4I3YA

Crystal structure of staphylococcal inositol monophosphatase-1: 100 mm licl soaked inhibitory complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
264
structure length
264
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation of the Binding Site and Mode of Inhibition of Li(+) and Mg(2+) in Inositol Monophosphatase
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mssa476
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 76
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4i3yA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4i3yA02
2OWZA 2FHYA 5EYGA 4HE1A 1LEVA 4H45A 4FBPA 1FBGA 1NV5A 4O7IA 5LDZA 1FSAA 1LBZA 2WEFA 3T0JA 2Q8MA 1FPEA 5ET5A 1FPJA 1NUYA 2Y5LA 4G61A 1G0HA 5EQ9A 2P3NA 2JJKA 1FJ6A 3FBPA 5EQ8A 2F3BA 1EYJA 1FPBA 2HHMA 1FPGA 5DW8A 1KZ8A 5EYHA 5T3JA 4GWUA 3RPLA 4GX6A 1NV1A 1NV3A 1FBPA 1YZ0A 2CZHA 1DBZA 3QMFA 5IZ1A 5J16A 4GBVA 1EYKA 2GQ1A 1FPFA 4H46A 1CNQA 1KA1A 5I3SA 2QVUA 3RYDA 3KBZA 5IZ3A 2OX3A 1D9QA 2Q74A 4GWZA 2FIEA 1JP4A 3RPLB 1LBXA 1NV2A 1FBDA 2QFLA 5ET6A 1LBWA 1SPIA 1IMAA 1DK4A 1INPA 2F3DA 2QVRA 1K9ZA 3B8BA 3IFCA 4KXPA 4HE2A 1EYIA 1FPDA 4GWSA 1NUWA 1FPLA 4AS4A 1AWBA 3LV0A 1YXIA 2BJIA 1G0IA 1IMBA 1NV4A 3BIHA 1NV7A 1QGXA 1IMFA 1IMCA 1FPIA 4I40A 2Y5KA 5ET7A 2FIXA 5IZ3B 4QXDA 1Q9DA 1FRPA 3KC0A 4GWYA 1FJ9A 1FBHA 1FTAA 4PTKA 1FPKA 2CZIA 1NI9A 3IFAA 1NV6A 3KC1A 1LBVA 1FBEA 4MJOA 3ROJA 1RDXA 2WBBA 4IR8A 1IMDA 4GBWA 1NUXA 1LBYA 4AS5A 1RDYA 5EQAA 1K9YA 2PCRA 3D1RA 1BK4A 4GX4A 1XI6A 1NUZA 5EQ7A 3BIGA 1DCUA 1VDWA 2WBDA 1FBCA 2CZKA 1RDZA 2QVVA 2VT5A 4I3EA 1FBFA 1NV0A 5ET8A 2R8TA 4HXVA 5ESYA 1KA0A 5FBPA 2DDKA 4GWXA 4GWWA 3LUZA 3A29A 2FBPA 2P3VA 5F24A 4I3YA 4HE0A 4N81A 1YYZA 4GX3A 5A5LA 1IMEA 2FVZA
chains in the Genus database with same CATH superfamily
2D3IA 4H45A 4MAGA 5CMBA 4O7IA 2G93A 3MW0A 2O68A 5KZTA 1FPJA 3HO7A 1B3HA 1KWHA 2AL5A 1A40A 4XTCQ 4MLQA 2B4LA 1D9YA 2F3BA 1B5IA 1MG1A 4PE3A 5T3JA 4JWYA 3U92A 2I3VA 2Q8JA 2ZZWA 4FAJA 1JNFA 1P1WA 2QS4A 4N6DA 4OMBA 3TKDA 4DI3D 4ELOA 4RYAA 1QKBA 3PU5A 3PPRA 4YB7A 2Z8EA 3SETA 1YXIA 3T1BA 3S9EA 4TLMB 5IZ3B 3MZ1A 4QF9A 3T9XB 4G68C 1IXHA 3SZPA 1FBHA 1TT1A 4PTKA 1IITA 2CZIA 4O3CA 1XOCA 2HXWA 2F36A 1MQDA 4P0IA 1PC3A 4PDHA 4GX4A 1TFAA 4R75A 1MM7A 2XWOA 3KZGA 4UABA 4OFLA 3LBSA 4BDOA 5FBPA 4ELPA 4H6DA 3TQLA 3KG2A 4RK2A 4OVTA 5ICQA 1Y20A 2OJTA 3S4UA 4O94A 1QUIA 2LAOA 5CC2A 5I56A 3PPPA 1B5HA 3K6UA 2B3FA 4BDRA 2R71A 4IGRA 1NV5A 3I5OA 1SYIA 2QL3A 1LBZA 1UIUA 2NWJA 4XEQA 3EHSA 3K6WA 4NHBA 4TLLB 1FQAA 4IGTA 4GL8A 4F39A 1G0HA 4P1LA 2PT1A 5AA2B 1O63A 3ISPA 4C1UA 4NE4A 2I0BA 4Q0CA 4EQBA 1SVXB 2PFYA 3V89B 3LSFB 1EU8A 1SYHA 2XXKA 4EQ9A 1S50A 2V93A 3MC2A 2V84A 1VFDA 1DTGA 3EN3A 3T96B 4XKNA 4E0XA 2DE4A 3M8UA 3B6QA 4PDDA 4N6PA 5ICTA 3M3LA 1B6HA 3K6XA 2XXUA 3R6UA 3H06B 2GRVA 2O6AA 4GWSA 4JSOA 4QSDA 5DVIA 3EHTA 3HPIA 4ZECA 4F18A 1FPIA 3R26A 3DM0A 1LCTA 1XS5A 2R9JA 3FASA 1XVXA 2Z8FA 3ZS6A 2REGA 3KGCA 3SEWA 2XXPA 4LONB 1DPPA 3VLUA 4AB6A 1AIVA 4UACA 1QUKA 2IA4A 3GXAA 4EF2A 1B1XA 1BIYA 5CMKA 4KYDA 3TTRA 3L6HA 3E78A 5ELVA 2OCUA 3PV0E 1UTBA 4H67A 2NVUB 3QYTA 1SW2A 1FSAA 3U8QA 2VP1A 2WEFA 5H8HA 5TP9B 1FCKA 2JJKA 4R74A 1USYH 2HHMA 3CHGA 1M5CA 1WODA 3IB1A 3N26A 3N6TA 1I6AA 3MP6A 3TTLA 4R72A 4OETA 2OBGA 4LZ7A 2B65A 2WYKA 3O2AA 4G77A 1Q35A 5ITOA 1PDAA 4P1EA 3KBZA 1MY1A 4OVSA 5EYFA 3C35A 1INPA 4NF5B 4G68B 2NUVA 2F34A 2ZNSA 2ONRA 4N8YA 1A54A 2UVIA 4DXUA 3LV0A 3CFXA 1IMBA 1GVCA 5JTYA 1FTOA 4NX1A 4MFIA 3FATA 1QVSA 3K6VA 2GHAA 1CE2A 2DXRA 1HSEA 5L9SA 5HBCA 3RN8A 1JETA 3PMWA 2HAVA 2FYIA 4H8IA 2F5XA 1B7HA 3G3GA 1L5TA 2PMSA 2OWTA 2I4CA 1DCUA 2ZXTA 4I9DA 4AQ4A 3ZKKA 4GWXA 4QFPA 3LSWA 4GWWA 5H8QA 2PVUA 3LUZA 4DE8A 4YU0A 1J1NA 5F24A 4YKIA 4HE0A 1GGGA 5A5LA 2O7IA 1NNKA 5IKBA 2A5TB 2ABHA 4U2RA 4O7MA 4OXVA 2HEUA 2RC8A 3IOUA 3A09A 4F2QA 4X8RA 4G61A 2RINA 2VOZA 1URSA 5IAIA 4KHZE 5EQ8A 3ODBA 3RLFE 4HTGA 4U23A 1T0KA 3T93B 3N94A 4F31B 2CZHA 2PX1A 1F9BA 2H25A 2QJEA 3K2DA 3UIFA 1EYKA 5H8FB 4MNPA 3N6UA 4N6KA 5AA4A 4PBQA 3MZ9A 1OVTA 4O8MA 2Q74A 4PAKA 4C1TA 4KYSA 4JVIA 5F7VA 2YPNA 1Z7NE 3RQTA 3FVNA 3UN6A 3QAXA 2UVGA 3USDA 1Y3QA 4N17A 3KJTA 