1LBVA

Crystal structure of apo-form (p21) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 83
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbvA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbvA02
3LUZA 4IR8A 4MJOA 3A29A 4I3YA 3KC0A 5ET6A 4N81A 1KZ8A 5IZ3B 1JP4A 3FBPA 1G0HA 4KXPA 1IMDA 4H45A 5DW8A 4I3EA 1FPGA 1CNQA 1FBDA 1IMBA 1NV3A 2CZIA 2Q8MA 1FBHA 2F3DA 4G61A 1AWBA 1RDXA 1NV5A 3KC1A 4H46A 1NV4A 3D1RA 4GWSA 4GWZA 1NUYA 1YYZA 1DK4A 3T0JA 2BJIA 3ROJA 1FBPA 5ESYA 5ET5A 5ET7A 5EQ7A 1NV0A 4HE2A 4GX3A 5EYHA 1FPLA 2JJKA 1IMCA 1XI6A 4GWWA 2QFLA 2VT5A 3RPLB 1IMEA 2FBPA 1FBGA 5T3JA 1DBZA 1NV1A 2Y5KA 1LBXA 1NUXA 1LBVA 2QVUA 4GBWA 1YXIA 3BIHA 3LV0A 5EQ8A 3RPLA 3IFAA 5IZ1A 1NUWA 1K9ZA 1FPIA 2PCRA 4GX4A 1LEVA 1NV6A 3RYDA 2OX3A 2Q74A 1FTAA 1FSAA 1G0IA 1SPIA 3B8BA 2QVVA 2FHYA 1INPA 1K9YA 2P3NA 1EYKA 4HE0A 1IMFA 4GWUA 1FJ6A 2FIEA 2CZHA 1LBWA 1RDZA 1FBCA 1FRPA 1QGXA 1EYIA 2QVRA 2P3VA 1FPKA 1RDYA 4PTKA 5FBPA 2R8TA 1FBFA 1EYJA 2FIXA 1FJ9A 4GBVA 4FBPA 5LDZA 1IMAA 1FPEA 2CZKA 4HXVA 4GX6A 5J16A 1LBYA 1Q9DA 1NUZA 4O7IA 4QXDA 3IFCA 5I3SA 5ET8A 2WBDA 1BK4A 1FPBA 2WEFA 5F24A 5A5LA 4GWXA 4HE1A 4I40A 1FPFA 2FVZA 1FBEA 2OWZA 1VDWA 2DDKA 5EQAA 3KBZA 1NV2A 2WBBA 2Y5LA 5IZ3A 1YZ0A 4GWYA 1FPDA 4AS5A 1DCUA 1FPJA 1LBZA 1D9QA 1KA1A 1NI9A 4AS4A 3BIGA 3QMFA 1KA0A 2F3BA 1NV7A 5EQ9A 2HHMA 2GQ1A 5EYGA
chains in the Genus database with same CATH superfamily
5HBCA 3GLBA 4MX6A 5AA2D 3FBPA 4EXKA 1SW5A 2ANJA 4NF5A 1D9YA 4DXUA 3MQ9A 3H4ZA 3G3GA 5CMBA 4DE8A 3MVWA 3O66A 3ILTB 2PT1A 1YYZA 1WVJA 5M2VA 1NV0A 1PDAA 1IITA 2PFZA 1DTZA 3K1NA 3K6WA 3ZS6A 2E1SA 1SW4A 1LBVA 2VHAA 4MEVA 2DVCA 3RY3A 1QJMA 4EQ9A 3V8XB 1QW0A 4F29A 1MY4A 3MVXA 2F5XA 5CRYA 1WDNA 1FW0A 5TPAA 1LGBC 4RA1A 1MQJA 3SEUA 3KBRA 4ISUA 4ZEBA 4MLVA 4F2OA 5LDZA 2H98A 3IORA 5CI5A 4R9FA 4X04A 1P1QA 1URSA 2O84X 1SW2A 2XXXA 1JEVA 3N6UA 2R6GE 4R6YA 3EN3A 1MQHA 2F97A 1NL5A 2LAOA 1H76A 1QKAA 3LC8A 4G77A 4OFLA 1YTVA 3HFUA 1B9JA 3KC0A 1HSJA 2ZZWA 3H6WA 1B4ZA 1KZ8A 1G0HA 4F3PA 1RYOA 4XTCQ 3H3GA 1NMUA 2Q8MA 4C0RA 4F18A 1AWBA 1SI0A 2XXUA 4PDHA 3T9XB 1RDXA 4ESWA 5AA4B 4H0WA 4QFOA 2VD3A 2XWOA 4LATA 4I62A 4NAPA 4LVQA 2NVUB 4MBPA 1SQYA 1NNFA 1GR2A 4Z7EA 4XF5A 3TCGA 2HPGA 4YZZA 4H67A 4MLQA 1B1HA 1Z7ME 4JSOA 2W7YA 3IK6B 4XEQA 2FA7A 5A5XA 2PCRA 3M8UA 1MXWA 4R72A 5B7DA 3B6QA 4BDMA 1R1NA 2F7BA 1MH4A 3Q28A 3H6VA 2P3VA 4L17A 1H3DA 3V5AA 1POTA 4GFRA 1JNFA 5ELVA 1LB8A 4G8MA 5F1QA 4OFOA 1B4HA 4NE4A 1B40A 3MP1A 4GXAA 2H5YA 1M5BA 5A5LA 5I58B 3U65A 2DWHA 3EPEA 4P47A 4ZDMA 2FVZA 1FBEA 1XHYA 4F31B 2QS1A 4G4PA 1DCUA 1A55A 1D3KA 4EQ7A 1LBZA 3UIFA 3FXRA 2AIXA 3BIGA 4JXIA 1NKXA 1JEUA 1XVXA 3OO6A 1B0LA 4H6DA 3A29A 1YCJA 1IZ1A 3A09A 4N13A 2XXTA 3BFTA 3GZGA 2VPNA 1NNTA 2NWJA 5JTYB 5L9OA 1NV5A 3WAEA 3EHTA 1NV4A 4U1ZA 5IKBA 1NUYA 3M3FA 3PD8A 3PUVE 4ESXA 1JVXA 5I2KB 4PFYA 4NF5B 4P11A 4PAIA 4GWOA 2Y5KA 4GIZA 3O29A 1SD3A 2ESNA 1K9ZA 4NF6B 5CC2A 2GH9A 1B5IA 4PDDA 3GYYA 2Q89A 3RYDA 4YMAA 1FTAA 2P3NA 3FJMA 4E0WA 1B51A 3H7MA 3K01A 2MKZA 3E3KA 4GOTA 4RY1A 1SYHA 4RNSA 4PAKA 1IMAA 4NWCA 5H8QA 3THIA 4YB6A 2XX7A 3OO8A 1MXXA 1AMFA 3LBSA 5TPAB 2B3FA 3T96B 3H6UA 1DSNA 3TZAA 4DXCA 5HM4B 5IAIA 1FPFA 3H06B 4R6HA 4I8CA 3PPOA 3FXBA 3S9LC 2DWJA 1B1XA 4N6PA 4R2BA 5AA1A 1PBQA 1OLCA 1US5A 3TAJA 2WYKA 3HV1A 4P56A 4PGPA 5IGAA 4MNPA 5JEIA 5DW8A 1MXYA 3E79A 4H46A 3D4GA 1DK4A 4OEUA 3FASA 4E0XA 1FTMA 1SVXB 1QUJA 4O3BA 3ZKKA 1IMEA 2FBPA 2NXOA 5T3JA 2PBWA 1S50A 2GRVA 4LZ8A 1NUWA 3SKPA 3HHFA 1P99A 2PX1A 3I6VA 3SEXA 1VE4A 3FV1A 2OCUA 2Q74A 1XOCA 3CG1A 4PAFA 4G8NA 2V84A 4YU0A 3HN0A 4NHBA 1MQDA 3QXMA 3VXCA 4Q30B 1FJ9A 2O1MA 4Q8RA 1FPEA 4Q5TA 4DI4B 1SBPA 5J16A 4OVQA 1N3XA 4M4GA 3D4CA 4PF6A 1IEJA 3TTMA 3QAXA 2QJEA 4DCXA 4RXLA 2YLNA 2KQZA 5DTBA 4GXSB 3MVZA 3QK6A 5ISUA 2WKYA 4X8RA 1M5EA 1NI9A 4AS4A 4H65A 3P7IA 1A99A 2GQ1A 2OJTA 4IR8A 3C35A 2DOJA 2QL3A 2E0SA 3RT8A 1ZJLA 1MPDA 1LCTA 3KSXA 5FHOA 4G2ZA 1IMBA 1KWHA 3GXAA 4ZEFA 3VVEA 4N8GA 3ROJA 1FBPA 5ESYA 3G3JA 4ZEIA 3VXBA 3GBBA 1LLSA 3KN7A 1IQ7A 3RPLB 5DEXA 5AA2A 1EZPA 2ONRA 2R9JA 1DBZA 1N3WA 3CFLA 2XXQA 1I6QA 3MUQA 4Q0CA 4P9KA 3HHGA 1LEVA 2OX3A 1USYH 4NF4A 2DE4A 4X1BA 4I1DA 4LN5A 4HE0A 4HS7A 5EHSA 2CZHA 3R6UA 2ZYMA 5CMMA 3KOSA 