4I3YA

Crystal structure of staphylococcal inositol monophosphatase-1: 100 mm licl soaked inhibitory complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
264
structure length
264
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mssa476
total genus 76
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i3yA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i3yA02
1IMEA 5J16A 2FVZA 4G61A 2FHYA 4HXVA 4IR8A 4GBWA 1K9YA 1FPBA 4H45A 3LV0A 1FBPA 1EYIA 2DDKA 2WEFA 2OX3A 5EQAA 1LBVA 1INPA 1VDWA 4HE2A 3KC0A 2WBDA 5EQ9A 1FJ6A 1FPDA 2WBBA 4QXDA 1FTAA 2BJIA 5FBPA 1LBYA 1RDXA 3FBPA 2HHMA 2QVUA 2FIEA 1JP4A 1FPIA 1G0IA 1EYKA 4N81A 5I3SA 3IFAA 3RYDA 5EYHA 1RDYA 1Q9DA 4GWSA 5T3JA 4I3EA 4H46A 1NV3A 5ET6A 5ESYA 1SPIA 2CZHA 1NI9A 5ET7A 3LUZA 1YZ0A 1IMCA 2CZKA 2F3BA 1QGXA 3KBZA 1DBZA 1DK4A 3KC1A 4GX3A 3D1RA 3RPLB 5DW8A 3ROJA 1KZ8A 4GWUA 1XI6A 1NUXA 1IMAA 1K9ZA 2P3VA 3IFCA 1NV2A 5LDZA 3BIGA 1LBXA 4FBPA 2Y5LA 2Y5KA 1FPGA 1NV0A 1D9QA 1FBHA 1FPEA 2PCRA 5ET5A 2FBPA 3BIHA 1NUWA 5IZ3A 1CNQA 2QFLA 1KA0A 1FBFA 1NUZA 1FPJA 1FBEA 4MJOA 1KA1A 4I40A 1NV1A 4GX4A 1FBDA 4GWXA 1AWBA 1IMFA 4HE0A 1LBWA 2Q74A 1YXIA 2P3NA 4PTKA 2F3DA 1NV7A 4GWYA 1EYJA 1NV5A 1NUYA 4GWWA 1FBGA 3B8BA 5IZ3B 5EYGA 5A5LA 4KXPA 3T0JA 2OWZA 1LBZA 4AS5A 4I3YA 1NV4A 2QVVA 2VT5A 1LEVA 2FIXA 2R8TA 2QVRA 5F24A 3QMFA 1DCUA 5EQ8A 2GQ1A 4HE1A 4GBVA 5EQ7A 4O7IA 1YYZA 1IMBA 1FBCA 1FPKA 2JJKA 2Q8MA 4GX6A 1BK4A 3A29A 5IZ1A 1RDZA 5ET8A 4GWZA 1FJ9A 1FSAA 1NV6A 1IMDA 1FRPA 2CZIA 1FPLA 1FPFA 3RPLA 1G0HA 4AS4A
chains in the Genus database with same CATH superfamily
3MUQA 3Q26A 3KN8A 2HAVA 1CE2A 2O6AA 3OO9A 3TTMA 1MQDA 3Q29A 4ECFA 3K0VA 4OWDA 5H8HB 5EQ9A 1B3EA 1D9YA 3MP1A 4IGTA 3F11A 4POWA 2QVUA 1MQIA 4OMBA 2NUVA 4GXSB 3CFLA 4H46A 3FJGA 5H8QA 1ZLQA 4PBQA 4C1UA 1MM6A 4FATA 1GV8A 3KJTA 1URSA 5ELVA 4PP0A 3N94A 4RYAA 3G3HA 2P3VA 4BLAA 4MNIA 4LZ8A 1FQFA 2ONSA 3IORA 3RPWA 3ZKLA 1KA0A 4H67A 4I40A 1JQFA 2XXWA 1F9BA 2ABHA 1PBPA 2ONKE 5I58B 4R74A 1S7YA 2H98A 5EYGA 1B52A 4QHQA 3MPKA 4GL8A 5I59B 4I3YA 4AB5A 3EHUA 2XD2A 2PBWA 4P56A 4ZZAA 3GZGA 4RY1A 4MH5A 2H5YA 3PMXA 4OFOA 1MQHA 1VE4A 1B6HA 1IQ7A 4GOTA 4N6KA 4KHZE 4PFRA 4FORA 3U94A 3T66A 1TFDA 1XOCA 3TMGA 4X1DA 1H45A 3FVKA 5A5XA 1DTGA 4HCYA 1NNTA 3KC0A 3Q27A 1MXWA 2ZMBA 5JTYA 3MZBA 3T93B 1P1OA 3LR1A 2LAOA 3SEXA 2F8DA 2XXPA 3BBRA 2HZLA 3K4UA 3IFAA 1P99A 4PETA 1LCTA 1Q9DA 3HHFA 4MLVA 4XEQA 1NV3A 2PMSA 4KR5A 1H3DA 1OIBA 5HBCA 1MXUA 2F78A 4X1BA 2DVZA 1I6QA 4YU0A 3SETA 1PB7A 3PUWE 4DZ1A 2H25A 4OTEA 2H99A 3K00A 5CRYA 1D9QA 3LSXA 3NOHA 5AA1A 4OERA 4MJOA 1KA1A 2ZNTA 3KJ7A 3MYUA 4GWXA 1N3XA 3K2DA 4JWXA 3A3CA 3U8QA 4N4UA 4MX6A 4P0GA 2L5VA 2I3WA 4O8MA 5KZTA 1Q1KA 1FTLA 4P1EA 3C31A 1PB9A 5EQ7A 2A5TB 4F1VA 3DELB 3VVFA 1OVTA 2B3FA 4YKPA 4DI4B 1RDZA 1IMDA 5EYFA 1FRPA 4NF8A 1MDP1 4NN3A 1ZJLA 2VGQA 1MM7A 4JBZA 4GWOA 5JEIA 1A8EA 1EYIA 5FHMA 4LZ5A 1VDWA 4KCCA 4G77A 4HE2A 4YKJA 4IY6A 1Y3PA 4XKPA 1MPCA 2F7AA 1SW1A 3CG1A 3U1OA 4ZE8A 2DE2A 3T22A 1EYKA 3RYDA 1US4A 5H8NA 3KFMA 3S2VA 3TELA 4GX3A 1UTHA 1HSEA 2F6GA 2QJEA 1IXGA 4O3BA 2R6GE 3MW0A 5AE4A 2O51A 5ET5A 3FXQA 1NUWA 2WKYA 4RK2A 1P1NA 3E9XA 3CR9A 3TZAA 1UIVA 2F5XA 4R6HA 1M5DA 2X7QA 2I0CA 4EQBA 1EH3A 1Y3QA 2THIA 4YKIA 3FVOA 1FBGA 3ILTB 3U93A 3TKDA 5KCJB 3V89B 4GD5A 2Q2CA 4ZEBA 4LVQA 3SKPA 1Y20A 4IO2A 4F1YA 2G29A 1LAGE 3O6HA 1SI1A 4QFKA 4GBVA 4M1VA 2GHBA 3KSXA 1B3GA 3B7DA 1NV6A 2ZNSA 2I6EA 3RUMA 4KYSA 5H8HA 1M5FA 3K1PA 1H43A 4R73A 3TCGA 2AL5A 3ONMA 4G8MA 1ZTYA 1NMUA 3LUYA 3ZS6A 4G8HA 1J1NA 4QSCA 1M5CA 1NNPA 1AIVA 4KPTA 2BJJX 3LSWA 3C36A 3PPNA 4MLQA 4NQ8A 4OFLA 1LCFA 2UVJA 4ND9A 1B0HA 1MS7A 4I9DA 4PE5B 2XWIA 4OHNA 4DI3D 5ET6A 3PD9A 2KR0A 4HCWA 4NF5B 3UN6A 1PB8A 4O94A 4EF2A 4ELRA 3E3KA 2PX1A 4OEVA 5TU0A 5CMBA 4R6YA 4BDMA 3IFCA 2ZZWA 3THIA 1LBXA 4NF6A 3HPIA 2Y5KA 1VFEA 5DTBA 1B58A 2OLBA 1FPGA 3TODA 2FA7A 2ZYMA 3K02A 2QFLA 3RNNA 4BDLA 3IJXB 1P1UA 1FBEA 5I59A 3CSGA 2RC7A 1AWBA 1LBWA 3CFZA 4PGPA 1HSJA 3MSTA 3TUSA 3UGWA 4N6DA 1NUYA 4U4XA 5IKBA 2HXRA 1ELJA 3SEWA 1OVBA 1B51A 2GH9A 3UP9A 2QVRA 4HTGA 4Q30B 4QBAA 4NMYA 2ONRA 1ZU0A 5EQ8A 3R7XA 4O7IA 1LSTA 1DOTA 3E78A 5ITPA 1URDA 4JVDA 1I69A 4TOZA 1FTMA 2CZLA 4N6PA 2XXHA 1XT8A 3IB0A 2AYSA 3FUZA 1A99A 4R72A 3EN3A 