1IMAA

Structural analysis of inositol monophosphatase complexes with substrates
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inositol monophosphatase complexes with substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 89
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imaA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imaA02
1KA0A 1XI6A 3D1RA 1DK4A 1FPDA 2FIEA 2WBBA 1INPA 1LBZA 1NUXA 3KC0A 3LV0A 1IMBA 2P3VA 2QVVA 1FPJA 5J16A 1FBCA 1Q9DA 1NV4A 1JP4A 1K9ZA 1FPKA 3KC1A 1QGXA 4I40A 4N81A 5ET5A 3T0JA 1NUZA 4QXDA 2QVUA 5DW8A 3QMFA 3BIGA 1EYIA 4HE0A 2BJIA 1G0HA 1KZ8A 5ESYA 1RDXA 1NV0A 1FPIA 1FBEA 2VT5A 1VDWA 3RPLB 1K9YA 2QVRA 1FBDA 1FPBA 4G61A 1DCUA 1BK4A 1RDZA 1YYZA 4GWYA 1NUYA 4GWZA 1NI9A 4GBWA 1IMFA 1FPFA 2PCRA 3RPLA 4FBPA 2DDKA 5EYHA 2WBDA 1CNQA 4H46A 2WEFA 2Q74A 4HE1A 1YXIA 1LEVA 4GBVA 1SPIA 1EYKA 1FTAA 4GX4A 1IMDA 1LBWA 1DBZA 4HXVA 1FPGA 1IMCA 2GQ1A 3IFCA 5T3JA 3IFAA 4GWSA 2QFLA 1FBPA 3LUZA 4GX3A 4GWWA 1FBGA 3B8BA 1KA1A 4HE2A 5EYGA 2OX3A 2F3BA 1NV7A 2R8TA 2CZKA 2FIXA 2HHMA 1FBFA 1IMAA 5LDZA 1FPEA 2F3DA 4GX6A 4I3EA 4PTKA 5F24A 4AS4A 2FBPA 3A29A 3FBPA 5EQAA 1FJ6A 2Q8MA 4H45A 1YZ0A 1IMEA 3RYDA 2CZIA 5EQ9A 4MJOA 4GWXA 3ROJA 1EYJA 1D9QA 1NV5A 1NV6A 1NV3A 2JJKA 1FPLA 2OWZA 1NV1A 1AWBA 4AS5A 3KBZA 2P3NA 5IZ1A 4I3YA 2Y5LA 1FBHA 2FHYA 2Y5KA 2FVZA 4GWUA 4O7IA 5ET8A 5EQ8A 1RDYA 1LBXA 1LBVA 4IR8A 1FJ9A 5FBPA 1FSAA 1NV2A 1LBYA 2CZHA 4KXPA 5IZ3B 5IZ3A 5I3SA 5ET6A 1NUWA 5A5LA 5EQ7A 1FRPA 3BIHA 5ET7A 1G0IA
chains in the Genus database with same CATH superfamily
3UA8A 1XI6A 1MM6A 2I4BA 4P47A 1INPA 4G2ZA 3SEYA 5DYHA 5B70A 2P3VA 2DXYA 1MXUA 4XTCQ 2XWKA 5I56A 1POTA 3IOTA 1KZ8A 2P1SA 4PBHA 1OQHA 1B4HA 2QVRA 1FPBA 2OWSA 1OVTA 5I5PA 3MVZA 5DVFA 1WVJA 1B51A 2WEFA 3O9PA 1AMFA 1USYH 2F6PA 3GLBA 1IMDA 3MVWA 1MQDA 1GVCA 2UVJA 1P1QA 3C31A 5HM4B 4JXIA 5I58A 1US4A 2V3UA 3H6TA 1QJMA 4OQOA 1EU8A 4JB7A 3K6VA 1ELJA 4AS4A 1M5FA 2B4MA 2O6AA 5I2KB 2B3FA 4DLDA 4R6KA 5CMKA 1ZLQA 4ZE9A 3DP6A 4GFRA 1LCTA 2FNCA 3IOWA 2FHYA 4JWYA 2RKMA 2FVZA 2DE2A 2XXWA 4N8YA 4KXPA 3B6QA 3BIHA 4PGPA 1S50A 4OVRA 1PB9A 5IAIA 5DT6A 5AA2D 4UABA 3E9XA 1MM7A 1MY1A 3I3VA 2ZZVA 4ZE8A 1TT1A 4F1YA 4P0IA 4PC9A 4JWXA 4FE8A 4O3AA 3QAXA 3E79A 1PEBA 2R9JA 4QFOA 4PFBA 4G61A 3OO6A 3PMVA 5H8NA 4LATA 1NI9A 4ELPA 3KJTA 1PB7A 3CFXA 3LSXA 3HHFA 1SI1A 2O1LA 4THIA 2XXHA 4NF4A 1H44A 1P1UA 5H8SA 1MQGA 4UACA 1JETA 3PPPA 3C33A 2HQ0A 1RYXA 1FPGA 4G68A 1QULA 2RC8A 3BFTA 1LFIA 4JWOA 3B8BA 4XEQA 4RXLA 5CC2A 4NN3A 1I6BA 5LDZA 1GTKA 1JW5A 3CHGA 3ISPA 3EQ1A 2CZLA 4C1TA 3PUYE 2F97A 1IMEA 2ZXTA 2REGA 2QMXA 3T22A 5AA3A 3H6UA 2OWZA 1AWBA 1Y9UA 5I58B 1VR5A 3TAJA 2F36A 4ISUA 4RY1A 1B9JA 4NWCA 2QRYA 1DPPA 4GLIA 5JTYA 4PF6A 1Q35A 3KJ7A 4EQBA 3H03A 3VLUA 2PT2A 3MPLA 5AE4A 4X9TA 4O94A 1URSA 4OFOA 1HSJA 1N3WA 4PETA 4G68C 3ECRA 3FUZA 3CSGA 1NKXA 3FV1A 4NTLA 1UIVA 2AL4A 1NMUA 3H7MA 3LSLA 3K0VA 4MNCA 1RDXA 1K9YA 4ZEBA 1MY3A 3ZKLA 2XXVA 4O3CA 2KR0A 3QUFA 4YMBA 4Q5TA 1URGA 3O6HA 2F6GA 5CMCA 5A5XB 1A55A 1IIWA 3ODBA 3TTLA 1YXIA 3TEPA 4LZ8A 1SPIA 3R26A 4OXVA 1LBWA 3EHSA 3IB1A 1KA1A 3SKPA 1M5EA 2FIXA 3FJMA 3M3LA 3GXAA 2R6GE 4PTKA 4GWOA 3FVKA 4KR5A 2V25A 4DXCA 5EQ9A 4N15A 4U1ZA 3MP1A 3ILTB 3KOSA 2PBWA 4KYSA 1EZPA 3TZAA 5CBRA 1NH8A 3SERA 2F7AA 3R6UA 5I56B 1B46A 2Y5KA 4EF1A 2A5TB 4F39A 3VFJA 2I6EA 4ESWA 3S4UA 2RCBA 5A5LA 4IO2A 4RNSA 1TFAA 1IXHA 4EXLA 1MRPA 1UTHB 3TODA 2E0SA 3FV2A 1LAFE 4LZ5A 1H43A 4QBAA 4QFNA 2THIA 5LTCA 1N3XA 3I5OA 3KC1A 1QUKA 4IO4A 3C36A 2ZNSA 1GGGA 1ATGA 5ESYA 4H0WA 3KSJA 1S9TA 3E13X 4O3BA 4Z0IA 1US5A 1GR2A 1MS7A 3B50A 3N6UA 5L9OA 2DE3A 4FBPA 2DWIA 4OERA 1Q1KA 4YZZA 1TWYA 2DDKA 1MDQA 1CNQA 1A8FA 4ECFA 4MX6A 2VD2A 3Q25A 4NE4A 1DMBA 4MMPA 4PFRA 4DI3D 3FGSA 4EF2A 1FTAA 3GYYA 5B7DA 1IMCA 1D9YA 3FVNA 3PD9A 4MHFA 4R6YA 3EPEA 4GWWA 4U2RA 5BWJA 4EXKA 4PDHA 5I59A 5DVIA 2FBPA 4PE5B 1XC1A 4OHNA 1B3EA 4GRKA 3V83A 4R74A 5IKBA 4P11A 3MUQA 4NF8A 3ROJA 1D9QA 1TXFA 2VPNA 1WDNA 5CMMA 2I49A 4OWDA 3G3FA 2RINA 3RUMA 3MWBA 3O97A 4HTGA 1CB6A 3UIFA 3A3CA 1Y1MA 2CZHA 5L9MA 1LB9A 3IO6A 2XA5A 4H5GA 3KN8A 1SW4A 3V8XB 4H65A 3N26A 4POWA 4XFEA 4R9GA 4F29A 1O64A 4QF9A 4NMYA 5L9SA 4FORA 3FXUA 3KC0A 2UYEA 2O69A 3TKDA 1ZMGA 4WEPA 4RPNA 4QXDA 1CE2A 