1IMAA

Structural analysis of inositol monophosphatase complexes with substrates
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inositol monophosphatase complexes with substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 89
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imaA02
4GWYA 3KC0A 1RDXA 1NUYA 2OX3A 1FBPA 1FJ6A 1IMAA 1NV1A 2FVZA 1FBHA 4FBPA 5F24A 5EQ8A 1LBVA 1NUXA 1YYZA 1LBZA 3IFAA 2QVVA 5LDZA 3LUZA 1K9YA 5ET8A 1D9QA 1LEVA 1EYJA 2FBPA 3KC1A 1BK4A 1FPLA 1G0IA 1IMBA 1EYKA 1FPKA 2DDKA 4H45A 4QXDA 1NV7A 5J16A 5A5LA 1FPBA 2FIXA 4I40A 3A29A 1SPIA 1FPDA 1YZ0A 2R8TA 1FRPA 1DBZA 1LBXA 1K9ZA 1CNQA 4G61A 5ET5A 1RDYA 2BJIA 4HE1A 2P3VA 2QVRA 1YXIA 2CZKA 4I3YA 3T0JA 4H46A 2WBDA 1Q9DA 3D1RA 2QFLA 1EYIA 4PTKA 5EYGA 3IFCA 1FBGA 3BIHA 4GBVA 1FPEA 1KZ8A 1INPA 1FPIA 2Y5KA 5T3JA 4GBWA 4GX4A 1RDZA 2WEFA 5EQ9A 1FBCA 1NI9A 5I3SA 2GQ1A 1VDWA 1KA0A 1FPFA 2OWZA 5EQAA 2FHYA 1JP4A 2Y5LA 3B8BA 1IMCA 1FTAA 1LBYA 4MJOA 2Q8MA 1FBFA 2VT5A 3BIGA 2QVUA 2Q74A 1IMFA 3FBPA 1NV2A 3QMFA 4IR8A 5IZ1A 5IZ3B 4HE2A 4GWUA 1DCUA 1KA1A 3RPLB 2F3BA 4GWWA 3KBZA 5ET7A 4GWZA 3ROJA 5ESYA 4I3EA 1AWBA 1FPJA 1NV6A 1XI6A 1NV4A 1IMDA 2P3NA 5ET6A 1FBDA 2JJKA 1FBEA 2CZHA 1LBWA 4GX3A 1FPGA 4N81A 4O7IA 2CZIA 3LV0A 4AS5A 4GX6A 1NUZA 1G0HA 1NV3A 2F3DA 2FIEA 2HHMA 1FJ9A 2WBBA 1FSAA 5EQ7A 2PCRA 4GWXA 4KXPA 5IZ3A 5FBPA 4HXVA 4AS4A 1NV5A 5EYHA 1NUWA 4HE0A 1IMEA 5DW8A 3RPLA 1QGXA 1NV0A 4GWSA 1DK4A 3RYDA
chains in the Genus database with same CATH superfamily
2O1LA 3RT8A 1OQHA 4HS7A 3VV5A 2V4CA 4JSDA 1OLAA 1URSA 4NAPA 1LAGE 3QXMA 4G68B 5JTYB 1P99A 4KPTA 2B4MA 4F22A 4I40A 3TZAA 1DSNA 1I6BA 3QUFA 1IIWA 2E1SA 2I6EA 3TELA 3ISPA 5JEIA 4EXKA 1TWYA 5IKBA 3CR9A 4MLVA 4DE8A 1JNFA 1LB8A 2WBDA 3N94A 1MPBA 3DELB 1NNTA 4IO5A 3VXBA 1XOCA 2F34A 1IMCA 2XXUA 3TODA 1B51A 1P1WA 2XX9A 3L6HA 4GL8A 1EZ9A 1B7ZA 2P1SA 4G77A 4X48A 4XF5A 1WODA 2ZNSA 1B5IA 4NHBA 3OD7A 5J1DA 1GGGA 3MC2A 3TDJA 3T9UA 3IOUA 4R6KA 4JWXA 3IB2A 3MPLA 4YMBA 2FIEA 2ZYOA 4N6PA 4NF6B 3PGFA 3KJ7A 3EKIA 4PBQA 3CFLA 1PC3A 3D4GA 2FVZA 3PUWE 4F3BA 1LBVA 4F2OA 1K9YA 4BDQA 2R9JA 2V3TA 2HEUA 5I57B 5IAIA 2ZMBA 1TXFA 1US4A 3CI8A 4GRKA 1LB9A 1RKMA 4F3PA 2FIXA 5I56B 3FVGA 4RPOA 5KDTB 5IGAA 5F7VA 2CZKA 5ICTA 2ESNA 3FJMA 3F11A 3CSBA 3K4UA 4OVJA 2RF1A 3VLVA 1FBGA 1INPA 1XT8A 2XXYA 4PDHA 1WDNA 4LN5A 3C35A 1LBYA 1DMBA 3UORA 1N04A 4O3BA 2DWAA 5IZ3B 2Q74A 4H8JA 4P9KA 4R6YA 4HE2A 1SDXA 3CG3A 1P1OA 1USYH 3OENA 1B3EA 4PETA 2Q8JA 3RY3A 1RYOA 4YB6A 2KQZA 2CZIA 2F97A 2UVJA 3K6VA 1FTJA 4RPNA 2AL4A 3TQWA 1M5EA 3FVKA 3U93A 3Q28A 5H8QA 1B0LA 3KC0A 4HTGA 1BLFA 4WKMA 4DXUA 2OPEA 5EQ8A 5EHSA 4OANA 1YYZA 2QSXA 3MQ9A 1D9QA 1D9VA 3KC1A 2XD3A 4GD5A 1FTKA 4QFKA 2IEEA 1R9QA 1Y4CA 1SW5A 5H8NB 3SEXA 3OEMA 4N17A 4GIZA 2P3VA 1B6HA 1WVJA 3T96B 2HAUA 3ZKKA 5TU0A 1SD3A 5L8DA 3EHSA 1P1NA 4RNSA 5ITPA 4NF5A 4IO2A 4MH5A 2G93A 4MLQA 1B0HA 2WEFA 4P8BA 1NI9A 4XEQA 1VDWA 5ITOA 4G68C 3CIJA 1H76A 4Q0CA 1VE4A 2XHDA 2HXRA 2GHBA 3S9MC 2UVIA 4OMBA 1PBQA 1CE2A 2DP8A 4ZZEA 1UTBA 3IORA 3PUXE 1NV6A 1A55A 5L9MA 4P11A 1Q1KA 4TLLB 2Q88A 3VVDA 4PFIA 1NMUA 4KQPA 1SW2A 1TFAA 2AIXA 1NV3A 1USYE 3MP6A 4N6DA 1GVCA 4O3AA 1FQBA 3GXAA 2ONRA 1DPEA 1MM7A 1Y4TA 5EYHA 3E4RA 3QK6A 2AYSA 4P1LA 3RYDA 4GFRA 1N7XA 3MAMA 1NV1A 4RY1A 1LBBA 2XXQA 3K1MA 3TTLA 1ZU0A 3RTFB 4YAHX 2H98A 4ECFA 4XIGQ 4BLAA 3PD9A 4QFPA 4PAIA 4H45A 4MIJA 3UK4A 4LATA 1HSJA 3K6UA 3SZPA 4U4XA 2F7CA 3N6TA 4U1OA 4NTLA 1UIUA 1H45A 5KCJA 4GOTA 3PUZE 4I3YA 1PB8A 3TQLA 4FJPA 3S9LC 3BIHA 4JDFA 2Z22A 3MPKA 2XWVA 1N3WA 4HCYA 4NWCA 1TFDA 5TP9A 4PFRA 2D5WA 2HFBA 1IXCA 1QKAA 5M2VA 4F18A 3QMFA 4RXLA 1IQ7A 2Z23A 1NNFA 4NWDA 1EZPA 3HHFA 3PU5A 1LCFA 1B9JA 2WX9A 3CG1A 4JWYA 3IO6A 3B50A 1N76A 2X7PA 4E0WA 5AA2B 4N8YA 3S9EA 4F39A 2Q2CA 4ZZAA 1FSAA 1MM6A 2DWIA 3R26A 1IMEA 2XXVA 3HSTA 2O69A 2ZZVA 3UP9A 1FJ6A 2VD3A 3CRBA 1NUXA 1LBZA 2PVUA 2QVVA 1JEUA 3LUZA 2FA7A 3FVNA 3T22A 4XTCQ 2ANJA 3TCHA 1FQCA 1Q35A 3RT6B 3KOTA 4RK9A 4LA9A 1M5FA 4I1DA 2F36A 1B40A 4LZ5A 2HAVA 5I59A 2F7AA 1Y3QA 4JWOA 1ZMGA 4IB2A 2KR0A 1HSLA 4ESWA 3BBRA 3IO4A 1S50A 3DP4A 3C34A 4FECA 4NGUA 4QSEA 2XXTA 4C1UA 1BTJA 1MH4A 3DP8A 1RYXA 1ELJA 1FPFA 3HFUA 3WAEA 3EN3A 2FHYA 4R74A 2Q8MA 1B4HA 3OO6A 5BWJA 2VHAA 