1IMAA

Structural analysis of inositol monophosphatase complexes with substrates
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural analysis of inositol monophosphatase complexes with substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 89
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imaA02
5EQAA 5EQ7A 3IFCA 1FJ9A 1LBVA 1RDZA 5F24A 4HE1A 1NUZA 1YYZA 1EYKA 1FRPA 1LBXA 1IMDA 4GWZA 4GWSA 5T3JA 3RPLA 2VT5A 5I3SA 2OX3A 4I40A 1IMFA 1FBEA 4AS5A 1LEVA 5DW8A 2BJIA 1G0IA 1K9YA 3LV0A 2WEFA 3IFAA 4GX4A 2CZHA 5ET8A 1YXIA 1FBCA 4GBVA 1FPBA 4FBPA 3B8BA 1FPKA 1DCUA 1QGXA 2QFLA 2QVVA 1YZ0A 5A5LA 1XI6A 1VDWA 1JP4A 1INPA 2R8TA 5IZ3B 2FIXA 1NUWA 5ESYA 1NV6A 1FBFA 1RDYA 2WBBA 3D1RA 3KC0A 3ROJA 5ET7A 3KBZA 2PCRA 2QVUA 4MJOA 5FBPA 1DK4A 1NV4A 4KXPA 1FJ6A 2FIEA 1FPLA 1FSAA 5IZ1A 4HE2A 4O7IA 5IZ3A 3BIGA 1FPGA 2Y5KA 5EQ9A 4HE0A 5ET5A 1IMBA 1FTAA 1AWBA 1FPIA 1KA0A 1NV2A 4H46A 5EYHA 4I3EA 1K9ZA 1SPIA 4GWYA 1IMCA 3LUZA 2CZKA 2FBPA 2FHYA 3RYDA 4QXDA 1FPFA 2GQ1A 1IMEA 2JJKA 2CZIA 1DBZA 4GBWA 2P3NA 1NV1A 2OWZA 4GWWA 3QMFA 3FBPA 2HHMA 1IMAA 1NV0A 1Q9DA 2F3BA 2Q74A 3BIHA 5EYGA 1KA1A 1KZ8A 2F3DA 1LBWA 2P3VA 5J16A 1NUXA 4GX6A 3T0JA 1FPEA 1LBZA 4AS4A 1NV5A 1NV7A 2WBDA 1EYIA 5LDZA 2Q8MA 1FBGA 1FBDA 3A29A 4GX3A 4I3YA 1NUYA 1LBYA 4IR8A 1EYJA 1BK4A 1G0HA 3KC1A 4GWUA 5ET6A 1FBPA 1D9QA 4GWXA 4N81A 1NV3A 1FBHA 2Y5LA 4PTKA 5EQ8A 2QVRA 3RPLB 1FPDA 4H45A 2DDKA 4G61A 1FPJA 1NI9A 4HXVA 2FVZA 1CNQA 1RDXA
chains in the Genus database with same CATH superfamily
1P1UA 4POWA 3P7IA 3LUYA 2Y7IA 3O9PA 4GWZA 3QXMA 1GR2A 4IO6A 1FBEA 3S9EA 4EQBA 2VPOA 5CBSA 2L5VA 1Y4CA 4KHZE 5FHNA 3GYYA 4OANA 3ZSFA 1VFDA 5I2NA 4KI0E 2A5TA 3OOAA 3TQWA 2PT2A 4XF5A 2REJA 3E13X 1OLAA 4C0RA 3T9XB 5CMMA 1OVBA 3T9UA 2MKZA 2P2AA 3BIGA 1SVXB 3V8XB 1TFAA 4LP2B 4HE0A 4GL8A 4P3LA 4RA1A 5BUUA 4F2OA 1XOCA 2NWJA 4I3EA 3DM0A 2FBPA 2RF1A 5B70A 2PFZA 5FTHA 2UVIA 4GBWA 4OWDA 2XXWA 2AYSA 3RUMA 5TP9A 2XA5A 4Q5TA 4G8HA 1NNFA 4R72A 4PE5B 5JTYB 2M8CA 1LBYA 5KCJB 2V3TA 3ILUB 4U2RA 4PTKA 2Q88A 3RPLB 3MC2A 4G61A 4HXVA 4QFOA 4NF0A 4QSDA 3IFCA 1YYZA 4F3BA 2F7BA 5CMCA 3R6UA 2OX3A 2XWKA 4KYDA 5I57A 1I69A 1FTLA 2F8DA 4X48A 1LGBC 1K9YA 2VPNA 1B0LA 1LFGA 2HPGA 3TCGA 1XC1A 3M8UA 1B5HA 2O69A 2QFLA 1JEVA 2QVVA 5DVJA 3OSQA 3O29A 1PB9A 1AH5A 2ESNA 3CVGA 3C4MA 3GBAA 1MY1A 4R6YA 1IXCA 4LONB 3TTMA 2IEEA 2FYIA 1DK4A 3G3KA 1LAFE 5IZ1A 1MXVA 4YB5A 3FVGA 3KG2A 4JB7A 3MP1A 4ESWA 1IMCA 3CIJA 5EHMA 4N6PA 1LBBA 1B3HA 1B1HA 3SEYA 2ANJA 5BWJA 3OO7A 3UA8A 4I8CA 3G3HA 3MUQA 1Q9DA 1URGA 3K6XA 2VHAA 4MX6A 1DPEA 1B4HA 4HW8A 3C31A 3KN8A 4PFWA 2YPNA 1SI1A 3PPQA 1IIWA 3FXBA 1FBDA 2XXUA 2ZXTA 3U94A 3MW0A 4F39A 1B4ZA 4FJPA 1G0HA 3KOSA 3KJTA 3KC1A 5ET6A 2Z22A 1IITA 4IO2A 5AA1A 1O63A 4GLIA 1YTVA 2F5XA 4GD5A 1BTJA 2OCUA 3IL1B 2RCAA 4UA8A 1JQFA 1QUJA 3ZKKA 4P47A 1IMDA 3IR1A 5T3JA 2O6AA 1PC3A 4X9TA 2HXWA 1IMFA 4G68C 5I2NB 3E78A 2A5TB 5F1QA 4F19A 1Y20A 3H6WA 2ZMBA 4FBPA 4MNCA 1FQCA 1I6BA 5HM4B 3VVDA 3IOUA 1NKXA 2QMWA 1NUWA 3EQ1A 1USYH 1RDYA 2ZNSA 4PAIA 1MG1A 3O66A 4IGTA 1S7YA 4N8YA 5ISUA 2W7YA 3S4UA 1FPIA 1B3LA 4Q0CA 5TP9B 1UTBA 4DCYA 3KSJA 4XEQA 4ZEFA 4GWYA 4NF4A 4QFKA 4P1LA 4DI4B 4PFUA 3UK4A 3CG1A 3BFUA 3KN3A 5L8DA 4EF1A 5TPAA 1B52A 1MQDA 1Y4TA 4MIJA 2I3WA 2XX9A 1FQAA 3PPNA 4DXUA 3T22A 1ZU0A 4AS4A 4DZ1A 5CI5A 1NNTA 4G68A 4IO3A 2D3IA 1LFHA 2I0CA 3MWBA 3OENA 1FBHA 3SERA 3FV1A 1NI9A 2E0SA 5I57B 2FA7A 3T66A 5CBRA 1FRPA 4YMBA 1VR5A 2XX8A 1DTZA 2HCAA 3O6IA 4YMAA 4H67A 4F29A 2AL4A 4OQOA 5FTIA 1POY1 2XXQA 4QBAA 4PDDA 2DOJA 4GX4A 1SI0A 1J1NA 3K1NA 1P99A 2B3FA 3VXCA 1Z7NE 1ZIUA 3CSGA 2XXRA 4N07A 4JWYA 5HBCA 2OLBA 3WAEA 1QW0A 4QFPA 1B05A 1O64A 2OBGA 4F1YA 4ZE9A 1PDAA 4MJOA 1NNKA 2R71A 3M3LA 2IA4A 2Q9TA 4ZDMA 3FASA 4R6KA 5ELVA 3TELA 5I59A 3IOVA 4GOTA 1JW4A 4F3GA 3U92A 2X7PA 1FTJA 3IB2A 3TCHA 1B51A 3TYHA 2P0SA 1DBZA 1A55A 4MHFA 4QRZA 2UVJA 2I6EA 4RXLA 4N8GA 3IK6B 2I48A 3SKPA 2F97A 3IO6A 4I9DA 5IKBA 4FORA 4XKRA 1GV8A 1FBPA 4GWXA 2XXVA 2NXOA 1XS5A 3FATA 3JV9A 4U1ZA 4H5GA 4BDOA 3DP8A 1CNQA 1MQGA 3SEVA 5I56A 3QYTA 5F24A 4LZ7A 5DEXA 1MS7A 3PD9A 2OPDA 3UORA 5DVIA 1P1NA 4M4GA 1B9JA 1JVXA 3OD7A 3LV0A 2WEFA 3VXBA 3PTYA 4ZZAA 5DYHA 4G2ZA 4PQJA 1DMBA 1QULA 4ZEIA 2UYFA 2FIXA 1NV6A 