1LB9A 4F3PA 2WBDA 2HXWA 1FPDA 3SDFA 1WDNA 1QUKA 5FBPA 1R1NA 5FHOA 4ZDMA 1FTKA 2V93A 1D3KA 1LGBC 3IOTA 4ESWA 2XD3A 4MFIA 3C9HA 4YKKA 1NI9A 4HS7A 1YZ0A 4OZ9A 4NF8B 4AB6A 1DTZA 4N07A 4YAHX 1ATGA 1PEBA 3KZGA 1NKXA 2RF1A 3PPRA 2DXYA 3Q25A 4XKRA 1NV1A 2AL4A 5I56A 1O64A 4ZEFA 2O1LA 2O84X 4WEDA 1JW5A 4NF0A 1SDXA 3CSBA 4JWYA 4H8JA 2I58A 4BDRA 4ELQA 2A5TA 2GFEA 4AS5A 3FXBA 2PYYA 2OPEA 5KDTB 4Z0IA 4LATA 2VT5A 4GVOA 3MVYA 2Y84A 3PV0E 1UTHB 1XC1A 3OO6A 1A55A 4X9TA 1MQGA 2ZNUA 1FBCA 4FE8A 1H76A 4F18A 3A29A 3M3LA 1FPLA 3RPLA 1B3FA 3IK6B 2Y7IA 1SI0A 4MHFA 3RGYA 3PD8A 3K6XA 3RT6B 1MXYA 1SYIA 4R75A 1MH4A 3OELA 4HW8A 2WBBA 4QXDA 1FTAA 4TLLB 3T9XB 1II5A 1IEJA 3FBPA 3OSQA 1TWYA 4Q8RA 3PMVA 3OEKA 5DVFA 3O97A 3HV1A 4FAJA 4YMBA 1T0KA 2D21A 1LFGA 1VSOA 1CB6A 3N6TA 3V5AA 5CBRA 1PBQA 2VHAA 4LUBA 2CZKA 3EPEA 3KC1A 4FECA 2XX9A 1WVJA 1YTVA 5CC2A 2QS2A 1KWHA 4P3LA 4LZ7A 1DPPA 1Q35A 3LC8A 5I2NA 1MXZA 4OVQA 1NV0A 1SW4A 4Q5TA 4E0WA 5KCJA 2F6PA 4IO4A 3D4CA 3H6UA 3IR1A 3VDFA 3K1NA 1B0LA 3O6IA 4KXPA 3RTWB 3VXCA 1JW1A 3B50A 1LEVA 2PFYA 5L9OA 2OBGA 1XVXA 3HN0A 5IZZA 1OLAA 4GX6A 2UVIA 4MNPA 4NF6B 2O69A 3KOTA 3UIFA 1PDAA 2I4CA 3OO8A 4OA4A 2CZIA 2HPGA 4N91A 1MG1A 1NH7A 4AQ4A 1LB8A 3PPOA 3ISPA 1N7XA 3FJ7A 2UYEA 3KSJA 3KG2A 3MC2A 3B6QA 2QL3A 3M3KA 4F3GA 1EZPA 2BJIA 4NF5A 4PDHA 3T9UA 1GTKA 3QSLA 3E4RA 3FV1A 4U23A 3E79A 3I3VA 1DPEA 2CZHA 4G68C 4BDNA 4YB7A 1B4HA 2OZZA 2PVUA 2Z8DA 3T9HB 4THIA 1B1HA 2AIXA 2Y7PA 4PBHA 4F2QA 3O29A 1D4NA 2HAUA 1MXXA 4QFNA 5AA4A 3Q28A 2Y5LA 1FBHA 3BIHA 1LFIA 3SESA 4H0WA 2XXKA 4U21A 2KLFA 3G7WA 2P2AA 4F22A 4POXA 2I0BA 1LBCA 3I5OA 3JYRA 4PF8A 1XVYA 1UTBB 2I4BA 2DQVA 4OANA 2PFZA 2F35A 3HCQA 4IY5A 2JJKA 3HFUA 3ZKKA 2QRYA 3KN7A 5EHMA 1FPFA 2RC8A 4NE4A 3TQWA 4N15A 3G3KA 1IMEA 3OSRA 4R6KA 4G61A 5I56B 1K9YA 1FPBA 1QVSA 4ESXA 3USDA 2XWVA 2ZXTA 3W9WA 1FBPA 1SVXB 4DE8A 1FCKA 1FJ6A 3HHGA 2Q9TA 1LBYA 1VR5A 1A8FA 4KYDA 2F7BA 3QYTA 1B46A 5EYHA 1RDYA 2NWJA 4YMAA 4EF1A 3OOAA 5I57A 3O9PA 3LUZA 5J1DA 1IMCA 2F3BA 3H4ZA 4H1XA 5DVJA 1DBZA 3RPLB 3EF7A 1XI6A 3GXAA 2W7YA 5LDZA 4FBPA 3S9LC 2XXUA 4P0IA 2XXIA 5KDTA 3GYYA 5DT6A 1MH3A 2QS3A 1NFTA 3SERA 3I6VA 2GHAA 1MDQA 3S9NC 3MVZA 5F1QA 3MJNA 3QUFA 2OWZA 1LBZA 4G8NA 4FEDA 1LFHA 3MP6A 5I7IA 3K6VA 2QVVA 3MZ1A 3TQLA 3KBRA 3H06B 2Q2AA 3MVWA 5DYHA 3CVGA 2XXRA 1R9QA 1S50A 2O7IA 1B7HA 3DP6A 4QF9A 3BFTA 2Z8FA 3UORA 5I2NB 5IZ1A 2NVUB 3FXUA 3QK6A 1I6BA 1POY1 4NG7A 2VD3A 4GQOA 2B65A 3TYHA 1AOVA 3DP4A 4H45A 3ECRA 3H3GA 1INPA 3IO6A 5ICTA 2I48A 2NXOA 1P1WA 2UVGA 2HQ0A 4PQJA 4PGNA 3FJMA 4RJZA 4N81A 4BDOA 1SW5A 4GWSA 2PT2A 4KCDA 1IZ1A 3SEVA 2D5WA 1N04A 3KOSA 4IO5A 1QUIA 4GWUA 3PUZE 3QXMA 3AXFA 3K6UA 3FASA 1Y3NA 4JDFA 1D9VA 4U22A 3PUVE 5CMMA 2RKMA 5M2VA 3FXRA 1MXVA 2V3UA 1FPJA 1IUDA 3LBSA 1FBDA 2XWOA 2Z8EA 5TPAB 5AA2D 1YXIA 3H6WA 2O68A 3S9EA 4GWWA 1ZBMA 5B70A 4NGUA 5FHNA 1MY1A 1NV4A 1QKAA 4EQ7A 1N84A 1PC3A 4XF5A 1GR2A 2R8TA 3H03A 3O66A 5F24A 1TT1A 1YYZA 3KGCA 3H7MA 5AA4B 4LQ2A 4OYVA 1URGA 1QULA 2KQZA 3PPQA 4DLDA 2UVHA 1Y9UA 5DVIA 4GRKA 2H9BA 2RC9A 4DIGA 2Z23A 1FQBA 3VFJA 4DXUA 4PAFA 4RPNA 1H44A 2IEEA 1N0TA 4PC9A 4P1LA 3PMWA 4OFJA 4F3BA 1MY2A 1MY0A 5CMCA 5T3JA 4O3AA 1I6AA 5JK4A 3WAFA 2CMOA 2OCUA 4WXJA 4PE3A 3VLWA 1B40A 1QGXA 2FNCA 3OXNA 2ZZVA 5I5PA 1OQHA 1AMFA 1N3WA 2X26A 3UA8A 3G3IA 5AA2A 1MRPA 4F19A 3RTFB 2P3NA 4X48A 3VXBA 4GWYA 1UTBA 1EYJA 1GVCA 4PAIA 3QAXA 5ICQA 3MP8A 5H8FA 2DYXA 4C1TA 5I57B 3TPAA 1FQEA 1QKBA 1Z7ME 4MBPA 4KD5A 4GXAA 3MWBA 3IJOB 4HE1A 3OENA 1QJMA 1LLSA 1A54A 3MZ9A 4OETA 5ET8A 2H4IA 2UXAA 2DS9A 4O7MA 4ELPA 4LN5A 1OLCA 3MVXA 3IB2A 3EHTA 2V25A 3TCHA 4PDDA 1B5HA 4PFIA 3T96B 2WX9A 5IM2A 5H8SA 3M8UA 1BLFA 1MY4A 1EU8A 4UA8A 2OX3A 3U72A 4NHBA 3QIMA 4F39A 1B2HA 1IITA 3H6TA 3G3JA 4F2OA 5I3SA 2O1MA 3ILUB 5I2KB 4NWDA 3C35A 4EXKA 4FJPA 3HO7A 4U1ZA 4G2ZA 2Q88A 1POTA 4MAGA 4ZEIA 1NUXA 1IMAA 1R6ZA 1ANFA 3TCFA 2V3TA 2XA5A 2PCRA 1CNQA 2A5SA 3CHGA 1NUZA 3B6TA 1MPDA 4XXUA 2QS4A 2VOZA 1MPBA 1OQGA 3SEYA 3VVDA 1JEUA 5IZ3B 3OEMA 2QS1A 2RCBA 2F97A 4U4SA 4BDQA 1IXCA 3IB1A 5L8DA 2HZKA 3CI8A 4ZS9A 3PTYA 2Q89A 3VE1B 5TP9B 3N26A 5HM4B 4GWZA 1FJ9A 3A09A 2CEYA 1NNKA 4QSEA 5J16A 1FW0A 2VD2A 1BP5A 4F29A 2O7UA 4IR8A 1XHYA 1TXFA 1YPNA 3VV5A 1Y4CA 3GBBA 3KN3A 4X04A 1TFAA 2V84A 