2Q2CA 1USYE 2QS3A 4JDFA 1FPKA 4F3GA 5HPQA 4FBPA 2CEXA 4R74A 4M1VA 1IXGA 3MZBA 2I48A 4AQ4A 4R73A 4OFJA 4MCOA 3PUYE 1PEBA 3E13X 3T9HB 2X26A 2PYYA 2THIA 5H8QB 1WODA 5IZ3A 4NF8B 4RJZA 4LZ7A 2B3BA 1FPJA 2NOOA 4FORA 2O7IA 5H8NB 3CFXA 3U94A 3TUSA 2F3BA 4JBZA 2HHMA 3U72A 1FQCA 3A3UA 3CG3A 3MAMA 1LAGE 4QRZA 4KXPA 4PQJA 4OVJA 3RPWA 3TTRA 2I4BA 1MQIA 2F3DA 1VFEA 3D1RA 4GWSA 3IAZA 4GWZA 2RC9A 1F9BA 1Z7NE 1UTBA 1FPLA 5K2YA 4EF2A 4UACA 4GL8A 3PMVA 3EF7A 1QKBA 1LBXA 3RTWB 5I2KA 5KCJB 2CEYA 1Y3PA 1FPIA 3UK4A 3FVKA 4GX4A 4QBAA 2ONKE 3RUMA 2XXYA 2KLFA 4NF6A 1B7HA 4HW8A 3B8BA 1SPIA 2ZZVA 2O1LA 1EH3A 4LQ5A 5H8HA 2I0BA 4X9TA 4ECFA 1FBCA 3CSGA 1R6ZA 2V3QA 2QS2A 2R8TA 5BUUA 4YKJA 2H99A 4N91A 1ELJA 2V3UA 2M8CA 2CZKA 4RPOA 4PFRA 3RLFE 5AA3A 2Z8FA 3CRBA 5IZZA 4N8YA 3VLWA 3PUZE 5ET8A 2WBDA 3V89B 1Y1MA 4LUBA 3TODA 4I40A 4NN3A 2RKMA 3O6HA 5ITOA 2HFBA 3WAFA 4GWYA 2O68A 2Y7WA 3FJ7A 4X1DA 2REGA 3QMFA 4MNIA 4KQPA 4F3SA 2PVUA 5KZTA 5EYGA 3KN8A 4QSEA 1BTJA 1DPPA 2P2AA 4FJPA 3IB1A 3OOAA 1AOVA 4ND9A 1XS5A 1BP5A 1FBHA 1VFDA 3KEIA 4WXJA 4N6DA 3KC1A 4I9DA 1B6HA 2I0CA 3IOWA 1YPNA 3SETA 5AE4A 2QFLA 3RGYA 1JQFA 1SYIA 4RYAA 5CMCA 1OVTA 1FBGA 2DWIA 5IM2A 2QVUA 3S4UA 3VVFA 3BIHA 3K1PA 4JWXA 3TTLA 5I57A 2XWVA 1RKMA 1PB9A 5I2NA 4AB6A 1MXUA 2Q2AA 4OVTA 5DEXB 5AA2B 1UTHA 2UVGA 3ISPA 1LBWA 3KJ7A 3O2AA 3UP9A 1M5DA 1RDZA 3MYUA 4PTKA 4PE3A 4LQ2A 4Z0IA 3IO6A 2XWKA 5FTIA 4NF4B 4NX1A 1Q9DA 4MIJA 4N4UA 1AIVA 4ELOA 1BLFA 4IGRA 3IL1B 2X7PA 3USDA 1LFIA 1S9TA 4YB7A 1LFGA 3K00A 1LB9A 3KBZA 3KG2A 2B4MA 2DWAA 3FD3A 1FQDA 4KR5A 3EQ1A 3TPAA 4OWDA 1D9QA 3IO4A 4GL0A 2UXAA 2O69A 4BDNA 3I3VA 2DP8A 2IA4A 1II5A 2OWTA 2DXRA 3FIRA 5ITPA 2V4CA 1PB8A 4EUOA 4DDDA 5IZ3B 2NUVA 2HZKA 1MM7A 4MF3A 3K02A 3OXNA 1EZOA 1Y9UA 2YJPA 2ZNTA 4PFBA 4N17A 2RINA 1N04A 3IB0A 5CBRA 3FXUA 1NH8A 5I5PA 4QFNA 4JWYA 3CFZA 4IY6A 4JWOA 2XD3A 3RPLA 3E4RA 2X7QA 2RC8A 3E78A 4C1TA 1ZIUA 1UTBB 2Y7RA 4YKKA 2FHYA 3I5OA 1EYKA 1IMFA 3KOTA 1T0KA 3RNNA 1B2HA 1Y1ZA 1QVSA 1JETA 1QGXA 3G3IA 3KZGA 1FTJA 3SEWA 3MZ9A 4IO4A 1MRPA 4O94A 3B6WA 5H8HB 1EZ9A 2VD2A 2WX9A 4N6KA 3U1OA 4P3LA 2QMWA 4JVCA 3FVGA 4ONYA 2DDKA 1NNPA 3FJGA 3SEYA 3HCQA 3R7XA 4NF8A 2I49A 4MMPA 2Y84A 1ZBMA 4IO5A 3W9WA 1H45A 4YKIA 5H8NA 1JW1A 1O7TA 4GLIA 1GV8A 3LSXA 1OVBA 3ILUB 3EHSA 2I6EA 3U92A 1IMDA 4ZEDA 4H45A 3GBAA 4PFIA 2VOZA 4QSDA 5B70A 2A5TB 2ZYOA 2RCAA 3IJXB 4GX3A 3ZSFA 1A40A 1EU8A 1NFTA 1NH7A 2VT5A 3FUZA 4HTGA 2DXYA 3PTYA 3H03A 2BJJX 2HXRA 4DXBA 3T22A 3LV0A 4P0GA 4ZS9A 3HSTA 3NOHA 5KCJA 2RF1A 5TP9A 2H4IA 3DLNA 1TFDA 2ZNSA 4BDRA 4P1LA 2DVZA 2KR0A 4GQOA 1INPA 3T1BA 4UA8A 1LFHA 2CMOA 4ZECA 2I4CA 2VGQA 2YPNA 3VVDA 3KN3A 5FBPA 5I57B 1URGA 3G3KA 4QFLA 3S9EA 5I2NB 4GX6A 2AL4A 1UTHB 4OVSA 1LAXA 3TFLA 1BK4A 1XT8A 1YAEA 3QYTA 5F24A 4GWXA 1Y3QA 1DOTA 4X48A 4N07A 1N76A 1OMPA 4KD5A 4H8JA 2XXVA 3IX1A 1MM6A 2Y5LA 1MY0A 4U21A 4AS5A 2OZZA 1Y3NA 1VSOA 1HSLA 4FATA 2Y7IA 1KA0A 2QS4A 3G3FA 2XX9A 1TT1A 1PC3A 4MJOA 3FXQA 5ET6A 4R2FA 4N81A 3SERA 3FZVA 1N7XA 1B05A 5I56B 1CE2A 4G61A 3U93A 1H43A 1Y20A 4LZ5A 3C33A 4THIA 3UGWA 4OVRA 1MQGA 3VLUA 2V93A 3OD7A 1B3GA 4F22A 2P0SA 1MY1A 4LONB 4GBWA 1S7YA 1FTKA 2HEUA 5JK4A 3T93B 1I69A 4O7MA 4R9GA 4RK9A 1FQBA 2AL5A 4U22A 1ZMGA 1G0IA 3MVYA 4MHFA 4OYVA 4P0IA 1TFAA 2OLBA 3N26A 1IXIA 1FJ6A 3MC2A 4H8IA 3FATA 1M5FA 3LR1A 3SESA 4NMYA 1URDA 1GGGA 1XVYA 4IO7A 4OHNA 2REJA 3G3HA 1DTGA 1GVCA 2F8DA 3O6GA 1XC1A 4C1UA 2I58A 3OO7A 2PT2A 3PMWA 1JVYA 5CM6A 2ZYNA 1MXVA 3OEKA 4PE5B 2WBBA 4U1OA 3CR9A 4ELQA 1P1UA 4H5GA 4ELRA 4NF0A 4DZ1A 4KFQA 5EQ9A 4G68C 1B3HA 3RT6B 3JV9A 4OMBA 3LSFB 4MAGA 1AL3A 1P1WA 3ONMA 4OA4A 4XIGQ 3B6TA 3Q27A 1B58A 1CNQA 1NV3A 2F6PA 4UABA 4N15A 3VV5A 3RTFB 3T0JA 1Y4CA 5H8FA 1BIYA 3L6GA 5I7IA 4HE2A 1B3LA 3HO7A 4R75A 1MS7A 3ZKLA 4HCWA 1JW5A 1NUXA 5EQ8A 3L6HA 5LOMA 3IFAA 5IZ1A 3T66A 4NEDA 1NV6A 3LUYA 4PFUA 4KYDA 1LAFE 1FSAA 3AXFA 1K9YA 3OO9A 2OPEA 4K3FA 2FIEA 4OEVA 3QUJA 1Q1KA 3PUWE 2RCBA 4O8MA 5TP9B 3S9NC 3MZ1A 2B65A 1J1NA 2VPOA 4ZZEA 2F7CA 1NUZA 4POWA 1A54A 4QFKA 2P1SA 2UVHA 4PBHA 1M5CA 1QUIA 3N5LA 1SI1A 3OELA 3QIMA 4WEDA 1MH3A 1FPBA 3TQWA 3VLVA 4G68A 2ALUA 3T9UA 3OMBA 2ZNUA 4IO6A 2HCAA 2PFYA 4ZE8A 1QUKA 3O6IA 4BLAA 3O28A 2I3WA 4EF1A 4RPNA 3KJTA 4U2RA 4IO2A 4OXVA 