 4TLMB 5F24A 3FXQA 4EXKA 5H8QB 1WODA 2HCAA 5H8HA 1AMFA 4THIA 1JNFA 1FPJA 1I6BA 1NNKA 3C31A 2I6EA 2CZIA 4HS7A 1YXIA 1IMFA 4JSOA 4OA4A 3R7XA 4NN3A 3C33A 4BDQA 1DOTA 4ZEBA 5M2VA 3EKIA 1QUJA 2DWIA 4R73A 5I57A 1B32A 3VXCA 3D4GA 3MBPA 4YMBA 1FBGA 4R6KA 1MH4A 2I58A 3RT8A 3F11A 3LC8A 5ET5A 3OXNA 4FBPA 1B3EA 3K1MA 4YKJA 1WDNA 3EHUA 5ISUA 2VT5A 3IJOB 2BJIA 4C1UA 4F18A 2QRYA 5CMCA 3KOSA 1YCJA 4MAGA 1FQCA 4PAIA 4X04A 1MQJA 3TUSA 4NX1A 5I57B 3DM0A 3T66A 4DI4B 4DCYA 1FPBA 4GL0A 3I3VA 1B46A 1NFTA 3U72A 1DTZA 3KN3A 3O6HA 1H44A 4HE1A 1QGXA 4AS5A 5FHMA 5EHMA 1O64A 4JSDA 1LB9A 2Y84A 5DVJA 3H6UA 4YU0A 4EF1A 2I4CA 3GZGA 4NAPA 3BFTA 4KYSA 4YB6A 4GLIA 4H8JA 4OERA 4NGUA 2F3BA 3B50A 3RYDA 2ZXTA 4N17A 2OWZA 1EYIA 3CG1A 4PFTA 1NUXA 2VP1A 3K01A 4DDDA 1BK4A 2H99A 3N6TA 3ISPA 3C35A 5LDZA 4WEPA 4F3BA 3E4RA 4QFKA 1QKAA 2QPQA 5IZ1A 5AA3A 1PB8A 2XWIA 1MDQA 4NG7A 1MY4A 4RPNA 1T0KA 4U23A 4FEDA 4GQOA 1Q35A 5K2YA 2IEEA 3PGFA 3IOTA 4E0WA 1DBZA 1YYZA 3B6TA 1A99A 4ESXA 2A5TB 2OLBA 2P0SA 2F35A 2FYIA 1Y20A 5TU0A 5CMBA 3TFLA 2Y7PA 4KCCA 3UGWA 1OVTA 1LFHA 3O6GA 1A8EA 1EZ9A 3QSLA 1AIVA 4P47A 4GWYA 4NF5A 3KG2A 4F2QA 3G3GA 4ESWA 1Z7NE 4MF3A 3MVZA 4F29A 3QIMA 1M5BA 3FJ7A 1XI6A 4KI0E 5AE4A 2I49A 2V25A 3Q27A 3FV1A 4Q30B 3PUXE 4NF5B 3CRBA 3W15C 5I2NA 3TCHA 1MXWA 3FV2A 4I9DA 4MNCA 1B5JA 3H6WA 2PCRA 3U92A 4X8RA 4F3SA 3SKPA 5EQ8A 2REJA 1N3XA 2Y7IA 1B40A 3TPAA 4OWDA 5DEXA 2XWKA 4NTLA 3GXAA 2WBBA 1SYIA 2PFYA 5I58B 1I6AA 1RYXA 1EYKA 1OQGA 3MYUA 1QUKA 3Q29A 1IEJA 4XXUA 4BDNA 1SW5A 2DDKA 2Q88A 2OWTA 3Q25A 4P11A 1SI0A 3MZ9A 4NF0A 2XX7A 4I62A 1YZ0A 5LTCA 2QVVA 4HCYA 1IMAA 1SQYA 2AL5A 3TZAA 5DEXB 4H46A 4GBVA 5ICQA 5JTYA 5ET7A 4EUOA 2ONRA 1SI1A 3MZBA 4NMYA 1LSTA 2ONSA 3M3FA 4FORA 3ZKLA 1B7HA 2ANJA 1LB8A 4M4GA 3U1OA 2D21A 3O29A 3PMVA 3VVDA 5I56B 4TLLB 3ILUB 2HQ0A 2XXRA 3MQ9A 4PF8A 1R6ZA 2ZZXA 1RDXA 2F8DA 3FVKA 5JTYB 3K0VA 3TELA 3MSTA 4XEQA 1B7ZA 4IR8A 4N81A 5BUUA 1NH8A 4RK2A 5K2XA 4OVJA 2V4CA 1XOCA 1DSNA 3LSLA 2VHAA 4U21A 1G0HA 4GIZA 5H8FB 1B4HA 4E0XA 5KCJB 1KWHA 3G3IA 4OFJA 4NQ8A 3OO8A 3B6WA 5CMMA 2Q2AA 2Y5KA 3MZ1A 3ODBA 4WKMA 4YMAA 4F1UA 4N13A 2I0CA 1SVXB 2ONKE 1ZJLA 2RC8A 4IGRA 4OESA 3ECRA 4XKNA 4IO6A 3RPLA 4EQ9A 3PPRA 1LAHE 4H0WA 1B2HA 3L6HA 1OVBA 5EQ7A 1H76A 1VE4A 1UIVA 2NWJA 2OK2A 4QFOA 3MPLA 4QSCA 2NVUB 1FPFA 5I84A 4HXVA 4U4XA 2F3DA 3IK6B 5IZ3B 4GWUA 2GHBA 1Q9DA 1FTJA 3S9MC 1MPCA 3MWBA 3RPLB 3PPNA 4IGTA 3QAXA 4IO5A 2GHAA 3W9WA 3OO9A 2V3QA 3WAFA 4GXAA 3LV0A 1DTGA 4C0RA 3MAMA 3FBPA 4F19A 3IB1A 5JEIA 1FBHA 5CI5A 1SD3A 4G8HA 3K2DA 3VDFA 1VDWA 5AA2D 4BDRA 2DE4A 5EYFA 5AA1A 1MM7A 3MVXA 2LAOA 3CFZA 4QHQA 1P1NA 2XA5A 3HHGA 1MRPA 2DE3A 2XWOA 1ZU0A 1A40A 1FJ9A 3O9PA 1XHYA 3VXBA 3G3FA 4YZZA 4MJOA 2O7UA 3LUZA 1FBEA 3TCFA 1FPKA 4KFQA 3K1PA 4G68A 2O1MA 3G3HA 1P99A 2F7AA 2RCBA 1IMDA 4HTGA 3KJ7A 4H5GA 2B3BA 3CHGA 2CZLA 3GYYA 2VGQA 2HFBA 3Q28A 4JXIA 5CRYA 2OJTA 3FJMA 5EHSA 4KXPA 1ANFA 4XTCQ 3T9UA 3EHTA 1LEVA 1FPEA 4DXBA 3KGCA 4H1XA 1I6QA 1LAFE 3IFAA 3SETA 5DVFA 1A8FA 3K6WA 5KDTA 4HW8A 3UIFA 4JVCA 3H7MA 3CIJA 4OFOA 2VPNA 3S4UA 3H6VA 4JWYA 4GVOA 1PBPA 4KR5A 4GWXA 5L9MA 1S50A 4WEDA 3KFMA 3O6IA 4DXUA 1NUYA 1TT1A 5FHOA 5B70A 3FGSA 2O84X 3K1NA 2Y7WA 1UTBA 4R9FA 4IO4A 3TMGA 4JBZA 5I59B 2O1LA 2F34A 4R2BA 1UTHB 1N76A 3K4UA 3SDFA 2O69A 4OTEA 2QJEA 4HE0A 4PE5B 4PBQA 3PTYA 1K9ZA 1UQWA 4POWA 1UTBB 4OYVA 4H65A 1JP4A 4YKIA 4DE8A 2QSXA 1FQBA 3R26A 1OLAA 4MH5A 3UA8A 4PDDA 1R1NA 1MQDA 2RKMA 2GRVA 1NNFA 4LA9A 1GVCA 3HO7A 3QUFA 2IA4A 4IO7A 4PE3A 1MXXA 4NF8A 1DCUA 2UYEA 2KLFA 4GD5A 3S9NC 3ZS6A 3KC0A 1LBBA 2FVZA 4R72A 4QSEA 3H03A 2DQVA 4N6KA 4LP2B 4R9GA 3H6TA 3UP9A 5H8HB 4IY5A 1Z7ME 4IB2A 5A5LA 4GXSB 4PFWA 1JVYA 3EHSA 4ZEDA 3FVGA 4FIMA 1SBPA 2FIXA 3RN8A 2H4IA 4PFIA 2E1SA 1USYH 3IOWA 1MPBA 1Y9UA 3CVGA 1YAEA 2B65A 2AYSA 2HZLA 3SEYA 1FTMA 5FTIA 1KA0A 2OCUA 1FBPA 3OELA 3EN3A 2FNCA 