3K1NA 1WDNA 3SKPA 3TFLA 3QIMA 2QPQA 4HCYA 3Q28A 2XX9A 4P11A 2W7YA 1PB9A 3AXFA 3VVFA 4QXDA 4R6HA 2DWIA 3RY3A 1FJ9A 3SESA 3KC1A 3MP1A 1RDXA 2Z8DA 4N8GA 1BK4A 1D4NA 1JQFA 3VV5A 1ANFA 4OVQA 4DXBA 2D21A 1MY4A 1Z7ME 1N84A 1LLSA 4G68A 1FW0A 4ECFA 5A5XB 3MZBA 1MM6A 4OTEA 1UQWA 2HZKA 1IMEA 3IOVA 1ZMGA 4PFRA 4RJZA 5IZZA 3E9XA 4X1BA 3PPQA 5DEXA 2UXAA 1P1NA 2L5VA 3HHGA 3KSXA 5JEIA 3K00A 3KFMA 2Q8MA 4NF8A 3VLVA 2ONSA 1JW1A 4H8JA 1H45A 3JZJA 3FBPA 1A8FA 1LB9A 5HM4B 2VD2A 1FBPA 4EXLA 2DQVA 3TCFA 1NH7A 1A55A 3ILUB 4KQPA 5I57A 2OX3A 3TYHA 1YCJA 3THIA 2XX7A 4MMPA 4P47A 4OVRA 1JP4A 4QFOA 2ZZXA 2QFLA 2AIXA 4RPOA 1M5DA 3R7XA 3TZAA 1US5A 3C32A 5AA2D 4F2OA 5B7DA 1JEVA 4R9FA 4PE5B 4OVJA 1IQ7A 4JWXA 4MJOA 4PGNA 2HAUA 2G29A 4EXKA 2ZMBA 1BLFA 1RDYA 4MNCA 2Q9TA 5ISUA 3D1RA 3OMBA 4YICA 2MKZA 4LQ2A 4P56A 3P7IA 4KD5A 3OO8A 5I2NB 1D3KA 5B70A 1LFHA 1FQEA 2YLNA 3C34A 1P1OA 3IOWA 4I3YA 4N81A 3CVGA 1LB8A 4DDDA 4F19A 3G3KA 1MY3A 4PP0A 4MLVA 3CSBA 4IO4A 2GFEA 3C33A 4BDLA 1PB8A 2DVZA 5H8FA 4GLIA 5EHMA 1ATGA 3LSXA 5I2NA 4PAIA 5HPQA 1FPBA 2V4CA 4BDQA 5DW8A 3DP4A 2XXIA 3MPLA 3CIJA 1S7YA 3Q25A 4MX6A 2VD3A 5I56B 1A7LA 1EZPA 2I6EA 1CNQA 4OENA 2QVUA 3H4ZA 2ZZVA 5M2VA 3LUYA 4RY1A 1H43A 2UYFA 4OYVA 4GWZA 3SEUA 3OO9A 1LBXA 4N91A 2R6GE 2V25A 3GBBA 1OLAA 1MQJA 4KXPA 3UA8A 4HE2A 1FPDA 1MPDA 1MQHA 4POXA 1FPLA 4AS4A 3OD7A 3FXUA 4X9TA 4YMBA 5ET7A 3U65A 3OEMA 2XA5A 4GVOA 4RNSA 2UYEA 3Q27A 4FEDA 3N5LA 4U21A 3KOSA 2IEEA 5I84A 5I2KA 1SQYA 4ZEIA 1MPBA 2QVVA 3HCQA 4I3EA 5TU0A 2DE2A 1ZJLA 3MUQA 1EZOA 4YMAA 3I6VA 1A8EA 2ZNTA 4WXJA 3CFZA 3HN0A 5AA4B 5DTBA 2F97A 3KSJA 3CG3A 3L6GA 1GR2A 3QUJA 4UA8A 3KOTA 3BKIB 5KDTA 3UP9A 1FQBA 4X04A 1EYJA 3H6WA 1FPGA 2OPEA 5EYHA 1NH8A 1NNFA 4ZEBA 4GX6A 4YAHX 2XXHA 1DMBA 5LOMA 3BBRA 1S9TA 3QMFA 5H8HB 3M3FA 2HQ0A 1VR5A 1SDXA 3RYDA 4N13A 5TPAB 4RPNA 3U72A 4N15A 1SW4A 2QS3A 1NV2A 1JVYA 2B4MA 1SD3A 1DK4A 3RTFB 3EHUA 1K9ZA 4JXIA 4LA9A 3EKIA 5FHMA 5K2XA 2RF1A 4JSDA 4MH5A 1MXXA 1IMCA 2ZYNA 5I59A 3K01A 3H03A 2O1LA 1EZ9A 4LP2B 1MDP1 5AA1A 4EQ7A 3IFAA 4OWDA 1LAHE 1MY0A 4DLDA 1LBVA 3ROJA 4NG7A 1N3WA 2O84X 3FJGA 4I8CA 2O69A 1BKAA 5F1QA 2F78A 5L9MA 2FBPA 2NXOA 2XD2A 1SBPA 1N04A 2XHDA 2FHYA 4G8NA 1FPEA 1B4HA 2H5YA 1MXWA 4OESA 4BDNA 3MAMA 3RTWB 1FJ6A 2FA7A 3E79A 3ZSFA 3LC8A 3IB2A 3QUFA 4PFYA 4XFEA 2ZYMA 3QK6A 3Q29A 1YZ0A 1I69A 2E1SA 5KCJA 2DYXA 3DP6A 4R9GA 3W15C 1H76A 4ND9A 4H46A 5I3SA 1Y4TA 2E0SA 4NF6B 3UK4A 1IZ1A 5AE4A 3OO6A 5IGAA 1I6BA 1B3GA 2XWKA 3QSLA 4OEVA 3MWBA 4JVCA 4MIJA 4LN5A 3EQ1A 3T9UA 2ZNUA 1QKAA 2PBWA 1HSJA 1NV4A 5JK4A 2XXTA 3MQ9A 4LUBA 5I57B 2DP8A 4GWYA 2F6GA 4NTLA 1B58A 1NMUA 1B46A 4QSEA 3CFLA 4FATA 1IMDA 4H65A 3KJ7A 1K9YA 4OEUA 2CMOA 4MBPA 4JDFA 1NV0A 1Y1MA 5FTIA 3TMGA 4MCOA 3PUXE 1LEVA 1UTBB 4H1XA 2VGQA 5LDZA 3C9HA 2V3UA 4OHNA 3CG1A 1B7UA 4PFUA 3SEXA 3RT6B 2OWSA 2KQZA 1US4A 1B0LA 1B1HA 4ZS9A 1Y1ZA 3OSRA 4NN3A 4DCXA 1B7ZA 2QMXA 3C4MA 4LQ5A 3UGWA 2OPDA 4E0WA 3RNNA 2F7CA 2ZYKA 4XXUA 1OVBA 3RPLB 3FVGA 1FBDA 3FV2A 1QUJA 2PYYA 3JYRA 3H6TA 3SEYA 4U4SA 5H8NA 4OANA 3CRBA 1FTJA 2BJIA 2FNCA 1LCFA 1A99A 1FTLA 3SDFA 1IMFA 3H3GA 2Y7IA 3O97A 1RYXA 1FTKA 1SI1A 4ELQA 2I58A 4F3PA 5I7IA 4PF6A 1MH3A 3TTMA 3KBRA 3G3FA 1H44A 5KDTB 3IX1A 1FBCA 1URDA 4H5FA 3S9MC 5L8DA 4QBAA 2R8TA 4WKMA 2DDKA 2DWJA 2XX8A 2P3VA 3TEPA 4JB7A 3O66A 1R9QA 2A5TA 2F6PA 1QW0A 4IO6A 1Y4CA 1I6QA 3MVXA 1FQFA 3A3UA 4YB6A 3TDJA 1NUYA 4H5GA 3K02A 4OFJA 4F3GA 3PTYA 2O1MA 1RKMA 5I2KB 3VVDA 4IO5A 1USYE 1KZ8A 1LGBC 3NOHA 2I3WA 1XVYA 1ZTYA 2XXQA 4F22A 4WEPA 1N7WA 4Q30B 2GQ1A 3MVWA 1B2HA 3H6UA 4F29A 2DE3A 2FIEA 1LBBA 5JTYB 5I5PA 2WYPA 1Y9UA 1AL3A 1POTA 5DYHA 3IO4A 4RA1A 1UIVA 1B3EA 4YKKA 3HHFA 2Q89A 3OOAA 3OELA 2B3BA 2RKMA 4NWCA 3MVYA 4OVPA 5DVJA 3FIRA 4DCYA 1P1QA 3SEVA 2X26A 3RGYA 5H8NB 3MSTA 3KC0A 2ANJA 1IXGA 4KI0E 3U1OA 2THIA 3G3IA 1JEUA 2F8DA 3TCHA 1D9VA 1B05A 1LSTA 3OENA 1LBYA 2OZZA 4G4PA 5I58A 1VDWA 3FD3A 4NF4B 1RDZA 2UVHA 3B6WA 3VVEA 1IEJA 1M5FA 2V3TA 1NFTA 4GRKA 2Y7WA 4YB5A 2H4IA 4P0GA 4IY6A 4FBPA 1NNPA 3O9PA 3VXBA 4GXSB 1AMFA 3TPAA 3T0JA 2DWHA 5ET5A 3V5AA 4GOTA 5H8QB 3KN8A 2Y5LA 3MP8A 1LFIA 3KN7A 5EQ9A 4XF5A 2XXYA 5CM6A 4GWUA 3RPLA 3TELA 