2P2AA 4I1DA 3N6TA 4NF6B 2VGQA 2I48A 2PYYA 3MVXA 4IGRA 4TLMB 1M5BA 3KOTA 2XXXA 1DSNA 1NL5A 2HEUA 1B5HA 1IEJA 5TPAB 2DVCA 1FTMA 4Q0CA 1N76A 3DP8A 2Q2AA 3G3IA 3CG3A 2R71A 1FBGA 3CI8A 2Y7PA 1FQAA 3D4GA 5FHMA 1B7ZA 2F3DA 3MSTA 3U92A 2WYKA 1N7XA 2F7CA 1MQIA 4QFPA 5TPAA 1FQDA 1FQEA 2CMOA 1HSLA 4DCYA 2HZLA 1FPLA 1NV1A 1N84A 3IORA 4X1DA 5FTIA 1B4ZA 3W15C 3OSRA 4FJPA 4OANA 4DXBA 2ONSA 3O28A 4YKPA 3D1RA 3VE1B 1PC3A 4IO3A 5FHOA 4IY5A 3SEUA 2HCAA 1R9LA 1ZTYA 2HFBA 1FPKA 2ABHA 1NUZA 4WEDA 1MY0A 4PQJA 2BJIA 1G0HA 4N4UA 2O84X 2L5VA 3PUZE 4QSDA 4N6PA 4KYEA 1WODA 1FBDA 3PGFA 3OELA 5A5XA 3CIJA 3DELB 4IGTA 4GWZA 4TQUQ 4GBWA 3K00A 2DS9A 2PCRA 3G3HA 3PMWA 5LOMA 1Z7ME 3FVOA 3M3FA 4LVQA 3IR1A 3SZPA 1IXIA 4E0WA 2GQ1A 4X04A 2X26A 3UP9A 2NOOA 2V4CA 4WKMA 1Y3QA 3OSQA 4YKJA 1FBFA 1B40A 1SW1A 4PP0A 2QSXA 4N17A 3E78A 4FATA 3A29A 3C9HA 1VFDA 2FA7A 3SESA 4FAJA 4LP2B 4GWXA 3KG2A 1NV5A 1B3GA 2F34A 1XT8A 4PGNA 1EH3A 4EDPA 1OMPA 3FJ7A 3T1BA 2H25A 3EF7A 3HPIA 2QS4A 1SYHA 3PTYA 1M5DA 3RN8A 1Y4TA 5IZ3A 1PB8A 1NUWA 5EQ7A 1UTBA 4R2BA 1FRPA 2QL3A 3GBAA 4F3BA 1ZU0A 3IJXB 2ANJA 4GXAA 4TLLB 2D3IA 4YMAA 3FIRA 2RC9A 3QYTA 2UVIA 3KN7A 3O6GA 1I69A 1T0KA 4DIGA 2YJPA 1MPBA 1UIUA 2DXRA 2UYFA 4HCWA 1H76A 3MAMA 5HBCA 1LAXA 3FXRA 1JEVA 1JQFA 1Y20A 1AOVA 4OEUA 4FEBA 3U94A 1FTJA 3HO7A 5J1DA 4OA4A 3K2DA 4P0GA 4PFTA 3S2VA 1P1WA 4MLVA 3E3KA 1RYOA 2WKYA 1MPDA 4MCOA 3IFCA 4N8GA 2XD2A 4F3PA 1YAEA 1FBPA 3C32A 3DLNA 4MLQA 4KFQA 4XKRA 5JK4A 1LGBC 1IXCA 5K2XA 4MAGA 4GX6A 2XXKA 4XF5A 1LB8A 1FTKA 4M4GA 4TOZA 3S9NC 2ZYOA 3W9WA 3M3KA 4P3LA 4F22A 1MY4A 3T93B 2XD3A 3C35A 1HSEA 2ONRA 1Y4CA 3FXQA 2OLBA 5AA4A 3V5AA 4GOTA 3KN3A 1F9BA 5KDTA 5H8FA 1IQ7A 2XXPA 3RGYA 1USYE 1RDYA 1YCJA 1LCFA 5H8FB 2AIXA 5H8QB 2CEXA 4NGUA 2XX8A 1R1NA 2ZYMA 1A8EA 3IL1B 4C0RA 4PFUA 2M8CA 4QHQA 4ZEKA 4FEDA 2DQVA 3K4UA 4N91A 4E0XA 2DP8A 3G3JA 1XVXA 2OK2A 4YB7A 3O2AA 5HPQA 2Y7KA 1FBEA 4U4SA 1L5TA 1RDZA 1B3FA 3JYRA 3KBRA 3MQ9A 1A99A 1P1NA 4MBPA 4OETA 5ISUA 5I57A 2GHAA 2Z22A 4RPOA 4PFYA 4NAPA 4H46A 4HW8A 1B6HA 3T66A 4X1BA 4ZZAA 4OVPA 4IY6A 3HV1A 4DXUA 3PUVE 5IZZA 2Y84A 3ZS6A 3GZGA 1B0HA 3IFAA 4ELQA 5CMBA 1IUDA 3T9HB 4KQPA 2F5XA 3K02A 4YICA 1QW0A 1NNTA 2HHMA 3RT6B 2ALUA 4OFLA 4F3SA 3T9UA 1FJ6A 1PDAA 2OCUA 1AH5A 2DYXA 3M8UA 2G29A 1TFDA 4OEVA 4OVTA 5H8NB 2B4LA 3TQWA 4GWUA 4POXA 3G7WA 5EQ8A 3MPKA 4AQ4A 2LAOA 3L6HA 4F1VA 1DK4A 2O51A 4QRZA 2WBBA 1LBZA 2NVUB 3V89B 3VLVA 1QUIA 4BDMA 1NV4A 3FVGA 1A54A 3T0JA 3MVYA 3FATA 3MBPA 3QK6A 4G4PA 2VPOA 3THIA 4NF5A 1DTZA 3OEMA 2HZKA 3MW0A 3HSTA 1ZJLA 2H5YA 2H99A 5CM6A 4GWYA 2KQZA 4ZEFA 5I2KA 2WBDA 3VVFA 3B7DA 3RNNA 4PAKA 2Q74A 4MFIA 1XS5A 4NQ8A 1MXVA 1NNKA 2ESNA 1MDP1 2H9BA 2VOZA 4Q8RA 5T3JA 2OWTA 3UGWA 1DTGA 2QFLA 3VXCA 4KPTA 4LA9A 3JV9A 4HE2A 5K2YA 4I8CA 4I62A 2ZNUA 2ZYNA 3O66A 2XWVA 3BBRA 3K1NA 3OD7A 3MC2A 3RLFE 4I3EA 1B0LA 4LUBA 5CRYA 4GD5A 1IZ1A 1OLAA 5IGAA 1YZ0A 3RYDA 3IOUA 2Y7IA 2IA4A 1MXYA 1S7YA 4IO6A 1B32A 4H5FA 4JVCA 4GXSB 2I3WA 1NNFA 4QFKA 3TUSA 3E4RA 2Q89A 1FW0A 4LN5A 4RA1A 1B5IA 3N5LA 2VHAA 3RTFB 1FPDA 4PBQA 4OVQA 4BDRA 3SEVA 2WYPA 3U8QA 3N94A 2MKZA 2QVVA 2W7YA 3OMBA 3LC8A 3I6VA 3BIGA 4NF0A 4R75A 4H67A 2VT5A 1JW4A 1JEUA 2UVHA 5KZTA 1VFEA 3L6GA 4PF8A 3TTRA 2XHDA 1FTLA 2DSFA 1I6QA 2ONKE 4KI0E 3FJGA 4BLAA 2XX9A 1SW2A 3DM0A 1LEVA 3VDFA 3S9MC 4O7MA 4HXVA 4GL0A 3LUZA 5I57B 4ZS9A 5EYGA 4GF8A 3WAEA 2XXUA 2Y7RA 4G77A 2GFEA 3MZ1A 4ELOA 4QSCA 1FPEA 3CSBA 3CVGA 5F24A 2ZNTA 5CBSA 1SQYA 3FBPA 3RQTA 4IO7A 3PU5A 3OO9A 4QFLA 3KEIA 2Q88A 5DTBA 1R6ZA 4ESXA 4ONYA 3QIMA 2P3NA 3IB2A 5I2NB 3D4CA 3TFLA 1LSTA 1OIBA 1LBXA 4Z7EA 3FD3A 3PV0E 2GH9A 3S9LC 1EZ9A 1QKBA 1Y3PA 4NF8B 2KLFA 2O1MA 1D3KA 3Q27A 5EYFA 4EQ7A 4RK2A 5TP9B 5FTHA 1I6AA 1NUXA 5JEIA 1BTJA 4NHBA 4I40A 2VD3A 4YAHX 2XXYA 4PDDA 3QMFA 3TQLA 3OO8A 1NV0A 2HXRA 4PFWA 3LSWA 3HCQA 5JTYB 1IMFA 1FTOA 2RC7A 1N04A 2AL5A 4KD5A 2XWIA 1EYKA 2O7UA 2HPGA 3P7IA 4H6DA 1SW5A 2OX3A 3HHGA 4ZDMA 3LBSA 2CZKA 4GQOA 4OESA 4NWDA 1B52A 4OFJA 3KSXA 3UK4A 1B05A 2WX9A 1B58A 2XXTA 5L8DA 1AL3A 4H45A 3CFLA 3MZBA 5CI5A 1SDXA 4BDLA 1SVXB 3AXFA 4YKKA 3RPWA 4Q30B 5IZ1A 2Y5LA 4RJZA 3TCFA 1JVYA 3H4ZA 1SYIA 3TMGA 2A5TA 3QUJA 5F1QA 4PCDA 3CR9A 2QS1A 5IZ3B 1O7TA 2XXRA 1B7UA 3UORA 2HAUA 3ZKKA 2I58A 4KYDA 3O29A 