2B4MA 3U94A 4H67A 4TQUQ 4LZ7A 1B3LA 4PC9A 2H98A 4O3BA 4LATA 1AOVA 1EH3A 3PUZE 3K02A 2KQZA 5EYHA 3N94A 1H43A 4N91A 2DS9A 3PUVE 3R6UA 4MMPA 2OWSA 2VD2A 3RLFE 4ELPA 2XXYA 2DWJA 2PYYA 1B0LA 3K00A 3AXFA 1MY1A 4GWWA 5DYHA 1FTAA 2PFZA 3BKIB 2DYXA 1SDXA 4O7IA 2I3WA 3IO4A 1PB7A 3MP1A 3OENA 5AA4A 4F3PA 3O97A 2GQ1A 1Y1ZA 5B7DA 2G29A 1TWYA 2F7CA 3K6UA 1B3FA 4GF8A 4PFYA 4EQBA 3LSWA 3IFCA 3MP6A 3OEMA 1FQEA 3VFJA 3PV0E 3SESA 4Q5TA 3TEPA 1B52A 2R6GE 5FTHA 1NV6A 2DVZA 2CEXA 3T1BA 1AL3A 1IQ7A 2XXTA 1URGA 1H3DA 3DELB 1NL5A 1WVJA 1ELJA 4LZ5A 3BIHA 3N5LA 3V83A 2Q8JA 1N7XA 4KCDA 1D9YA 4OHNA 1PDAA 4QFNA 1JW5A 2OBGA 4KYEA 1Y4TA 1FSAA 1ZTYA 2RF1A 2XXIA 2HAVA 4PFRA 4F1VA 3U65A 1QW0A 2Z8FA 4EF2A 1MG1A 4PTKA 5DW8A 3KSXA 4OANA 4G61A 2B3FA 5L9OA 3VV5A 1O7TA 4PAKA 2XXHA 1QULA 4QRZA 5F1QA 2Y7RA 1POTA 5IKBA 1JQFA 5IM2A 1D3KA 1LBYA 1XC1A 3FIRA 4OZ9A 3BFUA 5HM4B 1ZBMA 5I2NB 5F7VA 1BIYA 5ET6A 5CMKA 1FPDA 1B05A 3MW0A 4PCDA 4F22A 5J1DA 3PPOA 5HPQA 5IAIA 2THIA 3KZGA 2CEYA 1NV7A 3PD9A 1FBFA 1QVSA 2H5YA 2ZNUA 1Y4CA 4LONB 3EQ1A 1IMBA 2ABHA 5ICTA 4ZE8A 2ZNTA 2F36A 2Q89A 1NV4A 2X7QA 3MC2A 5CBSA 4U2RA 4GWZA 1OQHA 1JETA 3FXUA 3LBSA 1NKXA 5DVIA 3EPEA 2UYFA 4G77A 2DXRA 4N6PA 1L5TA 2FHYA 4ZEIA 4PGPA 2Q9TA 2NOOA 5T3JA 4R75A 2ZZWA 4I8CA 3C9HA 4GX4A 4AB6A 1LAGE 4X1BA 3CG3A 1BP5A 2F78A 4PDHA 3SEUA 2DWHA 2VOZA 4AB5A 2ZZVA 1A55A 4NF6A 1SPIA 3KJTA 4Z0IA 2O68A 4RXLA 1US4A 3CR9A 4ZECA 4GOTA 4F1YA 5I2KA 2WYPA 1NV2A 1MH3A 5FHNA 3TTNA 4NWCA 4MBPA 1LCTA 2REGA 1MXYA 2P1SA 4K3FA 3HPIA 2DE2A 3IOUA 4OMBA 1EYJA 3UN6A 1CE2A 3G3JA 1O63A 4P1EA 4U4SA 2PT2A 3TTKA 2CMOA 4X9TA 5I2KB 2ZNSA 4I40A 5TP9A 4AS4A 5BWJA 2CZHA 5H8NA 1P1UA 3IR1A 3TQWA 2R71A 3FVNA 3BIGA 2XXWA 4PF6A 3HN0A 2PVUA 2ALUA 1NI9A 2QMXA 4P9KA 2V3TA 2YPNA 3RUMA 4JVDA 4OVQA 4DI3D 3PPPA 1LCFA 3OO7A 4XFEA 1MS7A 1DPPA 2XXPA 4ZEKA 1B51A 3T22A 1POY1 4PGNA 4MHFA 4ZZEA 4NF4A 4C1TA 2F97A 4ZEFA 2D5WA 5KZTA 4POXA 2Y7KA 3FZVA 3E79A 2L5VA 3I6VA 3NOHA 4XKRA 3T96B 3VLWA 3T9HB 3N26A 3GLBA 1TFAA 1D9QA 1G0IA 1LLSA 2F6GA 3TCGA 4NF4B 1R9QA 2QFLA 3TKDA 3A3UA 2DSFA 3OOAA 4R6HA 3TDJA 3MVYA 1XVYA 3KBZA 3RTWB 4OFLA 1Y3PA 4G68B 2W7YA 2V93A 4LZ8A 2FA7A 3ZKKA 5DT6A 3TAJA 4PFUA 1Y3NA 1FCKA 3Q26A 4U22A 1BKAA 4F39A 1P1WA 3IOVA 1MQHA 2QVRA 2HAUA 1MPDA 2HZKA 3THIA 4XKPA 1OIBA 5ET8A 5FBPA 5KDTB 5CM6A 4RY1A 4LVQA 4M1VA 4TOZA 4LQ2A 3O28A 1VFEA 3IL1B 4OVPA 3IJXB 4H45A 3FUZA 2HEUA 4MCOA 3T9VA 2Q74A 4RPOA 3D4CA 2XWVA 3FD3A 4FEBA 4XKQA 1R9LA 3B7DA 1D4NA 4U1OA 2P3VA 2H25A 4LN5A 5ELVA 4UACA 4DLDA 3C4MA 4OEUA 3P7IA 4ONYA 3FVOA 3TTRA 1MY3A 3PPQA 3L6GA 2XXQA 4OXVA 3USDA 3IAZA 3OEKA 1NUZA 1B7UA 2DP8A 3PMXA 3MPKA 3JV9A 4IO2A 5H8QA 1LBWA 1NNTA 3OO6A 2I48A 4JVIA 4P1LA 2PX1A 3SEWA 1S7YA 1UIUA 1CNQA 2F5XA 4UABA 4YKKA 1YTVA 1N84A 5I7IA 4KPTA 2XD2A 1PB9A 3OSQA 4R74A 1DPEA 4H8IA 3OSRA 5IGAA 4NE4A 1LBVA 3CSGA 2NUVA 1ZIUA 1LFIA 4NF8B 5J16A 2XXKA 3RY3A 2XXXA 3CI8A 4O3CA 1DK4A 1KA1A 4GFRA 1JW1A 1FPIA 2OZZA 4RJZA 1B5IA 1M5FA 3C32A 3A3CA 1RYOA 1NNPA 4N4UA 1IITA 2X26A 5CC2A 4GWOA 3A29A 1USYE 3T93B 1QUIA 4MLQA 4PAFA 1BTJA 3VE1B 2ZYOA 4MNPA 2DOJA 1NUWA 1Y3QA 2I4BA 2RC7A 1IMCA 1EU8A 3FATA 2WKYA 3V8XB 2F6PA 4OVSA 4PP0A 3TQLA 1VFDA 3W9VA 2UVJA 4ISUA 1NV1A 2AIXA 4BDOA 4AQ4A 4G8MA 1MY0A 1HSLA 1IXIA 2VPOA 1B5HA 1SYHA 3FXBA 2OPEA 3K6VA 4O94A 1FQDA 3EF7A 4XF5A 2R9JA 4BLAA 2UXAA 2XX9A 4N8YA 4EQ7A 2M8CA 1OMPA 2MKZA 2O7IA 4BDMA 5ITOA 5I3SA 4ELRA 5TPAA 3VVEA 1LBXA 3PU5A 2WBDA 5ITPA 4MEVA 1QKBA 2DVCA 4RK9A 4WXJA 2A5TA 1FRPA 3PD8A 2O6AA 3S9EA 4OEVA 4LQ5A 1NV0A 4R2FA 1JVXA 4IY6A 1B58A 4QFLA 4RYAA 3E78A 3E3KA 4MX6A 1FPGA 2A5SA 3VLVA 3SZPA 5TPAB 3KEIA 1FW0A 5EQAA 4Q8RA 3WAEA 1LBCA 4KYDA 2XD3A 4O8MA 1N3WA 1N04A 5AA4B 3U8QA 1US5A 2DXYA 3KBRA 1GTKA 4YB7A 1URSA 4I3EA 5CBRA 4JWXA 4N15A 1DMBA 3TYHA 1IIWA 2RC9A 2X7PA 4OETA 1PC3A 2D3IA 4P56A 3PUYE 1A54A 4BDLA 4PBHA 1A7LA 1INPA 