4P11A 1GGGA 1LBBA 4L17A 3O28A 3DLNA 2VP1A 2V3QA 5FTIA 2DXRA 1JP4A 5F7VA 1FTJA 4MEVA 1B3LA 3H6VA 1B32A 4ZEDA 4I3EA 3R6UA 1SPIA 4XKNA 3S9MC 4I8CA 3IOVA 4GIZA 3D1RA 1N76A 4R9GA 4O3CA 2M8CA 1Z7NE 1K9ZA 3O2AA 3FV2A 5TPAA 2Z22A 2HFBA 4XIGQ 1SYHA 3FD3A 1A7LA 3N5LA 4KFQA 4GX4A 2P1SA 4NAPA 3RY3A 4ZEKA 1IMFA 4PTKA 3U65A 4DDDA 1NV5A 5A5LA 4OENA 4NF4A 2Q8JA 4I62A 1IXHA 4LA9A 4U2RA 4UACA 3HSTA 4QFPA 3IOWA 4G4PA 2XHDA 1BK4A 1SD3A 4MMPA 1AH5A 3OMBA 1B7UA 5AA2B 2D3IA 3K01A 3MPLA 2X7PA 1JNFA 2OK2A 3N6UA 2I49A 1LAXA 3SZPA 3CFXA 3LV0A 2B4LA 1O7TA 2DWHA 2DDKA 2WEFA 5H8FB 1LBVA 4N17A 4GLIA 4LQ5A 4F3SA 3K1MA 3IL1B 4OVJA 3BFUA 4QSDA 1JVYA 3IX1A 4PAKA 2DP8A 2I3VA 4H6DA 2XWKA 3FZVA 3E13X 3PUYE 4YZZA 1B4ZA 1DK4A 2XXTA 1ZIUA 1B5JA 1FQAA 1ZKBA 1Y1MA 4JSOA 1US5A 3WAEA 4ZZEA 4OESA 4PFYA 4RK9A 3EKIA 4QFOA 3A3UA 4IO7A 4G68A 2REJA 2XXQA 1YAEA 3CG3A 5FTHA 1JETA 1VFDA 3B8BA 1USYH 4UABA 3GBAA 4KQPA 3TAJA 4P47A 4TLMB 4WEPA 4K3FA 5IAIA 1MY3A 4JVIA 1O63A 2DE3A 3QMFA 5DEXB 4FIMA 1DCUA 3PGFA 4JXIA 2VPNA 1IMBA 4PFWA 3TDJA 3L6HA 4IB2A 2OWTA 4AS4A 2P0SA 3C32A 5CI5A 1S9TA 4C0RA 2FVZA 4FEBA 4GFRA 5I84A 2FHYA 1IIWA 4HXVA 4GBWA 4OXVA 4JWOA 5CBSA 4WKMA 4ISUA 1AL3A 3C4MA 3O6GA 3T9VA 5EQAA 1RYXA 5I2KA 4GL0A 1B9JA 2NOOA 3V8XB 4P9KA 4NX1A 2ANJA 2WYKA 1FPIA 2CEXA 4EUOA 5AA3A 2OPDA 2YJPA 4IO3A 4IO6A 1LAHE 4EQ9A 2RCAA 2OJTA 3KBZA 2F7CA 4RA1A 5DW8A 4EDPA 5CMKA 4ELOA 3QUJA 4PFUA 2R71A 1SW2A 1SQYA 3BIGA 3IO4A 5LOMA 4YB6A 3T1BA 5H8QB 1FPEA 5IZ3A 4RXLA 1XS5A 1FBFA 1JVXA 3L6GA 3M3FA 1B5IA 3RQTA 3KEIA 3ODBA 3TTRA 3LSLA 4JVCA 3C33A 4ONYA 2ZZXA 1WODA 4H5GA 5ITOA 4Q0CA 3RT8A 4OVTA 3R26A 2QPQA 3K6WA 3OD7A 5BWJA 3FVNA 5TP9A 2FIXA 1USYE 3W15C 4DCXA 1FPKA 3VLUA 5BUUA 4F1UA 4OQOA 1BTJA 3PPPA 1Y1ZA 4YICA 2B4MA 2DOJA 1G0HA 4KYEA 4RPOA 2YPNA 4OVPA 4X8RA 1B05A 1B3HA 2F36A 4H5FA 4F31B 3PU5A 2V4CA 1L5TA 3BKIB 2PT1A 3LSFB 4P8BA 4ZECA 3VLVA 3G3GA 1NL5A 4NF4B 4MF3A 2HEUA 3CIJA 1N7WA 5IGAA 4H65A 5I58A 2FIEA 3TTNA 4N8GA 5A5XB 1G0IA 1A40A 2DWIA 2E1SA 2E0SA 1BKAA 3G3FA 5JTYB 5CM6A 2R9JA 2YLNA 1YCJA 3EQ1A 1SBPA 1M5BA 4R9FA 2ZYKA 2ESNA 3TEPA 2QMWA 3UK4A 2DWAA 1FTOA 2XX8A 1DSNA 3FATA 5LTCA 2OWSA 1M5EA 2VPOA 4H8IA 1JW4A 2ALUA 4QRZA 2Q74A 4R2FA 1NV7A 4DXBA 3JZJA 3PUXE 2GRVA 2XXYA 5HPQA 2G93A 4PFBA 1EZOA 4XKQA 4NTLA 4MIJA 4EXLA 2FYIA 4OEUA 3SEUA 2RINA 2Y7KA 1QUJA 4LONB 1FQDA 5L9SA 4U1OA 2Y7WA 5ISUA 4PCDA 1NH8A 3CRBA 2UYFA 3TFLA 4I1DA 3V83A 2WYPA 4JSDA 2Q8MA 4IGRA 1Y4TA 3EHSA 5L9MA 2F34A 3RN8A 2DWJA 3VVEA 1BIYA 4JB7A 2QMXA 4G68B 4RNSA 3DP8A 3GLBA 1DMBA 2Y7RA 3MBPA 3MQ9A 4DCYA 4N8YA 1RKMA 4QFLA 3TTLA 4MCOA 4PF6A 2QSXA 3P7IA 4R2BA 3FGSA 1RDXA 4DXCA 2ZYNA 2HHMA 4NEDA 2DVCA 2MKZA 4OVRA 5B7DA 5EHSA 5ESYA 2HCAA 4TQUQ 4YB5A 5ET7A 4M4GA 3FVGA 4MNCA 2XX7A 3ZSFA 3ROJA 1KZ8A 2ZYOA 5H8NB 4XTCQ 1NV2A 1HSLA 3S4UA 3W9VA 3RLFE 4XFEA 1UQWA 2FBPA 1R9LA 4N13A 1ZMGA 3D4GA 1RYOA 3JV9A 4HE0A 1P1QA 3FIRA 1OMPA 2XXVA 4KI0E 2F3DA 1IXIA 1QW0A 5DEXA 2IA4A 4ZE9A 5K2YA 1B7ZA 5K2XA 3T0JA 4LP2B 1B1XA 1NNFA 3OO7A 3IOUA 2DE4A 3C34A 2REGA 3MAMA 2XXXA 4OVSA 1FQCA 4E0XA 2GQ1A 1LAFE 4GF8A 1JEVA 4PFTA 2B3BA 3U92A 4Z7EA 3DM0A 1FSAA 3B6WA 3IAZA 3TTKA 4NWCA 1EZ9A 2DSFA 1MQJA 1UIUA
chains in the Genus database with same CATH topology
3SZPA 4H45A 3LV0A 2B4LA 2DDKA 2WEFA 1LBVA 1INPA 2WBDA 5EQ9A 1FPDA 4N17A 5FBPA 4PGNA 2QVUA 4N81A 4PAKA 4GWSA 2XWKA 4H46A 1NI9A 4PBQA 4YZZA 1YZ0A 1DK4A 4GWUA 2P3VA 4MNIA 3EKIA 1KA0A 1FPJA 4I40A 1NV1A 1FBDA 2XWOA 1YXIA 4NF0A 4GWWA 3B8BA 5EYGA 4UABA 4NGUA 4AS5A 4P47A 4I3YA 1NV4A 3FXBA 4XF5A 2VT5A 4P56A 2R8TA 4JVIA 5F24A 2DE3A 3QMFA 1DCUA 4X9TA 2VPNA 1YYZA 1IMBA 1FBCA 4F18A 3A29A 1FPLA 3RPLA 4AS4A 2KQZA 2FVZA 4N6KA 4MHFA 4PFRA 2FHYA 4HXVA 4GBWA 4HCYA 5EQAA 3KC0A 4PAFA 2WBBA 4QXDA 1FTAA 4P9KA 4NX1A 3FBPA 4PC9A 4P1LA 2WYKA 1FPIA 2HZLA 3IFAA 2CEXA 4PETA 1Q9DA 5T3JA 5JK4A 4XEQA 1NV3A 4PE3A 3KBZA 2CZKA 1QGXA 3KC1A 2ZZVA 5DW8A 5I5PA 2DVZA 4P3LA 3BIGA 3T1BA 4OVQA 1NV0A 1D9QA 1FPEA 3NOHA 5IZ3A 1FBFA 4MJOA 1KA1A 3MYUA 4F19A 4GWXA 2P3NA 4JVCA 4GWYA 1EYJA 2ZZXA 4PAIA 4KXPA 4N4UA 4OVTA 4MX6A 2QPQA 3B50A 2L5VA 1LEVA 2FIXA 4O8MA 2PFYA 4P1EA 4HE1A 5EQ7A 5IZZA 1FPKA 4GX6A 4F1VA 4MNPA 4F1UA 4DI4B 1RDZA 5ET8A 1IMDA 1FRPA 4YICA 4O7MA 4OA4A 2B4MA 2CZIA 2HPGA 4LN5A 4N91A 