3IB0A 2HXWA 1B1HA 1K9ZA 1MH4A 1H45A 4PAIA 4RYAA 4N81A 3Q26A 1MG1A 2A5SA 4X48A 5DW8A 4HE0A 4H8JA 4OMBA 4O8MA 4UA8A 4XKNA 3TPAA 4DZ1A 2OJTA 5KCJA 3K1MA 4F2QA 2FYIA 4OVJA 3BFUA 2DWAA 4ELRA 1B3HA 1SD3A 2QJEA 4K3FA 3CG1A 1YPNA 3H3GA 3C4MA 1J1NA 2NXOA 2UVGA 3USDA 2Y7WA 2I0CA 2YLNA 3PPOA 3S9EA 1ZIUA 4R9FA 4R73A 3VVDA 1POY1 1D9VA 1MY2A 4N07A 2AYSA 2CZIA 4OVSA 5ELVA 1BP5A 4JSDA 1MXWA 1IITA 4U4XA 1SBPA 1FBHA 5AA2B 3SETA 1NFTA 3OENA 5ET8A 1P1OA 4HCYA 1LBYA 3A3UA 2IEEA 3PPNA 5ET6A 4P56A 1RKMA 4F18A 3G3KA 5DEXB 4NX1A 3G3GA 2VP1A 1PBPA 2QS2A 1MQHA 2PVUA 1QUJA 4G8HA 4U22A 4PFIA 1QKAA 4LQ2A 3KZGA 5TU0A 4XKPA 1N0TA 4IB2A 5KDTB 3VV5A 1QVSA 5AA4B 5ITOA 2V84A 1NH7A 4FIMA 2QMWA 1DCUA 1NUYA 3ILUB 4P1EA 4NF5B 1PBQA 5EHSA 1FPFA 4JBZA 4G8MA 2Z8EA 3DP4A 4G8NA 2Q2CA 4NF4B 3T96B 4GBVA 3F11A 2ZYKA 4ND9A 4GX4A 4OYVA 3MP6A 2B65A 1DPEA 4LONB 1MXXA 4EQ9A 4OENA 4PAFA 2REJA 3TYHA 2E1SA 3LSFB 1NV7A 5ITPA 1URDA 4EUOA 1KWHA 4H1XA 3IOVA 1B1XA 2V3QA 4NEDA 3EN3A 4MJOA 4H8IA 4L17A 5H8HB 1NV6A 2JJKA 3K6UA 3RTWB 1SI0A 2XX7A 2XWOA 1LBBA 2ZMBA 3VXBA 2Q9TA 4IR8A 1FJ9A 5FBPA 4KCCA 4R2FA 1IXGA 4F1UA 2I0BA 3IJOB 4DE8A 3MP8A 4GL8A 3HFUA 1YTVA 2OBGA 2H98A 3TTNA 3RPLA 5ET7A 2ZZXA 3K1PA 4MNPA 4X8RA 3T9VA 1UTBB 1LAGE 1JW1A 2B3BA 3CRBA 5AA1A 4BDQA 5M2VA 1II5A 2PT1A 4JVIA 2QS3A 1JP4A 1D4NA 5DEXA 2X7QA 3Q29A 3MYUA 4RK9A 4F2OA 4FECA 1FPIA 2PX1A 3PD8A 2O7IA 3GBBA 3T9XB 4R72A 1YYZA 5F7VA 2DWHA 5AA2A 4F31B 3MJNA 4NG7A 3SEWA 3PPQA 1MQJA 1BLFA 3H06B 1FQCA 4N13A 3RT8A 5ICQA 2NUVA 4GX3A 3A09A 2P0SA 4LZ7A 2OPDA 3K01A 4JDFA 4M1VA 5H8QA 5TP9A 3TDJA 4JVDA 5EQAA 3CFZA 4MH5A 1ANFA 3OO7A 2F8DA 3TCHA 1NV3A 3KFMA 4IO5A 1FQFA 4XKQA 4F19A 5I2NA 4AS5A 4I3YA 1UTHA 1H3DA 3H6VA 4YB5A 4XIGQ 3QXMA 3LR1A 4N6KA 5BUUA 1XVYA 5FHNA 5KCJB 1LBVA 1LLSA 2O68A 1FSAA 1NV2A 4KHZE 3FZVA 1O63A 2D5WA 2HAVA 3BKIB 4WXJA 5EHMA 5I3SA 1B7HA 1OQGA 3EKIA 3TCGA 2FIEA 4BDNA 1UQWA 3IX1A 4ZEDA 1N7WA 3LV0A 1MPCA 1BIYA 4YKIA 1B3LA 3IK6B 5ET5A 2QVUA 2Z8FA 3ONMA 5I7IA 2Z23A 4DDDA 4U23A 2RF1A 3JZJA 4MIJA 1VDWA 2GRVA 2CEYA 1BK4A 3VVEA 1Y1ZA 4KCDA 2DVZA 4OTEA 5EYHA 4AB5A 3U72A 3ZSFA 3O6IA 1MH3A 1B2HA 4HE1A 1VE4A 3LUYA 2DOJA 2YPNA 1AIVA 4YB6A 4N6DA 1DBZA 2XXQA 2V93A 4ZECA 3Q28A 5IM2A 1ZBMA 2OPEA 3B6WA 1IMAA 1XHYA 1FCKA 3K6XA 1GV8A 2H4IA 5I84A 3EHTA 3IAZA 2PFYA 5I59B 3UN6A 3U1OA 1BKAA 4ZEIA 1VSOA 2F78A 1A7LA 1DOTA 3KBZA 4NF6A 2BJJX 5DVJA 3B6TA 4P1LA 2I4CA 1XOCA 1M5CA 4C1UA 4MNIA 3SDFA 3IO4A 3R7XA 3VLWA 2NWJA 3FASA 3SEXA 1LFHA 1G0IA 2OZZA 4BDOA 4GIZA 1KA0A 3QSLA 4JSOA 2F35A 2UXAA 3PUXE 4P9KA 1JNFA 2D21A 1Z7NE 1JVXA 1Y3NA 3OXNA 1IMBA 5J16A 1FPJA 4U21A 1FBCA 1A40A 1Q9DA 3U93A 2ZZWA 3PUWE 1QGXA 3MZ9A 3C34A 2DWJA 2G93A 2XXIA 1EYIA 3NOHA 2Q8JA 2GHBA 2RCAA 2F7BA 1FQBA 2DE4A 3RPLB 3FXBA 3WAFA 3TTMA 3OEKA 1LAHE 4MEVA 4OZ9A 5ICTA 4G68B 3RY3A 2X7PA 4DCXA 3H6WA 4LQ5A 1MXZA 5H8HA 1P99A 4GWSA 1ZKBA 1LFGA 3TTKA 3TELA 4R6HA 1OLCA 1B5JA 2F3BA 2R8TA 2Z8DA 2V3TA 4XXUA 4PE3A 4HS7A 2Q8MA 3KGCA 4I9DA 3HN0A 2PFZA 2I3VA 4F3GA 1NNPA 3PMXA 4GVOA 1EYJA 1OVBA 4QSEA 1LBCA 4DI4B 4AB6A 4ZZEA 3OOAA 4MF3A 1R9QA 2PMSA 4YU0A 4O7IA 3PPRA 2QPQA 4U1OA 3K6WA 3EHUA 1EZOA 3U65A 4P8BA 3W9VA
chains in the Genus database with same CATH topology
1KA0A 1XI6A 4XFEA 3D1RA 4MNPA 1DK4A 1FPDA 2FIEA 4PBQA 4X8RA 2WBBA 4OVQA 4P9KA 4P47A 1INPA 2WYPA 4QBAA 4X9TA 1LBZA 4O94A 4UABA 5LTCA 1NUXA 3KC0A 3LV0A 4N91A 4PFIA 1IMBA 2P3VA 2QVVA 1FPJA 5J16A 2MKZA 1FBCA 2ZZVA 4JVIA 1Q9DA 4PETA 1NV4A 1JP4A 1K9ZA 1FPKA 3KC1A 1QGXA 4I40A 2ZZWA 4NHBA 4PAIA 4N81A 4PC9A 5ET5A 2XWKA 3T0JA 1NUZA 4O7MA 4QXDA 2QVUA 5I7IA 3MYUA 4PDDA 5DW8A 3QMFA 3BIGA 1EYIA 4HE0A 2VPOA 3NOHA 4NF0A 2BJIA 1G0HA 1KZ8A 5ESYA 3E79A 4MNCA 1RDXA 4O8MA 4PBHA 1NV0A 1FPIA 1FBEA 4N4UA 2HXRA 4HCWA 4PFBA 2VT5A 2HZKA 2L5VA 4MIJA 1VDWA 3RPLB 1K9YA 2DE4A 2QVRA 1FBDA 1FPBA 4G61A 2CEYA 3FXBA 3B50A 1DCUA 1BK4A 1RDZA 1YYZA 4GWYA 2KQZA 4PF8A 3U65A 1NUYA 4P1EA 5CM6A 4GWZA 1NI9A 2KR0A 4GBWA 1IMFA 4NG7A 4MEVA 2DE3A 1FPFA 2PCRA 3RPLA 4FBPA 2DVZA 5I5PA 4YZZA 2DDKA 5EYHA 5J1DA 4OA4A 2WBDA 1CNQA 4PAKA 4NAPA 4H46A 2WEFA 3EKIA 2Q74A 4MX6A 4HE1A 1YXIA 4NQ8A 1LEVA 4GBVA 2XWIA 1SPIA 4MMPA 4OVPA 4PFRA 4DI3D 1EYKA 1FTAA 4GX4A 1IMDA 3GYYA 3SZPA 5IZZA 4N6DA 1LBWA 1DBZA 4HXVA 1FPGA 1IMCA 2GQ1A 