3HFUA 4KD5A 1IXCA 1IZ1A 2G93A 3B6QA 5EYGA 3BBRA 4MIJA 3TTLA 3ZSFA 3DP4A 1VSOA 1GR2A 4N8GA 3DP8A 5EQ9A 4Z7EA 1IUDA 4YB5A 5I58A 2PT1A 4FATA 1RDYA 3M3LA 3S9LC 1AWBA 3LR1A 3O2AA 4OENA 1SW4A 1K9YA 3VLUA 1IXGA 1VR5A 4I3YA 1MXVA 1MXZA 3FXRA 2Y5LA 2QS1A 2QS4A 3K6XA 4H6DA 3H3GA 4U1ZA 4DZ1A 1JEUA 4FECA 3E9XA 4ZS9A 4JB7A 2QVUA 3E13X 3M3KA 3CSBA 4DXCA 1FBCA 4QSDA 4EDPA 3IB2A 1Q1KA 1FTOA 2Q2CA 4P0GA 2Z23A 1B0HA 5I56A 3CFXA 4FJPA 1B3GA 3V89B 4P8BA 3M8UA 1M5CA 4FAJA 1B6HA 3HSTA 5AA2A 4OVTA 2Z22A 4JWOA 3CFLA 3RT6B 1SW2A 2ZYMA 1Y1MA 2ZYKA 1B3HA 3FJGA 4QFPA 4XIGQ 2F7BA 2QMWA 1H45A 4F3GA 3LSFB 1ZLQA 3TODA 4PFBA 4ND9A 5L8DA 1FPLA 3O66A 5H8FA 3PMWA 5KCJA 3JZJA 5AA2B 1B4ZA 1B9JA 3I5OA 2B4LA 3IX1A 1B1XA 1NMUA 2HHMA 1MQGA 4FE8A 4NWDA 2FBPA 2JJKA 1RKMA 1S9TA 4UA8A 3H06B 4NEDA 3IO6A 2I0BA 1AH5A 2E0SA 3JYRA
chains in the Genus database with same CATH topology
1XI6A 3KBZA 3KC1A 2FIXA 4PFIA 3D1RA 2QVRA 5IZ3A 2HZLA 4MNCA 1FBDA 2HZKA 5ET8A 5FBPA 1KA0A 2PCRA 1FBPA 4X8RA 5CM6A 5EQ8A 2B4MA 4M1VA 4P3LA 4N6DA 4PETA 4PC9A 2XWKA 4NHBA 4GX6A 2WBBA 2PFYA 4OVPA 1EYKA 2KQZA 4H45A 5EYHA 4MCOA 3MYUA 2Q74A 2XWVA 4N91A 4MMPA 2DDKA 4QXDA 2P3VA 2FIEA 4LN5A 2CZKA 4NF0A 1YZ0A 5LTCA 2QVVA 4HCYA 1IMAA 2KR0A 5JK4A 5ESYA 4H46A 4GX3A 4GWWA 1FTAA 4GBVA 2PFZA 5ET7A 1NUZA 4O7IA 1LBWA 5IZZA 4JVIA 2GQ1A 4P1LA 1CNQA 2F5XA 4QBAA 4UABA 5I7IA 4PF8A 2ZZXA 1RDXA 3IFCA 5IGAA 1IMEA 2WYKA 1LBVA 4OVRA 2HXRA 3MSTA 1NV6A 4XEQA 5I5PA 2DVZA 4IR8A 2CEXA 3T1BA 4N81A 5J16A 2XXKA 3BIHA 2V4CA 1DK4A 3B8BA 1NV3A 1KA1A 1FPIA 1G0HA 4HCWA 1FSAA 4NQ8A 4PFRA 4N4UA 4F1VA 3U65A 1RDZA 2Y5KA 3A29A 4F1UA 2R8TA 4PTKA 5DW8A 4PAFA 4OANA 4GWSA 4G61A 3ROJA 4MNIA 4MNPA 3RPLA 1NUWA 4PAKA 1IMCA 4OVSA 5EQ7A 2HPGA 5IM2A 3W9VA 1NV1A 1LBYA 1FPFA 4HXVA 2F3DA 5IZ3B 4GWUA 2VPOA 1Q9DA 5ET6A 3FXBA 3QMFA 4HE2A 1FPDA 4O94A 3RPLB 4XF5A 4PCDA 3T0JA 3W9WA 5J1DA 2V3QA 4N8YA 2P3NA 3LV0A 2MKZA 2CEYA 4GBWA 1NV7A 5I3SA 3FBPA 1FBFA 4F19A 2WEFA 1IMBA 1LBXA 2WBDA 1FBHA 1LBZA 1VDWA 4MEVA 2DE4A 1NV4A 1FRPA 4GWZA 4YICA 2XA5A 1NV0A 2WX9A 2DE3A 3E78A 4MX6A 4O7MA 2XWOA 1FPGA 1KZ8A 3SZPA 1FJ9A 2Q8MA 1FJ6A 1NV5A 5EQAA 2FHYA 2OX3A 4PGPA 2Q9TA 4YZZA 5F24A 5T3JA 4MJOA 4O8MA 3LUZA 2ZZWA 1FPJA 1FBEA 4GX4A 1FPKA 2CZIA 1YXIA 4I3EA 1IMFA 4OA4A 4NN3A 4PDHA 4N15A 1IMDA 3EKIA 3CHGA 2ZZVA 3GYYA 4KXPA 4P56A 1LEVA 1FPEA 4PBHA 1SPIA 1INPA 3HFUA 3IFAA 1FBGA 5EYGA 5ET5A 4JVCA 4FBPA 4MIJA 2VT5A 2BJIA 4F18A 4N8GA 2VPNA 4MAGA 5EQ9A 4PAIA 4X04A 2WYPA 4NX1A 1NV2A 4GWXA 1RDYA 4DI4B 1AWBA 1FPBA 1NUYA 1K9YA 4HE1A 2DE2A 1QGXA 4AS5A 1EYJA 4I3YA 4P1EA 2Y5LA 4NAPA 4X9TA 4NGUA 4I40A 2F3BA 4HE0A 4AS4A 4PBQA 3B50A 2CZHA 3RYDA 4N17A 2QVUA 2OWZA 3PTYA 1EYIA 1K9ZA 3BIGA 1NUXA 4PF6A 1FBCA 1JP4A 1BK4A 3ISPA 1NI9A 5LDZA 4P9KA 4P8BA 2QPQA 5IZ1A 4JVDA 2XWIA 4OVQA 4OVTA 4NG7A 4DI3D 4PDDA 4XFEA 4PGNA 4PE3A 4MHFA 1DCUA 1DBZA 1YYZA 4PFBA 3KC0A 3E79A 1FPLA 2L5VA 3NOHA 2FVZA 1D9QA 2B4LA 1G0IA 4N6KA 2HHMA 4P47A 4GWYA 2FBPA 2JJKA 2QFLA 5A5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMB A;  1LBX A;  1RDX A;  1QGX A;  1FBH A;  1XI6 A;  2WBD A;  3IFC A;  4AS5 A;  3KBZ A;  1EYJ A;  4I3Y A;  1LBZ A;  1VDW A;  1IME A;  1LBV A;  3KC1 A;  2FIX A;  2Y5L A;  1NV4 A;  1NV6 A;  1FRP A;  4IR8 A;  4N81 A;  4GWZ A;  1NV0 A;  5J16 A;  3D1R A;  2QVR A;  3BIH A;  5IZ3 A;  4I40 A;  2F3B A;  4HE0 A;  4AS4 A;  1FPG A;  1FBD A;  1DK4 A;  2CZH A;  3B8B A;  3RYD A;  1KZ8 A;  1NV3 A;  1KA1 A;  5ET8 A;  2QVU A;  1FJ9 A;  5FBP A;  2Q8M A;  1FPI A;  1KA0 A;  2OWZ A;  2PCR A;  1G0H A;  1FJ6 A;  1NV5 A;  1EYI A;  1FBP A;  1K9Z A;  3BIG A;  2FHY A;  5EQA A;  1NUX A;  2OX3 A;  1FBC A;  5EQ8 A;  1FSA A;  5F24 A;  1JP4 A;  1BK4 A;  5T3J A;  4MJO A;  1RDZ A;  2Y5K A;  3LUZ A;  3A29 A;  1FPJ A;  1NI9 A;  2R8T A;  5LDZ A;  4PTK A;  5DW8 A;  1FBE A;  4GX6 A;  2WBB A;  4GX4 A;  1FPK A;  