1G0HA 4OVPA 4X8RA 4NN3A 2V4CA 4PDDA 4PFIA 4P8BA 2WX9A 3ISPA 5IM2A 1EYIA 2OX3A 1VDWA 4NHBA 4HE2A 2BJIA 4PDHA 5IGAA 2FIEA 4N8GA 1G0IA 2DE2A 1EYKA 5I3SA 3RYDA 3E79A 5CM6A 2CZHA 4GX3A 4MAGA 4PBHA 1NUXA 1IMAA 2Y5LA 2XA5A 1FBHA 5LTCA 2PCRA 5ET5A 3BIHA 1NUWA 2VPOA 1CNQA 3CHGA 1NUZA 2XXKA 2F5XA 2Q74A 1NV7A 1FBGA 4PFBA 5IZ3B 4MIJA 4PF8A 2HZKA 4PCDA 4OANA 4GBVA 2PFZA 4M1VA 2WYPA 2JJKA 2Q8MA 3PTYA 3HFUA 4GWZA 1FJ9A 1NV6A 2CEYA 1FPFA 4N15A 1IMEA 5J16A 4G61A 4IR8A 1K9YA 1FPBA 4X04A 2XWVA 3W9WA 1FBPA 4N8YA 1FJ6A 4MCOA 4PF6A 2Q9TA 1LBYA 2V3QA 1RDXA 2HHMA 1JP4A 2MKZA 4MEVA 4NQ8A 4OVRA 5EYHA 1RDYA 4I3EA 2XWIA 4DI3D 5ET6A 5ESYA 1SPIA 5ET7A 2KR0A 3LUZA 4HCWA 5J1DA 4O94A 1IMCA 2F3BA 4MNCA 1DBZA 3RPLB 3D1RA 3ROJA 1KZ8A 1XI6A 1K9ZA 3IFCA 2ZZWA 1NV2A 5LDZA 3W9VA 1LBXA 4FBPA 4XFEA 2Y5KA 1FPGA 2FBPA 2QFLA 1FBEA 4GX4A 3GYYA 4NAPA 1AWBA 1IMFA 4HE0A 1LBWA 4PTKA 3U65A 2F3DA 4PGPA 3MSTA 4N6DA 1NV5A 1NUYA 5A5LA 2HXRA 3T0JA 2OWZA 1LBZA 5I7IA 2QVVA 2DE4A 2QVRA 4OVSA 4QBAA 5EQ8A 2GQ1A 4O7IA 1BK4A 4MMPA 3E78A 5IZ1A 1FSAA 4JVDA 4NG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IME A;  5J16 A;  2FVZ A;  4G61 A;  2FHY A;  4HXV A;  4IR8 A;  4GBW A;  1K9Y A;  1FPB A;  4H45 A;  3LV0 A;  1FBP A;  1EYI A;  2DDK A;  2WEF A;  2OX3 A;  5EQA A;  1LBV A;  1INP A;  1VDW A;  4HE2 A;  3KC0 A;  2WBD A;  5EQ9 A;  1FJ6 A;  1FPD A;  2WBB A;  4QXD A;  1FTA A;  2BJI A;  5FBP A;  1LBY A;  1RDX A;  3FBP A;  2HHM A;  2QVU A;  2FIE A;  1JP4 A;  1FPI A;  1G0I A;  1EYK A;  4N81 A;  5I3S A;  3IFA A;  3RYD A;  5EYH A;  1RDY A;  1Q9D A;  4GWS A;  5T3J A;  4I3E A;  4H46 A;  1NV3 A;  5ET6 A;  5ESY A;  1SPI A;  2CZH A;  1NI9 A;  5ET7 A;  3LUZ A;  1YZ0 A;  1IMC A;  2CZK A;  2F3B A;  1QGX A;  3KBZ A;  1DBZ A;  1DK4 A;  3KC1 A;  4GX3 A;  3D1R A;  3RPL B;  5DW8 A;  3ROJ A;  1KZ8 A;  4GWU A;  1XI6 A;  1NUX A;  1IMA A;  1K9Z A;  2P3V A;  3IFC A;  1NV2 A;  5LDZ A;  3BIG A;  1LBX A;  4FBP A;  2Y5L A;  2Y5K A;  1FPG A;  1NV0 A;  1D9Q A;  1FBH A;  1FPE A;  2PCR A;  5ET5 A;  2FBP A;  3BIH A;  1NUW A;  5IZ3 A;  1CNQ A;  2QFL A;  1KA0 A;  1FBF A;  1NUZ A;  1FPJ A;  1FBE A;  4MJO A;  1KA1 A;  4I40 A;  1NV1 A;  4GX4 A;  1FBD A;  4GWX A;  1AWB A;  1IMF A;  4HE0 A;  1LBW A;  2Q74 A;  1YXI A;  2P3N A;  4PTK A;  2F3D A;  1NV7 A;  4GWY A;  1EYJ A;  1NV5 A;  1NUY A;  4GWW A;  1FBG A;  3B8B A;  5IZ3 B;  5EYG A;  5A5L A;  4KXP A;  3T0J A;  2OWZ A;  1LBZ A;  4AS5 A;  4I3Y A;  1NV4 A;  2QVV A;  2VT5 A;  1LEV A;  2FIX A;  2R8T A;  2QVR A;  5F24 A;  3QMF A;  1DCU A;  5EQ8 A;  2GQ1 A;  4HE1 A;  4GBV A;  5EQ7 A;  4O7I A;  1YYZ A;  1IMB A;  1FBC A;  1FPK A;  2JJK A;  2Q8M A;  4GX6 A;  1BK4 A;  3A29 A;  5IZ1 A;  1RDZ A;  5ET8 A;  4GWZ A;  1FJ9 A;  1FSA A;  1NV6 A;  1IMD A;  1FRP A;  2CZI A;  1FPL A;  1FPF A;  3RPL A;  1G0H A;  4AS4 A; 
#chains in the Genus database with same CATH topology
 3MUQ A;  3Q26 A;  3KN8 A;  2HAV A;  1CE2 A;  2O6A A;  3OO9 A;  3TTM A;  1MQD A;  3Q29 A;  4ECF A;  3K0V A;  4OWD A;  5H8H B;  5EQ9 A;  1B3E A;  1D9Y A;  3MP1 A;  4IGT A;  3F11 A;  4POW A;  2QVU A;  1MQI A;  4OMB A;  2NUV A;  4GXS B;  3CFL A;  4H46 A;  3FJG A;  5H8Q A;  1ZLQ A;  4PBQ A;  4C1U A;  1MM6 A;  4FAT A;  1GV8 A;  3KJT A;  1URS A;  5ELV A;  4PP0 A;  3N94 A;  4RYA A;  3G3H A;  2P3V A;  4BLA A;  4MNI A;  4LZ8 A;  1FQF A;  2ONS A;  3IOR A;  3RPW A;  3ZKL A;  1KA0 A;  4H67 A;  4I40 A;  1JQF A;  2XXW A;  1F9B A;  2ABH A;  1PBP A;  2ONK E;  5I58 B;  4R74 A;  1S7Y A;  2H98 A;  5EYG A;  1B52 A;  4QHQ A;  3MPK A;  4GL8 A;  5I59 B;  4I3Y A;  4AB5 A;  3EHU A;  2XD2 A;  2PBW A;  4P56 A;  4ZZA A;  3GZG A;  4RY1 A;  4MH5 A;  2H5Y A;  3PMX A;  4OFO A;  1MQH A;  1VE4 A;  1B6H A;  1IQ7 A;  4GOT A;  4N6K A;  4KHZ E;  4PFR A;  4FOR A;  3U94 A;  3T66 A;  1TFD A;  1XOC A;  3TMG A;  4X1D A;  1H45 A;  3FVK A;  5A5X A;  1DTG A;  4HCY A;  1NNT A;  3KC0 A;  3Q27 A;  1MXW A;  2ZMB A;  5JTY A;  3MZB A;  3T93 B;  1P1O A;  3LR1 A;  2LAO A;  3SEX A;  2F8D A;  2XXP A;  3BBR A;  2HZL A;  3K4U A;  3IFA A;  1P99 A;  4PET A;  1LCT A;  1Q9D A;  3HHF A;  4MLV A;  4XEQ A;  1NV3 A;  2PMS A;  4KR5 A;  1H3D A;  1OIB A;  5HBC A;  1MXU A;  2F78 A;  4X1B A;  2DVZ A;  1I6Q A;  4YU0 A;  3SET