3IFCA 5T3JA 4MCOA 4MHFA 3IFAA 4GWSA 4N8GA 4X04A 2HPGA 2QFLA 1FBPA 3LUZA 4GX3A 4GWWA 5IM2A 1FBGA 5JK4A 2V4CA 3B8BA 1KA1A 4PAFA 4HE2A 4XEQA 5EYGA 2OX3A 4M1VA 2F3BA 2F5XA 4YICA 1NV7A 2R8TA 4MAGA 2CZKA 2FIXA 2HHMA 1FBFA 4NN3A 2XWVA 1IMAA 5LDZA 1FPEA 4PDHA 4JVDA 3CHGA 2F3DA 4GX6A 3MSTA 4N17A 3E78A 2WYKA 2XXKA 4I3EA 4PTKA 5F24A 4AS4A 4XF5A 2FBPA 3A29A 3ISPA 4PE3A 3FBPA 5EQAA 1FJ6A 2Q8MA 2WX9A 5IGAA 2V3QA 2PFZA 2B4MA 4H45A 1YZ0A 3W9WA 1IMEA 2PFYA 3RYDA 2CZIA 5EQ9A 4N15A 4MJOA 4OVSA 4P3LA 4GWXA 3ROJA 1EYJA 1D9QA 1NV5A 2VPNA 1NV6A 1NV3A 2JJKA 4DI4B 4F1VA 4PGNA 2HZLA 1FPLA 2OWZA 1NV1A 4F19A 1AWBA 4OVTA 4AS5A 3KBZA 2P3NA 5IZ1A 4I3YA 2Y5LA 1FBHA 2FHYA 3T1BA 2B4LA 2Y5KA 2FVZA 2XWOA 2DE2A 4GWUA 4O7IA 2Q9TA 2QPQA 5ET8A 4N6KA 4P1LA 5EQ8A 1RDYA 1LBXA 1LBVA 4IR8A 4JVCA 1FJ9A 5FBPA 1FSAA 1NV2A 3PTYA 4HCYA 1LBYA 4PCDA 2CZHA 4F1UA 4N8YA 4KXPA 5IZ3B 4OANA 5IZ3A 5I3SA 5ET6A 2CEXA 1NUWA 4LN5A 5A5LA 2XA5A 4NGUA 3HFUA 4MNIA 5EQ7A 4P56A 4P8BA 1FRPA 3BIHA 4F18A 4PF6A 4PGPA 4NX1A 3W9VA 5ET7A 4OVRA 2ZZXA 1G0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KA0 A;  1XI6 A;  3D1R A;  1DK4 A;  1FPD A;  2FIE A;  2WBB A;  1INP A;  1LBZ A;  1NUX A;  3KC0 A;  3LV0 A;  1IMB A;  2P3V A;  2QVV A;  1FPJ A;  5J16 A;  1FBC A;  1Q9D A;  1NV4 A;  1JP4 A;  1K9Z A;  1FPK A;  3KC1 A;  1QGX A;  4I40 A;  4N81 A;  5ET5 A;  3T0J A;  1NUZ A;  4QXD A;  2QVU A;  5DW8 A;  3QMF A;  3BIG A;  1EYI A;  4HE0 A;  2BJI A;  1G0H A;  1KZ8 A;  5ESY A;  1RDX A;  1NV0 A;  1FPI A;  1FBE A;  2VT5 A;  1VDW A;  3RPL B;  1K9Y A;  2QVR A;  1FBD A;  1FPB A;  4G61 A;  1DCU A;  1BK4 A;  1RDZ A;  1YYZ A;  4GWY A;  1NUY A;  4GWZ A;  1NI9 A;  4GBW A;  1IMF A;  1FPF A;  2PCR A;  3RPL A;  4FBP A;  2DDK A;  5EYH A;  2WBD A;  1CNQ A;  4H46 A;  2WEF A;  2Q74 A;  4HE1 A;  1YXI A;  1LEV A;  4GBV A;  1SPI A;  1EYK A;  1FTA A;  4GX4 A;  1IMD A;  1LBW A;  1DBZ A;  4HXV A;  1FPG A;  1IMC A;  2GQ1 A;  3IFC A;  5T3J A;  3IFA A;  4GWS A;  2QFL A;  1FBP A;  3LUZ A;  4GX3 A;  4GWW A;  1FBG A;  3B8B A;  1KA1 A;  4HE2 A;  5EYG A;  2OX3 A;  2F3B A;  1NV7 A;  2R8T A;  2CZK A;  2FIX A;  2HHM A;  1FBF A;  1IMA A;  5LDZ A;  1FPE A;  2F3D A;  4GX6 A;  4I3E A;  4PTK A;  5F24 A;  4AS4 A;  2FBP A;  3A29 A;  3FBP A;  5EQA A;  1FJ6 A;  2Q8M A;  4H45 A;  1YZ0 A;  1IME A;  3RYD A;  2CZI A;  5EQ9 A;  4MJO A;  4GWX A;  3ROJ A;  1EYJ A;  1D9Q A;  1NV5 A;  1NV6 A;  1NV3 A;  2JJK A;  1FPL A;  2OWZ A;  1NV1 A;  1AWB A;  4AS5 A;  3KBZ A;  2P3N A;  5IZ1 A;  4I3Y A;  2Y5L A;  1FBH A;  2FHY A;  2Y5K A;  2FVZ A;  4GWU A;  4O7I A;  5ET8 A;  5EQ8 A;  1RDY A;  1LBX A;  1LBV A;  4IR8 A;  1FJ9 A;  5FBP A;  1FSA A;  1NV2 A;  1LBY A;  2CZH A;  4KXP A;  5IZ3 B;  5IZ3 A;  5I3S A;  5ET6 A;  1NUW A;  5A5L A;  5EQ7 A;  1FRP A;  3BIH A;  5ET7 A;  1G0I A; 
#chains in the Genus database with same CATH topology
 3UA8 A;  1XI6 A;  1MM6 A;  2I4B A;  4P47 A;  1INP A;  4G2Z A;  3SEY A;  5DYH A;  5B70 A;  2P3V A;  2DXY A;  1MXU A;  4XTC Q;  2XWK A;  5I56 A;  1POT A;  3IOT A;  1KZ8 A;  2P1S A;  4PBH A;  1OQH A;  1B4H A;  2QVR A;  1FPB A;  2OWS A;  1OVT A;  5I5P A;  3MVZ A;  5DVF A;  1WVJ A;  1B51 A;  2WEF A;  3O9P A;  1AMF A;  1USY H;  2F6P A;  3GLB A;  1IMD A;  3MVW A;  1MQD A;  1GVC A;  2UVJ A;  1P1Q A;  3C31 A;  5HM4 B;  4JXI A;  5I58 A;  1US4 A;  2V3U A;  3H6T A;  1QJM A;  4OQO A;  1EU8 A;  4JB7 A;  3K6V A;  1ELJ A;  4AS4 A;  1M5F A;  2B4M A;  2O6A A;  5I2K B;  2B3F A;  4DLD A;  4R6K A;  5CMK A;  1ZLQ A;  4ZE9 A;  3DP6 A;  4GFR A;  1LCT A;  2FNC A;  3IOW A;  2FHY A;  4JWY A;  2RKM A;  2FVZ A;  2DE2 A;  2XXW A;  4N8Y A;  4KXP A;  3B6Q A;  3BIH A;  4PGP A;  1S50 A;  4OVR A;  1PB9 A;  5IAI A;  5DT6 A;  5AA2 D;  4UAB A;  3E9X A;  1MM7 A;  1MY1 A;  3I3V A;  2ZZV A;  4ZE8 A;  1TT1 A;  4F1Y A;  4P0I A;  4PC9 A;  4JWX A;  4FE8 A;  4O3A A;  3QAX A;  3E79 A;  1PEB A;  2R9J A;  4QFO A;  4PFB A;  4G61 A;  3OO6 A;  3PMV A;  5H8N A;  4LAT A;  1NI9 A;  4ELP A;  3KJT A;  1PB7 A;  3CFX A;  3LSX A;  3HHF A;  1SI1 A;  2O1L A;  4THI A;  2XXH A;  4NF4 A;  1H44 A;  1P1U A;  5H8S A;  1MQG A;  4UAC A;  1JET A;  3PPP A;  3C33 A;  2HQ0 A;  1RYX A;  1FPG A;  4G68 A;  1QUL A;  2RC8 A;  3BFT A;  1LFI A;  