4QHQA 4TQUQ 2F34A 4EXLA 4NWDA 4YICA 4I3YA 2GHBA 3EKIA 4NQ8A 3G7WA 1FQEA 2A5SA 2F35A 2F6GA 3DELB 1FPGA 3CSBA 2HAVA 4XXUA 3C36A 2OBGA 4IB2A 1UIUA 2ONSA 1A8FA 4ZZAA 4F1VA 2A5TA 1ZU0A 2JJKA 5FHMA 3ECRA 2QSXA 1DPEA 3KGCA 3SZPA 3B50A 4KYEA 4FEBA 1BKAA 4GD5A 3CHGA 3PPNA 1B5JA 4ZE9A 2F7AA 4O3CA 4TOZA 4PFTA 3BBRA 2XA5A 4GWUA 3TEPA 3VE1B 3VFJA 3W15C 4PF8A 2HZLA 1IIWA 2DYXA 1LBYA 4O7IA 2O6AA 3OEMA 1Y4TA 2UYFA 3MPLA 4KYSA 2ABHA 4KPTA 4TLLB 1TWYA 1O63A 1SDXA 1MG1A 4XKPA 3TTNA 1LBBA 4OENA 1MXZA 2Y7PA 5EHMA 2OWSA 4FEDA 2XX8A 4FAJA 2DSFA 1MDQA 1NV7A 2QMXA 5DVFA 1ATGA 3LUZA 3KFMA 2D5WA 4U4XA 3TELA 1H44A 4OESA 3TCHA 4BDOA 3IOTA 4I3EA 3JZJA 3A3CA 4G8HA 2D21A 3IOUA 2I3VA 5DVIA 5F7VA 3MBPA 1QULA 2UVJA 5I56A 2BJIA 3PV0E 5ET7A 2QRYA 5DVJA 4XFEA 3TTKA 4GWWA 1R9LA 1LAHE 5KDTA 5K2XA 1B32A 2WYPA 4GF8A 5H8FB 3K0VA 1ANFA 1LCFA 3VDFA 4YMBA 1TXFA 2QVVA 2XD2A 1JW4A 4POXA 4GVOA 2DQVA 4PP0A 3PPQA 1IUDA 2B4LA 2XXIA 2G93A 1P1OA 2UVIA 2FIXA 2F78A 4FE8A 4DI3D 1B7UA 1ZLQA 4DLDA 5FTHA 1POY1 3PGFA 1D9VA 2Q88A 3QSLA 3R26A 4GRKA 4PETA 4F19A 3RN8A 5CMKA 2Z8EA 4DCYA 5EYFA 4PBQA 3EHUA 1VDWA 4XKQA 1YZ0A 3IJOB 1US4A 1FPDA 4WEPA 3W9VA 1HSEA 2F36A 4NTLA 3PD9A 1Q35A 4H1XA 4G68B 2HQ0A 1MPBA 2O7UA 2XXRA 4QF9A 2UYEA 4PC9A 3IOVA 5L9MA 2Q9TA 3FVNA 3PPPA 3TCFA 5DT6A 1LBCA 3OSRA 2AYSA 5ET5A 4QFPA 1FTOA 4WKMA 1B0HA 1XI6A 1PB7A 4OERA 4KHZE 4MH5A 3RQTA 4IO3A 1RYXA 3QUFA 3MP8A 3OSQA 3SEVA 1OIBA 2DS9A 2XXPA 3O97A 1NNKA 4OTEA 3TDJA 5I59A 1B3FA 2V3TA 3Q26A 3O9PA 3PUXE 3MJNA 1IXCA 3K2DA 5ICTA 3CI8A 3TYHA 1FRPA 2Z8DA 1FBFA 1SW1A 1A8EA 4ZEKA 4OANA 3MSTA 2XHDA 4BDQA 4F1UA 2ZZXA 1UIVA 4BDLA 2IEEA 3IFCA 3PPRA 3F11A 3S2VA 4EQBA 2G29A 3S9MC 4ELPA 2WEFA 2GHAA 1B3EA 2RC7A 2HXWA 3U8QA 2OWZA 4HCYA 5DYHA 1MDP1 5EQAA 1I6BA 2XXKA 4JVIA 4OETA 1O64A 2L5VA 3CIJA 5BWJA 1KA1A 3C9HA 4TLMB 3KSJA 4U4SA 4IY5A 1AH5A 1MY3A 3HPIA 1JP4A 2Z23A 3IB2A 4JB7A 3C32A 4QSCA 5H8SA 3TMGA 2CZIA 3BFUA 3K6UA 1FQFA 1I6AA 2O51A 4XKNA 4KI0E 4F3BA 1N0TA 2ZMBA 3DP6A 2HAUA 4OQOA 4R6KA 3BKIB 4PCDA 2H9BA 4RK2A 4MFIA 5A5XB 1NV1A 2D3IA 4F1YA 4OZ9A 1P1NA 1OQGA 3M3KA 2Y7KA 4OVPA 4IGTA 3LSWA 3M3LA 4YKPA 1LSTA 3DP4A 5L9SA 2DE3A 2GFEA 1N7WA 3FV2A 5KDTB 4MNCA 4PGNA 3Q25A 2CZLA 2QVRA 1RDYA 4FECA 1N84A 2ZYKA 5TU0A 4HXVA 2FNCA 1B46A 4QXDA 4NGUA 1D4NA 1FCKA 4HE1A 4DIGA 3UORA 4F2QA 2XWIA 2R71A 4LP2B 4P8BA 3B7DA 4YAHX 3MWBA 3MP6A 4NG7A 3FVOA 3CVGA 3C31A 3Q29A 4KCDA 3JYRA 3T9VA 3K4UA 4JSDA 2DE2A 5ICQA 3N94A 5CBSA 5AA4A 3SDFA 1ZKBA 1B52A 1FQAA 1B7ZA 3UA8A 3DP8A 3MPKA 3MW0A 5LTCA 1FTLA 1FBDA 1UQWA 4YB5A 1PBPA 2PMSA 1A7LA 3ODBA 1IXHA 3K6XA 5EQ7A 5EYHA 1VR5A 3FGSA 1IMCA 2VP1A 1ZTYA 1MPCA 2XXHA 4H5FA 3DM0A 1L5TA 1YXIA 2H25A 5I84A 3LSLA 2XXWA 5L8DA 2Q8JA 3K6VA 4FIMA 5FHNA 2OPDA 3OENA 3K1MA 4EDPA 5J1DA 3IR1A 2FYIA 3C34A 4KCCA 4LA9A 5I58A 4AB5A 2Z22A 3UN6A 1EYIA 4XKRA 1R9QA 3N6TA 4P1EA 2V25A 1EYJA 1B5HA 4GBVA 2ZXTA 5I59B 3TKDA 4U23A 3PU5A 1CB6A 3PMXA 3V83A 5I3SA 1GTKA 4JVDA 4PFWA 1OLAA 1NV2A 3C4MA 4O3AA 3H6TA 2QPQA 4F39A 2OK2A 1MY2A 1DMBA 3E9XA 5JTYA 1OQHA 3TQLA
chains in the Genus database with same CATH topology
3LUZA 4IR8A 4MX6A 3FBPA 1IMDA 4H45A 4I3EA 4PFIA 1IMBA 1YYZA 4N8GA 2BJIA 3ROJA 1FBPA 5ESYA 5ET7A 1NV0A 4GX3A 4XFEA 2PFZA 4GWWA 2VT5A 3RPLB 3PTYA 1DBZA 1LBVA 2HXRA 2WYPA 3LV0A 4MEVA 3NOHA 4P9KA 1LEVA 2OX3A 2F5XA 4P1LA 2DE4A 2DVZA 4LN5A 2QVVA 2KR0A 1INPA 3T1BA 4HE0A 2CZHA 1FPKA 2B4LA 5FBPA 2FIXA 4FBPA 5LDZA 2CEXA 4M1VA 4GX6A 4DI3D 4X04A 4OVSA 4MCOA 1BK4A 5F24A 4GWXA 4PETA 4F19A 4PBQA 1VDWA 2Y5LA 5IZ3A 1YZ0A 1FPDA 3W9VA 4AS5A 1FPJA 1KA0A 2F3BA 2HHMA 3HFUA 4MJOA 4PC9A 3KC0A 5ET6A 2ZZWA 4N81A 1KZ8A 1G0HA 4KXPA 2Q9TA 2Q8MA 4F18A 2F3DA 4G61A 1AWBA 4PDHA 1RDXA 3D1RA 4GWSA 4GWZA 2XWOA 4OVRA 5ET5A 4NAPA 1FPLA 1XI6A 4XF5A 2HPGA 4YZZA 1LBXA 4GBWA 4XEQA 2CEYA 5JK4A 4O7MA 1FPIA 2PCRA 4GX4A 4QBAA 1G0IA 1SPIA 3B8BA 2ZZVA 4MHFA 1FJ6A 4X9TA 1FBCA 1FRPA 2P3VA 2V3QA 2R8TA 1FBFA 4N91A 4OANA 2CZKA 3MSTA 4PFRA 4F1UA 2ZZXA 5IZZA 3IFCA 4N8YA 5ET8A 2WBDA 2WEFA 5A5LA 3U65A 4P47A 4I40A 2FVZA 1FBEA 2OWZA 4HCYA 4NN3A 5CM6A 5EQAA 2WBBA 2XXKA 4JVIA 4GWYA 1DCUA 2L5VA 1LBZA 1KA1A 4NF0A 3BIGA 3QMFA 5EQ9A 4MNIA 5EYGA 3A29A 4MAGA 1JP4A 4OA4A 1CNQA 2VPNA 1NV3A 2CZIA 1FBHA 4UABA 4N6DA 