5DEXB 3B6WA 1IUDA 3ROJA 2XX7A 4R2BA 3IJXB 2GHAA 4PCDA 2YJPA 4BDLA 1J1NA 3VLUA 2XX8A 3MVYA 4OVRA 3M3FA 4DCXA 2I49A 4U23A 3LV0A 1IXIA 5DEXA 5AA1A 4DI3D 2VP1A 1N7WA 1DTGA 2QRYA 1YTVA 4KHZE 3MJNA 4MHFA 4ISUA 3RUMA 3TTKA 4OZ9A 1YCJA 4FEBA 1FBPA 4N91A 4NF8A 4XXUA 1B5JA 4Z0IA 4OFJA 3OSRA 5FTIA 3IFAA 1R1NA 2HXWA 1GV8A 3G3JA 3KSXA 1IXGA 2VOZA 3QUJA 4QSCA 1ZBMA 3Q27A 3SEUA 2E0SA 4YKPA 4PGNA 1FPKA 1UQWA 4QFNA 1Y9UA 2AL5A 3U65A 4KR5A 3A29A 3QAXA 4RYAA 1DBZA 3FZVA 1LBXA 3SEVA 3KZGA 4TQUQ 3H6UA 2DVCA 1QW0A 2Y7IA 4P47A 1YXIA 4H46A 1MDQA 2QFLA 3W15C 4N13A 3JZJA 3K2DA 4GBWA 5I3SA 1AOVA 1FBCA 4IO4A 1LCTA 4N6KA 1UIVA 1JP4A 4YKIA 5FTHA 2HPGA 3K6WA 1NV2A 2ZNTA 5FHNA 3S2VA 2DQVA 3EHUA 2D21A 3E13X 5JK4A 2P3NA 5ET6A 1SQYA 1FBDA 3IOVA 3MZ9A 4G8NA 3LBSA 3OXNA 4UACA 3WAFA 3S9NC 4X1DA 2V3UA 4H8IA 2F3DA 4U2RA 5EQ7A 4YB7A 3FIRA 5FBPA 1PB7A 1LLSA 1URGA 1NUWA 3FV1A 3M8UA 2Q9TA 2NVUB 1B7UA 1S7YA 5TP9B 3B6TA 1RDXA 3PUVE 1NUYA 2X26A 2YPNA 3HO7A 3U72A 1MQIA 1NH8A 1FPLA 3KSJA 2PYYA 1EYKA 2DDKA 4FIMA 4XFEA 2DYXA 2QS1A 4TOZA 2HZKA 4PAFA 5I2NA 4LVQA 4G8HA 1CNQA 4DCYA 1RDYA 2THIA 2YLNA 2GH9A 1IEJA 3K00A 2NUVA 2GFEA 3LSFB 4DIGA 5B70A 4N07A 4WEPA 2DS9A 2FYIA 4HW8A 4U22A 1JETA 1Y20A 3FATA 2L5VA 3FXQA 1QUIA 1ZIUA 4QF9A 3PUYE 4IY5A 4N8GA 3TTNA 4IR8A 1R6ZA 2V93A 1O63A 1XC1A 3IX1A 2F3BA 1AIVA 2F78A 4OTEA 5DT6A 5CMMA 3E78A 1OIBA 1US5A 2X7QA 1ZKBA 3MVXA 4F2QA 1NV4A 4I62A 1MPDA 1MH3A 2Y7RA 4O7IA 1POTA 3MVZA 2UVHA 2QPQA 4ONYA 2WBBA 1Y3PA 3H6TA 3VVFA 3U92A 2VD2A 3OO7A 2O7UA 2F8DA 5AA3A 4YU0A 3B6QA 4MEVA 4P56A 3H6WA 1B58A 4PFWA 3PPNA 2QS2A 4OVQA 4F19A 3E79A 5ET8A 3VVEA 4N4UA 4NF4A 2IA4A 1HSEA 4JSOA 4OETA 1IMBA 4IO3A 1Z7ME 3U1OA 4QXDA 1NV7A 4EUOA 1FPBA 5H8NA 1FQFA 1K9ZA 1LGBC 3CVGA 3KJTA 2OZZA 1B4ZA 3U94A 3SESA 1MXYA 3EPEA 3D1RA 3HV1A 4EQ7A 1KZ8A 5T3JA 4GX4A 1RDZA 2GQ1A 4PQJA 1YPNA 2I0BA 4JVDA 1NNKA 1LFIA 3FV2A 4OESA 2UYEA 3H4ZA 3G3FA 1D9YA 4R9GA 3LSXA 3PMVA 5I59B 2DWHA 3DLNA 1ZJLA 3MVWA 4OFOA 3V5AA 5FHOA 1FQDA 4GWUA 3RPLB 3C4MA 5I2KA 2I58A 1FQAA 4NG7A 3EQ1A 4RA1A 1XVYA 4AS5A 4PF8A 3BKIB 1G0HA 1ZLQA 3IB1A 4E0XA 1LAFE 5IZ3A 1XHYA 1B1HA 3ODBA 1H43A 3FXBA 1H3DA 4F1VA 2PFYA 5AA2A 1B3LA 3RN8A 2RC9A 4BDNA 3EF7A 3MP8A 2Z8FA 2Y7WA 5CM6A 4NN3A 3L6GA 4YICA 3T66A 1MXZA 4ZE8A 1JVYA 4U4SA 5FHMA 3TCFA 2H4IA 5I58A 3R6UA 2RC8A 2ZZWA 1FRPA 3PTYA 2WYPA 3TMGA 4OXVA 2W7YA 5ET5A 1SW1A 4BDRA 4OYVA 3H7MA 5I57A 4C0RA 4OHNA 3TAJA 2A5TB 2QS4A 3IR1A 4OWDA 4H65A 4K3FA 4POXA 3TTMA 1BIYA 2WYKA 4ZE9A 3ILUB 1P1QA 4O8MA 2OWZA 3UGWA 4KYDA 5EQAA 5KCJB 5A5XB 2H9BA 3T93B 4NX1A 4MJOA 2ONSA 1FBFA 2H25A 3MYUA 1P1UA 4GXSB 1MPCA 1TT1A 1D4NA 4TLMB 4IY6A 2OLBA 3HPIA 2RINA 4XKRA 4DDDA 3SETA 2Y7PA 5CC2A 4NMYA 2QS3A 2RCAA 1SI1A 3C33A 4MBPA 4MF3A 4AB5A 4M1VA 1FPGA 3RNNA 1NUZA 1LBCA 4PF6A 4R6HA 2I0CA 1NNPA 5AE4A 1QUJA 2PFZA 4YKJA 4PFBA 2F7BA 3VDFA 3ZSFA 2ONKE 4PFUA 1EU8A 5I2KB 3O29A 1DTZA 1FCKA 4U21A 1MY1A 3LR1A 2G29A 1XVXA 1MXWA 3PPPA 2F35A 2O68A 2OWSA 5HPQA 1MY0A 1SVXB 4GVOA 2DWJA 4QFOA 4Q5TA 2XXPA 4QBAA 2CMOA 1MXUA 2XXXA 5CRYA 4EF2A 3CHGA 5K2YA 4OEUA 4ELRA 4OA4A 4U1ZA 3PPQA 4NF5B 2QMWA 1PB9A 3PMXA 2Z8DA 4DZ1A 1MQHA 1JEVA 1FTAA 1N0TA 3SDFA 3K01A 1NKXA 4NF4B 1IMFA 4P3LA 5ESYA 2ZYNA 2CEXA 1SI0A 3T9VA 3CSGA 4R72A 1VR5A 4JVIA 2CZHA 4F1YA 3I5OA 2RCBA 3RGYA 3HN0A 1IITA 5H8QB 1BKAA 3QSLA 4MMPA 4LZ8A 3MBPA 4PP0A 1PEBA 1DPPA 3LUYA 2UXAA 4GWOA 2CZLA 3K1PA 4GWSA 3H03A 3E9XA 3OO8A 1A8EA 3S4UA 3OMBA 2DE4A 1QKBA 1JW5A 1SW4A 3I6VA 1FBHA 4FBPA 4EXLA 3O9PA 2NWJA 3H06B 4PGPA 1G0IA 3K02A 2PBWA 1FTMA 3DP6A 4WEDA 1PBPA 3FXRA 3C9HA 4MAGA 3IL1B 4KFQA 1SPIA 1LAXA 4GQOA 3MZBA 4QRZA 3T9XB 4LUBA 4HE1A 3A09A 1VFEA 2RC7A 2I4BA 2P0SA 3KOSA 1LAHE 3ZKLA 1MY2A 4PTKA 5EYGA 3IFCA 1N3XA 5DVIA 5ICQA 4MCOA 4XKQA 1OLCA 1VSOA 2O1MA 4FATA 5I2NB 4OFLA 3MUQA 3M3LA 2B65A 2VT5A 5KDTA 3U8QA 1LSTA 2V25A 4F31B 1B3GA 3HHGA 2QVUA 1QUKA 5I56A 3HCQA 4PAKA 1KA1A 2OBGA 1BP5A 5HM4B 1AMFA 4I8CA 1A8FA 4GWZA 4G2ZA 1AWBA 1I69A 3GZGA 3O97A 2JJKA 4F3GA 3NOHA 5L9SA 2MKZA 1IXHA 5AA4A 3C32A 2F6PA 2Y7KA 2DSFA 2NOOA 2GRVA 4UABA 2VPOA 4F29A 4ZEFA 3TUSA 1O64A 2ZYMA 4HXVA 4BDMA 3BFUA 2F6GA 4KCDA 2B3BA 1ATGA 1PDAA 4DXCA 5HBCA 1T0KA 3OOAA 5LDZA 2Z8EA 4PDDA 3TKDA 1EYJA 3IOTA 4OEVA 3I3VA 2BJJX 5J16A 1QJMA 