4JWO A;  3B8B A;  4XEQ A;  4RXL A;  5CC2 A;  4NN3 A;  1I6B A;  5LDZ A;  1GTK A;  1JW5 A;  3CHG A;  3ISP A;  3EQ1 A;  2CZL A;  4C1T A;  3PUY E;  2F97 A;  1IME A;  2ZXT A;  2REG A;  2QMX A;  3T22 A;  5AA3 A;  3H6U A;  2OWZ A;  1AWB A;  1Y9U A;  5I58 B;  1VR5 A;  3TAJ A;  2F36 A;  4ISU A;  4RY1 A;  1B9J A;  4NWC A;  2QRY A;  1DPP A;  4GLI A;  5JTY A;  4PF6 A;  1Q35 A;  3KJ7 A;  4EQB A;  3H03 A;  3VLU A;  2PT2 A;  3MPL A;  5AE4 A;  4X9T A;  4O94 A;  1URS A;  4OFO A;  1HSJ A;  1N3W A;  4PET A;  4G68 C;  3ECR A;  3FUZ A;  3CSG A;  1NKX A;  3FV1 A;  4NTL A;  1UIV A;  2AL4 A;  1NMU A;  3H7M A;  3LSL A;  3K0V A;  4MNC A;  1RDX A;  1K9Y A;  4ZEB A;  1MY3 A;  3ZKL A;  2XXV A;  4O3C A;  2KR0 A;  3QUF A;  4YMB A;  4Q5T A;  1URG A;  3O6H A;  2F6G A;  5CMC A;  5A5X B;  1A55 A;  1IIW A;  3ODB A;  3TTL A;  1YXI A;  3TEP A;  4LZ8 A;  1SPI A;  3R26 A;  4OXV A;  1LBW A;  3EHS A;  3IB1 A;  1KA1 A;  3SKP A;  1M5E A;  2FIX A;  3FJM A;  3M3L A;  3GXA A;  2R6G E;  4PTK A;  4GWO A;  3FVK A;  4KR5 A;  2V25 A;  4DXC A;  5EQ9 A;  4N15 A;  4U1Z A;  3MP1 A;  3ILT B;  3KOS A;  2PBW A;  4KYS A;  1EZP A;  3TZA A;  5CBR A;  1NH8 A;  3SER A;  2F7A A;  3R6U A;  5I56 B;  1B46 A;  2Y5K A;  4EF1 A;  2A5T B;  4F39 A;  3VFJ A;  2I6E A;  4ESW A;  3S4U A;  2RCB A;  5A5L A;  4IO2 A;  4RNS A;  1TFA A;  1IXH A;  4EXL A;  1MRP A;  1UTH B;  3TOD A;  2E0S A;  3FV2 A;  1LAF E;  4LZ5 A;  1H43 A;  4QBA A;  4QFN A;  2THI A;  5LTC A;  1N3X A;  3I5O A;  3KC1 A;  1QUK A;  4IO4 A;  3C36 A;  2ZNS A;  1GGG A;  1ATG A;  5ESY A;  4H0W A;  3KSJ A;  1S9T A;  3E13 X;  4O3B A;  4Z0I A;  1US5 A;  1GR2 A;  1MS7 A;  3B50 A;  3N6U A;  5L9O A;  2DE3 A;  4FBP A;  2DWI A;  4OER A;  1Q1K A;  4YZZ A;  1TWY A;  2DDK A;  1MDQ A;  1CNQ A;  1A8F A;  4ECF A;  4MX6 A;  2VD2 A;  3Q25 A;  4NE4 A;  1DMB A;  4MMP A;  4PFR A;  4DI3 D;  3FGS A;  4EF2 A;  1FTA A;  3GYY A;  5B7D A;  1IMC A;  1D9Y A;  3FVN A;  3PD9 A;  4MHF A;  4R6Y A;  3EPE A;  4GWW A;  4U2R A;  5BWJ A;  4EXK A;  4PDH A;  5I59 A;  5DVI A;  2FBP A;  4PE5 B;  1XC1 A;  4OHN A;  1B3E A;  4GRK A;  3V83 A;  4R74 A;  5IKB A;  4P11 A;  3MUQ A;  4NF8 A;  3ROJ A;  1D9Q A;  1TXF A;  2VPN A;  1WDN A;  5CMM A;  2I49 A;  4OWD A;  3G3F A;  2RIN A;  3RUM A;  3MWB A;  3O97 A;  4HTG A;  1CB6 A;  3UIF A;  3A3C A;  1Y1M A;  2CZH A;  5L9M A;  1LB9 A;  3IO6 A;  2XA5 A;  4H5G A;  3KN8 A;  1SW4 A;  3V8X B;  4H65 A;  3N26 A;  4POW A;  4XFE A;  4R9G A;  4F29 A;  1O64 A;  4QF9 A;  4NMY A;  5L9S A;  4FOR A;  3FXU A;  3KC0 A;  2UYE A;  2O69 A;  3TKD A;  1ZMG A;  4WEP A;  4RPN A;  4QXD A;  1CE2 A;  2P2A A;  4I1D A;  3N6T A;  4NF6 B;  2VGQ A;  2I48 A;  2PYY A;  3MVX A;  4IGR A;  4TLM B;  1M5B A;  3KOT A;  2XXX A;  1DSN A;  1NL5 A;  2HEU A;  1B5H A;  1IEJ A;  5TPA B;  2DVC A;  1FTM A;  4Q0C A;  1N76 A;  3DP8 A;  2Q2A A;  3G3I A;  3CG3 A;  2R71 A;  1FBG A;  3CI8 A;  2Y7P A;  1FQA A;  3D4G A;  5FHM A;  1B7Z A;  2F3D A;  3MST A;  3U92 A;  2WYK A;  1N7X A;  2F7C A;  1MQI A;  4QFP A;  5TPA A;  1FQD A;  1FQE A;  2CMO A;  1HSL A;  4DCY A;  2HZL A;  1FPL A;  1NV1 A;  1N84 A;  3IOR A;  4X1D A;  5FTI A;  1B4Z A;  3W15 C;  3OSR A;  4FJP A;  4OAN A;  4DXB A;  2ONS A;  3O28 A;  4YKP A;  3D1R A;  3VE1 B;  1PC3 A;  4IO3 A;  5FHO A;  4IY5 A;  3SEU A;  2HCA A;  1R9L A;  1ZTY A;  2HFB A;  1FPK A;  2ABH A;  1NUZ A;  4WED A;  1MY0 A;  4PQJ A;  2BJI A;  1G0H A;  4N4U A;  2O84 X;  2L5V A;  3PUZ E;  4QSD A;  4N6P A;  4KYE A;  1WOD A;  1FBD A;  3PGF A;  3OEL A;  5A5X A;  3CIJ A;  3DEL B;  4IGT A;  4GWZ A;  4TQU Q;  4GBW A;  3K00 A;  2DS9 A;  2PCR A;  3G3H A;  3PMW A;  5LOM A;  1Z7M E;  3FVO A;  3M3F A;  4LVQ A;  3IR1 A;  3SZP A;  1IXI A;  4E0W A;  2GQ1 A;  4X04 A;  2X26 A;  3UP9 A;  2NOO A;  2V4C A;  4WKM A;  1Y3Q A;  3OSQ A;  4YKJ A;  1FBF A;  1B40 A;  1SW1 A;  4PP0 A;  2QSX A;  4N17 A;  3E78 A;  4FAT A;  3A29 A;  3C9H A;  1VFD A;  2FA7 A;  3SES A;  4FAJ A;  4LP2 B;  4GWX A;  3KG2 A;  1NV5 A;  1B3G A;  2F34 A;  1XT8 A;  4PGN A;  1EH3 A;  4EDP A;  1OMP A;  3FJ7 A;  3T1B A;  2H25 A;  3EF7 A;  3HPI A;  2QS4 A;  1SYH A;  3PTY A;  1M5D A;  3RN8 A;  1Y4T A;  5IZ3 A;  1PB8 A;  1NUW A;  5EQ7 A;  1UTB A;  4R2B A;  1FRP A;  