3U65A 1SW2A 2WBBA 4GL0A 4MF3A 4OENA 3RPWA 1UTBB 5FBPA 1EH3A 3V83A 1R9LA 4NF4B 3O6GA 4TLMB 4F18A 1MPDA 2Y7RA 4HCYA 1TT1A 1AMFA 4QF9A 1RYOA 1SD3A 5TPAB 3HN0A 5DT6A 3TZAA 1POTA 2GRVA 3PGFA 3PMXA 1MY3A 4I1DA 2F34A 1MY2A 4M1VA 5AA4A 1FPFA 4JSDA 2X26A 2H98A 4R9GA 2HAUA 4G68B 3OEMA 3HHFA 2KLFA 2DQVA 5I2KB 3IB0A 3BFTA 2Z8FA 4WEPA 1JVYA 3TUSA 3A29A 1A8FA 3HO7A 2QJEA 4MMPA 4N81A 4F2QA 3LBSA 1FPDA 4Z7EA 3C34A 2HFBA 3G3GA 4LA9A 4THIA 4GRKA 4YU0A 1XVXA 1OMPA 3ILTB 4KR5A 4KYSA 1M5EA 3MYUA 2HEUA 4PAFA 3MZBA 3OO8A 4BDLA 1Y1MA 3PPPA 1M5DA 1FPKA 1H45A 3FVKA 3R26A 2NUVA 3Q26A 2QS4A 4FATA 2O1LA 4FIMA 2LAOA 1EU8A 4OMBA 3RTFB 3Q28A 3MP8A 1A7LA 5I59B 1B3FA 1R1NA 3SETA 2VD2A 4MCOA 3T9VA 4NMYA 4LQ5A 4MNPA 1A40A 1D9VA 2DWAA 4YB7A 3T9HB 2Y5KA 1WDNA 4I62A 4R9FA 1B5IA 3MAMA 3C32A 3O2AA 3MBPA 4O3AA 4G8MA 4XKQA 2DYXA 3FXRA 3H4ZA 5H8NA 3QMFA 4H5FA 1QJMA 3RTWB 5KZTA 4N15A 1FTMA 1PBPA 4KCDA 1OIBA 3USDA 2P3VA 3DELB 4H0WA 2WBDA 1A54A 2ALUA 4O8MA 2Q8MA 2UXAA 5I56B 3RT6B 2XWOA 4XIGQ 4TOZA 5DEXB 2XXHA 1VSOA 1BKAA 3FGSA 1M5CA 1NFTA 3MPLA 5LOMA 2FVZA 3PUXE 4MLQA 5EQ7A 4BDRA 1B40A 2G29A 3HV1A 3TDJA 1HSEA 4IO7A 4OVTA 4ISUA 4X04A 3ZKLA 2OJTA 4QHQA 4ZEBA 1IEJA 1Y1ZA 3EPEA 5H8QA 3G3FA 4PBQA 1NMUA 2DE3A 3MJNA 3PUVE 3JZJA 3M3FA 3T96B 1INPA 5ICQA 1GVCA 4ZZEA 5DTBA 4MFIA 4H65A 1BLFA 2ZYNA 4FEDA 1VFEA 2GFEA 2FIEA 1EZPA 4L17A 5IZ3A 3PU5A 4IGRA 4ELRA 4HS7A 4NAPA 1FW0A 1KA0A 1B3EA 1N76A 5ITOA 1FQDA 3K6UA 1CB6A 2PFYA 2UYEA 2JJKA 2B65A 3KFMA 1MH4A 1SQYA 4Q30B 1YCJA 3FZVA 3UP9A 3DP6A 2D21A 4AB6A 2DWIA 2F3DA 3U93A 1N3WA 3B6QA 4GXAA 3T0JA 1H43A 1P1QA 4X1DA 2QS1A 5LDZA 2R9JA 4NWDA 1P1WA 2NVUB 1IXIA 1MH3A 3MZ9A 4OA4A 3TTNA 4MAGA 4NF5A 2QVRA 3UIFA 4QFNA 5H8FA 3SDFA 3O6HA 3H06B 5M2VA 1URSA 1URDA 4JXIA 1SW1A 4U22A 3R7XA 2BJIA 1TXFA 4WEDA 3VDFA 2F35A 3KGCA 4PBHA 1EZOA 1B3GA 4U1OA 3FUZA 3H03A 2PMSA 4GBVA 4MBPA 3V5AA 3EF7A 3PMWA 4U21A 3G7WA 2V84A 3GBBA 1JP4A 3VLWA 2G93A 3RY3A 1ZTYA 4XTCQ 2Z23A 2OK2A 5K2XA 3KJ7A 1FJ6A 2ONRA 1FPLA 4OVJA 4OESA 3B6TA 2H9BA 4ELQA 2F6PA 3TTKA 3BKIB 1FTAA 4PC9A 5H8NB 3JYRA 5EYFA 2RKMA 1MXXA 3FIRA 2FHYA 4YB6A 3TTRA 4IO5A 4LUBA 2GQ1A 1IMEA 1BIYA 2DVCA 4G77A 4GWWA 2HHMA 2H99A 4H1XA 4YKKA 3H6TA 3I6VA 2E1SA 4N17A 4NEDA 1NV5A 4GIZA 4EXLA 1LLSA 3PPRA 3IB1A 4IR8A 1BK4A 3N94A 2PYYA 4POXA 5L9OA 1YAEA 1M5FA 1D4NA 3SEUA 1LCTA 4MH5A 1FPJA 1LAHE 1N3XA 1LBVA 4RPNA 4HE1A 2Y7WA 3HHGA 4PCDA 1MDP1 3CI8A 3SEWA 2AIXA 2OWSA 5H8QB 1MXUA 4BDQA 4I40A 4OXVA 1MM7A 4G8NA 3K1MA 4YAHX 4MNIA 1G0IA 1USYE 3CFLA 2XXXA 4OFOA 4JVCA 2Q89A 2ZYKA 1DCUA 4E0WA 1B7HA 4EUOA 4OHNA 1QGXA 1WODA 1YZ0A 1XI6A 2ABHA 1NL5A 5IZ3B 1US4A 5ESYA 3TCFA 2ZYOA 1PB8A 3ROJA 4PF8A 1FQFA 3G3IA 4JWOA 3K02A 3V89B 4LVQA 3K01A 3OMBA 2ZZVA 4AB5A 1SW5A 1YPNA 4LN5A 1AIVA 2XXTA 5ET5A 3QAXA 3IAZA 2B4LA 4JSOA 5ICTA 2Q2CA 3C33A 3Q29A 1ATGA 3MP6A 4RK9A 3RYDA 2DS9A 2QSXA 4N4UA 2CZLA 5A5XA 3BBRA 4O7MA 1L5TA 1KA1A 4IO4A 3A09A 1JEUA 4C1TA 1Y3NA 4GQOA 1LBZA 3IJXB 2QPQA 4GX3A 4I3YA 5H8FB 2QMXA 3W9WA 1DPPA 2B4MA 4BLAA 4ZEKA 3KSXA 1D9QA 1IZ1A 1XHYA 4R2FA 2UVGA 3CHGA 3D4GA 1QUIA 1FJ9A 3MVXA 2QL3A 1NUZA 5I7IA 3M3KA 2H25A 1B58A 5DW8A 2O1MA 4H8IA 2PX1A 4MLVA 1AOVA 4YICA 5CMBA 2WKYA 3IFAA 1QVSA 5ET8A 1YXIA 3LSLA 1PEBA 3ODBA 4RJZA 1FBFA 1MY0A 2XXPA 1D9YA 3S9MC 2H4IA 3PMVA 4ZEDA 1NV4A 1ZMGA 3QIMA 4IY6A 1OQGA 3F11A 4KFQA 3S2VA 3LC8A 5I84A 3CFXA 2PT1A 5AA2A 4DI3D 2F36A 3H7MA 4YKPA 2HAVA 1UTHA 1LBCA 2ZYMA 2CZIA 1HSLA 4FECA 2OPEA 4KQPA 4ONYA 3KZGA 5AE4A 4GFRA 2FNCA 3CR9A 5KCJA 5J16A 4DE8A 4QSCA 5CRYA 2ZZXA 5DVFA 4UACA 4ZECA 3IO4A 3G3JA 1MPBA 4Z0IA 3OO9A 5L9MA 4GVOA 1DTGA 1M5BA 4PETA 4GWSA 5H8SA 2XWIA 3N6UA 2Y84A 3VE1B 3N26A 4R2BA 1I6QA 2I58A 3TTLA 1I6AA 3VLUA 2F6GA 3Q27A 4O94A 4WXJA 3RN8A 3PUYE 4P0GA 3H6VA 3B8BA 3TPAA 4E0XA 4NF6A 4XKPA 4U23A 3EKIA 3K6WA 4HCWA 1BP5A 4JBZA 1SBPA 3AXFA 5H8HA 1IXHA 3QUJA 4OFJA 3FVOA 3MVYA 2HZKA 3N6TA 1MQJA 5A5XB 4N6KA 3HPIA 3QK6A 4H46A 1OLCA 4FE8A 4PFTA 1SPIA 1ANFA 2CZKA 1MQIA 1ZLQA 1LSTA 4PFYA 4O3BA 3KN7A 3FXQA 2HQ0A 3GZGA 4GF8A 5JEIA 1NV0A 5EYGA 3HSTA 2Y7PA 3VV5A 3RLFE 1NUXA 3UN6A 4GXSB 4TQUQ 3RT8A 4DIGA 2V93A 3OO6A 2ONKE 4G4PA 4GWUA 4F1VA 4KD5A 2Q2AA 4N91A 5B7DA 4JWXA 1NV3A 2Y5LA 1FQEA 4H45A 3MPKA 3E4RA 2DXYA 2B3BA 1ZKBA 2RCBA 1NNPA 