3K1MA 3GZGA 1B9JA 4GD5A 3OXNA 1TWYA 4FORA 4OA4A 4DZ1A 2QSXA 2Z23A 4R6KA 1LAXA 3B7DA 1VSOA 4XKQA 3TTKA 4LZ8A 3V83A 1B51A 1OMPA 3PUVE 3LSLA 4KCDA 2ZYOA 3MYUA 5DVFA 3B8BA 2F7BA 2Q2AA 1MPCA 4ESXA 2HZLA 2O7UA 1PB7A 4MNIA 1IIWA 1AWBA 4DXCA 3MPKA 1NV7A 1QGXA 1GTKA 2NOOA 1MS7A 3DELB 1BTJA 4ESWA 4NEDA 3S9NC 3GLBA 3DLNA 4TOZA 2I48A 1OQHA 3CSGA 1NUXA 5K2YA 5DT6A 2PCRA 3BIGA 3IJXB 2RCBA 4GFRA 3TQWA 4NF0A 4QHQA 5KCJB 2XXXA 3T9VA 4NF8B 1DPEA 4JBZA 2VPNA 1MXUA 5AA3A 4XKPA 2ESNA 3FXQA 4PFWA 4Q5TA 2XXRA 4PCDA 3PUWE 4Z7EA 4KYEA 5A5XA 4F3BA 3HV1A 3VFJA 1ZKBA 2P3NA 3VDFA 4PF8A 5CBRA 2X7QA 4G8MA 2RCAA 1NV3A 3RPWA 4X48A 4NGUA 2QS2A 1IXCA 4R73A 1TXFA 3GYYA 2RC7A 4U22A 3Q26A 5IZ3A 4XIGQ 5BUUA 5LTCA 1D9QA 2QMWA 5CI5A 3S9LC 4EDPA 4NF6A 1N7XA 4X1DA 3TUSA 2XWIA 1OLCA 1UTHB 1IMAA 1URGA 4O3AA 3IAZA 5ITPA 1P1UA 3WAFA 3HFUA 3FVKA 1EYIA 4R2BA 4ZDMA 1NUWA 1DOTA 2KLFA 3FGSA 2M8CA 3BIHA 2Z22A 3U93A 1M5EA 3VE1B 4HCWA 4L17A 2O51A 3OO7A 3T66A 4F3SA 1HSLA 3E3KA 1DTZA 4MF3A 3G3JA 3RUMA 4KPTA 3O6IA 4F1YA 1R6ZA 3K4UA 1FBFA 1BP5A 1II5A 2DXYA 3IR1A 4N4UA 4ZE9A 4M4GA 1MY2A 2H99A 3EPEA 1R1NA 1SW5A 2OWZA 3D4CA 3O6HA 5IM2A 2CEXA 2H98A 4G8HA 2Y7KA 3O29A 1N3XA 1YAEA 3SERA 3H6VA 1TFDA 4OZ9A 3TAJA 1LBCA 4PETA 1MQIA 3G7WA 1MDQA 4ONYA 3FVOA 1ZIUA 2GHBA 2HFBA 3U94A 4THIA 1LAFE 1IXIA 5TPAA 5ET6A 1LFGA 1Y3NA 1LBWA 1SPIA 4P8BA 2F3DA 4GQOA 3CI8A 3UORA 3OEKA 2I0CA 3T9HB 4NF5A 4NF4A 2VPOA 4R2FA 2Y84A 3ONMA 3FV1A 3TODA 1DSNA 1MXVA 3A3CA 2PFZA 1FRPA 3C31A 4Z0IA 1MH4A 1JW5A 1FPKA 1NV6A 5BWJA 4IR8A 4ZE8A 3IOTA 3S2VA 3IB0A 4O3BA 3O6GA 5EQAA 3DP8A 4ISUA 2CEYA 3IK6B 1XC1A 2PT2A 4OERA 3B50A 1B3LA 1FQDA 4NAPA 5ET8A 4QFKA 4QSCA 4IY5A 3W9VA 1UTHA 4QRZA 2UVJA 3I3VA 5FHNA 3IJOB 4GX3A 3HSTA 5EYGA 2HCAA 5CRYA 4YZZA 2QS1A 4PQJA 2H9BA 3ZKLA 1R9LA 3PMXA 1B3FA 1YPNA 2WX9A 4IO3A 1VFEA 4FECA 3K0VA 1B32A 3IL1B 1LAGE 1AH5A 1PBPA 2D5WA 4U1OA 4F1VA 4DIGA 2REJA 1Q1KA 1QULA 1FPFA 2F7AA 2ONKE 4NWDA 1FTMA 4FEBA 4M1VA 4R6YA 1EH3A 3PUYE 3PPNA 1O7TA 4I62A 2QVRA 5TP9A 4PGPA 4RK9A 2BJJX 5J1DA 1PEBA 2Q88A 2OK2A 2WKYA 1NNTA 1G0IA 2F35A 4PFTA 1GV8A 3ILTB 3TTNA 1N76A 3M3KA 4NQ8A 1Q9DA 4GWOA 2QRYA 3EF7A 3FJ7A 1FTAA 3B6TA 2V3QA 4LATA 4OFOA 4GBWA 3MJNA 3CR9A 1IUDA 1MRPA 5L9OA 1XI6A 1RYOA 4KFQA 3G3HA 4EUOA 5AA2A 2YJPA 2DVCA 1NL5A 4ZZAA 4PBHA 5ESYA 2P2AA 3QXMA 1WVJA 2HXRA 1H3DA 1OIBA 4GIZA 2FVZA 1FQCA 3H7MA 2P1SA 2I4BA 4HE1A 3BFUA 1FBGA 4FE8A 1B0HA 1B40A 3KN3A 4P9KA 3O28A 2A5SA 4AB5A 4FIMA 1JW4A 4RXLA 1NV1A 4K3FA 1P99A 4IO7A 4LVQA 2X7PA 1DBZA 4NMYA 4IB2A 4GBVA 1KA1A 4KR5A 3D4GA 3PD8A 4HS7A 4BDMA 3E13X 4GF8A 2DSFA 2XD3A 3VXCA 1YTVA 4DI4B 3PUZE 3FUZA 3BFTA 3PPOA 2I49A 3LR1A 4I1DA 4Q8RA 5CBSA 3TCGA 2Q2CA 3IO6A 3IFCA 2VHAA 3W9WA 4HW8A 1B5JA 2HPGA 4KCCA 4I40A 2Y5KA 2FIXA 3PGFA 4PAFA 1XT8A 3MVZA 4YKJA 1NI9A 5DEXB 1FBEA 2Y7RA 2DWAA 1MXYA 1M5BA 4FJPA 1B4ZA 2CZKA 3IORA 2VT5A 2XWVA 4HXVA 4H0WA 3WAEA 1B52A 3F11A 4ZEFA 3A29A 2P0SA 5H8SA 1ZBMA 1JVXA 4TQUQ 1ELJA 2OLBA 4N07A 5FHOA 3MBPA 2XXVA 4ZEKA 1SI0A 3V8XB 2GH9A 1AOVA 5I59B 4XKRA 4GL0A 1O64A 2Y7PA 3VLWA 1QJMA 1NKXA 5IZ1A 4LZ5A 4MEVA 5J16A 1POY1 3FXBA 3RT8A 1ZU0A 3T22A 4EF1A 4MHFA 2XXWA 2DS9A 3FJMA 4YKPA 4GXAA 3K1PA 1CB6A 2KR0A 1ZLQA 4U4XA 1XHYA 2AL4A 3OSQA 4BLAA 4C0RA 4U1ZA 4PFIA 3FZVA 5CMMA 4ZZEA 5I58B 3GBAA 1VE4A 4POWA 1MXZA 4ZEDA 4QFLA 3C36A 3PD9A 3E4RA 1SW1A 3PMVA 2RC9A 1N0TA 5FTHA 1Y3PA 2WBBA 3FXRA 4PC9A 1OQGA 4AS5A 4WEDA 4P3LA 1MQGA 5EQ7A 3KEIA 1NUZA 2ALUA 2WBDA 4QFNA 3ECRA 2DOJA 5CMCA 1PBQA 4IO2A 1KA0A 4F1UA 5EHSA 2AYSA 3JV9A 4JVDA 4PFBA 4ELRA 1YYZA 4JWOA 4OQOA 4G2ZA 2CZLA
chains in the Genus database with same CATH topology