2QL3 A;  3GBA A;  4F3B A;  1ZU0 A;  3IJX B;  2ANJ A;  4GXA A;  4TLL B;  2D3I A;  4YMA A;  3FIR A;  2RC9 A;  3QYT A;  2UVI A;  3KN7 A;  3O6G A;  1I69 A;  1T0K A;  4DIG A;  2YJP A;  1MPB A;  1UIU A;  2DXR A;  2UYF A;  4HCW A;  1H76 A;  3MAM A;  5HBC A;  1LAX A;  3FXR A;  1JEV A;  1JQF A;  1Y20 A;  1AOV A;  4OEU A;  4FEB A;  3U94 A;  1FTJ A;  3HO7 A;  5J1D A;  4OA4 A;  3K2D A;  4P0G A;  4PFT A;  3S2V A;  1P1W A;  4MLV A;  3E3K A;  1RYO A;  2WKY A;  1MPD A;  4MCO A;  3IFC A;  4N8G A;  2XD2 A;  4F3P A;  1YAE A;  1FBP A;  3C32 A;  3DLN A;  4MLQ A;  4KFQ A;  4XKR A;  5JK4 A;  1LGB C;  1IXC A;  5K2X A;  4MAG A;  4GX6 A;  2XXK A;  4XF5 A;  1LB8 A;  1FTK A;  4M4G A;  4TOZ A;  3S9N C;  2ZYO A;  3W9W A;  3M3K A;  4P3L A;  4F22 A;  1MY4 A;  3T93 B;  2XD3 A;  3C35 A;  1HSE A;  2ONR A;  1Y4C A;  3FXQ A;  2OLB A;  5AA4 A;  3V5A A;  4GOT A;  3KN3 A;  1F9B A;  5KDT A;  5H8F A;  1IQ7 A;  2XXP A;  3RGY A;  1USY E;  1RDY A;  1YCJ A;  1LCF A;  5H8F B;  2AIX A;  5H8Q B;  2CEX A;  4NGU A;  2XX8 A;  1R1N A;  2ZYM A;  1A8E A;  3IL1 B;  4C0R A;  4PFU A;  2M8C A;  4QHQ A;  4ZEK A;  4FED A;  2DQV A;  3K4U A;  4N91 A;  4E0X A;  2DP8 A;  3G3J A;  1XVX A;  2OK2 A;  4YB7 A;  3O2A A;  5HPQ A;  2Y7K A;  1FBE A;  4U4S A;  1L5T A;  1RDZ A;  1B3F A;  3JYR A;  3KBR A;  3MQ9 A;  1A99 A;  1P1N A;  4MBP A;  4OET A;  5ISU A;  5I57 A;  2GHA A;  2Z22 A;  4RPO A;  4PFY A;  4NAP A;  4H46 A;  4HW8 A;  1B6H A;  3T66 A;  4X1B A;  4ZZA A;  4OVP A;  4IY6 A;  3HV1 A;  4DXU A;  3PUV E;  5IZZ A;  2Y84 A;  3ZS6 A;  3GZG A;  1B0H A;  3IFA A;  4ELQ A;  5CMB A;  1IUD A;  3T9H B;  4KQP A;  2F5X A;  3K02 A;  4YIC A;  1QW0 A;  1NNT A;  2HHM A;  3RT6 B;  2ALU A;  4OFL A;  4F3S A;  3T9U A;  1FJ6 A;  1PDA A;  2OCU A;  1AH5 A;  2DYX A;  3M8U A;  2G29 A;  1TFD A;  4OEV A;  4OVT A;  5H8N B;  2B4L A;  3TQW A;  4GWU A;  4POX A;  3G7W A;  5EQ8 A;  3MPK A;  4AQ4 A;  2LAO A;  3L6H A;  4F1V A;  1DK4 A;  2O51 A;  4QRZ A;  2WBB A;  1LBZ A;  2NVU B;  3V89 B;  3VLV A;  1QUI A;  4BDM A;  1NV4 A;  3FVG A;  1A54 A;  3T0J A;  3MVY A;  3FAT A;  3MBP A;  3QK6 A;  4G4P A;  2VPO A;  3THI A;  4NF5 A;  1DTZ A;  3OEM A;  2HZK A;  3MW0 A;  3HST A;  1ZJL A;  2H5Y A;  2H99 A;  5CM6 A;  4GWY A;  2KQZ A;  4ZEF A;  5I2K A;  2WBD A;  3VVF A;  3B7D A;  3RNN A;  4PAK A;  2Q74 A;  4MFI A;  1XS5 A;  4NQ8 A;  1MXV A;  1NNK A;  2ESN A;  1MDP 1;  2H9B A;  2VOZ A;  4Q8R A;  5T3J A;  2OWT A;  3UGW A;  1DTG A;  2QFL A;  3VXC A;  4KPT A;  4LA9 A;  3JV9 A;  4HE2 A;  5K2Y A;  4I8C A;  4I62 A;  2ZNU A;  2ZYN A;  3O66 A;  2XWV A;  3BBR A;  3K1N A;  3OD7 A;  3MC2 A;  3RLF E;  4I3E A;  1B0L A;  4LUB A;  5CRY A;  4GD5 A;  1IZ1 A;  1OLA A;  5IGA A;  1YZ0 A;  3RYD A;  3IOU A;  2Y7I A;  2IA4 A;  1MXY A;  1S7Y A;  4IO6 A;  1B32 A;  4H5F A;  4JVC A;  4GXS B;  2I3W A;  1NNF A;  4QFK A;  3TUS A;  3E4R A;  2Q89 A;  1FW0 A;  4LN5 A;  4RA1 A;  1B5I A;  3N5L A;  2VHA A;  3RTF B;  1FPD A;  4PBQ A;  4OVQ A;  4BDR A;  3SEV A;  2WYP A;  3U8Q A;  3N94 A;  2MKZ A;  2QVV A;  2W7Y A;  3OMB A;  3LC8 A;  3I6V A;  3BIG A;  4NF0 A;  4R75 A;  4H67 A;  2VT5 A;  1JW4 A;  1JEU A;  2UVH A;  5KZT A;  1VFE A;  3L6G A;  4PF8 A;  3TTR A;  2XHD A;  1FTL A;  2DSF A;  1I6Q A;  2ONK E;  4KI0 E;  3FJG A;  4BLA A;  2XX9 A;  1SW2 A;  3DM0 A;  1LEV A;  3VDF A;  3S9M C;  4O7M A;  4HXV A;  4GL0 A;  3LUZ A;  5I57 B;  4ZS9 A;  5EYG A;  4GF8 A;  3WAE A;  2XXU A;  2Y7R A;  4G77 A;  2GFE A;  3MZ1 A;  4ELO A;  4QSC A;  1FPE A;  3CSB A;  3CVG A;  5F24 A;  2ZNT A;  5CBS A;  1SQY A;  3FBP A;  3RQT A;  4IO7 A;  3PU5 A;  3OO9 A;  4QFL A;  3KEI A;  2Q88 A;  5DTB A;  1R6Z A;  4ESX A;  4ONY A;  3QIM A;  2P3N A;  3IB2 A;  5I2N B;  3D4C A;  3TFL A;  1LST A;  1OIB A;  1LBX A;  4Z7E A;  3FD3 A;  3PV0 E;  2GH9 A;  3S9L C;  1EZ9 A;  1QKB A;  1Y3P A;  4NF8 B;  2KLF A;  2O1M A;  1D3K A;  3Q27 A;  5EYF A;  4EQ7 A;  4RK2 A;  5TP9 B;  5FTH A;  1I6A A;  1NUX A;  5JEI A;  1BTJ A;  4NHB A;  4I40 A;  2VD3 A;  4YAH X;  2XXY A;  4PDD A;  3QMF A;  3TQL A;  3OO8 A;  1NV0 A;  2HXR A;  4PFW A;  3LSW A;  3HCQ A;  5JTY B;  1IMF A;  1FTO A;  2RC7 A;  1N04 A;  2AL5 A;  4KD5 A;  2XWI A;  1EYK A;  2O7U A;  2HPG A;  3P7I A;  4H6D A;  