1NH7A 3PD8A 1LCFA 4NQ8A 4PDHA 1WVJA 4NN3A 2Q8JA 3T1BA 3THIA 2I3VA 1LEVA 4JDFA 1P1OA 1B32A 4OVPA 4NHBA 5IGAA 3OELA 1MM6A 2CZHA 3FVNA 5CM6A 2VD3A 3D4CA 1FBCA 3C9HA 4FEBA 2DSFA 3VVEA 4FAJA 5AA3A 2O84X 1TFDA 2CEXA 2DWJA 3TODA 2YLNA 5AA2B 5J1DA 2CEYA 4OEUA 2PCRA 3MZ1A 4KPTA 2QVUA 2NOOA 4AQ4A 4KXPA 1UTHB 1N7XA 4LZ5A 3DLNA 4P8BA 4XKNA 1AWBA 3K2DA 4LZ8A 4RPOA 1N7WA 5I58A 3S9LC 3LUZA 1LB8A 1H3DA 4NX1A 2V25A 2P3NA 3LSWA 2RINA 1RYXA 4UABA 4IY5A 4EDPA 4DDDA 2GH9A 3IJOB 3LSXA 3C35A 5AA4B 1LBWA 1GGGA 4H6DA 3I3VA 4GX6A 1IXGA 1GTKA 1NV7A 2VOZA 4NE4A 1S50A 1R9QA 1SDXA 2VP1A 3N5LA 1Y3PA 1OVTA 3IOWA 1FQBA 5EQAA 2XWVA 3ECRA 1Q1KA 2RC7A 3MVWA 2V3QA 4RY1A 2REGA 3ONMA 1JW1A 4O3CA 1ELJA 3A3CA 1JETA 4NF6B 2F78A 1B1XA 1B46A 1B7UA 1XVYA 5I5PA 4RNSA 3K6VA 5H8HB 2DVZA 2Z8EA 2X7QA 3IOTA 4OVSA 3W15C 1QUKA 4F31B 4HTGA 5ET7A 2XD3A 1D3KA 3H3GA 4EQ9A 3H6UA 3K4UA 3HFUA 5TU0A 1FCKA 1RKMA 2WX9A 4R6HA 1N84A 2GHAA 5IZZA 4JVIA 4DLDA 1MRPA 1LB9A 2XXYA 1IMBA 4Q8RA 5EYHA 2Y7KA 1K9ZA 4X1BA 3TFLA 4F3SA 2PBWA 2I4CA 5IAIA 2CMOA 3K1PA 1DSNA 1FTKA 1IMAA 2F3BA 1NH8A 4OTEA 4DXBA 1Q35A 1PB7A 2PVUA 3VFJA 3TKDA 3RNNA 4X8RA 1FBGA 2Z8DA 1MQHA 4N6DA 3DP4A 1A99A 3U1OA 1MPCA 3L6HA 4KCCA 5HPQA 1JNFA 5FHMA 3KC0A 3NOHA 2QS2A 1EYKA 1Y3QA 1Z7ME 2I49A 1B6HA 3K00A 5CMKA 4PFRA 2XHDA 5L9SA 3FD3A 1B0HA 4K3FA 1HSJA 4NG7A 2F7AA 4YZZA 4P9KA 4LQ2A 3SZPA 4YKIA 3PUWE 3HCQA 3E9XA 4P56A 2ZNTA 3TEPA 3FV2A 4F22A 3WAFA 3OXNA 2DP8A 3KEIA 5JK4A 1SW4A 2R8TA 3LR1A 1R6ZA 1LAGE 3D1RA 1JW5A 2THIA 4OZ9A 2XXIA 4R74A 5I58B 3LSFB 2YJPA 4OFLA 1PBQA 3W9VA 1MY4A 1NV2A 1DOTA 5F7VA 1II5A 3Q25A 4PGPA 2AL5A 4QXDA 4RYAA 3MSTA 5KDTA 1UQWA 5I2KA 1B2HA 1XT8A 3RQTA 2OWZA 3QUFA 2HXRA 2Q74A 1US5A 2I0BA 4R75A 4YKJA 4ELPA 2O7IA 4EF2A 2V4CA 3SESA 3EN3A 1N0TA 1EYIA 1FTOA 2OWTA 2BJJX 2QRYA 3B6WA 4OVQA 3U8QA 4OVRA 1IUDA 2P1SA 4NTLA 4C1UA 1T0KA 1QKAA 3E3KA 3KBZA 1RDXA 3CG3A 2UVHA 4LATA 2DWHA 2O51A 1RDZA 3GXAA 3VVFA 1LBXA 2KQZA 4PGNA 2R6GE 5IM2A 4NF5B 2DE2A 4MEVA 2VT5A 3QSLA 4NF8A 3CFZA 4U4XA 4OYVA 1O7TA 1Y9UA 2F7CA 2I4BA 5AA2D 4GWOA 4NGUA 3IX1A 2V3UA 2DXRA 3S9NC 5A5LA 1VDWA 4EXKA 1SYHA 2XX7A 3U72A 3ISPA 3FXUA 1VE4A 1H44A 3KOTA 3CRBA 4QFLA 4ELOA 1TWYA 2D5WA 3KBRA 4P1EA 3MVZA 3TQLA 3K0VA 4OEVA 1ZBMA 4ECFA 3TAJA 4PE3A 1IQ7A 1F9BA 4DCXA 3CSBA 2QS3A 3B50A 3FBPA 4DXCA 3VLVA 2A5SA 2ONSA 3FJGA 4H8JA 3PUZE 1QKBA 4ND9A 1S9TA 1FPEA 5FHOA 3T93B 4QSEA 3UGWA 4ESXA 1NUYA 3FJ7A 1EYJA 5CC2A 4R73A 1UIVA 2KR0A 2DDKA 1EZ9A 4WKMA 4PAKA 5JTYA 1A8EA 1MXWA 3O28A 2WYKA 3MQ9A 3IORA 5ITPA 3RPLA 5I3SA 1CE2A 4AS5A 4RK2A 4KYEA 4XFEA 3GLBA 4OERA 3ZS6A 4P0IA 4U4SA 1OQHA 2VGQA 1UIUA 2GHBA 5LTCA 4ZE8A 1FPBA 2RC8A 3B7DA 3L6GA 4ZS9A 2DE4A 2HZLA 1H76A 4F1UA 1ZJLA 1AL3A 4PFBA 1MXZA 4BDMA 1MDQA 4TLLB 1FSAA 3E79A 4HE2A 4O7IA 1KWHA 3SEXA 1FPGA 3C36A 4P11A 5KDTB 5EQ9A 4PFIA 1LFIA 4BDNA 2WYPA 1MXYA 3RGYA 3FJMA 4N13A 4F3PA 5EHSA 1B5JA 1NV1A 3O97A 4JVDA 3EHUA 4IB2A 3EHTA 3BIHA 3OEKA 3EHSA 1KZ8A 4OETA 3PV0E 4EQ7A 1N04A 3A3UA 2O68A 2ZNUA 4XXUA 4NWCA 3OSRA 5K2YA 3I5OA 1B7ZA 2XD2A 4PP0A 2H5YA 2RC9A 2XXKA 1LAXA 2O7UA 2ZZWA 5EQ8A 3TMGA 3PPOA 2OZZA 1SYIA 4NF8B 4PF6A
chains in the Genus database with same CATH topology
5EQAA 2XWVA 1LBVA 5F24A 4HE1A 4PCDA 2V3QA 4GWZA 4I40A 1FBEA 2VPOA 4MNIA 2L5VA 1G0IA 4JVCA 3GYYA 3LV0A 4OANA 2WEFA 3PTYA 5I5PA 1DCUA 1QGXA 1YZ0A 2DVZA 1XI6A 4OVSA 4XF5A 5IZ3B 2FIXA 5ESYA 1NV6A 3U65A 2WBBA 3ROJA 4PF8A 5ET7A 5FBPA 2ZZVA 3HFUA 4F18A 2MKZA 2WX9A 4HCYA 3BIGA 4LN5A 5IZZA 4JVIA 4HE0A 5ET5A 4P3LA 1IMBA 2B4LA 5EYHA 4I3EA 1K9ZA 2FBPA 3RYDA 4M1VA 2PFZA 1FPFA 4N4UA 4GBWA 1IMAA 2XA5A 4O7MA 2F3BA 1KA1A 1LBZA 2QPQA 4X8RA 1FBGA 3A29A 4GX3A 4I3YA 1LBYA 3W9WA 4N6DA 2B4MA 1D9QA 4MMPA 4N81A 4PTKA 3RPLB 1FPDA 4G61A 4HXVA 3CHGA 3KC0A 4NF0A 3NOHA 3IFCA 1FJ9A 1NUZA 1YYZA 1EYKA 5I7IA 4PFRA 2OX3A 2XWKA 5DW8A 4NG7A 4YZZA 4P9KA 1K9YA 3SZPA 4YICA 3MYUA 3IFAA 4PAFA 5ET8A 4P56A 1YXIA 2VPNA 1FPKA 2HPGA 2QFLA 2QVVA 5JK4A 2R8TA 1FBFA 3D1RA 1DK4A 1NV4A 4MCOA 4MNPA 5IZ1A 2Y5KA 3W9VA 4DI3D 1NV2A 1IMCA 4PGPA 4QXDA 3MSTA 2CZIA 2OWZA 3QMFA 1Q9DA 2HXRA 2Q74A 4N15A 4MX6A 5J16A 2P3VA 2V4CA 2WBDA 1EYIA 4O8MA 2ZZXA 2Q8MA 3FXBA 1FBDA 4OVQA 4OVRA 1G0HA 2XWOA 3KC1A 5ET6A 2F5XA 2FVZA 3KBZA 1RDXA 5EQ7A 1RDZA 1LBXA 2KQZA 