2OWZA 2FHYA 5EYGA 5IZZA 4HE1A 1LEVA 4O7MA 4H45A 4FBPA 4MAGA 1FBGA 1NV5A 2L5VA 4O7IA 5LDZA 4PCDA 1FSAA 2CEXA 4P9KA 1LBZA 2WEFA 3T0JA 2Q8MA 4YZZA 1FPEA 5ET5A 2DVZA 4NHBA 4X8RA 4XEQA 1FPJA 1NUYA 4DI3D 4F19A 2Y5LA 4G61A 2KQZA 1G0HA 5EQ9A 4P1LA 4XF5A 2P3NA 3PTYA 2JJKA 1FJ6A 2WX9A 2B4LA 3FBPA 4PAIA 3E79A 5EQ8A 2F3BA 4PF8A 5CM6A 3ISPA 4X04A 1EYJA 1FPBA 2HHMA 2V4CA 3CHGA 1FPGA 5DW8A 1KZ8A 5EYHA 5T3JA 4PE3A 4NN3A 4XFEA 4GWUA 3RPLA 4GX6A 1NV1A 2PFYA 3NOHA 1NV3A 1FBPA 1YZ0A 4MX6A 2CZHA 1DBZA 2XXKA 4F1VA 3QMFA 5IZ1A 4MEVA 5J16A 4GBVA 4NGUA 1EYKA 4OA4A 2GQ1A 2WYKA 2ZZWA 1FPFA 4H46A 1CNQA 1KA1A 5I3SA 3FXBA 3GYYA 4MNPA 4PETA 2QVUA 4N6KA 3RYDA 2ZZVA 3KBZA 4P1EA 4PBQA 5IZ3A 2OX3A 5LTCA 1D9QA 4O8MA 2DE4A 2DE3A 2Q74A 4PAKA 4GWZA 4N6DA 4JVIA 4MMPA 4MHFA 2FIEA 4P47A 4N15A 4OVRA 1JP4A 3RPLB 4M1VA 5IGAA 1LBXA 4DI4B 5I5PA 1NV2A 2ZZXA 4N91A 2WYPA 1FBDA 2B4MA 2QFLA 2XWIA 5ET6A 2XWKA 4OVSA 1LBWA 1SPIA 4P8BA 4PDDA 1IMAA 1DK4A 1INPA 5IM2A 2F3DA 3MYUA 2QVRA 2KR0A 1K9ZA 4JVCA 4MIJA 3B8BA 4LN5A 3IFCA 4KXPA 4N17A 4PGPA 4OANA 3HFUA 4HE2A 1EYIA 1FPDA 4GWSA 1NUWA 2HZLA 1FPLA 3EKIA 4N8YA 5J1DA 4MNIA 4AS4A 2VPOA 1AWBA 3LV0A 4PFIA 3W9WA 1YXIA 2BJIA 1G0IA 1IMBA 1NV4A 3BIHA 4OVPA 3T1BA 1NV7A 1QGXA 1IMFA 4F18A 5JK4A 1IMCA 2HPGA 2QPQA 1FPIA 4HCYA 4I40A 4NX1A 2Y5KA 4X9TA 5ET7A 3U65A 2FIXA 2XA5A 2PFZA 4NQ8A 5IZ3B 4PAFA 4QXDA 4HCWA 1Q9DA 1FRPA 3MSTA 3KC0A 4GWYA 3SZPA 1FJ9A 1FBHA 1FTAA 4PTKA 1FPKA 2CZIA 1NI9A 3IFAA 5I7IA 2V3QA 1NV6A 4PF6A 3KC1A 1LBVA 1FBEA 4MJOA 3ROJA 4PGNA 1RDXA 2WBBA 4IR8A 2F5XA 4PC9A 4PDHA 1IMDA 4GBWA 1NUXA 1LBYA 4AS5A 1RDYA 5EQAA 4MNCA 2CEYA 4N8GA 2Q9TA 4NG7A 1K9YA 4P3LA 2PCRA 3D1RA 1BK4A 4GX4A 1XI6A 1NUZA 5EQ7A 3BIGA 1DCUA 1VDWA 2WBDA 4YICA 1FBCA 2CZKA 2MKZA 2XWOA 3B50A 4UABA 4NF0A 1RDZA 2QVVA 2VT5A 4P56A 4I3EA 1FBFA 2DE2A 2XWVA 4NAPA 1NV0A 5ET8A 4OVQA 4QBAA 2R8TA 4HXVA 5ESYA 1KA0A 5FBPA 4PBHA 3W9VA 4F1UA 2DDKA 4GWXA 4GWWA 3LUZA 4OVTA 4N4UA 3A29A 2VPNA 2FBPA 2P3VA 4JVDA 5F24A 4PFBA 3E78A 4I3YA 4HE0A 2HZKA 2HXRA 4N81A 1YYZA 4GX3A 5A5LA 4O94A 1IMEA 2FVZA 4MCOA 4PFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWZ A;  2FHY A;  5EYG A;  4HE1 A;  1LEV A;  4H45 A;  4FBP A;  1FBG A;  1NV5 A;  4O7I A;  5LDZ A;  1FSA A;  1LBZ A;  2WEF A;  3T0J A;  2Q8M A;  1FPE A;  5ET5 A;  1FPJ A;  1NUY A;  2Y5L A;  4G61 A;  1G0H A;  5EQ9 A;  2P3N A;  2JJK A;  1FJ6 A;  3FBP A;  5EQ8 A;  2F3B A;  1EYJ A;  1FPB A;  2HHM A;  1FPG A;  5DW8 A;  1KZ8 A;  5EYH A;  5T3J A;  4GWU A;  3RPL A;  4GX6 A;  1NV1 A;  1NV3 A;  1FBP A;  1YZ0 A;  2CZH A;  1DBZ A;  3QMF A;  5IZ1 A;  5J16 A;  4GBV A;  1EYK A;  2GQ1 A;  1FPF A;  4H46 A;  1CNQ A;  1KA1 A;  5I3S A;  2QVU A;  3RYD A;  3KBZ A;  5IZ3 A;  2OX3 A;  1D9Q A;  2Q74 A;  4GWZ A;  2FIE A;  1JP4 A;  3RPL B;  1LBX A;  1NV2 A;  1FBD A;  2QFL A;  5ET6 A;  1LBW A;  1SPI A;  1IMA A;  1DK4 A;  1INP A;  2F3D A;  2QVR A;  1K9Z A;  3B8B A;  3IFC A;  4KXP A;  4HE2 A;  1EYI A;  1FPD A;  4GWS A;  1NUW A;  1FPL A;  4AS4 A;  1AWB A;  3LV0 A;  1YXI A;  2BJI A;  1G0I A;  1IMB A;  1NV4 A;  3BIH A;  1NV7 A;  1QGX A;  1IMF A;  1IMC A;  1FPI A;  4I40 A;  2Y5K A;  5ET7 A;  2FIX A;  5IZ3 B;  4QXD A;  1Q9D A;  1FRP A;  3KC0 A;  4GWY A;  1FJ9 A;  1FBH A;  1FTA A;  4PTK A;  1FPK A;  2CZI A;  1NI9 A;  3IFA A;  1NV6 A;  3KC1 A;  1LBV A;  1FBE A;  4MJO A;  3ROJ A;  1RDX A;  2WBB A;  4IR8 A;  1IMD A;  4GBW A;  1NUX A;  1LBY A;  4AS5 A;  1RDY A;  5EQA A;  1K9Y A;  2PCR A;  3D1R A;  1BK4 A;  4GX4 A;  1XI6 A;  1NUZ A;  5EQ7 A;  3BIG A;  1DCU A;  1VDW A;  2WBD A;  1FBC A;  2CZK A;  1RDZ A;  2QVV A;  2VT5 A;  4I3E A;  1FBF A;  1NV0 A;  5ET8 A;  2R8T A;  4HXV A;  5ESY A;  1KA0 A;  5FBP A;  2DDK A;  4GWX A;  4GWW A;  3LUZ A;  3A29 A;  2FBP A;  2P3V A;  5F24 A;  4I3Y A;  4HE0 A;  4N81 A;  1YYZ A;  4GX3 A;  5A5L A;  1IME A;  2FVZ A; 
#chains in the Genus database with same CATH topology
 2D3I A;  4H45 A;  4MAG A;  5CMB A;  4O7I A;  2G93 A;  3MW0 A;  2O68 A;  5KZT A;  1FPJ A;  3HO7 A;  1B3H A;  1KWH A;  2AL5 A;  1A40 A;  4XTC Q;  4MLQ A;  2B4L A;  1D9Y A;  2F3B A;  1B5I A;  1MG1 A;  4PE3 A;  5T3J A;  4JWY A;  3U92 A;  2I3V A;  2Q8J A;  2ZZW A;  4FAJ A;  1JNF A;  1P1W A;  2QS4 A;  4N6D A;  4OMB A;  3TKD A;  4DI3 D;  4ELO A;  4RYA A;  1QKB A;  3PU5 A;  3PPR A;  4YB7 A;  2Z8E A;  3SET A;  1YXI A;  3T1B A;  3S9E A;  4TLM B;  5IZ3 B;  3MZ1 A;  4QF9 A;  3T9X B;  4G68 C;  1IXH A;  3SZP A;  1FBH A;  1TT1 A;  4PTK A;  1IIT A;  2CZI A;  4O3C A;  1XOC A;  2HXW A;  2F36 A;  1MQD A;  4P0I A;  1PC3 A;  4PDH A;  4GX4 A;  1TFA A;  4R75 A;  1MM7 A;  2XWO A;  3KZG A;  4UAB A;  4OFL A;  3LBS A;  4BDO A;  5FBP A;  