3O2AA 2RKMA 5ELVA 3RLFE 1F9BA 3D4CA 1B5HA 4THIA 4X8RA 2HQ0A 3VFJA 1QULA 2XXRA 5DYHA 2QMXA 3O28A 1L5TA 4EQ9A 2ZZXA 2P2AA 4ELOA 3SEYA 2F5XA 3FGSA 2V3QA 3UA8A 5IZZA 4XKNA 2DOJA 3W9VA 5EYFA 2PX1A 1OVBA 3MSTA 4KD5A 3G7WA 3JYRA 4IO7A 2D3IA 3KFMA 2ABHA 3V89B 4YZZA 4AB6A 2HCAA 3O6HA 5K2XA 3PD8A 3FBPA 3IOWA 5H8FA 4R2FA 4MNPA 1LFHA 2V84A 5I84A 3KBZA 4G68A 5JTYA 3RQTA 3T9HB 4MNIA 4OERA 1KWHA 1I6AA 1R9LA 3O6GA 1MS7A 3QYTA 3IB0A 3Q25A 1B2HA 3MP1A 4ESXA 3IK6B 4O94A 2PCRA 4JVCA 4KYSA 4NE4A 4AS4A 1NV5A 1URDA 5DW8A 1QGXA 4G4PA 5B7DA 2ALUA 1DK4A 2UVGA 2OX3A 3IJOB 3ONMA 4LQ5A 2PT1A 4KI0E 3TPAA 5A5XA 1IZ1A 2QJEA 4RJZA 4NF0A 5LTCA 2FBPA 1Y1MA 3VE1B 3FVOA 3ILTB 3CFXA 3GBAA 2A5TA 4KCCA 5DTBA 3FASA 4F3SA 3A3UA 1MY3A 1MXVA 2DXRA 1YZ0A 1YAEA 4ELQA 4G61A 2QVRA 1FTLA 1UTHB 4PFTA 4OVTA 1SYIA 2QL3A 3KN7A 5I58B 4O3CA 4R9FA 2DXYA 2Y5KA 1B7HA 4ZEBA 1KA0A 4I9DA 3K6XA 5CI5A 4P1EA 4R75A 4G8MA 4IO6A 5I7IA 4LONB 3B8BA 4DLDA 4UA8A 1XS5A 3BIGA 3K1NA 2O7IA 2NXOA 3O6IA 1ZTYA 2O84X 1A7LA 3SERA 5IM2A 3V83A 1ANFA 2A5SA 1FPJA 1MQGA 4FEDA 3Q26A 4X1BA 3THIA 1FBEA 3C31A 4OQOA 3H3GA 2H5YA 3LC8A 1FJ9A 4ZEIA 2FNCA 4GXAA 4PFYA 4HCWA 4PBHA 4N15A 3RPLA 3RPWA 1OMPA 4O7MA 3V8XB 2XWKA 2REJA 4Q30B 3FXUA 5F24A 5TPAB 5H8HB 5LOMA 1B52A 4ZEDA 1BK4A 1UTHA 5I5PA 1B32A 4H1XA 4C1TA 2XD2A 3KBRA 2XXWA 1SYHA 1OVTA 3G3HA 4DI4B 1DOTA 4LZ7A 4Q8RA 1S9TA 4JBZA 4RK2A 1JW1A 1LFGA 1MQDA 1MDP1 3TTRA 3W9WA 1EZOA 4GBVA 5CBSA 1NL5A 4M4GA 3TFLA 4EQBA 3OSQA 3UIFA 3N26A 3ZS6A 2KLFA 3T1BA 5DVJA 5CMCA 2Y5LA 4QSDA 4JB7A 3MZ1A 1MQJA 3KN3A 5IZ1A 4H5FA 2R6GE 4PC9A 4EDPA 4ND9A 5ET7A 3G3KA 5CMBA 3R7XA 3N5LA 4I3EA 1D3KA 3BFTA 3PMWA 4PE5B 1B05A 2OCUA 3O66A 5DVFA 2ZYKA 1Z7NE 5H8FB 3PV0E 4L17A 1SBPA 4ZS9A 1M5DA 3TCGA 4FE8A 4FAJA 3RTWB 1B46A 3K0VA 4GWYA 3IAZA 4F1UA 2XWOA 2O6AA 1IMAA 4MX6A 3M3KA 3PPRA 3FD3A 2LAOA 4XKPA 4ZEKA 4BDOA 3KG2A 1UTBB 2Q2AA 1LEVA 3DM0A 1B1XA 1NFTA 5AA2D 1MY4A 3G3GA 3GLBA 1O7TA 1FPDA 3B7DA 1JQFA 2XWIA 1M5BA 2I48A 3PPOA 5EHMA 3KN8A 2PT2A 2OWTA 1AL3A 1NH7A 4QHQA 3T0JA 2DE3A 5BUUA 1FPIA 4X04A 4H67A 3C36A 5EQ9A 3TYHA 3KGCA 2H99A 2ZNUA 2PMSA 3MWBA 1MG1A 5L9OA 1GR2A 5ISUA 4WXJA 2OK2A 2XXHA 4GWWA 3OEKA 4R73A 3GYYA 5AA4B 3ECRA 2XXKA 3FJGA 1IMDA 5H8SA 3A3CA 5H8HA 2B3FA 2Y84A 5TPAA 4P0IA 1LBWA 1II5A 5CBRA 1FQEA 4GX3A 4N81A 1GTKA 1A99A 4ZECA 2HHMA 4GL0A 4X9TA 2I3VA 4GWXA 4KXPA 4EF1A 4H0WA 4YB5A 4LP2B 1I6QA 3GBBA 3USDA 1CB6A 1NV0A 2I3WA 1Y3NA 4YKKA 2CEYA 3P7IA 3LSLA 4QFLA 1M5CA 2WKYA 4MNCA 4NEDA 3VXCA 2XA5A 1B3HA 2OJTA 2Q89A 5A5LA 4JXIA 4IGTA 5CMKA 1Y1ZA 3SKPA 4OVPA 3OELA 2R8TA 4FORA 1MRPA 3Q29A 2BJIA 2I4CA 4H5GA 2M8CA 4H6DA 3LSWA 1JVXA 1OQGA 1Q9DA 2HZLA 1EYIA 4LQ2A 1QVSA 2B4LA 1B3FA 3KEIA 1POY1 3MW0A 1FPEA 3UN6A 4NQ8A 4AQ4A 4KYEA 1VFDA 3SEWA 1N84A 2DVZA 2O51A 4P0GA 2REGA 4NF8B 2UYFA 3AXFA 3CFZA 3FUZA 3OO9A 1FTOA 1AH5A 4GF8A 4ELPA 2OPDA 1DCUA 1JW4A 3FJ7A 1EH3A 2VGQA 4POWA 3H6VA 4MFIA 3JV9A 5F1QA 1H44A 1XI6A 3TEPA 1MXXA 4IGRA 3E3KA 4OENA 3N6UA 1FW0A 4OVSA 2XXIA 4Z7EA 4GX6A 2DE2A 2ZXTA 4DXBA 4NF6A 4GLIA 2VPNA 3QIMA 3VLWA 5KZTA 1A54A 4YMAA 3EHTA 4ZDMA 4PE3A 1A40A 4HE0A 2R71A 3G3IA
chains in the Genus database with same CATH topology
4GWYA 3KC0A 4F1UA 4F1VA 1RDXA 2XWOA 2ZZVA 1NUYA 4MEVA 4P56A 2OX3A 2DE4A 2PFYA 2XWKA 1FBPA 1FJ6A 1IMAA 1NV1A 4N91A 4MX6A 2FVZA 2CEYA 1FBHA 4FBPA 5F24A 5EQ8A 4OANA 1LBVA 2V4CA 1NUXA 1YYZA 1LBZA 4OVQA 4F19A 3IFAA 2QVVA 5LDZA 3E79A 3LUZA 4MHFA 1K9YA 5ET8A 4NAPA 1D9QA 1LEVA 1EYJA 2FBPA 4MNCA 4NF0A 3KC1A 4PGPA 5CM6A 1BK4A 1FPLA 1G0IA 4NN3A 5I5PA 4N4UA 4YICA 1IMBA 2XA5A 1EYKA 4PAIA 4PGNA 1FPKA 2DDKA 4H45A 4QXDA 1NV7A 4MIJA 4MAGA 5J16A 4XFEA 2B4MA 5A5LA 1FPBA 2FIXA 4I40A 3U65A 2HZKA 4PAFA 4DI4B 3A29A 1SPIA 4OVPA 1FPDA 1YZ0A 2ZZWA 4X8RA 2R8TA 4N17A 3SZPA 1FRPA 1DBZA 2XWIA 1LBXA 1K9ZA 1CNQA 4G61A 2WYPA 3ISPA 3PTYA 5ET5A 1RDYA 2BJIA 2ZZXA 4HE1A 4P47A 5IGAA 2P3VA 2QVRA 4QBAA 2KR0A 1YXIA 2CZKA 4OVTA 4I3YA 3T0JA 4H46A 2WBDA 1Q9DA 2F5XA 2HZLA 3CHGA 3D1RA 2V3QA 2QFLA 1EYIA 4PTKA 2B4LA 5EYGA 3IFCA 1FBGA 4NGUA 4OA4A 3BIHA 3W9WA 4GBVA 2DE3A 1FPEA 1KZ8A 5IZZA 4NQ8A 1INPA 1FPIA 4X04A 2Y5KA 5T3JA 2WYKA 4GBWA 4MCOA 4GX4A 2XWVA 1RDZA 3W9VA 2WEFA 5EQ9A 1FBCA 1NI9A 5I3SA 2DVZA 3MSTA 2GQ1A 4HCYA 4P8BA 1VDWA 1KA0A 3T1BA 1FPFA 