4P47A 1IMDA 4PGNA 4PETA 5IM2A 4GWSA 5T3JA 2DE2A 4MEVA 2VT5A 4X9TA 2XWIA 1IMFA 4OVTA 4X04A 3E78A 4O94A 4F19A 4FBPA 4PBQA 3B8BA 4NGUA 2DE3A 4MNCA 5A5LA 1VDWA 3EKIA 1INPA 4HCWA 1NUWA 3ISPA 1RDYA 4PAIA 2FIEA 5IZ3A 2HZKA 4N8YA 4NAPA 4P1EA 4N6KA 1FPIA 1KA0A 4H46A 4XEQA 1SPIA 4GWYA 2CZKA 4P1LA 2PFYA 4PE3A 4DI4B 2JJKA 3B50A 3FBPA 1NV0A 4MIJA 5EYGA 2F3DA 1NUXA 3T0JA 1FPEA 4AS4A 5LDZA 1NUYA 1EYJA 4GWUA 4OA4A 4F1VA 4N91A 1NV3A 1FBHA 2Y5LA 2KR0A 4MAGA 2QVRA 4H45A 2DDKA 4PAKA 1NI9A 4NQ8A 4PDHA 4NN3A 1FRPA 3T1BA 2WYKA 3RPLA 5I3SA 4AS5A 1LEVA 2BJIA 4XFEA 4QBAA 4OVPA 4NHBA 4PBHA 4PDDA 5IGAA 4GX4A 5CM6A 2CZHA 5LTCA 1FBCA 4GBVA 1FPBA 2DE4A 2HZLA 2CEXA 1JP4A 4F1UA 5J1DA 2CEYA 2PCRA 2QVUA 4MJOA 4PFBA 4KXPA 1FJ6A 1FPLA 1FSAA 3E79A 4HE2A 4O7IA 1FPGA 2Q9TA 5EQ9A 4PFIA 4P8BA 1FTAA 4PC9A 1AWBA 2WYPA 3LUZA 2FHYA 2GQ1A 1IMEA 4NX1A 1DBZA 2P3NA 1NV1A 4MHFA 4GWWA 4JVDA 4UABA 2HHMA 3BIHA 1KZ8A 4N8GA 1LBWA 4GX6A 4N17A 1NV5A 1NV7A 4IR8A 1BK4A 2XXKA 1FBPA 4GWXA 2ZZWA 5EQ8A 1FPJA 4PF6A 1CNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQA A;  5EQ7 A;  3IFC A;  1FJ9 A;  1LBV A;  1RDZ A;  5F24 A;  4HE1 A;  1NUZ A;  1YYZ A;  1EYK A;  1FRP A;  1LBX A;  1IMD A;  4GWZ A;  4GWS A;  5T3J A;  3RPL A;  2VT5 A;  5I3S A;  2OX3 A;  4I40 A;  1IMF A;  1FBE A;  4AS5 A;  1LEV A;  5DW8 A;  2BJI A;  1G0I A;  1K9Y A;  3LV0 A;  2WEF A;  3IFA A;  4GX4 A;  2CZH A;  5ET8 A;  1YXI A;  1FBC A;  4GBV A;  1FPB A;  4FBP A;  3B8B A;  1FPK A;  1DCU A;  1QGX A;  2QFL A;  2QVV A;  1YZ0 A;  5A5L A;  1XI6 A;  1VDW A;  1JP4 A;  1INP A;  2R8T A;  5IZ3 B;  2FIX A;  1NUW A;  5ESY A;  1NV6 A;  1FBF A;  1RDY A;  2WBB A;  3D1R A;  3KC0 A;  3ROJ A;  5ET7 A;  3KBZ A;  2PCR A;  2QVU A;  4MJO A;  5FBP A;  1DK4 A;  1NV4 A;  4KXP A;  1FJ6 A;  2FIE A;  1FPL A;  1FSA A;  5IZ1 A;  4HE2 A;  4O7I A;  5IZ3 A;  3BIG A;  1FPG A;  2Y5K A;  5EQ9 A;  4HE0 A;  5ET5 A;  1IMB A;  1FTA A;  1AWB A;  1FPI A;  1KA0 A;  1NV2 A;  4H46 A;  5EYH A;  4I3E A;  1K9Z A;  1SPI A;  4GWY A;  1IMC A;  3LUZ A;  2CZK A;  2FBP A;  2FHY A;  3RYD A;  4QXD A;  1FPF A;  2GQ1 A;  1IME A;  2JJK A;  2CZI A;  1DBZ A;  4GBW A;  2P3N A;  1NV1 A;  2OWZ A;  4GWW A;  3QMF A;  3FBP A;  2HHM A;  1IMA A;  1NV0 A;  1Q9D A;  2F3B A;  2Q74 A;  3BIH A;  5EYG A;  1KA1 A;  1KZ8 A;  2F3D A;  1LBW A;  2P3V A;  5J16 A;  1NUX A;  4GX6 A;  3T0J A;  1FPE A;  1LBZ A;  4AS4 A;  1NV5 A;  1NV7 A;  2WBD A;  1EYI A;  5LDZ A;  2Q8M A;  1FBG A;  1FBD A;  3A29 A;  4GX3 A;  4I3Y A;  1NUY A;  1LBY A;  4IR8 A;  1EYJ A;  1BK4 A;  1G0H A;  3KC1 A;  4GWU A;  5ET6 A;  1FBP A;  1D9Q A;  4GWX A;  4N81 A;  1NV3 A;  1FBH A;  2Y5L A;  4PTK A;  5EQ8 A;  2QVR A;  3RPL B;  1FPD A;  4H45 A;  2DDK A;  4G61 A;  1FPJ A;  1NI9 A;  4HXV A;  2FVZ A;  1CNQ A;  1RDX A; 
#chains in the Genus database with same CATH topology
 1P1U A;  4POW A;  3P7I A;  3LUY A;  2Y7I A;  3O9P A;  4GWZ A;  3QXM A;  1GR2 A;  4IO6 A;  1FBE A;  3S9E A;  4EQB A;  2VPO A;  5CBS A;  2L5V A;  1Y4C A;  4KHZ E;  5FHN A;  3GYY A;  4OAN A;  3ZSF A;  1VFD A;  5I2N A;  4KI0 E;  2A5T A;  3OOA A;  3TQW A;  2PT2 A;  4XF5 A;  2REJ A;  3E13 X;  1OLA A;  4C0R A;  3T9X B;  5CMM A;  1OVB A;  3T9U A;  2MKZ A;  2P2A A;  3BIG A;  1SVX B;  3V8X B;  1TFA A;  4LP2 B;  4HE0 A;  4GL8 A;  4P3L A;  4RA1 A;  5BUU A;  4F2O A;  1XOC A;  2NWJ A;  4I3E A;  3DM0 A;  2FBP A;  2RF1 A;  5B70 A;  2PFZ A;  5FTH A;  2UVI A;  4GBW A;  4OWD A;  2XXW A;  2AYS A;  3RUM A;  5TP9 A;  2XA5 A;  4Q5T A;  4G8H A;  1NNF A;  4R72 A;  4PE5 B;  5JTY B;  2M8C A;  1LBY A;  5KCJ B;  2V3T A;  3ILU B;  4U2R A;  4PTK A;  2Q88 A;  3RPL B;  3MC2 A;  4G61 A;  4HXV A;  4QFO A;  4NF0 A;  4QSD A;  3IFC A;  1YYZ A;  4F3B A;  2F7B A;  5CMC A;  3R6U A;  2OX3 A;  2XWK A;  4KYD A;  5I57 A;  1I69 A;  1FTL A;  2F8D A;  4X48 A;  1LGB C;  1K9Y A;  2VPN A;  1B0L A;  1LFG A;  2HPG A;  3TCG A;  1XC1 A;  3M8U A;  1B5H A;  2O69 A;  2QFL A;  1JEV A;  2QVV A;  5DVJ A;  3OSQ A;  3O29 A;  1PB9 A;  1AH5 A;  2ESN A;  3CVG A;  3C4M A;  3GBA A;  1MY1 A;  4R6Y A;  1IXC A;  4LON B;  3TTM A;  2IEE A;  2FYI A;  1DK4 A;  3G3K A;  1LAF E;  5IZ1 A;  1MXV A;  4YB5 A;  3FVG A;  3KG2 A;  4JB7 A;  3MP1 A;  4ESW A;  1IMC A;  