A;  1PB7 A;  3PUW E;  4DZ1 A;  2H25 A;  4OTE A;  2H99 A;  3K00 A;  5CRY A;  1D9Q A;  3LSX A;  3NOH A;  5AA1 A;  4OER A;  4MJO A;  1KA1 A;  2ZNT A;  3KJ7 A;  3MYU A;  4GWX A;  1N3X A;  3K2D A;  4JWX A;  3A3C A;  3U8Q A;  4N4U A;  4MX6 A;  4P0G A;  2L5V A;  2I3W A;  4O8M A;  5KZT A;  1Q1K A;  1FTL A;  4P1E A;  3C31 A;  1PB9 A;  5EQ7 A;  2A5T B;  4F1V A;  3DEL B;  3VVF A;  1OVT A;  2B3F A;  4YKP A;  4DI4 B;  1RDZ A;  1IMD A;  5EYF A;  1FRP A;  4NF8 A;  1MDP 1;  4NN3 A;  1ZJL A;  2VGQ A;  1MM7 A;  4JBZ A;  4GWO A;  5JEI A;  1A8E A;  1EYI A;  5FHM A;  4LZ5 A;  1VDW A;  4KCC A;  4G77 A;  4HE2 A;  4YKJ A;  4IY6 A;  1Y3P A;  4XKP A;  1MPC A;  2F7A A;  1SW1 A;  3CG1 A;  3U1O A;  4ZE8 A;  2DE2 A;  3T22 A;  1EYK A;  3RYD A;  1US4 A;  5H8N A;  3KFM A;  3S2V A;  3TEL A;  4GX3 A;  1UTH A;  1HSE A;  2F6G A;  2QJE A;  1IXG A;  4O3B A;  2R6G E;  3MW0 A;  5AE4 A;  2O51 A;  5ET5 A;  3FXQ A;  1NUW A;  2WKY A;  4RK2 A;  1P1N A;  3E9X A;  3CR9 A;  3TZA A;  1UIV A;  2F5X A;  4R6H A;  1M5D A;  2X7Q A;  2I0C A;  4EQB A;  1EH3 A;  1Y3Q A;  2THI A;  4YKI A;  3FVO A;  1FBG A;  3ILT B;  3U93 A;  3TKD A;  5KCJ B;  3V89 B;  4GD5 A;  2Q2C A;  4ZEB A;  4LVQ A;  3SKP A;  1Y20 A;  4IO2 A;  4F1Y A;  2G29 A;  1LAG E;  3O6H A;  1SI1 A;  4QFK A;  4GBV A;  4M1V A;  2GHB A;  3KSX A;  1B3G A;  3B7D A;  1NV6 A;  2ZNS A;  2I6E A;  3RUM A;  4KYS A;  5H8H A;  1M5F A;  3K1P A;  1H43 A;  4R73 A;  3TCG A;  2AL5 A;  3ONM A;  4G8M A;  1ZTY A;  1NMU A;  3LUY A;  3ZS6 A;  4G8H A;  1J1N A;  4QSC A;  1M5C A;  1NNP A;  1AIV A;  4KPT A;  2BJJ X;  3LSW A;  3C36 A;  3PPN A;  4MLQ A;  4NQ8 A;  4OFL A;  1LCF A;  2UVJ A;  4ND9 A;  1B0H A;  1MS7 A;  4I9D A;  4PE5 B;  2XWI A;  4OHN A;  4DI3 D;  5ET6 A;  3PD9 A;  2KR0 A;  4HCW A;  4NF5 B;  3UN6 A;  1PB8 A;  4O94 A;  4EF2 A;  4ELR A;  3E3K A;  2PX1 A;  4OEV A;  5TU0 A;  5CMB A;  4R6Y A;  4BDM A;  3IFC A;  2ZZW A;  3THI A;  1LBX A;  4NF6 A;  3HPI A;  2Y5K A;  1VFE A;  5DTB A;  1B58 A;  2OLB A;  1FPG A;  3TOD A;  2FA7 A;  2ZYM A;  3K02 A;  2QFL A;  3RNN A;  4BDL A;  3IJX B;  1P1U A;  1FBE A;  5I59 A;  3CSG A;  2RC7 A;  1AWB A;  1LBW A;  3CFZ A;  4PGP A;  1HSJ A;  3MST A;  3TUS A;  3UGW A;  4N6D A;  1NUY A;  4U4X A;  5IKB A;  2HXR A;  1ELJ A;  3SEW A;  1OVB A;  1B51 A;  2GH9 A;  3UP9 A;  2QVR A;  4HTG A;  4Q30 B;  4QBA A;  4NMY A;  2ONR A;  1ZU0 A;  5EQ8 A;  3R7X A;  4O7I A;  1LST A;  1DOT A;  3E78 A;  5ITP A;  1URD A;  4JVD A;  1I69 A;  4TOZ A;  1FTM A;  2CZL A;  4N6P A;  2XXH A;  1XT8 A;  3IB0 A;  2AYS A;  3FUZ A;  1A99 A;  4R72 A;  3EN3 A;  1LB9 A;  4F3P A;  2WBD A;  2HXW A;  1FPD A;  3SDF A;  1WDN A;  1QUK A;  5FBP A;  1R1N A;  5FHO A;  4ZDM A;  1FTK A;  2V93 A;  1D3K A;  1LGB C;  3IOT A;  4ESW A;  2XD3 A;  4MFI A;  3C9H A;  4YKK A;  1NI9 A;  4HS7 A;  1YZ0 A;  4OZ9 A;  4NF8 B;  4AB6 A;  1DTZ A;  4N07 A;  4YAH X;  1ATG A;  1PEB A;  3KZG A;  1NKX A;  2RF1 A;  3PPR A;  2DXY A;  3Q25 A;  4XKR A;  1NV1 A;  2AL4 A;  5I56 A;  1O64 A;  4ZEF A;  2O1L A;  2O84 X;  4WED A;  1JW5 A;  4NF0 A;  1SDX A;  3CSB A;  4JWY A;  4H8J A;  2I58 A;  4BDR A;  4ELQ A;  2A5T A;  2GFE A;  4AS5 A;  3FXB A;  2PYY A;  2OPE A;  5KDT B;  4Z0I A;  4LAT A;  2VT5 A;  4GVO A;  3MVY A;  2Y84 A;  3PV0 E;  1UTH B;  1XC1 A;  3OO6 A;  1A55 A;  4X9T A;  1MQG A;  2ZNU A;  1FBC A;  4FE8 A;  1H76 A;  4F18 A;  3A29 A;  3M3L A;  1FPL A;  3RPL A;  1B3F A;  3IK6 B;  2Y7I A;  1SI0 A;  4MHF A;  3RGY A;  3PD8 A;  3K6X A;  3RT6 B;  1MXY A;  1SYI A;  4R75 A;  1MH4 A;  3OEL A;  4HW8 A;  2WBB A;  4QXD A;  1FTA A;  4TLL B;  3T9X B;  1II5 A;  1IEJ A;  3FBP A;  3OSQ A;  1TWY A;  4Q8R A;  3PMV A;  3OEK A;  5DVF A;  3O97 A;  3HV1 A;  4FAJ A;  4YMB A;  1T0K A;  2D21 A;  1LFG A;  1VSO A;  1CB6 A;  3N6T A;  3V5A A;  5CBR A;  1PBQ A;  2VHA A;  4LUB A;  2CZK A;  3EPE A;  3KC1 A;  4FEC A;  2XX9 A;  1WVJ A;  1YTV A;  5CC2 A;  2QS2 A;  1KWH A;  4P3L A;  4LZ7 A;  1DPP A;  1Q35 A;  3LC8 A;  5I2N A;  1MXZ A;  4OVQ A;  1NV0 A;  1SW4 A;  4Q5T A;  4E0W A;  5KCJ A;  2F6P A;  4IO4 A;  3D4C A;  3H6U A;  3IR1 A;  3VDF A;  3K1N A;  1B0L A;  3O6I A;  4KXP A;  3RTW B;  3VXC A;  1JW1 A;  3B50 A;  1LEV A;  2PFY A;  5L9O A;  2OBG A;  1XVX A;  