3HFUA 4JVDA 4O8MA 2OWZA 4P1EA 4LN5A 4PFRA 2L5VA 5EQAA 4N6KA 2FHYA 1JP4A 2Y5LA 3B8BA 5I7IA 1IMCA 1FTAA 4NX1A 1LBYA 4MJOA 2HXRA 4YZZA 2Q8MA 4N8GA 1FBFA 2VT5A 3MYUA 2HPGA 4F18A 3BIGA 2QVUA 2Q74A 1IMFA 3FBPA 1NV2A 3QMFA 4IR8A 5IZ1A 5IZ3B 4HE2A 4P3LA 4P9KA 4PC9A 4GWUA 4MNPA 1DCUA 4PAKA 1KA1A 3RPLB 2F3BA 4GWWA 3KBZA 5ET7A 5IM2A 3E78A 4GWZA 3ROJA 5ESYA 4I3EA 1AWBA 3GYYA 1FPJA 1NV6A 2CEXA 4PCDA 2WX9A 4NG7A 4XF5A 4MNIA 2XXKA 4PETA 1XI6A 1NV4A 1IMDA 2P3NA 5ET6A 1FBDA 2JJKA 5JK4A 4NHBA 1FBEA 4JVIA 2CZHA 3NOHA 5J1DA 4PFIA 3B50A 4OVRA 4M1VA 2MKZA 1LBWA 2KQZA 4GX3A 1FPGA 4N81A 4O7IA 2CZIA 4OVSA 3LV0A 4N8YA 4AS5A 4PF8A 4GX6A 2DE2A 1NUZA 2QPQA 1G0HA 4UABA 1NV3A 2F3DA 2FIEA 4PF6A 2HHMA 2VPOA 1FJ9A 4N6DA 2WBBA 2VPNA 1FSAA 4PDDA 5EQ7A 4MMPA 4O94A 4X9TA 4PDHA 2PCRA 4GWXA 4DI3D 4KXPA 5IZ3A 4XEQA 5FBPA 4JVCA 2PFZA 4HXVA 4AS4A 3EKIA 4PE3A 1NV5A 5LTCA 4HCWA 5EYHA 4PFBA 4PBQA 1NUWA 4HE0A 1IMEA 5DW8A 3RPLA 1QGXA 2Q9TA 3FXBA 4N15A 4PBHA 1NV0A 4P1LA 4GWSA 1DK4A 3RYDA 4O7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWY A;  3KC0 A;  1RDX A;  1NUY A;  2OX3 A;  1FBP A;  1FJ6 A;  1IMA A;  1NV1 A;  2FVZ A;  1FBH A;  4FBP A;  5F24 A;  5EQ8 A;  1LBV A;  1NUX A;  1YYZ A;  1LBZ A;  3IFA A;  2QVV A;  5LDZ A;  3LUZ A;  1K9Y A;  5ET8 A;  1D9Q A;  1LEV A;  1EYJ A;  2FBP A;  3KC1 A;  1BK4 A;  1FPL A;  1G0I A;  1IMB A;  1EYK A;  1FPK A;  2DDK A;  4H45 A;  4QXD A;  1NV7 A;  5J16 A;  5A5L A;  1FPB A;  2FIX A;  4I40 A;  3A29 A;  1SPI A;  1FPD A;  1YZ0 A;  2R8T A;  1FRP A;  1DBZ A;  1LBX A;  1K9Z A;  1CNQ A;  4G61 A;  5ET5 A;  1RDY A;  2BJI A;  4HE1 A;  2P3V A;  2QVR A;  1YXI A;  2CZK A;  4I3Y A;  3T0J A;  4H46 A;  2WBD A;  1Q9D A;  3D1R A;  2QFL A;  1EYI A;  4PTK A;  5EYG A;  3IFC A;  1FBG A;  3BIH A;  4GBV A;  1FPE A;  1KZ8 A;  1INP A;  1FPI A;  2Y5K A;  5T3J A;  4GBW A;  4GX4 A;  1RDZ A;  2WEF A;  5EQ9 A;  1FBC A;  1NI9 A;  5I3S A;  2GQ1 A;  1VDW A;  1KA0 A;  1FPF A;  2OWZ A;  5EQA A;  2FHY A;  1JP4 A;  2Y5L A;  3B8B A;  1IMC A;  1FTA A;  1LBY A;  4MJO A;  2Q8M A;  1FBF A;  2VT5 A;  3BIG A;  2QVU A;  2Q74 A;  1IMF A;  3FBP A;  1NV2 A;  3QMF A;  4IR8 A;  5IZ1 A;  5IZ3 B;  4HE2 A;  4GWU A;  1DCU A;  1KA1 A;  3RPL B;  2F3B A;  4GWW A;  3KBZ A;  5ET7 A;  4GWZ A;  3ROJ A;  5ESY A;  4I3E A;  1AWB A;  1FPJ A;  1NV6 A;  1XI6 A;  1NV4 A;  1IMD A;  2P3N A;  5ET6 A;  1FBD A;  2JJK A;  1FBE A;  2CZH A;  1LBW A;  4GX3 A;  1FPG A;  4N81 A;  4O7I A;  2CZI A;  3LV0 A;  4AS5 A;  4GX6 A;  1NUZ A;  1G0H A;  1NV3 A;  2F3D A;  2FIE A;  2HHM A;  1FJ9 A;  2WBB A;  1FSA A;  5EQ7 A;  2PCR A;  4GWX A;  4KXP A;  5IZ3 A;  5FBP A;  4HXV A;  4AS4 A;  1NV5 A;  5EYH A;  1NUW A;  4HE0 A;  1IME A;  5DW8 A;  3RPL A;  1QGX A;  1NV0 A;  4GWS A;  1DK4 A;  3RYD A; 
#chains in the Genus database with same CATH topology
 2O1L A;  3RT8 A;  1OQH A;  4HS7 A;  3VV5 A;  2V4C A;  4JSD A;  1OLA A;  1URS A;  4NAP A;  1LAG E;  3QXM A;  4G68 B;  5JTY B;  1P99 A;  4KPT A;  2B4M A;  4F22 A;  4I40 A;  3TZA A;  1DSN A;  1I6B A;  3QUF A;  1IIW A;  2E1S A;  2I6E A;  3TEL A;  3ISP A;  5JEI A;  4EXK A;  1TWY A;  5IKB A;  3CR9 A;  4MLV A;  4DE8 A;  1JNF A;  1LB8 A;  2WBD A;  3N94 A;  1MPB A;  3DEL B;  1NNT A;  4IO5 A;  3VXB A;  1XOC A;  2F34 A;  1IMC A;  2XXU A;  3TOD A;  1B51 A;  1P1W A;  2XX9 A;  3L6H A;  4GL8 A;  1EZ9 A;  1B7Z A;  2P1S A;  4G77 A;  4X48 A;  4XF5 A;  1WOD A;  2ZNS A;  1B5I A;  4NHB A;  3OD7 A;  5J1D A;  1GGG A;  3MC2 A;  3TDJ A;  3T9U A;  3IOU A;  4R6K A;  4JWX A;  3IB2 A;  3MPL A;  4YMB A;  2FIE A;  2ZYO A;  4N6P A;  4NF6 B;  3PGF A;  3KJ7 A;  3EKI A;  4PBQ A;  3CFL A;  1PC3 A;  3D4G A;  2FVZ A;  3PUW E;  4F3B A;  1LBV A;  4F2O A;  1K9Y A;  4BDQ A;  2R9J A;  2V3T A;  2HEU A;  5I57 B;  5IAI A;  2ZMB A;  1TXF A;  1US4 A;  3CI8 A;  4GRK A;  1LB9 A;  1RKM A;  4F3P A;  2FIX A;  5I56 B;  3FVG A;  4RPO A;  5KDT B;  5IGA A;  5F7V A;  2CZK A;  5ICT A;  2ESN A;  3FJM A;  3F11 A;  3CSB A;  3K4U A;  4OVJ A;  2RF1 A;  3VLV A;  1FBG A;  1INP A;  1XT8 A;  2XXY A;  4PDH A;  1WDN A;  4LN5 A;  3C35 A;  1LBY A;  1DMB A;  3UOR A;  1N04 A;  4O3B A;  2DWA A;  5IZ3 B;  2Q74 A;  4H8J A;  4P9K A;  4R6Y A;  4HE2 A;  1SDX A;  3CG3 A;  