4ELP A;  4H6D A;  3TQL A;  3KG2 A;  4RK2 A;  4OVT A;  5ICQ A;  1Y20 A;  2OJT A;  3S4U A;  4O94 A;  1QUI A;  2LAO A;  5CC2 A;  5I56 A;  3PPP A;  1B5H A;  3K6U A;  2B3F A;  4BDR A;  2R71 A;  4IGR A;  1NV5 A;  3I5O A;  1SYI A;  2QL3 A;  1LBZ A;  1UIU A;  2NWJ A;  4XEQ A;  3EHS A;  3K6W A;  4NHB A;  4TLL B;  1FQA A;  4IGT A;  4GL8 A;  4F39 A;  1G0H A;  4P1L A;  2PT1 A;  5AA2 B;  1O63 A;  3ISP A;  4C1U A;  4NE4 A;  2I0B A;  4Q0C A;  4EQB A;  1SVX B;  2PFY A;  3V89 B;  3LSF B;  1EU8 A;  1SYH A;  2XXK A;  4EQ9 A;  1S50 A;  2V93 A;  3MC2 A;  2V84 A;  1VFD A;  1DTG A;  3EN3 A;  3T96 B;  4XKN A;  4E0X A;  2DE4 A;  3M8U A;  3B6Q A;  4PDD A;  4N6P A;  5ICT A;  3M3L A;  1B6H A;  3K6X A;  2XXU A;  3R6U A;  3H06 B;  2GRV A;  2O6A A;  4GWS A;  4JSO A;  4QSD A;  5DVI A;  3EHT A;  3HPI A;  4ZEC A;  4F18 A;  1FPI A;  3R26 A;  3DM0 A;  1LCT A;  1XS5 A;  2R9J A;  3FAS A;  1XVX A;  2Z8F A;  3ZS6 A;  2REG A;  3KGC A;  3SEW A;  2XXP A;  4LON B;  1DPP A;  3VLU A;  4AB6 A;  1AIV A;  4UAC A;  1QUK A;  2IA4 A;  3GXA A;  4EF2 A;  1B1X A;  1BIY A;  5CMK A;  4KYD A;  3TTR A;  3L6H A;  3E78 A;  5ELV A;  2OCU A;  3PV0 E;  1UTB A;  4H67 A;  2NVU B;  3QYT A;  1SW2 A;  1FSA A;  3U8Q A;  2VP1 A;  2WEF A;  5H8H A;  5TP9 B;  1FCK A;  2JJK A;  4R74 A;  1USY H;  2HHM A;  3CHG A;  1M5C A;  1WOD A;  3IB1 A;  3N26 A;  3N6T A;  1I6A A;  3MP6 A;  3TTL A;  4R72 A;  4OET A;  2OBG A;  4LZ7 A;  2B65 A;  2WYK A;  3O2A A;  4G77 A;  1Q35 A;  5ITO A;  1PDA A;  4P1E A;  3KBZ A;  1MY1 A;  4OVS A;  5EYF A;  3C35 A;  1INP A;  4NF5 B;  4G68 B;  2NUV A;  2F34 A;  2ZNS A;  2ONR A;  4N8Y A;  1A54 A;  2UVI A;  4DXU A;  3LV0 A;  3CFX A;  1IMB A;  1GVC A;  5JTY A;  1FTO A;  4NX1 A;  4MFI A;  3FAT A;  1QVS A;  3K6V A;  2GHA A;  1CE2 A;  2DXR A;  1HSE A;  5L9S A;  5HBC A;  3RN8 A;  1JET A;  3PMW A;  2HAV A;  2FYI A;  4H8I A;  2F5X A;  1B7H A;  3G3G A;  1L5T A;  2PMS A;  2OWT A;  2I4C A;  1DCU A;  2ZXT A;  4I9D A;  4AQ4 A;  3ZKK A;  4GWX A;  4QFP A;  3LSW A;  4GWW A;  5H8Q A;  2PVU A;  3LUZ A;  4DE8 A;  4YU0 A;  1J1N A;  5F24 A;  4YKI A;  4HE0 A;  1GGG A;  5A5L A;  2O7I A;  1NNK A;  5IKB A;  2A5T B;  2ABH A;  4U2R A;  4O7M A;  4OXV A;  2HEU A;  2RC8 A;  3IOU A;  3A09 A;  4F2Q A;  4X8R A;  4G61 A;  2RIN A;  2VOZ A;  1URS A;  5IAI A;  4KHZ E;  5EQ8 A;  3ODB A;  3RLF E;  4HTG A;  4U23 A;  1T0K A;  3T93 B;  3N94 A;  4F31 B;  2CZH A;  2PX1 A;  1F9B A;  2H25 A;  2QJE A;  3K2D A;  3UIF A;  1EYK A;  5H8F B;  4MNP A;  3N6U A;  4N6K A;  5AA4 A;  4PBQ A;  3MZ9 A;  1OVT A;  4O8M A;  2Q74 A;  4PAK A;  4C1T A;  4KYS A;  4JVI A;  5F7V A;  2YPN A;  1Z7N E;  3RQT A;  3FVN A;  3UN6 A;  3QAX A;  2UVG A;  3USD A;  1Y3Q A;  4N17 A;  3KJT A;  3K1N A;  1WDN A;  3SKP A;  3TFL A;  3QIM A;  2QPQ A;  4HCY A;  3Q28 A;  2XX9 A;  4P11 A;  2W7Y A;  1PB9 A;  3AXF A;  3VVF A;  4QXD A;  4R6H A;  2DWI A;  3RY3 A;  1FJ9 A;  3SES A;  3KC1 A;  3MP1 A;  1RDX A;  2Z8D A;  4N8G A;  1BK4 A;  1D4N A;  1JQF A;  3VV5 A;  1ANF A;  4OVQ A;  4DXB A;  2D21 A;  1MY4 A;  1Z7M E;  1N84 A;  1LLS A;  4G68 A;  1FW0 A;  4ECF A;  5A5X B;  3MZB A;  1MM6 A;  4OTE A;  1UQW A;  2HZK A;  1IME A;  3IOV A;  1ZMG A;  4PFR A;  4RJZ A;  5IZZ A;  3E9X A;  4X1B A;  3PPQ A;  5DEX A;  2UXA A;  1P1N A;  2L5V A;  3HHG A;  3KSX A;  5JEI A;  3K00 A;  3KFM A;  2Q8M A;  4NF8 A;  3VLV A;  2ONS A;  1JW1 A;  4H8J A;  1H45 A;  3JZJ A;  3FBP A;  1A8F A;  1LB9 A;  5HM4 B;  2VD2 A;  1FBP A;  4EXL A;  2DQV A;  3TCF A;  1NH7 A;  1A55 A;  3ILU B;  4KQP A;  5I57 A;  2OX3 A;  3TYH A;  1YCJ A;  3THI A;  2XX7 A;  4MMP A;  4P47 A;  4OVR A;  1JP4 A;  4QFO A;  2ZZX A;  2QFL A;  2AIX A;  4RPO A;  1M5D A;  3R7X A;  3TZA A;  1US5 A;  3C32 A;  5AA2 D;  4F2O A;  5B7D A;  1JEV A;  4R9F A;  4PE5 B;  4OVJ A;  1IQ7 A;  4JWX A;  4MJO A;  4PGN A;  2HAU A;  2G29 A;  4EXK A;  2ZMB A;  1BLF A;  1RDY A;  4MNC A;  2Q9T A;  5ISU A;  3D1R A;  3OMB A;  4YIC A;  2MKZ A;  4LQ2 A;  4P56 A;  3P7I A;  4KD5 A;  3OO8 A;  5I2N B;  1D3K A;  5B70 A;  1LFH A;  1FQE A;  2YLN A;  3C34 A;  1P1O A;  3IOW A;  4I3Y A;  4N81 A;  3CVG A;  1LB8 A;  4DDD A;  