3CIJ A;  5EHM A;  4N6P A;  1LBB A;  1B3H A;  1B1H A;  3SEY A;  2ANJ A;  5BWJ A;  3OO7 A;  3UA8 A;  4I8C A;  3G3H A;  3MUQ A;  1Q9D A;  1URG A;  3K6X A;  2VHA A;  4MX6 A;  1DPE A;  1B4H A;  4HW8 A;  3C31 A;  3KN8 A;  4PFW A;  2YPN A;  1SI1 A;  3PPQ A;  1IIW A;  3FXB A;  1FBD A;  2XXU A;  2ZXT A;  3U94 A;  3MW0 A;  4F39 A;  1B4Z A;  4FJP A;  1G0H A;  3KOS A;  3KJT A;  3KC1 A;  5ET6 A;  2Z22 A;  1IIT A;  4IO2 A;  5AA1 A;  1O63 A;  4GLI A;  1YTV A;  2F5X A;  4GD5 A;  1BTJ A;  2OCU A;  3IL1 B;  2RCA A;  4UA8 A;  1JQF A;  1QUJ A;  3ZKK A;  4P47 A;  1IMD A;  3IR1 A;  5T3J A;  2O6A A;  1PC3 A;  4X9T A;  2HXW A;  1IMF A;  4G68 C;  5I2N B;  3E78 A;  2A5T B;  5F1Q A;  4F19 A;  1Y20 A;  3H6W A;  2ZMB A;  4FBP A;  4MNC A;  1FQC A;  1I6B A;  5HM4 B;  3VVD A;  3IOU A;  1NKX A;  2QMW A;  1NUW A;  3EQ1 A;  1USY H;  1RDY A;  2ZNS A;  4PAI A;  1MG1 A;  3O66 A;  4IGT A;  1S7Y A;  4N8Y A;  5ISU A;  2W7Y A;  3S4U A;  1FPI A;  1B3L A;  4Q0C A;  5TP9 B;  1UTB A;  4DCY A;  3KSJ A;  4XEQ A;  4ZEF A;  4GWY A;  4NF4 A;  4QFK A;  4P1L A;  4DI4 B;  4PFU A;  3UK4 A;  3CG1 A;  3BFU A;  3KN3 A;  5L8D A;  4EF1 A;  5TPA A;  1B52 A;  1MQD A;  1Y4T A;  4MIJ A;  2I3W A;  2XX9 A;  1FQA A;  3PPN A;  4DXU A;  3T22 A;  1ZU0 A;  4AS4 A;  4DZ1 A;  5CI5 A;  1NNT A;  4G68 A;  4IO3 A;  2D3I A;  1LFH A;  2I0C A;  3MWB A;  3OEN A;  1FBH A;  3SER A;  3FV1 A;  1NI9 A;  2E0S A;  5I57 B;  2FA7 A;  3T66 A;  5CBR A;  1FRP A;  4YMB A;  1VR5 A;  2XX8 A;  1DTZ A;  2HCA A;  3O6I A;  4YMA A;  4H67 A;  4F29 A;  2AL4 A;  4OQO A;  5FTI A;  1POY 1;  2XXQ A;  4QBA A;  4PDD A;  2DOJ A;  4GX4 A;  1SI0 A;  1J1N A;  3K1N A;  1P99 A;  2B3F A;  3VXC A;  1Z7N E;  1ZIU A;  3CSG A;  2XXR A;  4N07 A;  4JWY A;  5HBC A;  2OLB A;  3WAE A;  1QW0 A;  4QFP A;  1B05 A;  1O64 A;  2OBG A;  4F1Y A;  4ZE9 A;  1PDA A;  4MJO A;  1NNK A;  2R71 A;  3M3L A;  2IA4 A;  2Q9T A;  4ZDM A;  3FAS A;  4R6K A;  5ELV A;  3TEL A;  5I59 A;  3IOV A;  4GOT A;  1JW4 A;  4F3G A;  3U92 A;  2X7P A;  1FTJ A;  3IB2 A;  3TCH A;  1B51 A;  3TYH A;  2P0S A;  1DBZ A;  1A55 A;  4MHF A;  4QRZ A;  2UVJ A;  2I6E A;  4RXL A;  4N8G A;  3IK6 B;  2I48 A;  3SKP A;  2F97 A;  3IO6 A;  4I9D A;  5IKB A;  4FOR A;  4XKR A;  1GV8 A;  1FBP A;  4GWX A;  2XXV A;  2NXO A;  1XS5 A;  3FAT A;  3JV9 A;  4U1Z A;  4H5G A;  4BDO A;  3DP8 A;  1CNQ A;  1MQG A;  3SEV A;  5I56 A;  3QYT A;  5F24 A;  4LZ7 A;  5DEX A;  1MS7 A;  3PD9 A;  2OPD A;  3UOR A;  5DVI A;  1P1N A;  4M4G A;  1B9J A;  1JVX A;  3OD7 A;  3LV0 A;  2WEF A;  3VXB A;  3PTY A;  4ZZA A;  5DYH A;  4G2Z A;  4PQJ A;  1DMB A;  1QUL A;  4ZEI A;  2UYF A;  2FIX A;  1NV6 A;  3U65 A;  1SW2 A;  2WBB A;  4GL0 A;  4MF3 A;  4OEN A;  3RPW A;  1UTB B;  5FBP A;  1EH3 A;  3V83 A;  1R9L A;  4NF4 B;  3O6G A;  4TLM B;  4F18 A;  1MPD A;  2Y7R A;  4HCY A;  1TT1 A;  1AMF A;  4QF9 A;  1RYO A;  1SD3 A;  5TPA B;  3HN0 A;  5DT6 A;  3TZA A;  1POT A;  2GRV A;  3PGF A;  3PMX A;  1MY3 A;  4I1D A;  2F34 A;  1MY2 A;  4M1V A;  5AA4 A;  1FPF A;  4JSD A;  2X26 A;  2H98 A;  4R9G A;  2HAU A;  4G68 B;  3OEM A;  3HHF A;  2KLF A;  2DQV A;  5I2K B;  3IB0 A;  3BFT A;  2Z8F A;  4WEP A;  1JVY A;  3TUS A;  3A29 A;  1A8F A;  3HO7 A;  2QJE A;  4MMP A;  4N81 A;  4F2Q A;  3LBS A;  1FPD A;  4Z7E A;  3C34 A;  2HFB A;  3G3G A;  4LA9 A;  4THI A;  4GRK A;  4YU0 A;  1XVX A;  1OMP A;  3ILT B;  4KR5 A;  4KYS A;  1M5E A;  3MYU A;  2HEU A;  4PAF A;  3MZB A;  3OO8 A;  4BDL A;  1Y1M A;  3PPP A;  1M5D A;  1FPK A;  1H45 A;  3FVK A;  3R26 A;  2NUV A;  3Q26 A;  2QS4 A;  4FAT A;  2O1L A;  4FIM A;  2LAO A;  1EU8 A;  4OMB A;  3RTF B;  3Q28 A;  3MP8 A;  1A7L A;  5I59 B;  1B3F A;  1R1N A;  3SET A;  2VD2 A;  4MCO A;  3T9V A;  4NMY A;  4LQ5 A;  4MNP A;  1A40 A;  1D9V A;  2DWA A;  4YB7 A;  3T9H B;  2Y5K A;  1WDN A;  4I62 A;  4R9F A;  1B5I A;  3MAM A;  3C32 A;  3O2A A;  3MBP A;  4O3A A;  4G8M A;  4XKQ A;  2DYX A;  3FXR A;  3H4Z A;  5H8N A;  3QMF A;  4H5F A;  1QJM A;  3RTW B;  5KZT A;  4N15 A;  1FTM A;  1PBP A;  4KCD A;  1OIB A;  3USD A;  2P3V A;  3DEL B;  4H0W A;  2WBD A;  1A54 A;  2ALU A;  4O8M A;  2Q8M A;  2UXA A;  5I56 B;  3RT6 B;  2XWO A;  4XIG Q;  4TOZ A;  5DEX B;  2XXH A;  1VSO A;  1BKA A;  