1NV5A 3KC1A 4N15A 1NV4A 1NUYA 3T0JA 5I7IA 4HE2A 4PCDA 2QFLA 1FBGA 4PAIA 4HCWA 1NV1A 2Y5KA 5IM2A 1NUXA 2QVUA 3BIHA 5EQ8A 3IFAA 5IZ1A 1K9ZA 4PDDA 3GYYA 2XWVA 4OVPA 1NV6A 3RYDA 1FTAA 1FSAA 1K9YA 4OVTA 2P3NA 2FIEA 3ISPA 1LBWA 2DE3A 4MNCA 1RDZA 3MYUA 2MKZA 4PGNA 2QVRA 4PTKA 1RDYA 4PE3A 4O8MA 2XWKA 4PAKA 1IMAA 2VPOA 4HXVA 4NX1A 1Q9DA 1NUZA 4QXDA 4MIJA 4N4UA 4NGUA 4PBHA 1FPBA 4HE1A 2XWIA 1FPFA 4P8BA 3KBZA 4NG7A 2B4MA 2PFYA 3FXBA 1D9QA 2DE2A 2WYKA 2V4CA 4YICA 4I3YA 4P56A 4PGPA 3EKIA 4NQ8A 5IZ3B 5IGAA 2HZKA 4MNPA 5LTCA 5DW8A 1FPGA 1FBDA 3E79A 4H46A 4PFBA 4N17A 1DK4A 4F1VA 5EQ7A 5EYHA 5I5PA 2JJKA 1IMCA 1IMEA 2FBPA 5T3JA 3SZPA 3B50A 1YXIA 3RPLA 1NUWA 3CHGA 3E78A 2Q74A 4PAFA 2FHYA 2XA5A 1EYKA 1IMFA 4GWUA 5J1DA 4NHBA 1QGXA 1EYIA 4PF8A 4P1EA 1EYJA 1FJ9A 4GBVA 1FPEA 2HZLA 4DI4B 5J16A 1LBYA 4O7IA 4OVQA 4O94A 5I3SA 4PF6A 2WX9A 4N6KA 4JVDA 4P3LA 2KQZA 4JVCA 2DDKA 1NV2A 2QPQA 4X8RA 1NI9A 4AS4A 4MMPA 1NV7A 3W9WA 2GQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUZ A;  4IR8 A;  4MJO A;  3A29 A;  4I3Y A;  3KC0 A;  5ET6 A;  4N81 A;  1KZ8 A;  5IZ3 B;  1JP4 A;  3FBP A;  1G0H A;  4KXP A;  1IMD A;  4H45 A;  5DW8 A;  4I3E A;  1FPG A;  1CNQ A;  1FBD A;  1IMB A;  1NV3 A;  2CZI A;  2Q8M A;  1FBH A;  2F3D A;  4G61 A;  1AWB A;  1RDX A;  1NV5 A;  3KC1 A;  4H46 A;  1NV4 A;  3D1R A;  4GWS A;  4GWZ A;  1NUY A;  1YYZ A;  1DK4 A;  3T0J A;  2BJI A;  3ROJ A;  1FBP A;  5ESY A;  5ET5 A;  5ET7 A;  5EQ7 A;  1NV0 A;  4HE2 A;  4GX3 A;  5EYH A;  1FPL A;  2JJK A;  1IMC A;  1XI6 A;  4GWW A;  2QFL A;  2VT5 A;  3RPL B;  1IME A;  2FBP A;  1FBG A;  5T3J A;  1DBZ A;  1NV1 A;  2Y5K A;  1LBX A;  1NUX A;  1LBV A;  2QVU A;  4GBW A;  1YXI A;  3BIH A;  3LV0 A;  5EQ8 A;  3RPL A;  3IFA A;  5IZ1 A;  1NUW A;  1K9Z A;  1FPI A;  2PCR A;  4GX4 A;  1LEV A;  1NV6 A;  3RYD A;  2OX3 A;  2Q74 A;  1FTA A;  1FSA A;  1G0I A;  1SPI A;  3B8B A;  2QVV A;  2FHY A;  1INP A;  1K9Y A;  2P3N A;  1EYK A;  4HE0 A;  1IMF A;  4GWU A;  1FJ6 A;  2FIE A;  2CZH A;  1LBW A;  1RDZ A;  1FBC A;  1FRP A;  1QGX A;  1EYI A;  2QVR A;  2P3V A;  1FPK A;  1RDY A;  4PTK A;  5FBP A;  2R8T A;  1FBF A;  1EYJ A;  2FIX A;  1FJ9 A;  4GBV A;  4FBP A;  5LDZ A;  1IMA A;  1FPE A;  2CZK A;  4HXV A;  4GX6 A;  5J16 A;  1LBY A;  1Q9D A;  1NUZ A;  4O7I A;  4QXD A;  3IFC A;  5I3S A;  5ET8 A;  2WBD A;  1BK4 A;  1FPB A;  2WEF A;  5F24 A;  5A5L A;  4GWX A;  4HE1 A;  4I40 A;  1FPF A;  2FVZ A;  1FBE A;  2OWZ A;  1VDW A;  2DDK A;  5EQA A;  3KBZ A;  1NV2 A;  2WBB A;  2Y5L A;  5IZ3 A;  1YZ0 A;  4GWY A;  1FPD A;  4AS5 A;  1DCU A;  1FPJ A;  1LBZ A;  1D9Q A;  1KA1 A;  1NI9 A;  4AS4 A;  3BIG A;  3QMF A;  1KA0 A;  2F3B A;  1NV7 A;  5EQ9 A;  2HHM A;  2GQ1 A;  5EYG A; 
#chains in the Genus database with same CATH topology
 5HBC A;  3GLB A;  4MX6 A;  5AA2 D;  3FBP A;  4EXK A;  1SW5 A;  2ANJ A;  4NF5 A;  1D9Y A;  4DXU A;  3MQ9 A;  3H4Z A;  3G3G A;  5CMB A;  4DE8 A;  3MVW A;  3O66 A;  3ILT B;  2PT1 A;  1YYZ A;  1WVJ A;  5M2V A;  1NV0 A;  1PDA A;  1IIT A;  2PFZ A;  1DTZ A;  3K1N A;  3K6W A;  3ZS6 A;  2E1S A;  1SW4 A;  1LBV A;  2VHA A;  4MEV A;  2DVC A;  3RY3 A;  1QJM A;  4EQ9 A;  3V8X B;  1QW0 A;  4F29 A;  1MY4 A;  3MVX A;  2F5X A;  5CRY A;  1WDN A;  1FW0 A;  5TPA A;  1LGB C;  4RA1 A;  1MQJ A;  3SEU A;  3KBR A;  4ISU A;  4ZEB A;  4MLV A;  4F2O A;  5LDZ A;  2H98 A;  3IOR A;  5CI5 A;  4R9F A;  4X04 A;  1P1Q A;  1URS A;  2O84 X;  1SW2 A;  2XXX A;  1JEV A;  3N6U A;  2R6G E;  4R6Y A;  3EN3 A;  1MQH A;  2F97 A;  1NL5 A;  2LAO A;  1H76 A;  1QKA A;  3LC8 A;  4G77 A;  4OFL A;  1YTV A;  3HFU A;  1B9J A;  3KC0 A;  1HSJ A;  2ZZW A;  3H6W A;  1B4Z A;  1KZ8 A;  1G0H A;  4F3P A;  1RYO A;  4XTC Q;  3H3G A;  1NMU A;  2Q8M A;  4C0R A;  4F18 A;  1AWB A;  1SI0 A;  2XXU A;  4PDH A;  3T9X B;  1RDX A;  4ESW A;  5AA4 B;  4H0W A;  4QFO A;  2VD3 A;  2XWO A;  4LAT A;  4I62 A;  4NAP A;  4LVQ A;  2NVU B;  4MBP A;  1SQY A;  1NNF A;  1GR2 A;  4Z7E A;  4XF5 A;  3TCG A;  2HPG A;  4YZZ A;  4H67 A;  4MLQ A;  1B1H A;  1Z7M E;  4JSO A;  2W7Y A;  3IK6 B;  4XEQ A;  2FA7 A;  5A5X A;  2PCR A;  3M8U A;  1MXW A;  4R72 A;  5B7D A;  3B6Q A;  4BDM A;  1R1N A;  2F7B A;  1MH4 A;  3Q28 A;  3H6V A;  2P3V