4GWS A;  5IZ1 A;  4G61 A;  3ROJ A;  1EYK A;  2CZI A;  4H45 A;  5EYH A;  1YXI A;  4I3E A;  1IMF A;  2Q74 A;  3RPL A;  2DDK A;  1NUW A;  1IMC A;  1IMD A;  4QXD A;  2P3V A;  2FIE A;  1DCU A;  1DBZ A;  5EQ7 A;  1YYZ A;  2CZK A;  1YZ0 A;  1NV1 A;  1LBY A;  4KXP A;  2QVV A;  1LEV A;  1FPE A;  1IMA A;  1FPF A;  1SPI A;  4HXV A;  1INP A;  2F3D A;  3IFA A;  5ESY A;  3KC0 A;  4H46 A;  4GX3 A;  1FPL A;  1FBG A;  4GWW A;  1FTA A;  4GBV A;  5ET7 A;  5EYG A;  1NUZ A;  5ET5 A;  5IZ3 B;  2FVZ A;  4FBP A;  4GWU A;  4O7I A;  1Q9D A;  5ET6 A;  3QMF A;  4HE2 A;  1FPD A;  1LBW A;  2VT5 A;  3RPL B;  2BJI A;  1D9Q A;  3T0J A;  1G0I A;  2HHM A;  5EQ9 A;  2GQ1 A;  4GWY A;  2FBP A;  2P3N A;  2JJK A;  1CNQ A;  3LV0 A;  1NV2 A;  4GWX A;  4GBW A;  2QFL A;  1NV7 A;  5I3S A;  3FBP A;  1RDY A;  1FBF A;  1AWB A;  1FPB A;  5A5L A;  2WEF A;  1NUY A;  1K9Y A;  4HE1 A; 
#chains in the Genus database with same CATH topology
 2ZMB A;  3RTF B;  4ELO A;  3UK4 A;  2P2A A;  4YKP A;  4ZE9 A;  5L9S A;  1YPN A;  1HSE A;  1XVX A;  3KC1 A;  2XHD A;  3S2V A;  2Z8D A;  3RGY A;  4DCX A;  3G7W A;  3RNN A;  1TFD A;  3D1R A;  2PBW A;  4L17 A;  5IZ3 A;  4NF6 B;  3DP6 A;  3GBB A;  1FBD A;  2UVI A;  3RQT A;  1IXH A;  3ONM A;  1MM6 A;  2AL4 A;  2GH9 A;  3QK6 A;  3DLN A;  1I69 A;  4P3L A;  1JEV A;  4PQJ A;  4N6D A;  4PET A;  4NHB A;  3C34 A;  4GX6 A;  1XT8 A;  5LOM A;  4YAH X;  1N7W A;  1M5E A;  4F31 B;  2RCA A;  3UOR A;  1ZKB A;  3SEX A;  4GL8 A;  4ZZA A;  4N07 A;  4QXD A;  1HSJ A;  2FIE A;  1ATG A;  1XS5 A;  4ZDM A;  2CZK A;  1P1O A;  5HBC A;  2KR0 A;  5JK4 A;  1N0T A;  5ESY A;  3QUJ A;  4GX3 A;  1FQF A;  4P0I A;  2V84 A;  4KHZ E;  5TP9 B;  1MXU A;  1B1H A;  5H8N B;  1PBQ A;  3SEV A;  4JDF A;  5IZZ A;  1ZMG A;  5A5X A;  2DWA A;  4QBA A;  3A09 A;  3FAS A;  2YLN A;  4G2Z A;  1CB6 A;  4OQO A;  1TXF A;  4KQP A;  3HCQ A;  3MVW A;  3LUY A;  3T9X B;  3MJN A;  3QYT A;  3TTM A;  1IME A;  3N6U A;  2WYK A;  1II5 A;  4OVR A;  2HXR A;  5H8S A;  3IB0 A;  5I5P A;  3GBA A;  2O51 A;  1MQI A;  5DTB A;  3QXM A;  2XX8 A;  5A5X B;  3B8B A;  1NV3 A;  3G3K A;  1SW1 A;  4RA1 A;  3LSX A;  4HCW A;  1LGB C;  1RDZ A;  1NH7 A;  2UVG A;  1BLF A;  1M5D A;  3RPW A;  2R8T A;  3KOT A;  1EZP A;  2GFE A;  1GV8 A;  4GWS A;  2YJP A;  3ROJ A;  2ESN A;  3V5A A;  1FQA A;  4I1D A;  4MNI A;  4X1D A;  4RNS A;  4ELQ A;  2UVH A;  5I59 A;  2OPD A;  4GRK A;  4QF9 A;  2VD3 A;  1UTH A;  1FTK A;  2BJJ X;  2PMS A;  4EXL A;  2HPG A;  2Z8E A;  4IO3 A;  2V3U A;  4F2O A;  3HV1 A;  1MDP 1;  3C36 A;  1JW4 A;  2XXV A;  4H5F A;  1P1Q A;  3KSJ A;  1GGG A;  2XXU A;  3QMF A;  4HE2 A;  4X48 A;  3SER A;  3HHF A;  2I3V A;  3T0J A;  3IOR A;  4Q0C A;  1MY2 A;  4ECF A;  3OD7 A;  2H9B A;  2P3N A;  1LFG A;  4GBW A;  3ILT B;  4G4P A;  1J1N A;  1FTL A;  3KN8 A;  2WEF A;  1D9V A;  1OLC A;  3MUQ A;  4G68 C;  1LBZ A;  4G8N A;  4R6Y A;  1PEB A;  4O3A A;  1LAX A;  4LUB A;  4MFI A;  3VVF A;  3U93 A;  2ZYN A;  2NXO A;  4YIC A;  3H4Z A;  1F9B A;  3PUW E;  2WX9 A;  2HXW A;  2QS3 A;  1URD A;  4O7M A;  2QS2 A;  1KZ8 A;  2RIN A;  3MP8 A;  4MLV A;  2Q8M A;  2QL3 A;  1FJ6 A;  1NV5 A;  1QJM A;  1EZO A;  3KN7 A;  4DIG A;  2OX3 A;  3OMB A;  4TLM B;  5F24 A;  3FXQ A;  4EXK A;  5H8Q B;  1WOD A;  2HCA A;  5H8H A;  1AMF A;  4THI A;  1JNF A;  1FPJ A;  1I6B A;  1NNK A;  3C31 A;  2I6E A;  2CZI A;  4HS7 A;  1YXI A;  1IMF A;  4JSO A;  4OA4 A;  3R7X A;  4NN3 A;  3C33 A;  4BDQ A;  1DOT A;  4ZEB A;  5M2V A;  3EKI A;  1QUJ A;  2DWI A;  4R73 A;  5I57 A;  1B32 A;  3VXC A;  3D4G A;  3MBP A;  4YMB A;  1FBG A;  4R6K A;  1MH4 A;  2I58 A;  3RT8 A;  3F11 A;  3LC8 A;  5ET5 A;  3OXN A;  4FBP A;  1B3E A;  3K1M A;  4YKJ A;  1WDN A;  3EHU A;  5ISU A;  2VT5 A;  3IJO B;  2BJI A;  4C1U A;  4F18 A;  2QRY A;  5CMC A;  3KOS A;  1YCJ A;  4MAG A;  1FQC A;  4PAI