4F19 A;  3G3K A;  1MY3 A;  4PP0 A;  4MLV A;  3CSB A;  4IO4 A;  2GFE A;  3C33 A;  4BDL A;  1PB8 A;  2DVZ A;  5H8F A;  4GLI A;  5EHM A;  1ATG A;  3LSX A;  5I2N A;  4PAI A;  5HPQ A;  1FPB A;  2V4C A;  4BDQ A;  5DW8 A;  3DP4 A;  2XXI A;  3MPL A;  3CIJ A;  1S7Y A;  3Q25 A;  4MX6 A;  2VD3 A;  5I56 B;  1A7L A;  1EZP A;  2I6E A;  1CNQ A;  4OEN A;  2QVU A;  3H4Z A;  2ZZV A;  5M2V A;  3LUY A;  4RY1 A;  1H43 A;  2UYF A;  4OYV A;  4GWZ A;  3SEU A;  3OO9 A;  1LBX A;  4N91 A;  2R6G E;  2V25 A;  3GBB A;  1OLA A;  1MQJ A;  4KXP A;  3UA8 A;  4HE2 A;  1FPD A;  1MPD A;  1MQH A;  4POX A;  1FPL A;  4AS4 A;  3OD7 A;  3FXU A;  4X9T A;  4YMB A;  5ET7 A;  3U65 A;  3OEM A;  2XA5 A;  4GVO A;  4RNS A;  2UYE A;  3Q27 A;  4FED A;  3N5L A;  4U21 A;  3KOS A;  2IEE A;  5I84 A;  5I2K A;  1SQY A;  4ZEI A;  1MPB A;  2QVV A;  3HCQ A;  4I3E A;  5TU0 A;  2DE2 A;  1ZJL A;  3MUQ A;  1EZO A;  4YMA A;  3I6V A;  1A8E A;  2ZNT A;  4WXJ A;  3CFZ A;  3HN0 A;  5AA4 B;  5DTB A;  2F97 A;  3KSJ A;  3CG3 A;  3L6G A;  1GR2 A;  3QUJ A;  4UA8 A;  3KOT A;  3BKI B;  5KDT A;  3UP9 A;  1FQB A;  4X04 A;  1EYJ A;  3H6W A;  1FPG A;  2OPE A;  5EYH A;  1NH8 A;  1NNF A;  4ZEB A;  4GX6 A;  4YAH X;  2XXH A;  1DMB A;  5LOM A;  3BBR A;  1S9T A;  3QMF A;  5H8H B;  3M3F A;  2HQ0 A;  1VR5 A;  1SDX A;  3RYD A;  4N13 A;  5TPA B;  4RPN A;  3U72 A;  4N15 A;  1SW4 A;  2QS3 A;  1NV2 A;  1JVY A;  2B4M A;  1SD3 A;  1DK4 A;  3RTF B;  3EHU A;  1K9Z A;  4JXI A;  4LA9 A;  3EKI A;  5FHM A;  5K2X A;  2RF1 A;  4JSD A;  4MH5 A;  1MXX A;  1IMC A;  2ZYN A;  5I59 A;  3K01 A;  3H03 A;  2O1L A;  1EZ9 A;  4LP2 B;  1MDP 1;  5AA1 A;  4EQ7 A;  3IFA A;  4OWD A;  1LAH E;  1MY0 A;  4DLD A;  1LBV A;  3ROJ A;  4NG7 A;  1N3W A;  2O84 X;  3FJG A;  4I8C A;  2O69 A;  1BKA A;  5F1Q A;  2F78 A;  5L9M A;  2FBP A;  2NXO A;  2XD2 A;  1SBP A;  1N04 A;  2XHD A;  2FHY A;  4G8N A;  1FPE A;  1B4H A;  2H5Y A;  1MXW A;  4OES A;  4BDN A;  3MAM A;  3RTW B;  1FJ6 A;  2FA7 A;  3E79 A;  3ZSF A;  3LC8 A;  3IB2 A;  3QUF A;  4PFY A;  4XFE A;  2ZYM A;  3QK6 A;  3Q29 A;  1YZ0 A;  1I69 A;  2E1S A;  5KCJ A;  2DYX A;  3DP6 A;  4R9G A;  3W15 C;  1H76 A;  4ND9 A;  4H46 A;  5I3S A;  1Y4T A;  2E0S A;  4NF6 B;  3UK4 A;  1IZ1 A;  5AE4 A;  3OO6 A;  5IGA A;  1I6B A;  1B3G A;  2XWK A;  3QSL A;  4OEV A;  3MWB A;  4JVC A;  4MIJ A;  4LN5 A;  3EQ1 A;  3T9U A;  2ZNU A;  1QKA A;  2PBW A;  1HSJ A;  1NV4 A;  5JK4 A;  2XXT A;  3MQ9 A;  4LUB A;  5I57 B;  2DP8 A;  4GWY A;  2F6G A;  4NTL A;  1B58 A;  1NMU A;  1B46 A;  4QSE A;  3CFL A;  4FAT A;  1IMD A;  4H65 A;  3KJ7 A;  1K9Y A;  4OEU A;  2CMO A;  4MBP A;  4JDF A;  1NV0 A;  1Y1M A;  5FTI A;  3TMG A;  4MCO A;  3PUX E;  1LEV A;  1UTB B;  4H1X A;  2VGQ A;  5LDZ A;  3C9H A;  2V3U A;  4OHN A;  3CG1 A;  1B7U A;  4PFU A;  3SEX A;  3RT6 B;  2OWS A;  2KQZ A;  1US4 A;  1B0L A;  1B1H A;  4ZS9 A;  1Y1Z A;  3OSR A;  4NN3 A;  4DCX A;  1B7Z A;  2QMX A;  3C4M A;  4LQ5 A;  3UGW A;  2OPD A;  4E0W A;  3RNN A;  2F7C A;  2ZYK A;  4XXU A;  1OVB A;  3RPL B;  3FVG A;  1FBD A;  3FV2 A;  1QUJ A;  2PYY A;  3JYR A;  3H6T A;  3SEY A;  4U4S A;  5H8N A;  4OAN A;  3CRB A;  1FTJ A;  2BJI A;  2FNC A;  1LCF A;  1A99 A;  1FTL A;  3SDF A;  1IMF A;  3H3G A;  2Y7I A;  3O97 A;  1RYX A;  1FTK A;  1SI1 A;  4ELQ A;  2I58 A;  4F3P A;  5I7I A;  4PF6 A;  1MH3 A;  3TTM A;  3KBR A;  3G3F A;  1H44 A;  5KDT B;  3IX1 A;  1FBC A;  1URD A;  4H5F A;  3S9M C;  5L8D A;  4QBA A;  2R8T A;  4WKM A;  2DDK A;  2DWJ A;  2XX8 A;  2P3V A;  3TEP A;  4JB7 A;  3O66 A;  1R9Q A;  2A5T A;  2F6P A;  1QW0 A;  4IO6 A;  1Y4C A;  1I6Q A;  3MVX A;  1FQF A;  3A3U A;  4YB6 A;  3TDJ A;  1NUY A;  4H5G A;  3K02 A;  4OFJ A;  4F3G A;  3PTY A;  2O1M A;  1RKM A;  5I2K B;  3VVD A;  4IO5 A;  1USY E;  1KZ8 A;  1LGB C;  3NOH A;  2I3W A;  1XVY A;  1ZTY A;  2XXQ A;  4F22 A;  4WEP A;  1N7W A;  4Q30 B;  2GQ1 A;  3MVW A;  1B2H A;  3H6U A;  4F29 A;  2DE3 A;  2FIE A;  1LBB A;  5JTY B;  5I5P A;  2WYP A;  1Y9U A;  1AL3 A;  1POT A;  5DYH A;  3IO4 A;  4RA1 A;  1UIV A;  1B3E A;  4YKK A;  3HHF A;  2Q89 A;  3OOA A;  3OEL A;  2B3B A;  2RKM A;  4NWC A;  3MVY