3HN0 A;  5IZZ A;  1OLA A;  4GX6 A;  2UVI A;  4MNP A;  4NF6 B;  2O69 A;  3KOT A;  3UIF A;  1PDA A;  2I4C A;  3OO8 A;  4OA4 A;  2CZI A;  2HPG A;  4N91 A;  1MG1 A;  1NH7 A;  4AQ4 A;  1LB8 A;  3PPO A;  3ISP A;  1N7X A;  3FJ7 A;  2UYE A;  3KSJ A;  3KG2 A;  3MC2 A;  3B6Q A;  2QL3 A;  3M3K A;  4F3G A;  1EZP A;  2BJI A;  4NF5 A;  4PDH A;  3T9U A;  1GTK A;  3QSL A;  3E4R A;  3FV1 A;  4U23 A;  3E79 A;  3I3V A;  1DPE A;  2CZH A;  4G68 C;  4BDN A;  4YB7 A;  1B4H A;  2OZZ A;  2PVU A;  2Z8D A;  3T9H B;  4THI A;  1B1H A;  2AIX A;  2Y7P A;  4PBH A;  4F2Q A;  3O29 A;  1D4N A;  2HAU A;  1MXX A;  4QFN A;  5AA4 A;  3Q28 A;  2Y5L A;  1FBH A;  3BIH A;  1LFI A;  3SES A;  4H0W A;  2XXK A;  4U21 A;  2KLF A;  3G7W A;  2P2A A;  4F22 A;  4POX A;  2I0B A;  1LBC A;  3I5O A;  3JYR A;  4PF8 A;  1XVY A;  1UTB B;  2I4B A;  2DQV A;  4OAN A;  2PFZ A;  2F35 A;  3HCQ A;  4IY5 A;  2JJK A;  3HFU A;  3ZKK A;  2QRY A;  3KN7 A;  5EHM A;  1FPF A;  2RC8 A;  4NE4 A;  3TQW A;  4N15 A;  3G3K A;  1IME A;  3OSR A;  4R6K A;  4G61 A;  5I56 B;  1K9Y A;  1FPB A;  1QVS A;  4ESX A;  3USD A;  2XWV A;  2ZXT A;  3W9W A;  1FBP A;  1SVX B;  4DE8 A;  1FCK A;  1FJ6 A;  3HHG A;  2Q9T A;  1LBY A;  1VR5 A;  1A8F A;  4KYD A;  2F7B A;  3QYT A;  1B46 A;  5EYH A;  1RDY A;  2NWJ A;  4YMA A;  4EF1 A;  3OOA A;  5I57 A;  3O9P A;  3LUZ A;  5J1D A;  1IMC A;  2F3B A;  3H4Z A;  4H1X A;  5DVJ A;  1DBZ A;  3RPL B;  3EF7 A;  1XI6 A;  3GXA A;  2W7Y A;  5LDZ A;  4FBP A;  3S9L C;  2XXU A;  4P0I A;  2XXI A;  5KDT A;  3GYY A;  5DT6 A;  1MH3 A;  2QS3 A;  1NFT A;  3SER A;  3I6V A;  2GHA A;  1MDQ A;  3S9N C;  3MVZ A;  5F1Q A;  3MJN A;  3QUF A;  2OWZ A;  1LBZ A;  4G8N A;  4FED A;  1LFH A;  3MP6 A;  5I7I A;  3K6V A;  2QVV A;  3MZ1 A;  3TQL A;  3KBR A;  3H06 B;  2Q2A A;  3MVW A;  5DYH A;  3CVG A;  2XXR A;  1R9Q A;  1S50 A;  2O7I A;  1B7H A;  3DP6 A;  4QF9 A;  3BFT A;  2Z8F A;  3UOR A;  5I2N B;  5IZ1 A;  2NVU B;  3FXU A;  3QK6 A;  1I6B A;  1POY 1;  4NG7 A;  2VD3 A;  4GQO A;  2B65 A;  3TYH A;  1AOV A;  3DP4 A;  4H45 A;  3ECR A;  3H3G A;  1INP A;  3IO6 A;  5ICT A;  2I48 A;  2NXO A;  1P1W A;  2UVG A;  2HQ0 A;  4PQJ A;  4PGN A;  3FJM A;  4RJZ A;  4N81 A;  4BDO A;  1SW5 A;  4GWS A;  2PT2 A;  4KCD A;  1IZ1 A;  3SEV A;  2D5W A;  1N04 A;  3KOS A;  4IO5 A;  1QUI A;  4GWU A;  3PUZ E;  3QXM A;  3AXF A;  3K6U A;  3FAS A;  1Y3N A;  4JDF A;  1D9V A;  4U22 A;  3PUV E;  5CMM A;  2RKM A;  5M2V A;  3FXR A;  1MXV A;  2V3U A;  1FPJ A;  1IUD A;  3LBS A;  1FBD A;  2XWO A;  2Z8E A;  5TPA B;  5AA2 D;  1YXI A;  3H6W A;  2O68 A;  3S9E A;  4GWW A;  1ZBM A;  5B70 A;  4NGU A;  5FHN A;  1MY1 A;  1NV4 A;  1QKA A;  4EQ7 A;  1N84 A;  1PC3 A;  4XF5 A;  1GR2 A;  2R8T A;  3H03 A;  3O66 A;  5F24 A;  1TT1 A;  1YYZ A;  3KGC A;  3H7M A;  5AA4 B;  4LQ2 A;  4OYV A;  1URG A;  1QUL A;  2KQZ A;  3PPQ A;  4DLD A;  2UVH A;  1Y9U A;  5DVI A;  4GRK A;  2H9B A;  2RC9 A;  4DIG A;  2Z23 A;  1FQB A;  3VFJ A;  4DXU A;  4PAF A;  4RPN A;  1H44 A;  2IEE A;  1N0T A;  4PC9 A;  4P1L A;  3PMW A;  4OFJ A;  4F3B A;  1MY2 A;  1MY0 A;  5CMC A;  5T3J A;  4O3A A;  1I6A A;  5JK4 A;  3WAF A;  2CMO A;  2OCU A;  4WXJ A;  4PE3 A;  3VLW A;  1B40 A;  1QGX A;  2FNC A;  3OXN A;  2ZZV A;  5I5P A;  1OQH A;  1AMF A;  1N3W A;  2X26 A;  3UA8 A;  3G3I A;  5AA2 A;  1MRP A;  4F19 A;  3RTF B;  2P3N A;  4X48 A;  3VXB A;  4GWY A;  1UTB A;  1EYJ A;  1GVC A;  4PAI A;  3QAX A;  5ICQ A;  3MP8 A;  5H8F A;  2DYX A;  4C1T A;  5I57 B;  3TPA A;  1FQE A;  1QKB A;  1Z7M E;  4MBP A;  4KD5 A;  4GXA A;  3MWB A;  3IJO B;  4HE1 A;  3OEN A;  1QJM A;  1LLS A;  1A54 A;  3MZ9 A;  4OET A;  5ET8 A;  2H4I A;  2UXA A;  2DS9 A;  4O7M A;  4ELP A;  4LN5 A;  1OLC A;  3MVX A;  3IB2 A;  3EHT A;  2V25 A;  3TCH A;  4PDD A;  1B5H A;  4PFI A;  3T96 B;  2WX9 A;  5IM2 A;  5H8S A;  3M8U A;  1BLF A;  1MY4 A;  1EU8 A;  4UA8 A;  2OX3 A;  3U72 A;  4NHB A;  3QIM A;  4F39 A;  1B2H A;  1IIT A;  3H6T A;  3G3J A;  4F2O A;  5I3S A;  2O1M A;  3ILU B;  5I2K B;  4NWD A;  3C35 A;  4EXK A;  4FJP A;  3HO7 A;  4U1Z A;  4G2Z A;  2Q88 A;  1POT A;  4MAG A;  4ZEI A;  1NUX A;  1IMA A;  1R6Z A;  1ANF A;  3TCF A;  2V3T A;  2XA5 A;  2PCR A;  1CNQ A;  2A5S A;  3CHG A;  1NUZ A;  3B6T