1SW5 A;  2OX3 A;  3HHG A;  4ZDM A;  3LBS A;  2CZK A;  4GQO A;  4OES A;  4NWD A;  1B52 A;  4OFJ A;  3KSX A;  3UK4 A;  1B05 A;  2WX9 A;  1B58 A;  2XXT A;  5L8D A;  1AL3 A;  4H45 A;  3CFL A;  3MZB A;  5CI5 A;  1SDX A;  4BDL A;  1SVX B;  3AXF A;  4YKK A;  3RPW A;  4Q30 B;  5IZ1 A;  2Y5L A;  4RJZ A;  3TCF A;  1JVY A;  3H4Z A;  1SYI A;  3TMG A;  2A5T A;  3QUJ A;  5F1Q A;  4PCD A;  3CR9 A;  2QS1 A;  5IZ3 B;  1O7T A;  2XXR A;  1B7U A;  3UOR A;  2HAU A;  3ZKK A;  2I58 A;  4KYD A;  3O29 A;  3IB0 A;  2HXW A;  1B1H A;  1K9Z A;  1MH4 A;  1H45 A;  4PAI A;  4RYA A;  4N81 A;  3Q26 A;  1MG1 A;  2A5S A;  4X48 A;  5DW8 A;  4HE0 A;  4H8J A;  4OMB A;  4O8M A;  4UA8 A;  4XKN A;  3TPA A;  4DZ1 A;  2OJT A;  5KCJ A;  3K1M A;  4F2Q A;  2FYI A;  4OVJ A;  3BFU A;  2DWA A;  4ELR A;  1B3H A;  1SD3 A;  2QJE A;  4K3F A;  3CG1 A;  1YPN A;  3H3G A;  3C4M A;  1J1N A;  2NXO A;  2UVG A;  3USD A;  2Y7W A;  2I0C A;  2YLN A;  3PPO A;  3S9E A;  1ZIU A;  4R9F A;  4R73 A;  3VVD A;  1POY 1;  1D9V A;  1MY2 A;  4N07 A;  2AYS A;  2CZI A;  4OVS A;  5ELV A;  1BP5 A;  4JSD A;  1MXW A;  1IIT A;  4U4X A;  1SBP A;  1FBH A;  5AA2 B;  3SET A;  1NFT A;  3OEN A;  5ET8 A;  1P1O A;  4HCY A;  1LBY A;  3A3U A;  2IEE A;  3PPN A;  5ET6 A;  4P56 A;  1RKM A;  4F18 A;  3G3K A;  5DEX B;  4NX1 A;  3G3G A;  2VP1 A;  1PBP A;  2QS2 A;  1MQH A;  2PVU A;  1QUJ A;  4G8H A;  4U22 A;  4PFI A;  1QKA A;  4LQ2 A;  3KZG A;  5TU0 A;  4XKP A;  1N0T A;  4IB2 A;  5KDT B;  3VV5 A;  1QVS A;  5AA4 B;  5ITO A;  2V84 A;  1NH7 A;  4FIM A;  2QMW A;  1DCU A;  1NUY A;  3ILU B;  4P1E A;  4NF5 B;  1PBQ A;  5EHS A;  1FPF A;  4JBZ A;  4G8M A;  2Z8E A;  3DP4 A;  4G8N A;  2Q2C A;  4NF4 B;  3T96 B;  4GBV A;  3F11 A;  2ZYK A;  4ND9 A;  4GX4 A;  4OYV A;  3MP6 A;  2B65 A;  1DPE A;  4LON B;  1MXX A;  4EQ9 A;  4OEN A;  4PAF A;  2REJ A;  3TYH A;  2E1S A;  3LSF B;  1NV7 A;  5ITP A;  1URD A;  4EUO A;  1KWH A;  4H1X A;  3IOV A;  1B1X A;  2V3Q A;  4NED A;  3EN3 A;  4MJO A;  4H8I A;  4L17 A;  5H8H B;  1NV6 A;  2JJK A;  3K6U A;  3RTW B;  1SI0 A;  2XX7 A;  2XWO A;  1LBB A;  2ZMB A;  3VXB A;  2Q9T A;  4IR8 A;  1FJ9 A;  5FBP A;  4KCC A;  4R2F A;  1IXG A;  4F1U A;  2I0B A;  3IJO B;  4DE8 A;  3MP8 A;  4GL8 A;  3HFU A;  1YTV A;  2OBG A;  2H98 A;  3TTN A;  3RPL A;  5ET7 A;  2ZZX A;  3K1P A;  4MNP A;  4X8R A;  3T9V A;  1UTB B;  1LAG E;  1JW1 A;  2B3B A;  3CRB A;  5AA1 A;  4BDQ A;  5M2V A;  1II5 A;  2PT1 A;  4JVI A;  2QS3 A;  1JP4 A;  1D4N A;  5DEX A;  2X7Q A;  3Q29 A;  3MYU A;  4RK9 A;  4F2O A;  4FEC A;  1FPI A;  2PX1 A;  3PD8 A;  2O7I A;  3GBB A;  3T9X B;  4R72 A;  1YYZ A;  5F7V A;  2DWH A;  5AA2 A;  4F31 B;  3MJN A;  4NG7 A;  3SEW A;  3PPQ A;  1MQJ A;  1BLF A;  3H06 B;  1FQC A;  4N13 A;  3RT8 A;  5ICQ A;  2NUV A;  4GX3 A;  3A09 A;  2P0S A;  4LZ7 A;  2OPD A;  3K01 A;  4JDF A;  4M1V A;  5H8Q A;  5TP9 A;  3TDJ A;  4JVD A;  5EQA A;  3CFZ A;  4MH5 A;  1ANF A;  3OO7 A;  2F8D A;  3TCH A;  1NV3 A;  3KFM A;  4IO5 A;  1FQF A;  4XKQ A;  4F19 A;  5I2N A;  4AS5 A;  4I3Y A;  1UTH A;  1H3D A;  3H6V A;  4YB5 A;  4XIG Q;  3QXM A;  3LR1 A;  4N6K A;  5BUU A;  1XVY A;  5FHN A;  5KCJ B;  1LBV A;  1LLS A;  2O68 A;  1FSA A;  1NV2 A;  4KHZ E;  3FZV A;  1O63 A;  2D5W A;  2HAV A;  3BKI B;  4WXJ A;  5EHM A;  5I3S A;  1B7H A;  1OQG A;  3EKI A;  3TCG A;  2FIE A;  4BDN A;  1UQW A;  3IX1 A;  4ZED A;  1N7W A;  3LV0 A;  1MPC A;  1BIY A;  4YKI A;  1B3L A;  3IK6 B;  5ET5 A;  2QVU A;  2Z8F A;  3ONM A;  5I7I A;  2Z23 A;  4DDD A;  4U23 A;  2RF1 A;  3JZJ A;  4MIJ A;  1VDW A;  2GRV A;  2CEY A;  1BK4 A;  3VVE A;  1Y1Z A;  4KCD A;  2DVZ A;  4OTE A;  5EYH A;  4AB5 A;  3U72 A;  3ZSF A;  3O6I A;  1MH3 A;  1B2H A;  4HE1 A;  1VE4 A;  3LUY A;  2DOJ A;  2YPN A;  1AIV A;  4YB6 A;  4N6D A;  1DBZ A;  2XXQ A;  2V93 A;  4ZEC A;  3Q28 A;  5IM2 A;  1ZBM A;  2OPE A;  3B6W A;  1IMA A;  1XHY A;  1FCK A;  3K6X A;  1GV8 A;  2H4I A;  5I84 A;  3EHT A;  3IAZ A;  2PFY A;  5I59 B;  3UN6 A;  3U1O A;  1BKA A;  4ZEI A;  1VSO A;  2F78 A;  1A7L A;  1DOT A;  3KBZ A;  4NF6 A;  2BJJ X;  5DVJ A;  3B6T A;  4P1L A;  2I4C A;  1XOC A;  1M5C A;  4C1U A;  4MNI A;  3SDF A;  3IO4 A;  3R7X A;  3VLW A;  2NWJ A;  3FAS A;  3SEX A;  1LFH A;  1G0I