A;  4X04 A;  1MQJ A;  3TUS A;  4NX1 A;  5I57 B;  3DM0 A;  3T66 A;  4DI4 B;  4DCY A;  1FPB A;  4GL0 A;  3I3V A;  1B46 A;  1NFT A;  3U72 A;  1DTZ A;  3KN3 A;  3O6H A;  1H44 A;  4HE1 A;  1QGX A;  4AS5 A;  5FHM A;  5EHM A;  1O64 A;  4JSD A;  1LB9 A;  2Y84 A;  5DVJ A;  3H6U A;  4YU0 A;  4EF1 A;  2I4C A;  3GZG A;  4NAP A;  3BFT A;  4KYS A;  4YB6 A;  4GLI A;  4H8J A;  4OER A;  4NGU A;  2F3B A;  3B50 A;  3RYD A;  2ZXT A;  4N17 A;  2OWZ A;  1EYI A;  3CG1 A;  4PFT A;  1NUX A;  2VP1 A;  3K01 A;  4DDD A;  1BK4 A;  2H99 A;  3N6T A;  3ISP A;  3C35 A;  5LDZ A;  4WEP A;  4F3B A;  3E4R A;  4QFK A;  1QKA A;  2QPQ A;  5IZ1 A;  5AA3 A;  1PB8 A;  2XWI A;  1MDQ A;  4NG7 A;  1MY4 A;  4RPN A;  1T0K A;  4U23 A;  4FED A;  4GQO A;  1Q35 A;  5K2Y A;  2IEE A;  3PGF A;  3IOT A;  4E0W A;  1DBZ A;  1YYZ A;  3B6T A;  1A99 A;  4ESX A;  2A5T B;  2OLB A;  2P0S A;  2F35 A;  2FYI A;  1Y20 A;  5TU0 A;  5CMB A;  3TFL A;  2Y7P A;  4KCC A;  3UGW A;  1OVT A;  1LFH A;  3O6G A;  1A8E A;  1EZ9 A;  3QSL A;  1AIV A;  4P47 A;  4GWY A;  4NF5 A;  3KG2 A;  4F2Q A;  3G3G A;  4ESW A;  1Z7N E;  4MF3 A;  3MVZ A;  4F29 A;  3QIM A;  1M5B A;  3FJ7 A;  1XI6 A;  4KI0 E;  5AE4 A;  2I49 A;  2V25 A;  3Q27 A;  3FV1 A;  4Q30 B;  3PUX E;  4NF5 B;  3CRB A;  3W15 C;  5I2N A;  3TCH A;  1MXW A;  3FV2 A;  4I9D A;  4MNC A;  1B5J A;  3H6W A;  2PCR A;  3U92 A;  4X8R A;  4F3S A;  3SKP A;  5EQ8 A;  2REJ A;  1N3X A;  2Y7I A;  1B40 A;  3TPA A;  4OWD A;  5DEX A;  2XWK A;  4NTL A;  3GXA A;  2WBB A;  1SYI A;  2PFY A;  5I58 B;  1I6A A;  1RYX A;  1EYK A;  1OQG A;  3MYU A;  1QUK A;  3Q29 A;  1IEJ A;  4XXU A;  4BDN A;  1SW5 A;  2DDK A;  2Q88 A;  2OWT A;  3Q25 A;  4P11 A;  1SI0 A;  3MZ9 A;  4NF0 A;  2XX7 A;  4I62 A;  1YZ0 A;  5LTC A;  2QVV A;  4HCY A;  1IMA A;  1SQY A;  2AL5 A;  3TZA A;  5DEX B;  4H46 A;  4GBV A;  5ICQ A;  5JTY A;  5ET7 A;  4EUO A;  2ONR A;  1SI1 A;  3MZB A;  4NMY A;  1LST A;  2ONS A;  3M3F A;  4FOR A;  3ZKL A;  1B7H A;  2ANJ A;  1LB8 A;  4M4G A;  3U1O A;  2D21 A;  3O29 A;  3PMV A;  3VVD A;  5I56 B;  4TLL B;  3ILU B;  2HQ0 A;  2XXR A;  3MQ9 A;  4PF8 A;  1R6Z A;  2ZZX A;  1RDX A;  2F8D A;  3FVK A;  5JTY B;  3K0V A;  3TEL A;  3MST A;  4XEQ A;  1B7Z A;  4IR8 A;  4N81 A;  5BUU A;  1NH8 A;  4RK2 A;  5K2X A;  4OVJ A;  2V4C A;  1XOC A;  1DSN A;  3LSL A;  2VHA A;  4U21 A;  1G0H A;  4GIZ A;  5H8F B;  1B4H A;  4E0X A;  5KCJ B;  1KWH A;  3G3I A;  4OFJ A;  4NQ8 A;  3OO8 A;  3B6W A;  5CMM A;  2Q2A A;  2Y5K A;  3MZ1 A;  3ODB A;  4WKM A;  4YMA A;  4F1U A;  4N13 A;  2I0C A;  1SVX B;  2ONK E;  1ZJL A;  2RC8 A;  4IGR A;  4OES A;  3ECR A;  4XKN A;  4IO6 A;  3RPL A;  4EQ9 A;  3PPR A;  1LAH E;  4H0W A;  1B2H A;  3L6H A;  1OVB A;  5EQ7 A;  1H76 A;  1VE4 A;  1UIV A;  2NWJ A;  2OK2 A;  4QFO A;  3MPL A;  4QSC A;  2NVU B;  1FPF A;  5I84 A;  4HXV A;  4U4X A;  2F3D A;  3IK6 B;  5IZ3 B;  4GWU A;  2GHB A;  1Q9D A;  1FTJ A;  3S9M C;  1MPC A;  3MWB A;  3RPL B;  3PPN A;  4IGT A;  3QAX A;  4IO5 A;  2GHA A;  3W9W A;  3OO9 A;  2V3Q A;  3WAF A;  4GXA A;  3LV0 A;  1DTG A;  4C0R A;  3MAM A;  3FBP A;  4F19 A;  3IB1 A;  5JEI A;  1FBH A;  5CI5 A;  1SD3 A;  4G8H A;  3K2D A;  3VDF A;  1VDW A;  5AA2 D;  4BDR A;  2DE4 A;  5EYF A;  5AA1 A;  1MM7 A;  3MVX A;  2LAO A;  3CFZ A;  4QHQ A;  1P1N A;  2XA5 A;  3HHG A;  1MRP A;  2DE3 A;  2XWO A;  1ZU0 A;  1A40 A;  1FJ9 A;  3O9P A;  1XHY A;  3VXB A;  3G3F A;  4YZZ A;  4MJO A;  2O7U A;  3LUZ A;  1FBE A;  3TCF A;  1FPK A;  4KFQ A;  3K1P A;  4G68 A;  2O1M A;  3G3H A;  1P99 A;  2F7A A;  2RCB A;  1IMD A;  4HTG A;  3KJ7 A;  4H5G A;  2B3B A;  3CHG A;  2CZL A;  3GYY A;  2VGQ A;  2HFB A;  3Q28 A;  4JXI A;  5CRY A;  2OJT A;  3FJM A;  5EHS A;  4KXP A;  1ANF A;  4XTC Q;  3T9U A;  3EHT A;  1LEV A;  1FPE A;  4DXB A;  3KGC A;  4H1X A;  1I6Q A;  1LAF E;  3IFA A;  3SET A;  