A;  4OVP A;  5DVJ A;  3FIR A;  4DCY A;  1P1Q A;  3SEV A;  2X26 A;  3RGY A;  5H8N B;  3MST A;  3KC0 A;  2ANJ A;  1IXG A;  4KI0 E;  3U1O A;  2THI A;  3G3I A;  1JEU A;  2F8D A;  3TCH A;  1D9V A;  1B05 A;  1LST A;  3OEN A;  1LBY A;  2OZZ A;  4G4P A;  5I58 A;  1VDW A;  3FD3 A;  4NF4 B;  1RDZ A;  2UVH A;  3B6W A;  3VVE A;  1IEJ A;  1M5F A;  2V3T A;  1NFT A;  4GRK A;  2Y7W A;  4YB5 A;  2H4I A;  4P0G A;  4IY6 A;  4FBP A;  1NNP A;  3O9P A;  3VXB A;  4GXS B;  1AMF A;  3TPA A;  3T0J A;  2DWH A;  5ET5 A;  3V5A A;  4GOT A;  5H8Q B;  3KN8 A;  2Y5L A;  3MP8 A;  1LFI A;  3KN7 A;  5EQ9 A;  4XF5 A;  2XXY A;  5CM6 A;  4GWU A;  3RPL A;  3TEL A;  3K1M A;  3GZG A;  1B9J A;  4GD5 A;  3OXN A;  1TWY A;  4FOR A;  4OA4 A;  4DZ1 A;  2QSX A;  2Z23 A;  4R6K A;  1LAX A;  3B7D A;  1VSO A;  4XKQ A;  3TTK A;  4LZ8 A;  3V83 A;  1B51 A;  1OMP A;  3PUV E;  3LSL A;  4KCD A;  2ZYO A;  3MYU A;  5DVF A;  3B8B A;  2F7B A;  2Q2A A;  1MPC A;  4ESX A;  2HZL A;  2O7U A;  1PB7 A;  4MNI A;  1IIW A;  1AWB A;  4DXC A;  3MPK A;  1NV7 A;  1QGX A;  1GTK A;  2NOO A;  1MS7 A;  3DEL B;  1BTJ A;  4ESW A;  4NED A;  3S9N C;  3GLB A;  3DLN A;  4TOZ A;  2I48 A;  1OQH A;  3CSG A;  1NUX A;  5K2Y A;  5DT6 A;  2PCR A;  3BIG A;  3IJX B;  2RCB A;  4GFR A;  3TQW A;  4NF0 A;  4QHQ A;  5KCJ B;  2XXX A;  3T9V A;  4NF8 B;  1DPE A;  4JBZ A;  2VPN A;  1MXU A;  5AA3 A;  4XKP A;  2ESN A;  3FXQ A;  4PFW A;  4Q5T A;  2XXR A;  4PCD A;  3PUW E;  4Z7E A;  4KYE A;  5A5X A;  4F3B A;  3HV1 A;  3VFJ A;  1ZKB A;  2P3N A;  3VDF A;  4PF8 A;  5CBR A;  2X7Q A;  4G8M A;  2RCA A;  1NV3 A;  3RPW A;  4X48 A;  4NGU A;  2QS2 A;  1IXC A;  4R73 A;  1TXF A;  3GYY A;  2RC7 A;  4U22 A;  3Q26 A;  5IZ3 A;  4XIG Q;  5BUU A;  5LTC A;  1D9Q A;  2QMW A;  5CI5 A;  3S9L C;  4EDP A;  4NF6 A;  1N7X A;  4X1D A;  3TUS A;  2XWI A;  1OLC A;  1UTH B;  1IMA A;  1URG A;  4O3A A;  3IAZ A;  5ITP A;  1P1U A;  3WAF A;  3HFU A;  3FVK A;  1EYI A;  4R2B A;  4ZDM A;  1NUW A;  1DOT A;  2KLF A;  3FGS A;  2M8C A;  3BIH A;  2Z22 A;  3U93 A;  1M5E A;  3VE1 B;  4HCW A;  4L17 A;  2O51 A;  3OO7 A;  3T66 A;  4F3S A;  1HSL A;  3E3K A;  1DTZ A;  4MF3 A;  3G3J A;  3RUM A;  4KPT A;  3O6I A;  4F1Y A;  1R6Z A;  3K4U A;  1FBF A;  1BP5 A;  1II5 A;  2DXY A;  3IR1 A;  4N4U A;  4ZE9 A;  4M4G A;  1MY2 A;  2H99 A;  3EPE A;  1R1N A;  1SW5 A;  2OWZ A;  3D4C A;  3O6H A;  5IM2 A;  2CEX A;  2H98 A;  4G8H A;  2Y7K A;  3O29 A;  1N3X A;  1YAE A;  3SER A;  3H6V A;  1TFD A;  4OZ9 A;  3TAJ A;  1LBC A;  4PET A;  1MQI A;  3G7W A;  1MDQ A;  4ONY A;  3FVO A;  1ZIU A;  2GHB A;  2HFB A;  3U94 A;  4THI A;  1LAF E;  1IXI A;  5TPA A;  5ET6 A;  1LFG A;  1Y3N A;  1LBW A;  1SPI A;  4P8B A;  2F3D A;  4GQO A;  3CI8 A;  3UOR A;  3OEK A;  2I0C A;  3T9H B;  4NF5 A;  4NF4 A;  2VPO A;  4R2F A;  2Y84 A;  3ONM A;  3FV1 A;  3TOD A;  1DSN A;  1MXV A;  3A3C A;  2PFZ A;  1FRP A;  3C31 A;  4Z0I A;  1MH4 A;  1JW5 A;  1FPK A;  1NV6 A;  5BWJ A;  4IR8 A;  4ZE8 A;  3IOT A;  3S2V A;  3IB0 A;  4O3B A;  3O6G A;  5EQA A;  3DP8 A;  4ISU A;  2CEY A;  3IK6 B;  1XC1 A;  2PT2 A;  4OER A;  3B50 A;  1B3L A;  1FQD A;  4NAP A;  5ET8 A;  4QFK A;  4QSC A;  4IY5 A;  3W9V A;  1UTH A;  4QRZ A;  2UVJ A;  3I3V A;  5FHN A;  3IJO B;  4GX3 A;  3HST A;  5EYG A;  2HCA A;  5CRY A;  4YZZ A;  2QS1 A;  4PQJ A;  2H9B A;  3ZKL A;  1R9L A;  3PMX A;  1B3F A;  1YPN A;  2WX9 A;  4IO3 A;  1VFE A;  4FEC A;  3K0V A;  1B32 A;  3IL1 B;  1LAG E;  1AH5 A;  1PBP A;  2D5W A;  4U1O A;  4F1V A;  4DIG A;  2REJ A;  1Q1K A;  1QUL A;  1FPF A;  2F7A A;  2ONK E;  4NWD A;  1FTM A;  4FEB A;  4M1V A;  4R6Y A;  1EH3 A;  3PUY E;  3PPN A;  1O7T A;  4I62 A;  2QVR A;  5TP9 A;  4PGP A;  4RK9 A;  2BJJ X;  5J1D A;  1PEB A;  2Q88 A;  2OK2 A;  2WKY A;  1NNT A;  1G0I A;  2F35 A;  4PFT A;  1GV8 A;  3ILT B;  3TTN A;  1N76 A;  3M3K A;  4NQ8 A;  1Q9D A;  4GWO A;  2QRY A;  3EF7 A;  3FJ7 A;  1FTA A;  3B6T A;  2V3Q A;  4LAT A;  4OFO A;  4GBW A;  3MJN A;  3CR9 A;  1IUD A;  1MRP A;  5L9O A;  1XI6 A;  1RYO A;  4KFQ A;  3G3H A;  4EUO A;  5AA2 A;  2YJP A;  2DVC A;  1NL5 A;  4ZZA A;  4PBH A;  5ESY A;  2P2A A;  3QXM A;  