A;  1MPD A;  4XXU A;  2QS4 A;  2VOZ A;  1MPB A;  1OQG A;  3SEY A;  3VVD A;  1JEU A;  5IZ3 B;  3OEM A;  2QS1 A;  2RCB A;  2F97 A;  4U4S A;  4BDQ A;  1IXC A;  3IB1 A;  5L8D A;  2HZK A;  3CI8 A;  4ZS9 A;  3PTY A;  2Q89 A;  3VE1 B;  5TP9 B;  3N26 A;  5HM4 B;  4GWZ A;  1FJ9 A;  3A09 A;  2CEY A;  1NNK A;  4QSE A;  5J16 A;  1FW0 A;  2VD2 A;  1BP5 A;  4F29 A;  2O7U A;  4IR8 A;  1XHY A;  1TXF A;  1YPN A;  3VV5 A;  1Y4C A;  3GBB A;  3KN3 A;  4X04 A;  1TFA A;  2V84 A;  4P11 A;  1GGG A;  1LBB A;  4L17 A;  3O28 A;  3DLN A;  2VP1 A;  2V3Q A;  5FTI A;  2DXR A;  1JP4 A;  5F7V A;  1FTJ A;  4MEV A;  1B3L A;  3H6V A;  1B32 A;  4ZED A;  4I3E A;  3R6U A;  1SPI A;  4XKN A;  3S9M C;  4I8C A;  3IOV A;  4GIZ A;  3D1R A;  1N76 A;  4R9G A;  4O3C A;  2M8C A;  1Z7N E;  1K9Z A;  3O2A A;  3FV2 A;  5TPA A;  2Z22 A;  2HFB A;  4XIG Q;  1SYH A;  3FD3 A;  1A7L A;  3N5L A;  4KFQ A;  4GX4 A;  2P1S A;  4NAP A;  3RY3 A;  4ZEK A;  1IMF A;  4PTK A;  3U65 A;  4DDD A;  1NV5 A;  5A5L A;  4OEN A;  4NF4 A;  2Q8J A;  4I62 A;  1IXH A;  4LA9 A;  4U2R A;  4UAC A;  3HST A;  4QFP A;  3IOW A;  4G4P A;  2XHD A;  1BK4 A;  1SD3 A;  4MMP A;  1AH5 A;  3OMB A;  1B7U A;  5AA2 B;  2D3I A;  3K01 A;  3MPL A;  2X7P A;  1JNF A;  2OK2 A;  3N6U A;  2I49 A;  1LAX A;  3SZP A;  3CFX A;  3LV0 A;  2B4L A;  1O7T A;  2DWH A;  2DDK A;  2WEF A;  5H8F B;  1LBV A;  4N17 A;  4GLI A;  4LQ5 A;  4F3S A;  3K1M A;  3IL1 B;  4OVJ A;  3BFU A;  4QSD A;  1JVY A;  3IX1 A;  4PAK A;  2DP8 A;  2I3V A;  4H6D A;  2XWK A;  3FZV A;  3E13 X;  3PUY E;  4YZZ A;  1B4Z A;  1DK4 A;  2XXT A;  1ZIU A;  1B5J A;  1FQA A;  1ZKB A;  1Y1M A;  4JSO A;  1US5 A;  3WAE A;  4ZZE A;  4OES A;  4PFY A;  4RK9 A;  3EKI A;  4QFO A;  3A3U A;  4IO7 A;  4G68 A;  2REJ A;  2XXQ A;  1YAE A;  3CG3 A;  5FTH A;  1JET A;  1VFD A;  3B8B A;  1USY H;  4UAB A;  3GBA A;  4KQP A;  3TAJ A;  4P47 A;  4TLM B;  4WEP A;  4K3F A;  5IAI A;  1MY3 A;  4JVI A;  1O63 A;  2DE3 A;  3QMF A;  5DEX B;  4FIM A;  1DCU A;  3PGF A;  4JXI A;  2VPN A;  1IMB A;  4PFW A;  3TDJ A;  3L6H A;  4IB2 A;  2OWT A;  4AS4 A;  2P0S A;  3C32 A;  5CI5 A;  1S9T A;  4C0R A;  2FVZ A;  4FEB A;  4GFR A;  5I84 A;  2FHY A;  1IIW A;  4HXV A;  4GBW A;  4OXV A;  4JWO A;  5CBS A;  4WKM A;  4ISU A;  1AL3 A;  3C4M A;  3O6G A;  3T9V A;  5EQA A;  1RYX A;  5I2K A;  4GL0 A;  1B9J A;  2NOO A;  3V8X B;  4P9K A;  4NX1 A;  2ANJ A;  2WYK A;  1FPI A;  2CEX A;  4EUO A;  5AA3 A;  2OPD A;  2YJP A;  4IO3 A;  4IO6 A;  1LAH E;  4EQ9 A;  2RCA A;  2OJT A;  3KBZ A;  2F7C A;  4RA1 A;  5DW8 A;  4EDP A;  5CMK A;  4ELO A;  3QUJ A;  4PFU A;  2R71 A;  1SW2 A;  1SQY A;  3BIG A;  3IO4 A;  5LOM A;  4YB6 A;  3T1B A;  5H8Q B;  1FPE A;  5IZ3 A;  4RXL A;  1XS5 A;  1FBF A;  1JVX A;  3L6G A;  3M3F A;  1B5I A;  3RQT A;  3KEI A;  3ODB A;  3TTR A;  3LSL A;  4JVC A;  3C33 A;  4ONY A;  2ZZX A;  1WOD A;  4H5G A;  5ITO A;  4Q0C A;  3RT8 A;  4OVT A;  3R26 A;  2QPQ A;  3K6W A;  3OD7 A;  5BWJ A;  3FVN A;  5TP9 A;  2FIX A;  1USY E;  3W15 C;  4DCX A;  1FPK A;  3VLU A;  5BUU A;  4F1U A;  4OQO A;  1BTJ A;  3PPP A;  1Y1Z A;  4YIC A;  2B4M A;  2DOJ A;  1G0H A;  4KYE A;  4RPO A;  2YPN A;  4OVP A;  4X8R A;  1B05 A;  1B3H A;  2F36 A;  4H5F A;  4F31 B;  3PU5 A;  2V4C A;  1L5T A;  3BKI B;  2PT1 A;  3LSF B;  4P8B A;  4ZEC A;  3VLV A;  3G3G A;  1NL5 A;  4NF4 B;  4MF3 A;  2HEU A;  3CIJ A;  1N7W A;  5IGA A;  4H65 A;  5I58 A;  2FIE A;  3TTN A;  4N8G A;  5A5X B;  1G0I A;  1A40 A;  2DWI A;  2E1S A;  2E0S A;  1BKA A;  3G3F A;  5JTY B;  5CM6 A;  2R9J A;  2YLN A;  1YCJ A;  3EQ1 A;  1SBP A;  1M5B A;  4R9F A;  2ZYK A;  2ESN A;  3TEP A;  2QMW A;  3UK4 A;  2DWA A;  1FTO A;  2XX8 A;  1DSN A;  3FAT A;  5LTC A;  2OWS A;  1M5E A;  2VPO A;  4H8I A;  1JW4 A;  2ALU A;  4QRZ A;  2Q74 A;  4R2F A;  1NV7 A;  4DXB A;  3JZJ A;  3PUX E;  2GRV A;  2XXY A;  5HPQ A;  2G93 A;  4PFB A;  1EZO A;  4XKQ A;  4NTL A;  4MIJ A;  4EXL A;  2FYI A;  4OEU A;  3SEU A;  2RIN A;  2Y7K A;  1QUJ A;  4LON B;  1FQD A;  5L9S A;  4U1O A;  2Y7W A;  5ISU A;  4PCD A;  1NH8 A;  3CRB A;  2UYF A;  3TFL A;  4I1D A;  3V83 A;  2WYP A;  4JSD A;  2Q8M A;  4IGR A;  1Y4T A;  3EHS A;  5L9M A;  2F34 A;  3RN8 A;  2DWJ A;  3VVE A;  1BIY A;  4JB7 A;  