1P1O A;  1USY H;  3OEN A;  1B3E A;  4PET A;  2Q8J A;  3RY3 A;  1RYO A;  4YB6 A;  2KQZ A;  2CZI A;  2F97 A;  2UVJ A;  3K6V A;  1FTJ A;  4RPN A;  2AL4 A;  3TQW A;  1M5E A;  3FVK A;  3U93 A;  3Q28 A;  5H8Q A;  1B0L A;  3KC0 A;  4HTG A;  1BLF A;  4WKM A;  4DXU A;  2OPE A;  5EQ8 A;  5EHS A;  4OAN A;  1YYZ A;  2QSX A;  3MQ9 A;  1D9Q A;  1D9V A;  3KC1 A;  2XD3 A;  4GD5 A;  1FTK A;  4QFK A;  2IEE A;  1R9Q A;  1Y4C A;  1SW5 A;  5H8N B;  3SEX A;  3OEM A;  4N17 A;  4GIZ A;  2P3V A;  1B6H A;  1WVJ A;  3T96 B;  2HAU A;  3ZKK A;  5TU0 A;  1SD3 A;  5L8D A;  3EHS A;  1P1N A;  4RNS A;  5ITP A;  4NF5 A;  4IO2 A;  4MH5 A;  2G93 A;  4MLQ A;  1B0H A;  2WEF A;  4P8B A;  1NI9 A;  4XEQ A;  1VDW A;  5ITO A;  4G68 C;  3CIJ A;  1H76 A;  4Q0C A;  1VE4 A;  2XHD A;  2HXR A;  2GHB A;  3S9M C;  2UVI A;  4OMB A;  1PBQ A;  1CE2 A;  2DP8 A;  4ZZE A;  1UTB A;  3IOR A;  3PUX E;  1NV6 A;  1A55 A;  5L9M A;  4P11 A;  1Q1K A;  4TLL B;  2Q88 A;  3VVD A;  4PFI A;  1NMU A;  4KQP A;  1SW2 A;  1TFA A;  2AIX A;  1NV3 A;  1USY E;  3MP6 A;  4N6D A;  1GVC A;  4O3A A;  1FQB A;  3GXA A;  2ONR A;  1DPE A;  1MM7 A;  1Y4T A;  5EYH A;  3E4R A;  3QK6 A;  2AYS A;  4P1L A;  3RYD A;  4GFR A;  1N7X A;  3MAM A;  1NV1 A;  4RY1 A;  1LBB A;  2XXQ A;  3K1M A;  3TTL A;  1ZU0 A;  3RTF B;  4YAH X;  2H98 A;  4ECF A;  4XIG Q;  4BLA A;  3PD9 A;  4QFP A;  4PAI A;  4H45 A;  4MIJ A;  3UK4 A;  4LAT A;  1HSJ A;  3K6U A;  3SZP A;  4U4X A;  2F7C A;  3N6T A;  4U1O A;  4NTL A;  1UIU A;  1H45 A;  5KCJ A;  4GOT A;  3PUZ E;  4I3Y A;  1PB8 A;  3TQL A;  4FJP A;  3S9L C;  3BIH A;  4JDF A;  2Z22 A;  3MPK A;  2XWV A;  1N3W A;  4HCY A;  4NWC A;  1TFD A;  5TP9 A;  4PFR A;  2D5W A;  2HFB A;  1IXC A;  1QKA A;  5M2V A;  4F18 A;  3QMF A;  4RXL A;  1IQ7 A;  2Z23 A;  1NNF A;  4NWD A;  1EZP A;  3HHF A;  3PU5 A;  1LCF A;  1B9J A;  2WX9 A;  3CG1 A;  4JWY A;  3IO6 A;  3B50 A;  1N76 A;  2X7P A;  4E0W A;  5AA2 B;  4N8Y A;  3S9E A;  4F39 A;  2Q2C A;  4ZZA A;  1FSA A;  1MM6 A;  2DWI A;  3R26 A;  1IME A;  2XXV A;  3HST A;  2O69 A;  2ZZV A;  3UP9 A;  1FJ6 A;  2VD3 A;  3CRB A;  1NUX A;  1LBZ A;  2PVU A;  2QVV A;  1JEU A;  3LUZ A;  2FA7 A;  3FVN A;  3T22 A;  4XTC Q;  2ANJ A;  3TCH A;  1FQC A;  1Q35 A;  3RT6 B;  3KOT A;  4RK9 A;  4LA9 A;  1M5F A;  4I1D A;  2F36 A;  1B40 A;  4LZ5 A;  2HAV A;  5I59 A;  2F7A A;  1Y3Q A;  4JWO A;  1ZMG A;  4IB2 A;  2KR0 A;  1HSL A;  4ESW A;  3BBR A;  3IO4 A;  1S50 A;  3DP4 A;  3C34 A;  4FEC A;  4NGU A;  4QSE A;  2XXT A;  4C1U A;  1BTJ A;  1MH4 A;  3DP8 A;  1RYX A;  1ELJ A;  1FPF A;  3HFU A;  3WAE A;  3EN3 A;  2FHY A;  4R74 A;  2Q8M A;  1B4H A;  3OO6 A;  5BWJ A;  2VHA A;  5DEX B;  3B6W A;  1IUD A;  3ROJ A;  2XX7 A;  4R2B A;  3IJX B;  2GHA A;  4PCD A;  2YJP A;  4BDL A;  1J1N A;  3VLU A;  2XX8 A;  3MVY A;  4OVR A;  3M3F A;  4DCX A;  2I49 A;  4U23 A;  3LV0 A;  1IXI A;  5DEX A;  5AA1 A;  4DI3 D;  2VP1 A;  1N7W A;  1DTG A;  2QRY A;  1YTV A;  4KHZ E;  3MJN A;  4MHF A;  4ISU A;  3RUM A;  3TTK A;  4OZ9 A;  1YCJ A;  4FEB A;  1FBP A;  4N91 A;  4NF8 A;  4XXU A;  1B5J A;  4Z0I A;  4OFJ A;  3OSR A;  5FTI A;  3IFA A;  1R1N A;  2HXW A;  1GV8 A;  3G3J A;  3KSX A;  1IXG A;  2VOZ A;  3QUJ A;  4QSC A;  1ZBM A;  3Q27 A;  3SEU A;  2E0S A;  4YKP A;  4PGN A;  1FPK A;  1UQW A;  4QFN A;  1Y9U A;  2AL5 A;  3U65 A;  4KR5 A;  3A29 A;  3QAX A;  4RYA A;  1DBZ A;  3FZV A;  1LBX A;  3SEV A;  3KZG A;  4TQU Q;  3H6U A;  2DVC A;  1QW0 A;  2Y7I A;  4P47 A;  1YXI A;  4H46 A;  1MDQ A;  2QFL A;  3W15 C;  4N13 A;  3JZJ A;  3K2D A;  4GBW A;  5I3S A;  1AOV A;  1FBC A;  4IO4 A;  1LCT A;  4N6K A;  1UIV A;  1JP4 A;  4YKI A;  5FTH A;  2HPG A;  3K6W A;  1NV2 A;  2ZNT A;  5FHN A;  3S2V A;  2DQV A;  3EHU A;  2D21 A;  3E13 X;  5JK4 A;  2P3N A;  5ET6 A;  1SQY A;  1FBD A;  3IOV A;  3MZ9 A;  4G8N A;  3LBS A;  3OXN A;  4UAC A;  3WAF A;  3S9N C;  4X1D A;  2V3U A;  4H8I A;  2F3D A;  4U2R A;  5EQ7 A;  4YB7 A;  3FIR A;  5FBP A;  1PB7 A;  1LLS A;  1URG A;  1NUW A;  3FV1 A;  3M8U A;  2Q9T A;  2NVU B;  1B7U A;  1S7Y A;  5TP9 B;  3B6T A;  1RDX A;  3PUV E;  1NUY A;  2X26 A;  2YPN A;  3HO7 A;  3U72 A;  1MQI A;  1NH8 A;  1FPL A;  3KSJ A;  2PYY A;  1EYK A;  2DDK A;  4FIM A;  4XFE