A;  4L17 A;  1H3D A;  3V5A A;  1POT A;  4GFR A;  1JNF A;  5ELV A;  1LB8 A;  4G8M A;  5F1Q A;  4OFO A;  1B4H A;  4NE4 A;  1B40 A;  3MP1 A;  4GXA A;  2H5Y A;  1M5B A;  5A5L A;  5I58 B;  3U65 A;  2DWH A;  3EPE A;  4P47 A;  4ZDM A;  2FVZ A;  1FBE A;  1XHY A;  4F31 B;  2QS1 A;  4G4P A;  1DCU A;  1A55 A;  1D3K A;  4EQ7 A;  1LBZ A;  3UIF A;  3FXR A;  2AIX A;  3BIG A;  4JXI A;  1NKX A;  1JEU A;  1XVX A;  3OO6 A;  1B0L A;  4H6D A;  3A29 A;  1YCJ A;  1IZ1 A;  3A09 A;  4N13 A;  2XXT A;  3BFT A;  3GZG A;  2VPN A;  1NNT A;  2NWJ A;  5JTY B;  5L9O A;  1NV5 A;  3WAE A;  3EHT A;  1NV4 A;  4U1Z A;  5IKB A;  1NUY A;  3M3F A;  3PD8 A;  3PUV E;  4ESX A;  1JVX A;  5I2K B;  4PFY A;  4NF5 B;  4P11 A;  4PAI A;  4GWO A;  2Y5K A;  4GIZ A;  3O29 A;  1SD3 A;  2ESN A;  1K9Z A;  4NF6 B;  5CC2 A;  2GH9 A;  1B5I A;  4PDD A;  3GYY A;  2Q89 A;  3RYD A;  4YMA A;  1FTA A;  2P3N A;  3FJM A;  4E0W A;  1B51 A;  3H7M A;  3K01 A;  2MKZ A;  3E3K A;  4GOT A;  4RY1 A;  1SYH A;  4RNS A;  4PAK A;  1IMA A;  4NWC A;  5H8Q A;  3THI A;  4YB6 A;  2XX7 A;  3OO8 A;  1MXX A;  1AMF A;  3LBS A;  5TPA B;  2B3F A;  3T96 B;  3H6U A;  1DSN A;  3TZA A;  4DXC A;  5HM4 B;  5IAI A;  1FPF A;  3H06 B;  4R6H A;  4I8C A;  3PPO A;  3FXB A;  3S9L C;  2DWJ A;  1B1X A;  4N6P A;  4R2B A;  5AA1 A;  1PBQ A;  1OLC A;  1US5 A;  3TAJ A;  2WYK A;  3HV1 A;  4P56 A;  4PGP A;  5IGA A;  4MNP A;  5JEI A;  5DW8 A;  1MXY A;  3E79 A;  4H46 A;  3D4G A;  1DK4 A;  4OEU A;  3FAS A;  4E0X A;  1FTM A;  1SVX B;  1QUJ A;  4O3B A;  3ZKK A;  1IME A;  2FBP A;  2NXO A;  5T3J A;  2PBW A;  1S50 A;  2GRV A;  4LZ8 A;  1NUW A;  3SKP A;  3HHF A;  1P99 A;  2PX1 A;  3I6V A;  3SEX A;  1VE4 A;  3FV1 A;  2OCU A;  2Q74 A;  1XOC A;  3CG1 A;  4PAF A;  4G8N A;  2V84 A;  4YU0 A;  3HN0 A;  4NHB A;  1MQD A;  3QXM A;  3VXC A;  4Q30 B;  1FJ9 A;  2O1M A;  4Q8R A;  1FPE A;  4Q5T A;  4DI4 B;  1SBP A;  5J16 A;  4OVQ A;  1N3X A;  4M4G A;  3D4C A;  4PF6 A;  1IEJ A;  3TTM A;  3QAX A;  2QJE A;  4DCX A;  4RXL A;  2YLN A;  2KQZ A;  5DTB A;  4GXS B;  3MVZ A;  3QK6 A;  5ISU A;  2WKY A;  4X8R A;  1M5E A;  1NI9 A;  4AS4 A;  4H65 A;  3P7I A;  1A99 A;  2GQ1 A;  2OJT A;  4IR8 A;  3C35 A;  2DOJ A;  2QL3 A;  2E0S A;  3RT8 A;  1ZJL A;  1MPD A;  1LCT A;  3KSX A;  5FHO A;  4G2Z A;  1IMB A;  1KWH A;  3GXA A;  4ZEF A;  3VVE A;  4N8G A;  3ROJ A;  1FBP A;  5ESY A;  3G3J A;  4ZEI A;  3VXB A;  3GBB A;  1LLS A;  3KN7 A;  1IQ7 A;  3RPL B;  5DEX A;  5AA2 A;  1EZP A;  2ONR A;  2R9J A;  1DBZ A;  1N3W A;  3CFL A;  2XXQ A;  1I6Q A;  3MUQ A;  4Q0C A;  4P9K A;  3HHG A;  1LEV A;  2OX3 A;  1USY H;  4NF4 A;  2DE4 A;  4X1B A;  4I1D A;  4LN5 A;  4HE0 A;  4HS7 A;  5EHS A;  2CZH A;  3R6U A;  2ZYM A;  5CMM A;  3KOS A;  2Q2C A;  1USY E;  2QS3 A;  4JDF A;  1FPK A;  4F3G A;  5HPQ A;  4FBP A;  2CEX A;  4R74 A;  4M1V A;  1IXG A;  3MZB A;  2I48 A;  4AQ4 A;  4R73 A;  4OFJ A;  4MCO A;  3PUY E;  1PEB A;  3E13 X;  3T9H B;  2X26 A;  2PYY A;  2THI A;  5H8Q B;  1WOD A;  5IZ3 A;  4NF8 B;  4RJZ A;  4LZ7 A;  2B3B A;  1FPJ A;  2NOO A;  4FOR A;  2O7I A;  5H8N B;  3CFX A;  3U94 A;  3TUS A;  2F3B A;  4JBZ A;  2HHM A;  3U72 A;  1FQC A;  3A3U A;  3CG3 A;  3MAM A;  1LAG E;  4QRZ A;  4KXP A;  4PQJ A;  4OVJ A;  3RPW A;  3TTR A;  2I4B A;  1MQI A;  2F3D A;  1VFE A;  3D1R A;  4GWS A;  3IAZ A;  4GWZ A;  2RC9 A;  1F9B A;  1Z7N E;  1UTB A;  1FPL A;  5K2Y A;  4EF2 A;  4UAC A;  4GL8 A;  3PMV A;  3EF7 A;  1QKB A;  1LBX A;  3RTW B;  5I2K A;  5KCJ B;  2CEY A;  1Y3P A;  1FPI A;  3UK4 A;  3FVK A;  4GX4 A;  4QBA A;  2ONK E;  3RUM A;  2XXY A;  2KLF A;  4NF6 A;  1B7H A;  4HW8 A;  3B8B A;  1SPI A;  2ZZV A;  2O1L A;  1EH3 A;  4LQ5 A;  5H8H A;  2I0B A;  4X9T A;  4ECF A;  1FBC A;  3CSG A;  1R6Z A;  2V3Q A;  2QS2 A;  2R8T A;  5BUU A;  4YKJ A;  2H99 A;  4N91 A;  1ELJ A;  2V3U A;  2M8C A;  2CZK A;  4RPO A;  4PFR A;  3RLF E;  5AA3 A;  2Z8F A;  3CRB A;  5IZZ A;  4N8Y A;  3VLW A;  3PUZ E;  5ET8 A;  2WBD A;  3V89 B;  1Y1M A;  4LUB A;  3TOD A;  4I40 A;  4NN3 A;  2RKM A;  3O6H A;  5ITO A;  2HFB A;  3WAF A;  4GWY A;  2O68 A;  2Y7W A;  3FJ7 A;  4X1D A;  2REG A;  3QMF A;  4MNI A;  4KQP A;  4F3S A;  2PVU A;  5KZT A;  5EYG A;  3KN8 A;  4QSE A;  