2QMX A;  4G68 B;  4RNS A;  3DP8 A;  3GLB A;  1DMB A;  2Y7R A;  3MBP A;  3MQ9 A;  4DCY A;  4N8Y A;  1RKM A;  4QFL A;  3TTL A;  4MCO A;  4PF6 A;  2QSX A;  3P7I A;  4R2B A;  3FGS A;  1RDX A;  4DXC A;  2ZYN A;  2HHM A;  4NED A;  2DVC A;  2MKZ A;  4OVR A;  5B7D A;  5EHS A;  5ESY A;  2HCA A;  4TQU Q;  4YB5 A;  5ET7 A;  4M4G A;  3FVG A;  4MNC A;  2XX7 A;  3ZSF A;  3ROJ A;  1KZ8 A;  2ZYO A;  5H8N B;  4XTC Q;  1NV2 A;  1HSL A;  3S4U A;  3W9V A;  3RLF E;  4XFE A;  1UQW A;  2FBP A;  1R9L A;  4N13 A;  1ZMG A;  3D4G A;  1RYO A;  3JV9 A;  4HE0 A;  1P1Q A;  3FIR A;  1OMP A;  2XXV A;  4KI0 E;  2F3D A;  1IXI A;  1QW0 A;  5DEX A;  2IA4 A;  4ZE9 A;  5K2Y A;  1B7Z A;  5K2X A;  3T0J A;  4LP2 B;  1B1X A;  1NNF A;  3OO7 A;  3IOU A;  2DE4 A;  3C34 A;  2REG A;  3MAM A;  2XXX A;  4OVS A;  1FQC A;  4E0X A;  2GQ1 A;  1LAF E;  4GF8 A;  1JEV A;  4PFT A;  2B3B A;  3U92 A;  4Z7E A;  3DM0 A;  1FSA A;  3B6W A;  3IAZ A;  3TTK A;  4NWC A;  1EZ9 A;  2DSF A;  1MQJ A;  1UIU A; 
#chains in the Genus database with same CATH homology
 3SZP A;  4H45 A;  3LV0 A;  2B4L A;  2DDK A;  2WEF A;  1LBV A;  1INP A;  2WBD A;  5EQ9 A;  1FPD A;  4N17 A;  5FBP A;  4PGN A;  2QVU A;  4N81 A;  4PAK A;  4GWS A;  2XWK A;  4H46 A;  1NI9 A;  4PBQ A;  4YZZ A;  1YZ0 A;  1DK4 A;  4GWU A;  2P3V A;  4MNI A;  3EKI A;  1KA0 A;  1FPJ A;  4I40 A;  1NV1 A;  1FBD A;  2XWO A;  1YXI A;  4NF0 A;  4GWW A;  3B8B A;  5EYG A;  4UAB A;  4NGU A;  4AS5 A;  4P47 A;  4I3Y A;  1NV4 A;  3FXB A;  4XF5 A;  2VT5 A;  4P56 A;  2R8T A;  4JVI A;  5F24 A;  2DE3 A;  3QMF A;  1DCU A;  4X9T A;  2VPN A;  1YYZ A;  1IMB A;  1FBC A;  4F18 A;  3A29 A;  1FPL A;  3RPL A;  4AS4 A;  2KQZ A;  2FVZ A;  4N6K A;  4MHF A;  4PFR A;  2FHY A;  4HXV A;  4GBW A;  4HCY A;  5EQA A;  3KC0 A;  4PAF A;  2WBB A;  4QXD A;  1FTA A;  4P9K A;  4NX1 A;  3FBP A;  4PC9 A;  4P1L A;  2WYK A;  1FPI A;  2HZL A;  3IFA A;  2CEX A;  4PET A;  1Q9D A;  5T3J A;  5JK4 A;  4XEQ A;  1NV3 A;  4PE3 A;  3KBZ A;  2CZK A;  1QGX A;  3KC1 A;  2ZZV A;  5DW8 A;  5I5P A;  2DVZ A;  4P3L A;  3BIG A;  3T1B A;  4OVQ A;  1NV0 A;  1D9Q A;  1FPE A;  3NOH A;  5IZ3 A;  1FBF A;  4MJO A;  1KA1 A;  3MYU A;  4F19 A;  4GWX A;  2P3N A;  4JVC A;  4GWY A;  1EYJ A;  2ZZX A;  4PAI A;  4KXP A;  4N4U A;  4OVT A;  4MX6 A;  2QPQ A;  3B50 A;  2L5V A;  1LEV A;  2FIX A;  4O8M A;  2PFY A;  4P1E A;  4HE1 A;  5EQ7 A;  5IZZ A;  1FPK A;  4GX6 A;  4F1V A;  4MNP A;  4F1U A;  4DI4 B;  1RDZ A;  5ET8 A;  1IMD A;  1FRP A;  4YIC A;  4O7M A;  4OA4 A;  2B4M A;  2CZI A;  2HPG A;  4LN5 A;  4N91 A;  1G0H A;  4OVP A;  4X8R A;  4NN3 A;  2V4C A;  4PDD A;  4PFI A;  4P8B A;  2WX9 A;  3ISP A;  5IM2 A;  1EYI A;  2OX3 A;  1VDW A;  4NHB A;  4HE2 A;  2BJI A;  4PDH A;  5IGA A;  2FIE A;  4N8G A;  1G0I A;  2DE2 A;  1EYK A;  5I3S A;  3RYD A;  3E79 A;  5CM6 A;  2CZH A;  4GX3 A;  4MAG A;  4PBH A;  1NUX A;  1IMA A;  2Y5L A;  2XA5 A;  1FBH A;  5LTC A;  2PCR A;  5ET5 A;  3BIH A;  1NUW A;  2VPO A;  1CNQ A;  3CHG A;  1NUZ A;  2XXK A;  2F5X A;  2Q74 A;  1NV7 A;  1FBG A;  4PFB A;  5IZ3 B;  4MIJ A;  4PF8 A;  2HZK A;  4PCD A;  4OAN A;  4GBV A;  2PFZ A;  4M1V A;  2WYP A;  2JJK A;  2Q8M A;  3PTY A;  3HFU A;  4GWZ A;  1FJ9 A;  1NV6 A;  2CEY A;  1FPF A;  4N15 A;  1IME A;  5J16 A;  4G61 A;  4IR8 A;  1K9Y A;  1FPB A;  4X04 A;  2XWV A;  3W9W A;  1FBP A;  4N8Y A;  1FJ6 A;  4MCO A;  4PF6 A;  2Q9T A;  1LBY A;  2V3Q A;  1RDX A;  2HHM A;  1JP4 A;  2MKZ A;  4MEV A;  4NQ8 A;  4OVR A;  5EYH A;  1RDY A;  4I3E A;  2XWI A;  4DI3 D;  5ET6 A;  5ESY A;  1SPI A;  5ET7 A;  2KR0 A;  3LUZ A;  4HCW A;  5J1D A;  4O94 A;  1IMC A;  2F3B A;  4MNC A;  1DBZ A;  3RPL B;  3D1R A;  3ROJ A;  1KZ8 A;  1XI6 A;  1K9Z A;  3IFC A;  2ZZW A;  1NV2 A;  5LDZ A;  3W9V A;  1LBX A;  4FBP A;  4XFE A;  2Y5K A;  1FPG A;  2FBP A;  2QFL A;  1FBE A;  4GX4 A;  3GYY A;  4NAP A;  1AWB A;  1IMF A;  4HE0 A;  1LBW A;  4PTK A;  3U65 A;  2F3D A;  4PGP A;  3MST A;  4N6D A;  1NV5 A;  1NUY A;  5A5L A;  2HXR A;  3T0J A;  2OWZ A;  1LBZ A;  5I7I A;  2QVV A;  2DE4 A;  2QVR A;  4OVS A;  4QBA A;  5EQ8 A;  2GQ1 A;  4O7I A;  1BK4 A;  4MMP A;  3E78 A;  5IZ1 A;  1FSA A;  4JVD A;  4NG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...