A;  2OZZ A;  4BDO A;  4GIZ A;  1KA0 A;  3QSL A;  4JSO A;  2F35 A;  2UXA A;  3PUX E;  4P9K A;  1JNF A;  2D21 A;  1Z7N E;  1JVX A;  1Y3N A;  3OXN A;  1IMB A;  5J16 A;  1FPJ A;  4U21 A;  1FBC A;  1A40 A;  1Q9D A;  3U93 A;  2ZZW A;  3PUW E;  1QGX A;  3MZ9 A;  3C34 A;  2DWJ A;  2G93 A;  2XXI A;  1EYI A;  3NOH A;  2Q8J A;  2GHB A;  2RCA A;  2F7B A;  1FQB A;  2DE4 A;  3RPL B;  3FXB A;  3WAF A;  3TTM A;  3OEK A;  1LAH E;  4MEV A;  4OZ9 A;  5ICT A;  4G68 B;  3RY3 A;  2X7P A;  4DCX A;  3H6W A;  4LQ5 A;  1MXZ A;  5H8H A;  1P99 A;  4GWS A;  1ZKB A;  1LFG A;  3TTK A;  3TEL A;  4R6H A;  1OLC A;  1B5J A;  2F3B A;  2R8T A;  2Z8D A;  2V3T A;  4XXU A;  4PE3 A;  4HS7 A;  2Q8M A;  3KGC A;  4I9D A;  3HN0 A;  2PFZ A;  2I3V A;  4F3G A;  1NNP A;  3PMX A;  4GVO A;  1EYJ A;  1OVB A;  4QSE A;  1LBC A;  4DI4 B;  4AB6 A;  4ZZE A;  3OOA A;  4MF3 A;  1R9Q A;  2PMS A;  4YU0 A;  4O7I A;  3PPR A;  2QPQ A;  4U1O A;  3K6W A;  3EHU A;  1EZO A;  3U65 A;  4P8B A;  3W9V A; 
#chains in the Genus database with same CATH homology
 1KA0 A;  1XI6 A;  4XFE A;  3D1R A;  4MNP A;  1DK4 A;  1FPD A;  2FIE A;  4PBQ A;  4X8R A;  2WBB A;  4OVQ A;  4P9K A;  4P47 A;  1INP A;  2WYP A;  4QBA A;  4X9T A;  1LBZ A;  4O94 A;  4UAB A;  5LTC A;  1NUX A;  3KC0 A;  3LV0 A;  4N91 A;  4PFI A;  1IMB A;  2P3V A;  2QVV A;  1FPJ A;  5J16 A;  2MKZ A;  1FBC A;  2ZZV A;  4JVI A;  1Q9D A;  4PET A;  1NV4 A;  1JP4 A;  1K9Z A;  1FPK A;  3KC1 A;  1QGX A;  4I40 A;  2ZZW A;  4NHB A;  4PAI A;  4N81 A;  4PC9 A;  5ET5 A;  2XWK A;  3T0J A;  1NUZ A;  4O7M A;  4QXD A;  2QVU A;  5I7I A;  3MYU A;  4PDD A;  5DW8 A;  3QMF A;  3BIG A;  1EYI A;  4HE0 A;  2VPO A;  3NOH A;  4NF0 A;  2BJI A;  1G0H A;  1KZ8 A;  5ESY A;  3E79 A;  4MNC A;  1RDX A;  4O8M A;  4PBH A;  1NV0 A;  1FPI A;  1FBE A;  4N4U A;  2HXR A;  4HCW A;  4PFB A;  2VT5 A;  2HZK A;  2L5V A;  4MIJ A;  1VDW A;  3RPL B;  1K9Y A;  2DE4 A;  2QVR A;  1FBD A;  1FPB A;  4G61 A;  2CEY A;  3FXB A;  3B50 A;  1DCU A;  1BK4 A;  1RDZ A;  1YYZ A;  4GWY A;  2KQZ A;  4PF8 A;  3U65 A;  1NUY A;  4P1E A;  5CM6 A;  4GWZ A;  1NI9 A;  2KR0 A;  4GBW A;  1IMF A;  4NG7 A;  4MEV A;  2DE3 A;  1FPF A;  2PCR A;  3RPL A;  4FBP A;  2DVZ A;  5I5P A;  4YZZ A;  2DDK A;  5EYH A;  5J1D A;  4OA4 A;  2WBD A;  1CNQ A;  4PAK A;  4NAP A;  4H46 A;  2WEF A;  3EKI A;  2Q74 A;  4MX6 A;  4HE1 A;  1YXI A;  4NQ8 A;  1LEV A;  4GBV A;  2XWI A;  1SPI A;  4MMP A;  4OVP A;  4PFR A;  4DI3 D;  1EYK A;  1FTA A;  4GX4 A;  1IMD A;  3GYY A;  3SZP A;  5IZZ A;  4N6D A;  1LBW A;  1DBZ A;  4HXV A;  1FPG A;  1IMC A;  2GQ1 A;  3IFC A;  5T3J A;  4MCO A;  4MHF A;  3IFA A;  4GWS A;  4N8G A;  4X04 A;  2HPG A;  2QFL A;  1FBP A;  3LUZ A;  4GX3 A;  4GWW A;  5IM2 A;  1FBG A;  5JK4 A;  2V4C A;  3B8B A;  1KA1 A;  4PAF A;  4HE2 A;  4XEQ A;  5EYG A;  2OX3 A;  4M1V A;  2F3B A;  2F5X A;  4YIC A;  1NV7 A;  2R8T A;  4MAG A;  2CZK A;  2FIX A;  2HHM A;  1FBF A;  4NN3 A;  2XWV A;  1IMA A;  5LDZ A;  1FPE A;  4PDH A;  4JVD A;  3CHG A;  2F3D A;  4GX6 A;  3MST A;  4N17 A;  3E78 A;  2WYK A;  2XXK A;  4I3E A;  4PTK A;  5F24 A;  4AS4 A;  4XF5 A;  2FBP A;  3A29 A;  3ISP A;  4PE3 A;  3FBP A;  5EQA A;  1FJ6 A;  2Q8M A;  2WX9 A;  5IGA A;  2V3Q A;  2PFZ A;  2B4M A;  4H45 A;  1YZ0 A;  3W9W A;  1IME A;  2PFY A;  3RYD A;  2CZI A;  5EQ9 A;  4N15 A;  4MJO A;  4OVS A;  4P3L A;  4GWX A;  3ROJ A;  1EYJ A;  1D9Q A;  1NV5 A;  2VPN A;  1NV6 A;  1NV3 A;  2JJK A;  4DI4 B;  4F1V A;  4PGN A;  2HZL A;  1FPL A;  2OWZ A;  1NV1 A;  4F19 A;  1AWB A;  4OVT A;  4AS5 A;  3KBZ A;  2P3N A;  5IZ1 A;  4I3Y A;  2Y5L A;  1FBH A;  2FHY A;  3T1B A;  2B4L A;  2Y5K A;  2FVZ A;  2XWO A;  2DE2 A;  4GWU A;  4O7I A;  2Q9T A;  2QPQ A;  5ET8 A;  4N6K A;  4P1L A;  5EQ8 A;  1RDY A;  1LBX A;  1LBV A;  4IR8 A;  4JVC A;  1FJ9 A;  5FBP A;  1FSA A;  1NV2 A;  3PTY A;  4HCY A;  1LBY A;  4PCD A;  2CZH A;  4F1U A;  4N8Y A;  4KXP A;  5IZ3 B;  4OAN A;  5IZ3 A;  5I3S A;  5ET6 A;  2CEX A;  1NUW A;  4LN5 A;  5A5L A;  2XA5 A;  4NGU A;  3HFU A;  4MNI A;  5EQ7 A;  4P56 A;  4P8B A;  1FRP A;  3BIH A;  4F18 A;  4PF6 A;  4PGP A;  4NX1 A;  3W9V A;  5ET7 A;  4OVR A;  2ZZX A;  1G0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...