5DVF A;  1A8F A;  3K6W A;  5KDT A;  4HW8 A;  3UIF A;  4JVC A;  3H7M A;  3CIJ A;  4OFO A;  2VPN A;  3S4U A;  3H6V A;  4JWY A;  4GVO A;  1PBP A;  4KR5 A;  4GWX A;  5L9M A;  1S50 A;  4WED A;  3KFM A;  3O6I A;  4DXU A;  1NUY A;  1TT1 A;  5FHO A;  5B70 A;  3FGS A;  2O84 X;  3K1N A;  2Y7W A;  1UTB A;  4R9F A;  4IO4 A;  3TMG A;  4JBZ A;  5I59 B;  2O1L A;  2F34 A;  4R2B A;  1UTH B;  1N76 A;  3K4U A;  3SDF A;  2O69 A;  4OTE A;  2QJE A;  4HE0 A;  4PE5 B;  4PBQ A;  3PTY A;  1K9Z A;  1UQW A;  4POW A;  1UTB B;  4OYV A;  4H65 A;  1JP4 A;  4YKI A;  4DE8 A;  2QSX A;  1FQB A;  3R26 A;  1OLA A;  4MH5 A;  3UA8 A;  4PDD A;  1R1N A;  1MQD A;  2RKM A;  2GRV A;  1NNF A;  4LA9 A;  1GVC A;  3HO7 A;  3QUF A;  2IA4 A;  4IO7 A;  4PE3 A;  1MXX A;  4NF8 A;  1DCU A;  2UYE A;  2KLF A;  4GD5 A;  3S9N C;  3ZS6 A;  3KC0 A;  1LBB A;  2FVZ A;  4R72 A;  4QSE A;  3H03 A;  2DQV A;  4N6K A;  4LP2 B;  4R9G A;  3H6T A;  3UP9 A;  5H8H B;  4IY5 A;  1Z7M E;  4IB2 A;  5A5L A;  4GXS B;  4PFW A;  1JVY A;  3EHS A;  4ZED A;  3FVG A;  4FIM A;  1SBP A;  2FIX A;  3RN8 A;  2H4I A;  4PFI A;  2E1S A;  1USY H;  3IOW A;  1MPB A;  1Y9U A;  3CVG A;  1YAE A;  2B65 A;  2AYS A;  2HZL A;  3SEY A;  1FTM A;  5FTI A;  1KA0 A;  2OCU A;  1FBP A;  3OEL A;  3EN3 A;  2FNC A;  2B4M A;  3U94 A;  4H67 A;  4TQU Q;  4LZ7 A;  1B3L A;  4PC9 A;  2H98 A;  4O3B A;  4LAT A;  1AOV A;  1EH3 A;  3PUZ E;  3K02 A;  2KQZ A;  5EYH A;  3N94 A;  1H43 A;  4N91 A;  2DS9 A;  3PUV E;  3R6U A;  4MMP A;  2OWS A;  2VD2 A;  3RLF E;  4ELP A;  2XXY A;  2DWJ A;  2PYY A;  1B0L A;  3K00 A;  3AXF A;  1MY1 A;  4GWW A;  5DYH A;  1FTA A;  2PFZ A;  3BKI B;  2DYX A;  1SDX A;  4O7I A;  2I3W A;  3IO4 A;  1PB7 A;  3MP1 A;  3OEN A;  5AA4 A;  4F3P A;  3O97 A;  2GQ1 A;  1Y1Z A;  5B7D A;  2G29 A;  1TWY A;  2F7C A;  3K6U A;  1B3F A;  4GF8 A;  4PFY A;  4EQB A;  3LSW A;  3IFC A;  3MP6 A;  3OEM A;  1FQE A;  3VFJ A;  3PV0 E;  3SES A;  4Q5T A;  3TEP A;  1B52 A;  2R6G E;  5FTH A;  1NV6 A;  2DVZ A;  2CEX A;  3T1B A;  1AL3 A;  1IQ7 A;  2XXT A;  1URG A;  1H3D A;  3DEL B;  1NL5 A;  1WVJ A;  1ELJ A;  4LZ5 A;  3BIH A;  3N5L A;  3V83 A;  2Q8J A;  1N7X A;  4KCD A;  1D9Y A;  4OHN A;  1PDA A;  4QFN A;  1JW5 A;  2OBG A;  4KYE A;  1Y4T A;  1FSA A;  1ZTY A;  2RF1 A;  2XXI A;  2HAV A;  4PFR A;  4F1V A;  3U65 A;  1QW0 A;  2Z8F A;  4EF2 A;  1MG1 A;  4PTK A;  5DW8 A;  3KSX A;  4OAN A;  4G61 A;  2B3F A;  5L9O A;  3VV5 A;  1O7T A;  4PAK A;  2XXH A;  1QUL A;  4QRZ A;  5F1Q A;  2Y7R A;  1POT A;  5IKB A;  1JQF A;  5IM2 A;  1D3K A;  1LBY A;  1XC1 A;  3FIR A;  4OZ9 A;  3BFU A;  5HM4 B;  1ZBM A;  5I2N B;  5F7V A;  1BIY A;  5ET6 A;  5CMK A;  1FPD A;  1B05 A;  3MW0 A;  4PCD A;  4F22 A;  5J1D A;  3PPO A;  5HPQ A;  5IAI A;  2THI A;  3KZG A;  2CEY A;  1NV7 A;  3PD9 A;  1FBF A;  1QVS A;  2H5Y A;  2ZNU A;  1Y4C A;  4LON B;  3EQ1 A;  1IMB A;  2ABH A;  5ICT A;  4ZE8 A;  2ZNT A;  2F36 A;  2Q89 A;  1NV4 A;  2X7Q A;  3MC2 A;  5CBS A;  4U2R A;  4GWZ A;  1OQH A;  1JET A;  3FXU A;  3LBS A;  1NKX A;  5DVI A;  3EPE A;  2UYF A;  4G77 A;  2DXR A;  4N6P A;  1L5T A;  2FHY A;  4ZEI A;  4PGP A;  2Q9T A;  2NOO A;  5T3J A;  4R75 A;  2ZZW A;  4I8C A;  3C9H A;  4GX4 A;  4AB6 A;  1LAG E;  4X1B A;  3CG3 A;  1BP5 A;  2F78 A;  4PDH A;  3SEU A;  2DWH A;  2VOZ A;  4AB5 A;  2ZZV A;  1A55 A;  4NF6 A;  1SPI A;  3KJT A;  4Z0I A;  2O68 A;  4RXL A;  1US4 A;  3CR9 A;  4ZEC A;  4GOT A;  4F1Y A;  5I2K A;  2WYP A;  1NV2 A;  1MH3 A;  5FHN A;  3TTN A;  4NWC A;  4MBP A;  1LCT A;  2REG A;  1MXY A;  2P1S A;  4K3F A;  3HPI A;  2DE2 A;  3IOU A;  4OMB A;  1EYJ A;  3UN6 A;  1CE2 A;  3G3J A;  1O63 A;  4P1E A;  4U4S A;  2PT2 A;  3TTK A;  2CMO A;  4X9T A;  5I2K B;  2ZNS A;  4I40 A;  5TP9 A;  4AS4 A;  5BWJ A;  2CZH A;  5H8N A;  1P1U A;  3IR1 A;  3TQW A;  2R71 A;  3FVN A;  3BIG A;  2XXW