3FGS A;  1M5C A;  1NFT A;  3MPL A;  5LOM A;  2FVZ A;  3PUX E;  4MLQ A;  5EQ7 A;  4BDR A;  1B40 A;  2G29 A;  3HV1 A;  3TDJ A;  1HSE A;  4IO7 A;  4OVT A;  4ISU A;  4X04 A;  3ZKL A;  2OJT A;  4QHQ A;  4ZEB A;  1IEJ A;  1Y1Z A;  3EPE A;  5H8Q A;  3G3F A;  4PBQ A;  1NMU A;  2DE3 A;  3MJN A;  3PUV E;  3JZJ A;  3M3F A;  3T96 B;  1INP A;  5ICQ A;  1GVC A;  4ZZE A;  5DTB A;  4MFI A;  4H65 A;  1BLF A;  2ZYN A;  4FED A;  1VFE A;  2GFE A;  2FIE A;  1EZP A;  4L17 A;  5IZ3 A;  3PU5 A;  4IGR A;  4ELR A;  4HS7 A;  4NAP A;  1FW0 A;  1KA0 A;  1B3E A;  1N76 A;  5ITO A;  1FQD A;  3K6U A;  1CB6 A;  2PFY A;  2UYE A;  2JJK A;  2B65 A;  3KFM A;  1MH4 A;  1SQY A;  4Q30 B;  1YCJ A;  3FZV A;  3UP9 A;  3DP6 A;  2D21 A;  4AB6 A;  2DWI A;  2F3D A;  3U93 A;  1N3W A;  3B6Q A;  4GXA A;  3T0J A;  1H43 A;  1P1Q A;  4X1D A;  2QS1 A;  5LDZ A;  2R9J A;  4NWD A;  1P1W A;  2NVU B;  1IXI A;  1MH3 A;  3MZ9 A;  4OA4 A;  3TTN A;  4MAG A;  4NF5 A;  2QVR A;  3UIF A;  4QFN A;  5H8F A;  3SDF A;  3O6H A;  3H06 B;  5M2V A;  1URS A;  1URD A;  4JXI A;  1SW1 A;  4U22 A;  3R7X A;  2BJI A;  1TXF A;  4WED A;  3VDF A;  2F35 A;  3KGC A;  4PBH A;  1EZO A;  1B3G A;  4U1O A;  3FUZ A;  3H03 A;  2PMS A;  4GBV A;  4MBP A;  3V5A A;  3EF7 A;  3PMW A;  4U21 A;  3G7W A;  2V84 A;  3GBB A;  1JP4 A;  3VLW A;  2G93 A;  3RY3 A;  1ZTY A;  4XTC Q;  2Z23 A;  2OK2 A;  5K2X A;  3KJ7 A;  1FJ6 A;  2ONR A;  1FPL A;  4OVJ A;  4OES A;  3B6T A;  2H9B A;  4ELQ A;  2F6P A;  3TTK A;  3BKI B;  1FTA A;  4PC9 A;  5H8N B;  3JYR A;  5EYF A;  2RKM A;  1MXX A;  3FIR A;  2FHY A;  4YB6 A;  3TTR A;  4IO5 A;  4LUB A;  2GQ1 A;  1IME A;  1BIY A;  2DVC A;  4G77 A;  4GWW A;  2HHM A;  2H99 A;  4H1X A;  4YKK A;  3H6T A;  3I6V A;  2E1S A;  4N17 A;  4NED A;  1NV5 A;  4GIZ A;  4EXL A;  1LLS A;  3PPR A;  3IB1 A;  4IR8 A;  1BK4 A;  3N94 A;  2PYY A;  4POX A;  5L9O A;  1YAE A;  1M5F A;  1D4N A;  3SEU A;  1LCT A;  4MH5 A;  1FPJ A;  1LAH E;  1N3X A;  1LBV A;  4RPN A;  4HE1 A;  2Y7W A;  3HHG A;  4PCD A;  1MDP 1;  3CI8 A;  3SEW A;  2AIX A;  2OWS A;  5H8Q B;  1MXU A;  4BDQ A;  4I40 A;  4OXV A;  1MM7 A;  4G8N A;  3K1M A;  4YAH X;  4MNI A;  1G0I A;  1USY E;  3CFL A;  2XXX A;  4OFO A;  4JVC A;  2Q89 A;  2ZYK A;  1DCU A;  4E0W A;  1B7H A;  4EUO A;  4OHN A;  1QGX A;  1WOD A;  1YZ0 A;  1XI6 A;  2ABH A;  1NL5 A;  5IZ3 B;  1US4 A;  5ESY A;  3TCF A;  2ZYO A;  1PB8 A;  3ROJ A;  4PF8 A;  1FQF A;  3G3I A;  4JWO A;  3K02 A;  3V89 B;  4LVQ A;  3K01 A;  3OMB A;  2ZZV A;  4AB5 A;  1SW5 A;  1YPN A;  4LN5 A;  1AIV A;  2XXT A;  5ET5 A;  3QAX A;  3IAZ A;  2B4L A;  4JSO A;  5ICT A;  2Q2C A;  3C33 A;  3Q29 A;  1ATG A;  3MP6 A;  4RK9 A;  3RYD A;  2DS9 A;  2QSX A;  4N4U A;  2CZL A;  5A5X A;  3BBR A;  4O7M A;  1L5T A;  1KA1 A;  4IO4 A;  3A09 A;  1JEU A;  4C1T A;  1Y3N A;  4GQO A;  1LBZ A;  3IJX B;  2QPQ A;  4GX3 A;  4I3Y A;  5H8F B;  2QMX A;  3W9W A;  1DPP A;  2B4M A;  4BLA A;  4ZEK A;  3KSX A;  1D9Q A;  1IZ1 A;  1XHY A;  4R2F A;  2UVG A;  3CHG A;  3D4G A;  1QUI A;  1FJ9 A;  3MVX A;  2QL3 A;  1NUZ A;  5I7I A;  3M3K A;  2H25 A;  1B58 A;  5DW8 A;  2O1M A;  4H8I A;  2PX1 A;  4MLV A;  1AOV A;  4YIC A;  5CMB A;  2WKY A;  3IFA A;  1QVS A;  5ET8 A;  1YXI A;  3LSL A;  1PEB A;  3ODB A;  4RJZ A;  1FBF A;  1MY0 A;  2XXP A;  1D9Y A;  3S9M C;  2H4I A;  3PMV A;  4ZED A;  1NV4 A;  1ZMG A;  3QIM A;  4IY6 A;  1OQG A;  3F11 A;  4KFQ A;  3S2V A;  3LC8 A;  5I84 A;  3CFX A;  2PT1 A;  5AA2 A;  4DI3 D;  2F36 A;  3H7M A;  4YKP A;  2HAV A;  1UTH A;  1LBC A;  2ZYM A;  2CZI A;  1HSL A;  4FEC A;  2OPE A;  4KQP A;  4ONY A;  3KZG A;  5AE4 A;  4GFR A;  2FNC A;  3CR9 A;  5KCJ A;  5J16 A;  4DE8 A;  4QSC A;  5CRY A;  2ZZX A;  5DVF A;  4UAC A;  4ZEC A;  3IO4 A;  3G3J A;  1MPB A;  4Z0I A;  3OO9 A;  5L9M A;  4GVO A;  1DTG A;  1M5B A;  4PET A;  4GWS A;  5H8S A;  2XWI A;  3N6U A;  2Y84 A;  3VE1 B;  3N26 A;  4R2B A;  1I6Q A;  2I58 A;  3TTL A;  1I6A A;  3VLU A;  2F6G A;  3Q27 A;  4O94 A;  4WXJ A;  3RN8 A;  3PUY E;  4P0G A;  3H6V A;  3B8B A;  3TPA A;  4E0X A;  4NF6 A;  4XKP A;  4U23 A;  3EKI A;  3K6W A;  4HCW A;  1BP5 A;  4JBZ A;  1SBP A;  3AXF A;  5H8H A;  1IXH A;  3QUJ A;  4OFJ A;  3FVO A;  3MVY A;  2HZK A;  3N6T