1BTJ A;  1DPP A;  2P2A A;  4FJP A;  3IB1 A;  3OOA A;  1AOV A;  4ND9 A;  1XS5 A;  1BP5 A;  1FBH A;  1VFD A;  3KEI A;  4WXJ A;  4N6D A;  3KC1 A;  4I9D A;  1B6H A;  2I0C A;  3IOW A;  1YPN A;  3SET A;  5AE4 A;  2QFL A;  3RGY A;  1JQF A;  1SYI A;  4RYA A;  5CMC A;  1OVT A;  1FBG A;  2DWI A;  5IM2 A;  2QVU A;  3S4U A;  3VVF A;  3BIH A;  3K1P A;  4JWX A;  3TTL A;  5I57 A;  2XWV A;  1RKM A;  1PB9 A;  5I2N A;  4AB6 A;  1MXU A;  2Q2A A;  4OVT A;  5DEX B;  5AA2 B;  1UTH A;  2UVG A;  3ISP A;  1LBW A;  3KJ7 A;  3O2A A;  3UP9 A;  1M5D A;  1RDZ A;  3MYU A;  4PTK A;  4PE3 A;  4LQ2 A;  4Z0I A;  3IO6 A;  2XWK A;  5FTI A;  4NF4 B;  4NX1 A;  1Q9D A;  4MIJ A;  4N4U A;  1AIV A;  4ELO A;  1BLF A;  4IGR A;  3IL1 B;  2X7P A;  3USD A;  1LFI A;  1S9T A;  4YB7 A;  1LFG A;  3K00 A;  1LB9 A;  3KBZ A;  3KG2 A;  2B4M A;  2DWA A;  3FD3 A;  1FQD A;  4KR5 A;  3EQ1 A;  3TPA A;  4OWD A;  1D9Q A;  3IO4 A;  4GL0 A;  2UXA A;  2O69 A;  4BDN A;  3I3V A;  2DP8 A;  2IA4 A;  1II5 A;  2OWT A;  2DXR A;  3FIR A;  5ITP A;  2V4C A;  1PB8 A;  4EUO A;  4DDD A;  5IZ3 B;  2NUV A;  2HZK A;  1MM7 A;  4MF3 A;  3K02 A;  3OXN A;  1EZO A;  1Y9U A;  2YJP A;  2ZNT A;  4PFB A;  4N17 A;  2RIN A;  1N04 A;  3IB0 A;  5CBR A;  3FXU A;  1NH8 A;  5I5P A;  4QFN A;  4JWY A;  3CFZ A;  4IY6 A;  4JWO A;  2XD3 A;  3RPL A;  3E4R A;  2X7Q A;  2RC8 A;  3E78 A;  4C1T A;  1ZIU A;  1UTB B;  2Y7R A;  4YKK A;  2FHY A;  3I5O A;  1EYK A;  1IMF A;  3KOT A;  1T0K A;  3RNN A;  1B2H A;  1Y1Z A;  1QVS A;  1JET A;  1QGX A;  3G3I A;  3KZG A;  1FTJ A;  3SEW A;  3MZ9 A;  4IO4 A;  1MRP A;  4O94 A;  3B6W A;  5H8H B;  1EZ9 A;  2VD2 A;  2WX9 A;  4N6K A;  3U1O A;  4P3L A;  2QMW A;  4JVC A;  3FVG A;  4ONY A;  2DDK A;  1NNP A;  3FJG A;  3SEY A;  3HCQ A;  3R7X A;  4NF8 A;  2I49 A;  4MMP A;  2Y84 A;  1ZBM A;  4IO5 A;  3W9W A;  1H45 A;  4YKI A;  5H8N A;  1JW1 A;  1O7T A;  4GLI A;  1GV8 A;  3LSX A;  1OVB A;  3ILU B;  3EHS A;  2I6E A;  3U92 A;  1IMD A;  4ZED A;  4H45 A;  3GBA A;  4PFI A;  2VOZ A;  4QSD A;  5B70 A;  2A5T B;  2ZYO A;  2RCA A;  3IJX B;  4GX3 A;  3ZSF A;  1A40 A;  1EU8 A;  1NFT A;  1NH7 A;  2VT5 A;  3FUZ A;  4HTG A;  2DXY A;  3PTY A;  3H03 A;  2BJJ X;  2HXR A;  4DXB A;  3T22 A;  3LV0 A;  4P0G A;  4ZS9 A;  3HST A;  3NOH A;  5KCJ A;  2RF1 A;  5TP9 A;  2H4I A;  3DLN A;  1TFD A;  2ZNS A;  4BDR A;  4P1L A;  2DVZ A;  2KR0 A;  4GQO A;  1INP A;  3T1B A;  4UA8 A;  1LFH A;  2CMO A;  4ZEC A;  2I4C A;  2VGQ A;  2YPN A;  3VVD A;  3KN3 A;  5FBP A;  5I57 B;  1URG A;  3G3K A;  4QFL A;  3S9E A;  5I2N B;  4GX6 A;  2AL4 A;  1UTH B;  4OVS A;  1LAX A;  3TFL A;  1BK4 A;  1XT8 A;  1YAE A;  3QYT A;  5F24 A;  4GWX A;  1Y3Q A;  1DOT A;  4X48 A;  4N07 A;  1N76 A;  1OMP A;  4KD5 A;  4H8J A;  2XXV A;  3IX1 A;  1MM6 A;  2Y5L A;  1MY0 A;  4U21 A;  4AS5 A;  2OZZ A;  1Y3N A;  1VSO A;  1HSL A;  4FAT A;  2Y7I A;  1KA0 A;  2QS4 A;  3G3F A;  2XX9 A;  1TT1 A;  1PC3 A;  4MJO A;  3FXQ A;  5ET6 A;  4R2F A;  4N81 A;  3SER A;  3FZV A;  1N7X A;  1B05 A;  5I56 B;  1CE2 A;  4G61 A;  3U93 A;  1H43 A;  1Y20 A;  4LZ5 A;  3C33 A;  4THI A;  3UGW A;  4OVR A;  1MQG A;  3VLU A;  2V93 A;  3OD7 A;  1B3G A;  4F22 A;  2P0S A;  1MY1 A;  4LON B;  4GBW A;  1S7Y A;  1FTK A;  2HEU A;  5JK4 A;  3T93 B;  1I69 A;  4O7M A;  4R9G A;  4RK9 A;  1FQB A;  2AL5 A;  4U22 A;  1ZMG A;  1G0I A;  3MVY A;  4MHF A;  4OYV A;  4P0I A;  1TFA A;  2OLB A;  3N26 A;  1IXI A;  1FJ6 A;  3MC2 A;  4H8I A;  3FAT A;  1M5F A;  3LR1 A;  3SES A;  4NMY A;  1URD A;  1GGG A;  1XVY A;  4IO7 A;  4OHN A;  2REJ A;  3G3H A;  1DTG A;  1GVC A;  2F8D A;  3O6G A;  1XC1 A;  4C1U A;  2I58 A;  3OO7 A;  2PT2 A;  3PMW A;  1JVY A;  5CM6 A;  2ZYN A;  1MXV A;  3OEK A;  4PE5 B;  2WBB A;  4U1O A;  3CR9 A;  4ELQ A;  1P1U A;  4H5G A;  4ELR A;  4NF0 A;  4DZ1 A;  4KFQ A;  5EQ9 A;  4G68 C;  1B3H A;  3RT6 B;  3JV9 A;  4OMB A;  3LSF B;  4MAG A;  1AL3 A;  1P1W A;  3ONM A;  4OA4 A;  4XIG Q;  3B6T A;  3Q27 A;  1B58 A;  1CNQ A;  1NV3 A;  2F6P A;  4UAB A;  4N15 A;  3VV5 A;  3RTF B;  3T0J A;  1Y4C A;  5H8F A;  1BIY A;  3L6G A;  5I7I A;  4HE2 A;  1B3L A;  3HO7 A;  4R75 A;  1MS7 A;  3ZKL A;  4HCW A;  1JW5 A;  1NUX A;  5EQ8 A;  3L6H A;  5LOM A;  