A;  4PF6 A;  3HN0 A;  2PVU A;  2ALU A;  1NI9 A;  2QMX A;  4P9K A;  2V3T A;  2YPN A;  3RUM A;  4JVD A;  4OVQ A;  4DI3 D;  3PPP A;  1LCF A;  3OO7 A;  4XFE A;  1MS7 A;  1DPP A;  2XXP A;  4ZEK A;  1B51 A;  3T22 A;  1POY 1;  4PGN A;  4MHF A;  4ZZE A;  4NF4 A;  4C1T A;  2F97 A;  4ZEF A;  2D5W A;  5KZT A;  4POX A;  2Y7K A;  3FZV A;  3E79 A;  2L5V A;  3I6V A;  3NOH A;  4XKR A;  3T96 B;  3VLW A;  3T9H B;  3N26 A;  3GLB A;  1TFA A;  1D9Q A;  1G0I A;  1LLS A;  2F6G A;  3TCG A;  4NF4 B;  1R9Q A;  2QFL A;  3TKD A;  3A3U A;  2DSF A;  3OOA A;  4R6H A;  3TDJ A;  3MVY A;  1XVY A;  3KBZ A;  3RTW B;  4OFL A;  1Y3P A;  4G68 B;  2W7Y A;  2V93 A;  4LZ8 A;  2FA7 A;  3ZKK A;  5DT6 A;  3TAJ A;  4PFU A;  1Y3N A;  1FCK A;  3Q26 A;  4U22 A;  1BKA A;  4F39 A;  1P1W A;  3IOV A;  1MQH A;  2QVR A;  2HAU A;  1MPD A;  2HZK A;  3THI A;  4XKP A;  1OIB A;  5ET8 A;  5FBP A;  5KDT B;  5CM6 A;  4RY1 A;  4LVQ A;  4M1V A;  4TOZ A;  4LQ2 A;  3O28 A;  1VFE A;  3IL1 B;  4OVP A;  3IJX B;  4H45 A;  3FUZ A;  2HEU A;  4MCO A;  3T9V A;  2Q74 A;  4RPO A;  3D4C A;  2XWV A;  3FD3 A;  4FEB A;  4XKQ A;  1R9L A;  3B7D A;  1D4N A;  4U1O A;  2P3V A;  2H25 A;  4LN5 A;  5ELV A;  4UAC A;  4DLD A;  3C4M A;  4OEU A;  3P7I A;  4ONY A;  3FVO A;  3TTR A;  1MY3 A;  3PPQ A;  3L6G A;  2XXQ A;  4OXV A;  3USD A;  3IAZ A;  3OEK A;  1NUZ A;  1B7U A;  2DP8 A;  3PMX A;  3MPK A;  3JV9 A;  4IO2 A;  5H8Q A;  1LBW A;  1NNT A;  3OO6 A;  2I48 A;  4JVI A;  4P1L A;  2PX1 A;  3SEW A;  1S7Y A;  1UIU A;  1CNQ A;  2F5X A;  4UAB A;  4YKK A;  1YTV A;  1N84 A;  5I7I A;  4KPT A;  2XD2 A;  1PB9 A;  3OSQ A;  4R74 A;  1DPE A;  4H8I A;  3OSR A;  5IGA A;  4NE4 A;  1LBV A;  3CSG A;  2NUV A;  1ZIU A;  1LFI A;  4NF8 B;  5J16 A;  2XXK A;  3RY3 A;  2XXX A;  3CI8 A;  4O3C A;  1DK4 A;  1KA1 A;  4GFR A;  1JW1 A;  1FPI A;  2OZZ A;  4RJZ A;  1B5I A;  1M5F A;  3C32 A;  3A3C A;  1RYO A;  1NNP A;  4N4U A;  1IIT A;  2X26 A;  5CC2 A;  4GWO A;  3A29 A;  1USY E;  3T93 B;  1QUI A;  4MLQ A;  4PAF A;  1BTJ A;  3VE1 B;  2ZYO A;  4MNP A;  2DOJ A;  1NUW A;  1Y3Q A;  2I4B A;  2RC7 A;  1IMC A;  1EU8 A;  3FAT A;  2WKY A;  3V8X B;  2F6P A;  4OVS A;  4PP0 A;  3TQL A;  1VFD A;  3W9V A;  2UVJ A;  4ISU A;  1NV1 A;  2AIX A;  4BDO A;  4AQ4 A;  4G8M A;  1MY0 A;  1HSL A;  1IXI A;  2VPO A;  1B5H A;  1SYH A;  3FXB A;  2OPE A;  3K6V A;  4O94 A;  1FQD A;  3EF7 A;  4XF5 A;  2R9J A;  4BLA A;  2UXA A;  2XX9 A;  4N8Y A;  4EQ7 A;  2M8C A;  1OMP A;  2MKZ A;  2O7I A;  4BDM A;  5ITO A;  5I3S A;  4ELR A;  5TPA A;  3VVE A;  1LBX A;  3PU5 A;  2WBD A;  5ITP A;  4MEV A;  1QKB A;  2DVC A;  4RK9 A;  4WXJ A;  2A5T A;  1FRP A;  3PD8 A;  2O6A A;  3S9E A;  4OEV A;  4LQ5 A;  1NV0 A;  4R2F A;  1JVX A;  4IY6 A;  1B58 A;  4QFL A;  4RYA A;  3E78 A;  3E3K A;  4MX6 A;  1FPG A;  2A5S A;  3VLV A;  3SZP A;  5TPA B;  3KEI A;  1FW0 A;  5EQA A;  4Q8R A;  3WAE A;  1LBC A;  4KYD A;  2XD3 A;  4O8M A;  1N3W A;  1N04 A;  5AA4 B;  3U8Q A;  1US5 A;  2DXY A;  3KBR A;  1GTK A;  4YB7 A;  1URS A;  4I3E A;  5CBR A;  4JWX A;  4N15 A;  1DMB A;  3TYH A;  1IIW A;  2RC9 A;  2X7P A;  4OET A;  1PC3 A;  2D3I A;  4P56 A;  3PUY E;  1A54 A;  4BDL A;  4PBH A;  1A7L A;  1INP A;  3HFU A;  4KD5 A;  1IXC A;  1IZ1 A;  2G93 A;  3B6Q A;  5EYG A;  3BBR A;  4MIJ A;  3TTL A;  3ZSF A;  3DP4 A;  1VSO A;  1GR2 A;  4N8G A;  3DP8 A;  5EQ9 A;  4Z7E A;  1IUD A;  4YB5 A;  5I58 A;  2PT1 A;  4FAT A;  1RDY A;  3M3L A;  3S9L C;  1AWB A;  3LR1 A;  3O2A A;  4OEN A;  1SW4 A;  1K9Y A;  3VLU A;  1IXG A;  1VR5 A;  4I3Y A;  1MXV A;  1MXZ A;  3FXR A;  2Y5L A;  2QS1 A;  2QS4 A;  3K6X A;  4H6D A;  3H3G A;  4U1Z A;  4DZ1 A;  1JEU A;  4FEC A;  3E9X A;  4ZS9 A;  4JB7 A;  2QVU A;  3E13 X;  3M3K A;  3CSB A;  4DXC A;  1FBC A;  4QSD A;  4EDP A;  3IB2 A;  1Q1K A;  1FTO A;  2Q2C A;  4P0G A;  2Z23 A;  1B0H A;  