A;  1MQJ A;  5A5X B;  4N6K A;  3HPI A;  3QK6 A;  4H46 A;  1OLC A;  4FE8 A;  4PFT A;  1SPI A;  1ANF A;  2CZK A;  1MQI A;  1ZLQ A;  1LST A;  4PFY A;  4O3B A;  3KN7 A;  3FXQ A;  2HQ0 A;  3GZG A;  4GF8 A;  5JEI A;  1NV0 A;  5EYG A;  3HST A;  2Y7P A;  3VV5 A;  3RLF E;  1NUX A;  3UN6 A;  4GXS B;  4TQU Q;  3RT8 A;  4DIG A;  2V93 A;  3OO6 A;  2ONK E;  4G4P A;  4GWU A;  4F1V A;  4KD5 A;  2Q2A A;  4N91 A;  5B7D A;  4JWX A;  1NV3 A;  2Y5L A;  1FQE A;  4H45 A;  3MPK A;  3E4R A;  2DXY A;  2B3B A;  1ZKB A;  2RCB A;  1NNP A;  1NH7 A;  3PD8 A;  1LCF A;  4NQ8 A;  4PDH A;  1WVJ A;  4NN3 A;  2Q8J A;  3T1B A;  3THI A;  2I3V A;  1LEV A;  4JDF A;  1P1O A;  1B32 A;  4OVP A;  4NHB A;  5IGA A;  3OEL A;  1MM6 A;  2CZH A;  3FVN A;  5CM6 A;  2VD3 A;  3D4C A;  1FBC A;  3C9H A;  4FEB A;  2DSF A;  3VVE A;  4FAJ A;  5AA3 A;  2O84 X;  1TFD A;  2CEX A;  2DWJ A;  3TOD A;  2YLN A;  5AA2 B;  5J1D A;  2CEY A;  4OEU A;  2PCR A;  3MZ1 A;  4KPT A;  2QVU A;  2NOO A;  4AQ4 A;  4KXP A;  1UTH B;  1N7X A;  4LZ5 A;  3DLN A;  4P8B A;  4XKN A;  1AWB A;  3K2D A;  4LZ8 A;  4RPO A;  1N7W A;  5I58 A;  3S9L C;  3LUZ A;  1LB8 A;  1H3D A;  4NX1 A;  2V25 A;  2P3N A;  3LSW A;  2RIN A;  1RYX A;  4UAB A;  4IY5 A;  4EDP A;  4DDD A;  2GH9 A;  3IJO B;  3LSX A;  3C35 A;  5AA4 B;  1LBW A;  1GGG A;  4H6D A;  3I3V A;  4GX6 A;  1IXG A;  1GTK A;  1NV7 A;  2VOZ A;  4NE4 A;  1S50 A;  1R9Q A;  1SDX A;  2VP1 A;  3N5L A;  1Y3P A;  1OVT A;  3IOW A;  1FQB A;  5EQA A;  2XWV A;  3ECR A;  1Q1K A;  2RC7 A;  3MVW A;  2V3Q A;  4RY1 A;  2REG A;  3ONM A;  1JW1 A;  4O3C A;  1ELJ A;  3A3C A;  1JET A;  4NF6 B;  2F78 A;  1B1X A;  1B46 A;  1B7U A;  1XVY A;  5I5P A;  4RNS A;  3K6V A;  5H8H B;  2DVZ A;  2Z8E A;  2X7Q A;  3IOT A;  4OVS A;  3W15 C;  1QUK A;  4F31 B;  4HTG A;  5ET7 A;  2XD3 A;  1D3K A;  3H3G A;  4EQ9 A;  3H6U A;  3K4U A;  3HFU A;  5TU0 A;  1FCK A;  1RKM A;  2WX9 A;  4R6H A;  1N84 A;  2GHA A;  5IZZ A;  4JVI A;  4DLD A;  1MRP A;  1LB9 A;  2XXY A;  1IMB A;  4Q8R A;  5EYH A;  2Y7K A;  1K9Z A;  4X1B A;  3TFL A;  4F3S A;  2PBW A;  2I4C A;  5IAI A;  2CMO A;  3K1P A;  1DSN A;  1FTK A;  1IMA A;  2F3B A;  1NH8 A;  4OTE A;  4DXB A;  1Q35 A;  1PB7 A;  2PVU A;  3VFJ A;  3TKD A;  3RNN A;  4X8R A;  1FBG A;  2Z8D A;  1MQH A;  4N6D A;  3DP4 A;  1A99 A;  3U1O A;  1MPC A;  3L6H A;  4KCC A;  5HPQ A;  1JNF A;  5FHM A;  3KC0 A;  3NOH A;  2QS2 A;  1EYK A;  1Y3Q A;  1Z7M E;  2I49 A;  1B6H A;  3K00 A;  5CMK A;  4PFR A;  2XHD A;  5L9S A;  3FD3 A;  1B0H A;  4K3F A;  1HSJ A;  4NG7 A;  2F7A A;  4YZZ A;  4P9K A;  4LQ2 A;  3SZP A;  4YKI A;  3PUW E;  3HCQ A;  3E9X A;  4P56 A;  2ZNT A;  3TEP A;  3FV2 A;  4F22 A;  3WAF A;  3OXN A;  2DP8 A;  3KEI A;  5JK4 A;  1SW4 A;  2R8T A;  3LR1 A;  1R6Z A;  1LAG E;  3D1R A;  1JW5 A;  2THI A;  4OZ9 A;  2XXI A;  4R74 A;  5I58 B;  3LSF B;  2YJP A;  4OFL A;  1PBQ A;  3W9V A;  1MY4 A;  1NV2 A;  1DOT A;  5F7V A;  1II5 A;  3Q25 A;  4PGP A;  2AL5 A;  4QXD A;  4RYA A;  3MST A;  5KDT A;  1UQW A;  5I2K A;  1B2H A;  1XT8 A;  3RQT A;  2OWZ A;  3QUF A;  2HXR A;  2Q74 A;  1US5 A;  2I0B A;  4R75 A;  4YKJ A;  4ELP A;  2O7I A;  4EF2 A;  2V4C A;  3SES A;  3EN3 A;  1N0T A;  1EYI A;  1FTO A;  2OWT A;  2BJJ X;  2QRY A;  3B6W A;  4OVQ A;  3U8Q A;  4OVR A;  1IUD A;  2P1S A;  4NTL A;  4C1U A;  1T0K A;  1QKA A;  3E3K A;  3KBZ A;  1RDX A;  3CG3 A;  2UVH A;  4LAT A;  2DWH A;  2O51 A;  1RDZ A;  3GXA A;  3VVF A;  1LBX A;  2KQZ A;  4PGN A;  2R6G E;  5IM2 A;  4NF5 B;  2DE2 A;  4MEV A;  2VT5 A;  3QSL A;  4NF8 A;  3CFZ A;  4U4X A;  4OYV A;  1O7T A;  1Y9U A;  2F7C A;  2I4B A;  5AA2 D;  4GWO A;  4NGU A;  3IX1 A;  2V3U A;  2DXR A;  3S9N C;  5A5L A;  1VDW A;  4EXK A;  1SYH A;  2XX7 A;  3U72 A;  3ISP A;  3FXU A;  1VE4 A;  1H44 A;  3KOT A;  3CRB A;  4QFL A;  4ELO A;  1TWY A;  2D5W A;  3KBR A;  4P1E A;  3MVZ A;  3TQL A;  3K0V A;  4OEV A;  1ZBM A;  4ECF A;  3TAJ A;  4PE3 A;  1IQ7 A;  1F9B A;  4DCX A;  3CSB A;  2QS3 A;  3B50 A;  3FBP A;  4DXC A;  3VLV A;  2A5S A;  2ONS A;  3FJG A;  4H8J A;  3PUZ E;  1QKB A;  4ND9 A;  1S9T A;  1FPE A;  5FHO A;  3T93 B;  4QSE A;  3UGW A;  4ESX A;  1NUY A;  3FJ7 A;  1EYJ A;  5CC2 A;  4R73 A;  1UIV A;  2KR0 A;  2DDK A;  