3IFA A;  5IZ1 A;  3T66 A;  4NED A;  1NV6 A;  3LUY A;  4PFU A;  4KYD A;  1LAF E;  1FSA A;  3AXF A;  1K9Y A;  3OO9 A;  2OPE A;  4K3F A;  2FIE A;  4OEV A;  3QUJ A;  1Q1K A;  3PUW E;  2RCB A;  4O8M A;  5TP9 B;  3S9N C;  3MZ1 A;  2B65 A;  1J1N A;  2VPO A;  4ZZE A;  2F7C A;  1NUZ A;  4POW A;  1A54 A;  4QFK A;  2P1S A;  2UVH A;  4PBH A;  1M5C A;  1QUI A;  3N5L A;  1SI1 A;  3OEL A;  3QIM A;  4WED A;  1MH3 A;  1FPB A;  3TQW A;  3VLV A;  4G68 A;  2ALU A;  3T9U A;  3OMB A;  2ZNU A;  4IO6 A;  2HCA A;  2PFY A;  4ZE8 A;  1QUK A;  3O6I A;  4BLA A;  3O28 A;  2I3W A;  4EF1 A;  4RPN A;  3KJT A;  4U2R A;  4IO2 A;  4OXV A;  4QHQ A;  4TQU Q;  2F34 A;  4EXL A;  4NWD A;  4YIC A;  4I3Y A;  2GHB A;  3EKI A;  4NQ8 A;  3G7W A;  1FQE A;  2A5S A;  2F35 A;  2F6G A;  3DEL B;  1FPG A;  3CSB A;  2HAV A;  4XXU A;  3C36 A;  2OBG A;  4IB2 A;  1UIU A;  2ONS A;  1A8F A;  4ZZA A;  4F1V A;  2A5T A;  1ZU0 A;  2JJK A;  5FHM A;  3ECR A;  2QSX A;  1DPE A;  3KGC A;  3SZP A;  3B50 A;  4KYE A;  4FEB A;  1BKA A;  4GD5 A;  3CHG A;  3PPN A;  1B5J A;  4ZE9 A;  2F7A A;  4O3C A;  4TOZ A;  4PFT A;  3BBR A;  2XA5 A;  4GWU A;  3TEP A;  3VE1 B;  3VFJ A;  3W15 C;  4PF8 A;  2HZL A;  1IIW A;  2DYX A;  1LBY A;  4O7I A;  2O6A A;  3OEM A;  1Y4T A;  2UYF A;  3MPL A;  4KYS A;  2ABH A;  4KPT A;  4TLL B;  1TWY A;  1O63 A;  1SDX A;  1MG1 A;  4XKP A;  3TTN A;  1LBB A;  4OEN A;  1MXZ A;  2Y7P A;  5EHM A;  2OWS A;  4FED A;  2XX8 A;  4FAJ A;  2DSF A;  1MDQ A;  1NV7 A;  2QMX A;  5DVF A;  1ATG A;  3LUZ A;  3KFM A;  2D5W A;  4U4X A;  3TEL A;  1H44 A;  4OES A;  3TCH A;  4BDO A;  3IOT A;  4I3E A;  3JZJ A;  3A3C A;  4G8H A;  2D21 A;  3IOU A;  2I3V A;  5DVI A;  5F7V A;  3MBP A;  1QUL A;  2UVJ A;  5I56 A;  2BJI A;  3PV0 E;  5ET7 A;  2QRY A;  5DVJ A;  4XFE A;  3TTK A;  4GWW A;  1R9L A;  1LAH E;  5KDT A;  5K2X A;  1B32 A;  2WYP A;  4GF8 A;  5H8F B;  3K0V A;  1ANF A;  1LCF A;  3VDF A;  4YMB A;  1TXF A;  2QVV A;  2XD2 A;  1JW4 A;  4POX A;  4GVO A;  2DQV A;  4PP0 A;  3PPQ A;  1IUD A;  2B4L A;  2XXI A;  2G93 A;  1P1O A;  2UVI A;  2FIX A;  2F78 A;  4FE8 A;  4DI3 D;  1B7U A;  1ZLQ A;  4DLD A;  5FTH A;  1POY 1;  3PGF A;  1D9V A;  2Q88 A;  3QSL A;  3R26 A;  4GRK A;  4PET A;  4F19 A;  3RN8 A;  5CMK A;  2Z8E A;  4DCY A;  5EYF A;  4PBQ A;  3EHU A;  1VDW A;  4XKQ A;  1YZ0 A;  3IJO B;  1US4 A;  1FPD A;  4WEP A;  3W9V A;  1HSE A;  2F36 A;  4NTL A;  3PD9 A;  1Q35 A;  4H1X A;  4G68 B;  2HQ0 A;  1MPB A;  2O7U A;  2XXR A;  4QF9 A;  2UYE A;  4PC9 A;  3IOV A;  5L9M A;  2Q9T A;  3FVN A;  3PPP A;  3TCF A;  5DT6 A;  1LBC A;  3OSR A;  2AYS A;  5ET5 A;  4QFP A;  1FTO A;  4WKM A;  1B0H A;  1XI6 A;  1PB7 A;  4OER A;  4KHZ E;  4MH5 A;  3RQT A;  4IO3 A;  1RYX A;  3QUF A;  3MP8 A;  3OSQ A;  3SEV A;  1OIB A;  2DS9 A;  2XXP A;  3O97 A;  1NNK A;  4OTE A;  3TDJ A;  5I59 A;  1B3F A;  2V3T A;  3Q26 A;  3O9P A;  3PUX E;  3MJN A;  1IXC A;  3K2D A;  5ICT A;  3CI8 A;  3TYH A;  1FRP A;  2Z8D A;  1FBF A;  1SW1 A;  1A8E A;  4ZEK A;  4OAN A;  3MST A;  2XHD A;  4BDQ A;  4F1U A;  2ZZX A;  1UIV A;  4BDL A;  2IEE A;  3IFC A;  3PPR A;  3F11 A;  3S2V A;  4EQB A;  2G29 A;  3S9M C;  4ELP A;  2WEF A;  2GHA A;  1B3E A;  2RC7 A;  2HXW A;  3U8Q A;  2OWZ A;  4HCY A;  5DYH A;  1MDP 1;  5EQA A;  1I6B A;  2XXK A;  4JVI A;  4OET A;  1O64 A;  2L5V A;  3CIJ A;  5BWJ A;  1KA1 A;  3C9H A;  4TLM B;  3KSJ A;  4U4S A;  4IY5 A;  1AH5 A;  1MY3 A;  3HPI A;  1JP4 A;  2Z23 A;  3IB2 A;  4JB7 A;  3C32 A;  4QSC A;  5H8S A;  3TMG A;  2CZI A;  3BFU A;  3K6U A;  1FQF A;  1I6A A;  2O51 A;  4XKN A;  4KI0 E;  4F3B A;  1N0T A;  2ZMB A;  3DP6 A;  2HAU A;  4OQO A;  4R6K A;  3BKI B;  4PCD A;  2H9B A;  4RK2 A;  4MFI A;  5A5X B;  1NV1 A;  2D3I A;  4F1Y A;  4OZ9 A;  1P1N A;  1OQG A;  3M3K A;  2Y7K A;  4OVP A;  4IGT A;  3LSW A;  3M3L A;  4YKP A;  1LST A;  3DP4 A;  5L9S A;  2DE3 A;  2GFE A;  1N7W A;  3FV2 A;  5KDT B;  4MNC A;  4PGN A;  3Q25 A;  2CZL A;  2QVR A;  1RDY A;  4FEC A;  1N84 A;  2ZYK A;  5TU0 A;  4HXV A;  2FNC A;  1B46 A;  4QXD A;  4NGU A;  1D4N A;  1FCK A;  4HE1 A;  4DIG A;  3UOR A;  4F2Q A;  2XWI A;  2R71 A;  4LP2 B;  4P8B A;  3B7D A;  4YAH X;  3MWB A;  3MP6 A;  4NG7 A;  3FVO A;  3CVG