5I56 A;  3CFX A;  4FJP A;  1B3G A;  3V89 B;  4P8B A;  3M8U A;  1M5C A;  4FAJ A;  1B6H A;  3HST A;  5AA2 A;  4OVT A;  2Z22 A;  4JWO A;  3CFL A;  3RT6 B;  1SW2 A;  2ZYM A;  1Y1M A;  2ZYK A;  1B3H A;  3FJG A;  4QFP A;  4XIG Q;  2F7B A;  2QMW A;  1H45 A;  4F3G A;  3LSF B;  1ZLQ A;  3TOD A;  4PFB A;  4ND9 A;  5L8D A;  1FPL A;  3O66 A;  5H8F A;  3PMW A;  5KCJ A;  3JZJ A;  5AA2 B;  1B4Z A;  1B9J A;  3I5O A;  2B4L A;  3IX1 A;  1B1X A;  1NMU A;  2HHM A;  1MQG A;  4FE8 A;  4NWD A;  2FBP A;  2JJK A;  1RKM A;  1S9T A;  4UA8 A;  3H06 B;  4NED A;  3IO6 A;  2I0B A;  1AH5 A;  2E0S A;  3JYR A; 
#chains in the Genus database with same CATH homology
 1XI6 A;  3KBZ A;  3KC1 A;  2FIX A;  4PFI A;  3D1R A;  2QVR A;  5IZ3 A;  2HZL A;  4MNC A;  1FBD A;  2HZK A;  5ET8 A;  5FBP A;  1KA0 A;  2PCR A;  1FBP A;  4X8R A;  5CM6 A;  5EQ8 A;  2B4M A;  4M1V A;  4P3L A;  4N6D A;  4PET A;  4PC9 A;  2XWK A;  4NHB A;  4GX6 A;  2WBB A;  2PFY A;  4OVP A;  1EYK A;  2KQZ A;  4H45 A;  5EYH A;  4MCO A;  3MYU A;  2Q74 A;  2XWV A;  4N91 A;  4MMP A;  2DDK A;  4QXD A;  2P3V A;  2FIE A;  4LN5 A;  2CZK A;  4NF0 A;  1YZ0 A;  5LTC A;  2QVV A;  4HCY A;  1IMA A;  2KR0 A;  5JK4 A;  5ESY A;  4H46 A;  4GX3 A;  4GWW A;  1FTA A;  4GBV A;  2PFZ A;  5ET7 A;  1NUZ A;  4O7I A;  1LBW A;  5IZZ A;  4JVI A;  2GQ1 A;  4P1L A;  1CNQ A;  2F5X A;  4QBA A;  4UAB A;  5I7I A;  4PF8 A;  2ZZX A;  1RDX A;  3IFC A;  5IGA A;  1IME A;  2WYK A;  1LBV A;  4OVR A;  2HXR A;  3MST A;  1NV6 A;  4XEQ A;  5I5P A;  2DVZ A;  4IR8 A;  2CEX A;  3T1B A;  4N81 A;  5J16 A;  2XXK A;  3BIH A;  2V4C A;  1DK4 A;  3B8B A;  1NV3 A;  1KA1 A;  1FPI A;  1G0H A;  4HCW A;  1FSA A;  4NQ8 A;  4PFR A;  4N4U A;  4F1V A;  3U65 A;  1RDZ A;  2Y5K A;  3A29 A;  4F1U A;  2R8T A;  4PTK A;  5DW8 A;  4PAF A;  4OAN A;  4GWS A;  4G61 A;  3ROJ A;  4MNI A;  4MNP A;  3RPL A;  1NUW A;  4PAK A;  1IMC A;  4OVS A;  5EQ7 A;  2HPG A;  5IM2 A;  3W9V A;  1NV1 A;  1LBY A;  1FPF A;  4HXV A;  2F3D A;  5IZ3 B;  4GWU A;  2VPO A;  1Q9D A;  5ET6 A;  3FXB A;  3QMF A;  4HE2 A;  1FPD A;  4O94 A;  3RPL B;  4XF5 A;  4PCD A;  3T0J A;  3W9W A;  5J1D A;  2V3Q A;  4N8Y A;  2P3N A;  3LV0 A;  2MKZ A;  2CEY A;  4GBW A;  1NV7 A;  5I3S A;  3FBP A;  1FBF A;  4F19 A;  2WEF A;  1IMB A;  1LBX A;  2WBD A;  1FBH A;  1LBZ A;  1VDW A;  4MEV A;  2DE4 A;  1NV4 A;  1FRP A;  4GWZ A;  4YIC A;  2XA5 A;  1NV0 A;  2WX9 A;  2DE3 A;  3E78 A;  4MX6 A;  4O7M A;  2XWO A;  1FPG A;  1KZ8 A;  3SZP A;  1FJ9 A;  2Q8M A;  1FJ6 A;  1NV5 A;  5EQA A;  2FHY A;  2OX3 A;  4PGP A;  2Q9T A;  4YZZ A;  5F24 A;  5T3J A;  4MJO A;  4O8M A;  3LUZ A;  2ZZW A;  1FPJ A;  1FBE A;  4GX4 A;  1FPK A;  2CZI A;  1YXI A;  4I3E A;  1IMF A;  4OA4 A;  4NN3 A;  4PDH A;  4N15 A;  1IMD A;  3EKI A;  3CHG A;  2ZZV A;  3GYY A;  4KXP A;  4P56 A;  1LEV A;  1FPE A;  4PBH A;  1SPI A;  1INP A;  3HFU A;  3IFA A;  1FBG A;  5EYG A;  5ET5 A;  4JVC A;  4FBP A;  4MIJ A;  2VT5 A;  2BJI A;  4F18 A;  4N8G A;  2VPN A;  4MAG A;  5EQ9 A;  4PAI A;  4X04 A;  2WYP A;  4NX1 A;  1NV2 A;  4GWX A;  1RDY A;  4DI4 B;  1AWB A;  1FPB A;  1NUY A;  1K9Y A;  4HE1 A;  2DE2 A;  1QGX A;  4AS5 A;  1EYJ A;  4I3Y A;  4P1E A;  2Y5L A;  4NAP A;  4X9T A;  4NGU A;  4I40 A;  2F3B A;  4HE0 A;  4AS4 A;  4PBQ A;  3B50 A;  2CZH A;  3RYD A;  4N17 A;  2QVU A;  2OWZ A;  3PTY A;  1EYI A;  1K9Z A;  3BIG A;  1NUX A;  4PF6 A;  1FBC A;  1JP4 A;  1BK4 A;  3ISP A;  1NI9 A;  5LDZ A;  4P9K A;  4P8B A;  2QPQ A;  5IZ1 A;  4JVD A;  2XWI A;  4OVQ A;  4OVT A;  4NG7 A;  4DI3 D;  4PDD A;  4XFE A;  4PGN A;  4PE3 A;  4MHF A;  1DCU A;  1DBZ A;  1YYZ A;  4PFB A;  3KC0 A;  3E79 A;  1FPL A;  2L5V A;  3NOH A;  2FVZ A;  1D9Q A;  2B4L A;  1G0I A;  4N6K A;  2HHM A;  4P47 A;  4GWY A;  2FBP A;  2JJK A;  2QFL A;  5A5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...