A;  2DYX A;  2QS1 A;  4TOZ A;  2HZK A;  4PAF A;  5I2N A;  4LVQ A;  4G8H A;  1CNQ A;  4DCY A;  1RDY A;  2THI A;  2YLN A;  2GH9 A;  1IEJ A;  3K00 A;  2NUV A;  2GFE A;  3LSF B;  4DIG A;  5B70 A;  4N07 A;  4WEP A;  2DS9 A;  2FYI A;  4HW8 A;  4U22 A;  1JET A;  1Y20 A;  3FAT A;  2L5V A;  3FXQ A;  1QUI A;  1ZIU A;  4QF9 A;  3PUY E;  4IY5 A;  4N8G A;  3TTN A;  4IR8 A;  1R6Z A;  2V93 A;  1O63 A;  1XC1 A;  3IX1 A;  2F3B A;  1AIV A;  2F78 A;  4OTE A;  5DT6 A;  5CMM A;  3E78 A;  1OIB A;  1US5 A;  2X7Q A;  1ZKB A;  3MVX A;  4F2Q A;  1NV4 A;  4I62 A;  1MPD A;  1MH3 A;  2Y7R A;  4O7I A;  1POT A;  3MVZ A;  2UVH A;  2QPQ A;  4ONY A;  2WBB A;  1Y3P A;  3H6T A;  3VVF A;  3U92 A;  2VD2 A;  3OO7 A;  2O7U A;  2F8D A;  5AA3 A;  4YU0 A;  3B6Q A;  4MEV A;  4P56 A;  3H6W A;  1B58 A;  4PFW A;  3PPN A;  2QS2 A;  4OVQ A;  4F19 A;  3E79 A;  5ET8 A;  3VVE A;  4N4U A;  4NF4 A;  2IA4 A;  1HSE A;  4JSO A;  4OET A;  1IMB A;  4IO3 A;  1Z7M E;  3U1O A;  4QXD A;  1NV7 A;  4EUO A;  1FPB A;  5H8N A;  1FQF A;  1K9Z A;  1LGB C;  3CVG A;  3KJT A;  2OZZ A;  1B4Z A;  3U94 A;  3SES A;  1MXY A;  3EPE A;  3D1R A;  3HV1 A;  4EQ7 A;  1KZ8 A;  5T3J A;  4GX4 A;  1RDZ A;  2GQ1 A;  4PQJ A;  1YPN A;  2I0B A;  4JVD A;  1NNK A;  1LFI A;  3FV2 A;  4OES A;  2UYE A;  3H4Z A;  3G3F A;  1D9Y A;  4R9G A;  3LSX A;  3PMV A;  5I59 B;  2DWH A;  3DLN A;  1ZJL A;  3MVW A;  4OFO A;  3V5A A;  5FHO A;  1FQD A;  4GWU A;  3RPL B;  3C4M A;  5I2K A;  2I58 A;  1FQA A;  4NG7 A;  3EQ1 A;  4RA1 A;  1XVY A;  4AS5 A;  4PF8 A;  3BKI B;  1G0H A;  1ZLQ A;  3IB1 A;  4E0X A;  1LAF E;  5IZ3 A;  1XHY A;  1B1H A;  3ODB A;  1H43 A;  3FXB A;  1H3D A;  4F1V A;  2PFY A;  5AA2 A;  1B3L A;  3RN8 A;  2RC9 A;  4BDN A;  3EF7 A;  3MP8 A;  2Z8F A;  2Y7W A;  5CM6 A;  4NN3 A;  3L6G A;  4YIC A;  3T66 A;  1MXZ A;  4ZE8 A;  1JVY A;  4U4S A;  5FHM A;  3TCF A;  2H4I A;  5I58 A;  3R6U A;  2RC8 A;  2ZZW A;  1FRP A;  3PTY A;  2WYP A;  3TMG A;  4OXV A;  2W7Y A;  5ET5 A;  1SW1 A;  4BDR A;  4OYV A;  3H7M A;  5I57 A;  4C0R A;  4OHN A;  3TAJ A;  2A5T B;  2QS4 A;  3IR1 A;  4OWD A;  4H65 A;  4K3F A;  4POX A;  3TTM A;  1BIY A;  2WYK A;  4ZE9 A;  3ILU B;  1P1Q A;  4O8M A;  2OWZ A;  3UGW A;  4KYD A;  5EQA A;  5KCJ B;  5A5X B;  2H9B A;  3T93 B;  4NX1 A;  4MJO A;  2ONS A;  1FBF A;  2H25 A;  3MYU A;  1P1U A;  4GXS B;  1MPC A;  1TT1 A;  1D4N A;  4TLM B;  4IY6 A;  2OLB A;  3HPI A;  2RIN A;  4XKR A;  4DDD A;  3SET A;  2Y7P A;  5CC2 A;  4NMY A;  2QS3 A;  2RCA A;  1SI1 A;  3C33 A;  4MBP A;  4MF3 A;  4AB5 A;  4M1V A;  1FPG A;  3RNN A;  1NUZ A;  1LBC A;  4PF6 A;  4R6H A;  2I0C A;  1NNP A;  5AE4 A;  1QUJ A;  2PFZ A;  4YKJ A;  4PFB A;  2F7B A;  3VDF A;  3ZSF A;  2ONK E;  4PFU A;  1EU8 A;  5I2K B;  3O29 A;  1DTZ A;  1FCK A;  4U21 A;  1MY1 A;  3LR1 A;  2G29 A;  1XVX A;  1MXW A;  3PPP A;  2F35 A;  2O68 A;  2OWS A;  5HPQ A;  1MY0 A;  1SVX B;  4GVO A;  2DWJ A;  4QFO A;  4Q5T A;  2XXP A;  4QBA A;  2CMO A;  1MXU A;  2XXX A;  5CRY A;  4EF2 A;  3CHG A;  5K2Y A;  4OEU A;  4ELR A;  4OA4 A;  4U1Z A;  3PPQ A;  4NF5 B;  2QMW A;  1PB9 A;  3PMX A;  2Z8D A;  4DZ1 A;  1MQH A;  1JEV A;  1FTA A;  1N0T A;  3SDF A;  3K01 A;  1NKX A;  4NF4 B;  1IMF A;  4P3L A;  5ESY A;  2ZYN A;  2CEX A;  1SI0 A;  3T9V A;  3CSG A;  4R72 A;  1VR5 A;  4JVI A;  2CZH A;  4F1Y A;  3I5O A;  2RCB A;  3RGY A;  3HN0 A;  1IIT A;  5H8Q B;  1BKA A;  3QSL A;  4MMP A;  4LZ8 A;  3MBP A;  4PP0 A;  1PEB A;  1DPP A;  3LUY A;  2UXA A;  4GWO A;  2CZL A;  3K1P A;  4GWS A;  3H03 A;  3E9X A;  3OO8 A;  1A8E A;  3S4U A;  3OMB A;  2DE4 A;  1QKB A;  1JW5 A;  1SW4 A;  3I6V A;  1FBH A;  4FBP A;  4EXL A;  3O9P A;  2NWJ A;  3H06 B;  4PGP A;  1G0I A;  3K02 A;  2PBW A;  1FTM A;  3DP6 A;  4WED A;  1PBP A;  3FXR A;  3C9H A;  4MAG A;  3IL1 B;  4KFQ A;  1SPI A;  1LAX A;  4GQO A;  3MZB A;  4QRZ A;  3T9X B;  4LUB A;  4HE1 A;  3A09 A;  1VFE A;  2RC7 A;  2I4B A;  2P0S A;  3KOS A;  1LAH E;  3ZKL A;  1MY2 A;  4PTK A;  5EYG A;  3IFC A;  1N3X A;  5DVI A;  5ICQ A;  4MCO A;  4XKQ A;  1OLC A;  1VSO A;  2O1M A;  4FAT A;  5I2N B;  4OFL A;  3MUQ A;  3M3L A;  2B65 A;  2VT5 A;  5KDT A;  3U8Q A;  1LST A;  2V25 A;  4F31 B;  1B3G A;  3HHG A;  2QVU A;  1QUK A;  