A;  3C31 A;  3Q29 A;  4KCD A;  3JYR A;  3T9V A;  3K4U A;  4JSD A;  2DE2 A;  5ICQ A;  3N94 A;  5CBS A;  5AA4 A;  3SDF A;  1ZKB A;  1B52 A;  1FQA A;  1B7Z A;  3UA8 A;  3DP8 A;  3MPK A;  3MW0 A;  5LTC A;  1FTL A;  1FBD A;  1UQW A;  4YB5 A;  1PBP A;  2PMS A;  1A7L A;  3ODB A;  1IXH A;  3K6X A;  5EQ7 A;  5EYH A;  1VR5 A;  3FGS A;  1IMC A;  2VP1 A;  1ZTY A;  1MPC A;  2XXH A;  4H5F A;  3DM0 A;  1L5T A;  1YXI A;  2H25 A;  5I84 A;  3LSL A;  2XXW A;  5L8D A;  2Q8J A;  3K6V A;  4FIM A;  5FHN A;  2OPD A;  3OEN A;  3K1M A;  4EDP A;  5J1D A;  3IR1 A;  2FYI A;  3C34 A;  4KCC A;  4LA9 A;  5I58 A;  4AB5 A;  2Z22 A;  3UN6 A;  1EYI A;  4XKR A;  1R9Q A;  3N6T A;  4P1E A;  2V25 A;  1EYJ A;  1B5H A;  4GBV A;  2ZXT A;  5I59 B;  3TKD A;  4U23 A;  3PU5 A;  1CB6 A;  3PMX A;  3V83 A;  5I3S A;  1GTK A;  4JVD A;  4PFW A;  1OLA A;  1NV2 A;  3C4M A;  4O3A A;  3H6T A;  2QPQ A;  4F39 A;  2OK2 A;  1MY2 A;  1DMB A;  3E9X A;  5JTY A;  1OQH A;  3TQL A; 
#chains in the Genus database with same CATH homology
 3LUZ A;  4IR8 A;  4MX6 A;  3FBP A;  1IMD A;  4H45 A;  4I3E A;  4PFI A;  1IMB A;  1YYZ A;  4N8G A;  2BJI A;  3ROJ A;  1FBP A;  5ESY A;  5ET7 A;  1NV0 A;  4GX3 A;  4XFE A;  2PFZ A;  4GWW A;  2VT5 A;  3RPL B;  3PTY A;  1DBZ A;  1LBV A;  2HXR A;  2WYP A;  3LV0 A;  4MEV A;  3NOH A;  4P9K A;  1LEV A;  2OX3 A;  2F5X A;  4P1L A;  2DE4 A;  2DVZ A;  4LN5 A;  2QVV A;  2KR0 A;  1INP A;  3T1B A;  4HE0 A;  2CZH A;  1FPK A;  2B4L A;  5FBP A;  2FIX A;  4FBP A;  5LDZ A;  2CEX A;  4M1V A;  4GX6 A;  4DI3 D;  4X04 A;  4OVS A;  4MCO A;  1BK4 A;  5F24 A;  4GWX A;  4PET A;  4F19 A;  4PBQ A;  1VDW A;  2Y5L A;  5IZ3 A;  1YZ0 A;  1FPD A;  3W9V A;  4AS5 A;  1FPJ A;  1KA0 A;  2F3B A;  2HHM A;  3HFU A;  4MJO A;  4PC9 A;  3KC0 A;  5ET6 A;  2ZZW A;  4N81 A;  1KZ8 A;  1G0H A;  4KXP A;  2Q9T A;  2Q8M A;  4F18 A;  2F3D A;  4G61 A;  1AWB A;  4PDH A;  1RDX A;  3D1R A;  4GWS A;  4GWZ A;  2XWO A;  4OVR A;  5ET5 A;  4NAP A;  1FPL A;  1XI6 A;  4XF5 A;  2HPG A;  4YZZ A;  1LBX A;  4GBW A;  4XEQ A;  2CEY A;  5JK4 A;  4O7M A;  1FPI A;  2PCR A;  4GX4 A;  4QBA A;  1G0I A;  1SPI A;  3B8B A;  2ZZV A;  4MHF A;  1FJ6 A;  4X9T A;  1FBC A;  1FRP A;  2P3V A;  2V3Q A;  2R8T A;  1FBF A;  4N91 A;  4OAN A;  2CZK A;  3MST A;  4PFR A;  4F1U A;  2ZZX A;  5IZZ A;  3IFC A;  4N8Y A;  5ET8 A;  2WBD A;  2WEF A;  5A5L A;  3U65 A;  4P47 A;  4I40 A;  2FVZ A;  1FBE A;  2OWZ A;  4HCY A;  4NN3 A;  5CM6 A;  5EQA A;  2WBB A;  2XXK A;  4JVI A;  4GWY A;  1DCU A;  2L5V A;  1LBZ A;  1KA1 A;  4NF0 A;  3BIG A;  3QMF A;  5EQ9 A;  4MNI A;  5EYG A;  3A29 A;  4MAG A;  1JP4 A;  4OA4 A;  1CNQ A;  2VPN A;  1NV3 A;  2CZI A;  1FBH A;  4UAB A;  4N6D A;  1NV5 A;  3KC1 A;  4N15 A;  1NV4 A;  1NUY A;  3T0J A;  5I7I A;  4HE2 A;  4PCD A;  2QFL A;  1FBG A;  4PAI A;  4HCW A;  1NV1 A;  2Y5K A;  5IM2 A;  1NUX A;  2QVU A;  3BIH A;  5EQ8 A;  3IFA A;  5IZ1 A;  1K9Z A;  4PDD A;  3GYY A;  2XWV A;  4OVP A;  1NV6 A;  3RYD A;  1FTA A;  1FSA A;  1K9Y A;  4OVT A;  2P3N A;  2FIE A;  3ISP A;  1LBW A;  2DE3 A;  4MNC A;  1RDZ A;  3MYU A;  2MKZ A;  4PGN A;  2QVR A;  4PTK A;  1RDY A;  4PE3 A;  4O8M A;  2XWK A;  4PAK A;  1IMA A;  2VPO A;  4HXV A;  4NX1 A;  1Q9D A;  1NUZ A;  4QXD A;  4MIJ A;  4N4U A;  4NGU A;  4PBH A;  1FPB A;  4HE1 A;  2XWI A;  1FPF A;  4P8B A;  3KBZ A;  4NG7 A;  2B4M A;  2PFY A;  3FXB A;  1D9Q A;  2DE2 A;  2WYK A;  2V4C A;  4YIC A;  4I3Y A;  4P56 A;  4PGP A;  3EKI A;  4NQ8 A;  5IZ3 B;  5IGA A;  2HZK A;  4MNP A;  5LTC A;  5DW8 A;  1FPG A;  1FBD A;  3E79 A;  4H46 A;  4PFB A;  4N17 A;  1DK4 A;  4F1V A;  5EQ7 A;  5EYH A;  5I5P A;  2JJK A;  1IMC A;  1IME A;  2FBP A;  5T3J A;  3SZP A;  3B50 A;  1YXI A;  3RPL A;  1NUW A;  3CHG A;  3E78 A;  2Q74 A;  4PAF A;  2FHY A;  2XA5 A;  1EYK A;  1IMF A;  4GWU A;  5J1D A;  4NHB A;  1QGX A;  1EYI A;  4PF8 A;  4P1E A;  1EYJ A;  1FJ9 A;  4GBV A;  1FPE A;  2HZL A;  4DI4 B;  5J16 A;  1LBY A;  4O7I A;  4OVQ A;  4O94 A;  5I3S A;  4PF6 A;  2WX9 A;  4N6K A;  4JVD A;  4P3L A;  2KQZ A;  4JVC A;  2DDK A;  1NV2 A;  2QPQ A;  4X8R A;  1NI9 A;  4AS4 A;  4MMP A;  1NV7 A;  3W9W A;  2GQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...