1EZ9 A;  4WKM A;  4PAK A;  5JTY A;  1A8E A;  1MXW A;  3O28 A;  2WYK A;  3MQ9 A;  3IOR A;  5ITP A;  3RPL A;  5I3S A;  1CE2 A;  4AS5 A;  4RK2 A;  4KYE A;  4XFE A;  3GLB A;  4OER A;  3ZS6 A;  4P0I A;  4U4S A;  1OQH A;  2VGQ A;  1UIU A;  2GHB A;  5LTC A;  4ZE8 A;  1FPB A;  2RC8 A;  3B7D A;  3L6G A;  4ZS9 A;  2DE4 A;  2HZL A;  1H76 A;  4F1U A;  1ZJL A;  1AL3 A;  4PFB A;  1MXZ A;  4BDM A;  1MDQ A;  4TLL B;  1FSA A;  3E79 A;  4HE2 A;  4O7I A;  1KWH A;  3SEX A;  1FPG A;  3C36 A;  4P11 A;  5KDT B;  5EQ9 A;  4PFI A;  1LFI A;  4BDN A;  2WYP A;  1MXY A;  3RGY A;  3FJM A;  4N13 A;  4F3P A;  5EHS A;  1B5J A;  1NV1 A;  3O97 A;  4JVD A;  3EHU A;  4IB2 A;  3EHT A;  3BIH A;  3OEK A;  3EHS A;  1KZ8 A;  4OET A;  3PV0 E;  4EQ7 A;  1N04 A;  3A3U A;  2O68 A;  2ZNU A;  4XXU A;  4NWC A;  3OSR A;  5K2Y A;  3I5O A;  1B7Z A;  2XD2 A;  4PP0 A;  2H5Y A;  2RC9 A;  2XXK A;  1LAX A;  2O7U A;  2ZZW A;  5EQ8 A;  3TMG A;  3PPO A;  2OZZ A;  1SYI A;  4NF8 B;  4PF6 A; 
#chains in the Genus database with same CATH homology
 5EQA A;  2XWV A;  1LBV A;  5F24 A;  4HE1 A;  4PCD A;  2V3Q A;  4GWZ A;  4I40 A;  1FBE A;  2VPO A;  4MNI A;  2L5V A;  1G0I A;  4JVC A;  3GYY A;  3LV0 A;  4OAN A;  2WEF A;  3PTY A;  5I5P A;  1DCU A;  1QGX A;  1YZ0 A;  2DVZ A;  1XI6 A;  4OVS A;  4XF5 A;  5IZ3 B;  2FIX A;  5ESY A;  1NV6 A;  3U65 A;  2WBB A;  3ROJ A;  4PF8 A;  5ET7 A;  5FBP A;  2ZZV A;  3HFU A;  4F18 A;  2MKZ A;  2WX9 A;  4HCY A;  3BIG A;  4LN5 A;  5IZZ A;  4JVI A;  4HE0 A;  5ET5 A;  4P3L A;  1IMB A;  2B4L A;  5EYH A;  4I3E A;  1K9Z A;  2FBP A;  3RYD A;  4M1V A;  2PFZ A;  1FPF A;  4N4U A;  4GBW A;  1IMA A;  2XA5 A;  4O7M A;  2F3B A;  1KA1 A;  1LBZ A;  2QPQ A;  4X8R A;  1FBG A;  3A29 A;  4GX3 A;  4I3Y A;  1LBY A;  3W9W A;  4N6D A;  2B4M A;  1D9Q A;  4MMP A;  4N81 A;  4PTK A;  3RPL B;  1FPD A;  4G61 A;  4HXV A;  3CHG A;  3KC0 A;  4NF0 A;  3NOH A;  3IFC A;  1FJ9 A;  1NUZ A;  1YYZ A;  1EYK A;  5I7I A;  4PFR A;  2OX3 A;  2XWK A;  5DW8 A;  4NG7 A;  4YZZ A;  4P9K A;  1K9Y A;  3SZP A;  4YIC A;  3MYU A;  3IFA A;  4PAF A;  5ET8 A;  4P56 A;  1YXI A;  2VPN A;  1FPK A;  2HPG A;  2QFL A;  2QVV A;  5JK4 A;  2R8T A;  1FBF A;  3D1R A;  1DK4 A;  1NV4 A;  4MCO A;  4MNP A;  5IZ1 A;  2Y5K A;  3W9V A;  4DI3 D;  1NV2 A;  1IMC A;  4PGP A;  4QXD A;  3MST A;  2CZI A;  2OWZ A;  3QMF A;  1Q9D A;  2HXR A;  2Q74 A;  4N15 A;  4MX6 A;  5J16 A;  2P3V A;  2V4C A;  2WBD A;  1EYI A;  4O8M A;  2ZZX A;  2Q8M A;  3FXB A;  1FBD A;  4OVQ A;  4OVR A;  1G0H A;  2XWO A;  3KC1 A;  5ET6 A;  2F5X A;  2FVZ A;  3KBZ A;  1RDX A;  5EQ7 A;  1RDZ A;  1LBX A;  2KQZ A;  4P47 A;  1IMD A;  4PGN A;  4PET A;  5IM2 A;  4GWS A;  5T3J A;  2DE2 A;  4MEV A;  2VT5 A;  4X9T A;  2XWI A;  1IMF A;  4OVT A;  4X04 A;  3E78 A;  4O94 A;  4F19 A;  4FBP A;  4PBQ A;  3B8B A;  4NGU A;  2DE3 A;  4MNC A;  5A5L A;  1VDW A;  3EKI A;  1INP A;  4HCW A;  1NUW A;  3ISP A;  1RDY A;  4PAI A;  2FIE A;  5IZ3 A;  2HZK A;  4N8Y A;  4NAP A;  4P1E A;  4N6K A;  1FPI A;  1KA0 A;  4H46 A;  4XEQ A;  1SPI A;  4GWY A;  2CZK A;  4P1L A;  2PFY A;  4PE3 A;  4DI4 B;  2JJK A;  3B50 A;  3FBP A;  1NV0 A;  4MIJ A;  5EYG A;  2F3D A;  1NUX A;  3T0J A;  1FPE A;  4AS4 A;  5LDZ A;  1NUY A;  1EYJ A;  4GWU A;  4OA4 A;  4F1V A;  4N91 A;  1NV3 A;  1FBH A;  2Y5L A;  2KR0 A;  4MAG A;  2QVR A;  4H45 A;  2DDK A;  4PAK A;  1NI9 A;  4NQ8 A;  4PDH A;  4NN3 A;  1FRP A;  3T1B A;  2WYK A;  3RPL A;  5I3S A;  4AS5 A;  1LEV A;  2BJI A;  4XFE A;  4QBA A;  4OVP A;  4NHB A;  4PBH A;  4PDD A;  5IGA A;  4GX4 A;  5CM6 A;  2CZH A;  5LTC A;  1FBC A;  4GBV A;  1FPB A;  2DE4 A;  2HZL A;  2CEX A;  1JP4 A;  4F1U A;  5J1D A;  2CEY A;  2PCR A;  2QVU A;  4MJO A;  4PFB A;  4KXP A;  1FJ6 A;  1FPL A;  1FSA A;  3E79 A;  4HE2 A;  4O7I A;  1FPG A;  2Q9T A;  5EQ9 A;  4PFI A;  4P8B A;  1FTA A;  4PC9 A;  1AWB A;  2WYP A;  3LUZ A;  2FHY A;  2GQ1 A;  1IME A;  4NX1 A;  1DBZ A;  2P3N A;  1NV1 A;  4MHF A;  4GWW A;  4JVD A;  4UAB A;  2HHM A;  3BIH A;  1KZ8 A;  4N8G A;  1LBW A;  4GX6 A;  4N17 A;  1NV5 A;  1NV7 A;  4IR8 A;  1BK4 A;  2XXK A;  1FBP A;  4GWX A;  2ZZW A;  5EQ8 A;  1FPJ A;  4PF6 A;  1CNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...