5I56 A;  3HCQ A;  4PAK A;  1KA1 A;  2OBG A;  1BP5 A;  5HM4 B;  1AMF A;  4I8C A;  1A8F A;  4GWZ A;  4G2Z A;  1AWB A;  1I69 A;  3GZG A;  3O97 A;  2JJK A;  4F3G A;  3NOH A;  5L9S A;  2MKZ A;  1IXH A;  5AA4 A;  3C32 A;  2F6P A;  2Y7K A;  2DSF A;  2NOO A;  2GRV A;  4UAB A;  2VPO A;  4F29 A;  4ZEF A;  3TUS A;  1O64 A;  2ZYM A;  4HXV A;  4BDM A;  3BFU A;  2F6G A;  4KCD A;  2B3B A;  1ATG A;  1PDA A;  4DXC A;  5HBC A;  1T0K A;  3OOA A;  5LDZ A;  2Z8E A;  4PDD A;  3TKD A;  1EYJ A;  3IOT A;  4OEV A;  3I3V A;  2BJJ X;  5J16 A;  1QJM A;  3O2A A;  2RKM A;  5ELV A;  3RLF E;  1F9B A;  3D4C A;  1B5H A;  4THI A;  4X8R A;  2HQ0 A;  3VFJ A;  1QUL A;  2XXR A;  5DYH A;  2QMX A;  3O28 A;  1L5T A;  4EQ9 A;  2ZZX A;  2P2A A;  4ELO A;  3SEY A;  2F5X A;  3FGS A;  2V3Q A;  3UA8 A;  5IZZ A;  4XKN A;  2DOJ A;  3W9V A;  5EYF A;  2PX1 A;  1OVB A;  3MST A;  4KD5 A;  3G7W A;  3JYR A;  4IO7 A;  2D3I A;  3KFM A;  2ABH A;  3V89 B;  4YZZ A;  4AB6 A;  2HCA A;  3O6H A;  5K2X A;  3PD8 A;  3FBP A;  3IOW A;  5H8F A;  4R2F A;  4MNP A;  1LFH A;  2V84 A;  5I84 A;  3KBZ A;  4G68 A;  5JTY A;  3RQT A;  3T9H B;  4MNI A;  4OER A;  1KWH A;  1I6A A;  1R9L A;  3O6G A;  1MS7 A;  3QYT A;  3IB0 A;  3Q25 A;  1B2H A;  3MP1 A;  4ESX A;  3IK6 B;  4O94 A;  2PCR A;  4JVC A;  4KYS A;  4NE4 A;  4AS4 A;  1NV5 A;  1URD A;  5DW8 A;  1QGX A;  4G4P A;  5B7D A;  2ALU A;  1DK4 A;  2UVG A;  2OX3 A;  3IJO B;  3ONM A;  4LQ5 A;  2PT1 A;  4KI0 E;  3TPA A;  5A5X A;  1IZ1 A;  2QJE A;  4RJZ A;  4NF0 A;  5LTC A;  2FBP A;  1Y1M A;  3VE1 B;  3FVO A;  3ILT B;  3CFX A;  3GBA A;  2A5T A;  4KCC A;  5DTB A;  3FAS A;  4F3S A;  3A3U A;  1MY3 A;  1MXV A;  2DXR A;  1YZ0 A;  1YAE A;  4ELQ A;  4G61 A;  2QVR A;  1FTL A;  1UTH B;  4PFT A;  4OVT A;  1SYI A;  2QL3 A;  3KN7 A;  5I58 B;  4O3C A;  4R9F A;  2DXY A;  2Y5K A;  1B7H A;  4ZEB A;  1KA0 A;  4I9D A;  3K6X A;  5CI5 A;  4P1E A;  4R75 A;  4G8M A;  4IO6 A;  5I7I A;  4LON B;  3B8B A;  4DLD A;  4UA8 A;  1XS5 A;  3BIG A;  3K1N A;  2O7I A;  2NXO A;  3O6I A;  1ZTY A;  2O84 X;  1A7L A;  3SER A;  5IM2 A;  3V83 A;  1ANF A;  2A5S A;  1FPJ A;  1MQG A;  4FED A;  3Q26 A;  4X1B A;  3THI A;  1FBE A;  3C31 A;  4OQO A;  3H3G A;  2H5Y A;  3LC8 A;  1FJ9 A;  4ZEI A;  2FNC A;  4GXA A;  4PFY A;  4HCW A;  4PBH A;  4N15 A;  3RPL A;  3RPW A;  1OMP A;  4O7M A;  3V8X B;  2XWK A;  2REJ A;  4Q30 B;  3FXU A;  5F24 A;  5TPA B;  5H8H B;  5LOM A;  1B52 A;  4ZED A;  1BK4 A;  1UTH A;  5I5P A;  1B32 A;  4H1X A;  4C1T A;  2XD2 A;  3KBR A;  2XXW A;  1SYH A;  1OVT A;  3G3H A;  4DI4 B;  1DOT A;  4LZ7 A;  4Q8R A;  1S9T A;  4JBZ A;  4RK2 A;  1JW1 A;  1LFG A;  1MQD A;  1MDP 1;  3TTR A;  3W9W A;  1EZO A;  4GBV A;  5CBS A;  1NL5 A;  4M4G A;  3TFL A;  4EQB A;  3OSQ A;  3UIF A;  3N26 A;  3ZS6 A;  2KLF A;  3T1B A;  5DVJ A;  5CMC A;  2Y5L A;  4QSD A;  4JB7 A;  3MZ1 A;  1MQJ A;  3KN3 A;  5IZ1 A;  4H5F A;  2R6G E;  4PC9 A;  4EDP A;  4ND9 A;  5ET7 A;  3G3K A;  5CMB A;  3R7X A;  3N5L A;  4I3E A;  1D3K A;  3BFT A;  3PMW A;  4PE5 B;  1B05 A;  2OCU A;  3O66 A;  5DVF A;  2ZYK A;  1Z7N E;  5H8F B;  3PV0 E;  4L17 A;  1SBP A;  4ZS9 A;  1M5D A;  3TCG A;  4FE8 A;  4FAJ A;  3RTW B;  1B46 A;  3K0V A;  4GWY A;  3IAZ A;  4F1U A;  2XWO A;  2O6A A;  1IMA A;  4MX6 A;  3M3K A;  3PPR A;  3FD3 A;  2LAO A;  4XKP A;  4ZEK A;  4BDO A;  3KG2 A;  1UTB B;  2Q2A A;  1LEV A;  3DM0 A;  1B1X A;  1NFT A;  5AA2 D;  1MY4 A;  3G3G A;  3GLB A;  1O7T A;  1FPD A;  3B7D A;  1JQF A;  2XWI A;  1M5B A;  2I48 A;  3PPO A;  5EHM A;  3KN8 A;  2PT2 A;  2OWT A;  1AL3 A;  1NH7 A;  4QHQ A;  3T0J A;  2DE3 A;  5BUU A;  1FPI A;  4X04 A;  4H67 A;  3C36 A;  5EQ9 A;  3TYH A;  3KGC A;  2H99 A;  2ZNU A;  2PMS A;  3MWB A;  1MG1 A;  5L9O A;  1GR2 A;  5ISU A;  4WXJ A;  2OK2 A;  2XXH A;  4GWW A;  3OEK A;  4R73 A;  3GYY A;  5AA4 B;  3ECR A;  2XXK A;  3FJG A;  1IMD A;  5H8S A;  3A3C A;  5H8H A;  2B3F A;  2Y84 A;  5TPA A;  4P0I A;  1LBW A;  1II5 A;  5CBR A;  1FQE A;  4GX3 A;  4N81 A;  1GTK A;  1A99 A;  4ZEC A;  2HHM A;  4GL0 A;  4X9T A;  2I3V A;  4GWX A;  4KXP A;  4EF1 A;  4H0W A;  4YB5 A;  4LP2 B;  1I6Q A;  3GBB A;  3USD A;  1CB6 A;  1NV0 A;  2I3W A;  1Y3N A;  4YKK A;  2CEY A;  3P7I A;  3LSL A;  4QFL A;  1M5C A;  2WKY A;  4MNC A;  4NED A;  3VXC A;  2XA5 A;  1B3H A;  2OJT A;  2Q89 A;  5A5L A;  4JXI A;  4IGT A;  5CMK A;  1Y1Z A;  3SKP A;  4OVP A;  3OEL A;  2R8T A;  4FOR A;  1MRP A;  3Q29 A;  2BJI A;  2I4C A;  4H5G A;  2M8C A;  4H6D A;  3LSW A;  1JVX A;  1OQG A;  1Q9D A;  2HZL A;  1EYI A;  4LQ2 A;  1QVS A;  2B4L A;  1B3F A;  3KEI A;  1POY 1;  3MW0 A;  1FPE A;  3UN6 A;  4NQ8 A;  4AQ4 A;  4KYE A;  1VFD A;  3SEW A;  1N84 A;  2DVZ A;  2O51 A;  4P0G A;  2REG A;  4NF8 B;  2UYF A;  3AXF A;  3CFZ A;  3FUZ A;  3OO9 A;  1FTO A;  1AH5 A;  4GF8 A;  4ELP A;  2OPD A;  1DCU A;  1JW4 A;  3FJ7 A;  1EH3 A;  2VGQ A;  4POW A;  3H6V A;  4MFI A;  3JV9 A;  5F1Q A;  1H44 A;  1XI6 A;  3TEP A;  1MXX A;  4IGR A;  3E3K A;  4OEN A;  3N6U A;  1FW0 A;  4OVS A;  2XXI A;  4Z7E A;  4GX6 A;  2DE2 A;  2ZXT A;  4DXB A;  4NF6 A;  4GLI A;  2VPN A;  3QIM A;  3VLW A;  5KZT A;  1A54 A;  4YMA A;  3EHT A;  4ZDM A;  4PE3 A;  1A40 A;  4HE0 A;  2R71 A;  3G3I A; 
#chains in the Genus database with same CATH homology
 4GWY A;  3KC0 A;  4F1U A;  4F1V A;  1RDX A;  2XWO A;  2ZZV A;  1NUY A;  4MEV A;  4P56 A;  2OX3 A;  2DE4 A;  2PFY A;  2XWK A;  1FBP A;  1FJ6 A;  1IMA A;  1NV1 A;  4N91 A;  4MX6 A;  2FVZ A;  2CEY A;  1FBH A;  4FBP A;  5F24 A;  5EQ8 A;  4OAN A;  1LBV A;  2V4C A;  1NUX A;  1YYZ A;  1LBZ A;  4OVQ A;  4F19 A;  3IFA A;  2QVV A;  5LDZ A;  3E79 A;  3LUZ A;  4MHF A;  1K9Y A;  5ET8 A;  4NAP A;  1D9Q A;  1LEV A;  1EYJ A;  2FBP A;  4MNC A;  4NF0 A;  3KC1 A;  4PGP A;  5CM6 A;  1BK4 A;  1FPL A;  1G0I A;  4NN3 A;  5I5P A;  4N4U A;  4YIC A;  1IMB A;  2XA5 A;  1EYK A;  4PAI A;  4PGN A;  1FPK A;  2DDK A;  4H45 A;  4QXD A;  1NV7 A;  4MIJ A;  4MAG A;  5J16 A;  4XFE A;  2B4M A;  5A5L A;  1FPB A;  2FIX A;  4I40 A;  3U65 A;  2HZK A;  4PAF A;  4DI4 B;  3A29 A;  1SPI A;  4OVP A;  1FPD A;  1YZ0 A;  2ZZW A;  4X8R A;  2R8T A;  4N17 A;  3SZP A;  1FRP A;  1DBZ A;  2XWI A;  1LBX A;  1K9Z A;  1CNQ A;  4G61 A;  2WYP A;  3ISP A;  3PTY A;  5ET5 A;  1RDY A;  2BJI A;  2ZZX A;  4HE1 A;  4P47 A;  5IGA A;  2P3V A;  2QVR A;  4QBA A;  2KR0 A;  1YXI A;  2CZK A;  4OVT A;  4I3Y A;  3T0J A;  4H46 A;  2WBD A;  1Q9D A;  2F5X A;  2HZL A;  3CHG A;  3D1R A;  2V3Q A;  2QFL A;  1EYI A;  4PTK A;  2B4L A;  5EYG A;  3IFC A;  1FBG A;  4NGU A;  4OA4 A;  3BIH A;  3W9W A;  4GBV A;  2DE3 A;  1FPE A;  1KZ8 A;  5IZZ A;  4NQ8 A;  1INP A;  1FPI A;  4X04 A;  2Y5K A;  5T3J A;  2WYK A;  4GBW A;  4MCO A;  4GX4 A;  2XWV A;  1RDZ A;  3W9V A;  2WEF A;  5EQ9 A;  1FBC A;  1NI9 A;  5I3S A;  2DVZ A;  3MST A;  2GQ1 A;  4HCY A;  4P8B A;  1VDW A;  1KA0 A;  3T1B A;  1FPF A;  3HFU A;  4JVD A;  4O8M A;  2OWZ A;  4P1E A;  4LN5 A;  4PFR A;  2L5V A;  5EQA A;  4N6K A;  2FHY A;  1JP4 A;  2Y5L A;  3B8B A;  5I7I A;  1IMC A;  1FTA A;  4NX1 A;  1LBY A;  4MJO A;  2HXR A;  4YZZ A;  2Q8M A;  4N8G A;  1FBF A;  2VT5 A;  3MYU A;  2HPG A;  4F18 A;  3BIG A;  2QVU A;  2Q74 A;  1IMF A;  3FBP A;  1NV2 A;  3QMF A;  4IR8 A;  5IZ1 A;  5IZ3 B;  4HE2 A;  4P3L A;  4P9K A;  4PC9 A;  4GWU A;  4MNP A;  1DCU A;  4PAK A;  1KA1 A;  3RPL B;  2F3B A;  4GWW A;  3KBZ A;  5ET7 A;  5IM2 A;  3E78 A;  4GWZ A;  3ROJ A;  5ESY A;  4I3E A;  1AWB A;  3GYY A;  1FPJ A;  1NV6 A;  2CEX A;  4PCD A;  2WX9 A;  4NG7 A;  4XF5 A;  4MNI A;  2XXK A;  4PET A;  1XI6 A;  1NV4 A;  1IMD A;  2P3N A;  5ET6 A;  1FBD A;  2JJK A;  5JK4 A;  4NHB A;  1FBE A;  4JVI A;  2CZH A;  3NOH A;  5J1D A;  4PFI A;  3B50 A;  4OVR A;  4M1V A;  2MKZ A;  1LBW A;  2KQZ A;  4GX3 A;  1FPG A;  4N81 A;  4O7I A;  2CZI A;  4OVS A;  3LV0 A;  4N8Y A;  4AS5 A;  4PF8 A;  4GX6 A;  2DE2 A;  1NUZ A;  2QPQ A;  1G0H A;  4UAB A;  1NV3 A;  2F3D A;  2FIE A;  4PF6 A;  2HHM A;  2VPO A;  1FJ9 A;  4N6D A;  2WBB A;  2VPN A;  1FSA A;  4PDD A;  5EQ7 A;  4MMP A;  4O94 A;  4X9T A;  4PDH A;  2PCR A;  4GWX A;  4DI3 D;  4KXP A;  5IZ3 A;  4XEQ A;  5FBP A;  4JVC A;  2PFZ A;  4HXV A;  4AS4 A;  3EKI A;  4PE3 A;  1NV5 A;  5LTC A;  4HCW A;  5EYH A;  4PFB A;  4PBQ A;  1NUW A;  4HE0 A;  1IME A;  5DW8 A;  3RPL A;  1QGX A;  2Q9T A;  3FXB A;  4N15 A;  4PBH A;  1NV0 A;  4P1L A;  4GWS A;  1DK4 A;  3RYD A;  4O7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...