1WVJ A;  2HXR A;  1H3D A;  1OIB A;  4GIZ A;  2FVZ A;  1FQC A;  3H7M A;  2P1S A;  2I4B A;  4HE1 A;  3BFU A;  1FBG A;  4FE8 A;  1B0H A;  1B40 A;  3KN3 A;  4P9K A;  3O28 A;  2A5S A;  4AB5 A;  4FIM A;  1JW4 A;  4RXL A;  1NV1 A;  4K3F A;  1P99 A;  4IO7 A;  4LVQ A;  2X7P A;  1DBZ A;  4NMY A;  4IB2 A;  4GBV A;  1KA1 A;  4KR5 A;  3D4G A;  3PD8 A;  4HS7 A;  4BDM A;  3E13 X;  4GF8 A;  2DSF A;  2XD3 A;  3VXC A;  1YTV A;  4DI4 B;  3PUZ E;  3FUZ A;  3BFT A;  3PPO A;  2I49 A;  3LR1 A;  4I1D A;  4Q8R A;  5CBS A;  3TCG A;  2Q2C A;  3IO6 A;  3IFC A;  2VHA A;  3W9W A;  4HW8 A;  1B5J A;  2HPG A;  4KCC A;  4I40 A;  2Y5K A;  2FIX A;  3PGF A;  4PAF A;  1XT8 A;  3MVZ A;  4YKJ A;  1NI9 A;  5DEX B;  1FBE A;  2Y7R A;  2DWA A;  1MXY A;  1M5B A;  4FJP A;  1B4Z A;  2CZK A;  3IOR A;  2VT5 A;  2XWV A;  4HXV A;  4H0W A;  3WAE A;  1B52 A;  3F11 A;  4ZEF A;  3A29 A;  2P0S A;  5H8S A;  1ZBM A;  1JVX A;  4TQU Q;  1ELJ A;  2OLB A;  4N07 A;  5FHO A;  3MBP A;  2XXV A;  4ZEK A;  1SI0 A;  3V8X B;  2GH9 A;  1AOV A;  5I59 B;  4XKR A;  4GL0 A;  1O64 A;  2Y7P A;  3VLW A;  1QJM A;  1NKX A;  5IZ1 A;  4LZ5 A;  4MEV A;  5J16 A;  1POY 1;  3FXB A;  3RT8 A;  1ZU0 A;  3T22 A;  4EF1 A;  4MHF A;  2XXW A;  2DS9 A;  3FJM A;  4YKP A;  4GXA A;  3K1P A;  1CB6 A;  2KR0 A;  1ZLQ A;  4U4X A;  1XHY A;  2AL4 A;  3OSQ A;  4BLA A;  4C0R A;  4U1Z A;  4PFI A;  3FZV A;  5CMM A;  4ZZE A;  5I58 B;  3GBA A;  1VE4 A;  4POW A;  1MXZ A;  4ZED A;  4QFL A;  3C36 A;  3PD9 A;  3E4R A;  1SW1 A;  3PMV A;  2RC9 A;  1N0T A;  5FTH A;  1Y3P A;  2WBB A;  3FXR A;  4PC9 A;  1OQG A;  4AS5 A;  4WED A;  4P3L A;  1MQG A;  5EQ7 A;  3KEI A;  1NUZ A;  2ALU A;  2WBD A;  4QFN A;  3ECR A;  2DOJ A;  5CMC A;  1PBQ A;  4IO2 A;  1KA0 A;  4F1U A;  5EHS A;  2AYS A;  3JV9 A;  4JVD A;  4PFB A;  4ELR A;  1YYZ A;  4JWO A;  4OQO A;  4G2Z A;  2CZL A; 
#chains in the Genus database with same CATH homology
 2OWZ A;  2FHY A;  5EYG A;  5IZZ A;  4HE1 A;  1LEV A;  4O7M A;  4H45 A;  4FBP A;  4MAG A;  1FBG A;  1NV5 A;  2L5V A;  4O7I A;  5LDZ A;  4PCD A;  1FSA A;  2CEX A;  4P9K A;  1LBZ A;  2WEF A;  3T0J A;  2Q8M A;  4YZZ A;  1FPE A;  5ET5 A;  2DVZ A;  4NHB A;  4X8R A;  4XEQ A;  1FPJ A;  1NUY A;  4DI3 D;  4F19 A;  2Y5L A;  4G61 A;  2KQZ A;  1G0H A;  5EQ9 A;  4P1L A;  4XF5 A;  2P3N A;  3PTY A;  2JJK A;  1FJ6 A;  2WX9 A;  2B4L A;  3FBP A;  4PAI A;  3E79 A;  5EQ8 A;  2F3B A;  4PF8 A;  5CM6 A;  3ISP A;  4X04 A;  1EYJ A;  1FPB A;  2HHM A;  2V4C A;  3CHG A;  1FPG A;  5DW8 A;  1KZ8 A;  5EYH A;  5T3J A;  4PE3 A;  4NN3 A;  4XFE A;  4GWU A;  3RPL A;  4GX6 A;  1NV1 A;  2PFY A;  3NOH A;  1NV3 A;  1FBP A;  1YZ0 A;  4MX6 A;  2CZH A;  1DBZ A;  2XXK A;  4F1V A;  3QMF A;  5IZ1 A;  4MEV A;  5J16 A;  4GBV A;  4NGU A;  1EYK A;  4OA4 A;  2GQ1 A;  2WYK A;  2ZZW A;  1FPF A;  4H46 A;  1CNQ A;  1KA1 A;  5I3S A;  3FXB A;  3GYY A;  4MNP A;  4PET A;  2QVU A;  4N6K A;  3RYD A;  2ZZV A;  3KBZ A;  4P1E A;  4PBQ A;  5IZ3 A;  2OX3 A;  5LTC A;  1D9Q A;  4O8M A;  2DE4 A;  2DE3 A;  2Q74 A;  4PAK A;  4GWZ A;  4N6D A;  4JVI A;  4MMP A;  4MHF A;  2FIE A;  4P47 A;  4N15 A;  4OVR A;  1JP4 A;  3RPL B;  4M1V A;  5IGA A;  1LBX A;  4DI4 B;  5I5P A;  1NV2 A;  2ZZX A;  4N91 A;  2WYP A;  1FBD A;  2B4M A;  2QFL A;  2XWI A;  5ET6 A;  2XWK A;  4OVS A;  1LBW A;  1SPI A;  4P8B A;  4PDD A;  1IMA A;  1DK4 A;  1INP A;  5IM2 A;  2F3D A;  3MYU A;  2QVR A;  2KR0 A;  1K9Z A;  4JVC A;  4MIJ A;  3B8B A;  4LN5 A;  3IFC A;  4KXP A;  4N17 A;  4PGP A;  4OAN A;  3HFU A;  4HE2 A;  1EYI A;  1FPD A;  4GWS A;  1NUW A;  2HZL A;  1FPL A;  3EKI A;  4N8Y A;  5J1D A;  4MNI A;  4AS4 A;  2VPO A;  1AWB A;  3LV0 A;  4PFI A;  3W9W A;  1YXI A;  2BJI A;  1G0I A;  1IMB A;  1NV4 A;  3BIH A;  4OVP A;  3T1B A;  1NV7 A;  1QGX A;  1IMF A;  4F18 A;  5JK4 A;  1IMC A;  2HPG A;  2QPQ A;  1FPI A;  4HCY A;  4I40 A;  4NX1 A;  2Y5K A;  4X9T A;  5ET7 A;  3U65 A;  2FIX A;  2XA5 A;  2PFZ A;  4NQ8 A;  5IZ3 B;  4PAF A;  4QXD A;  4HCW A;  1Q9D A;  1FRP A;  3MST A;  3KC0 A;  4GWY A;  3SZP A;  1FJ9 A;  1FBH A;  1FTA A;  4PTK A;  1FPK A;  2CZI A;  1NI9 A;  3IFA A;  5I7I A;  2V3Q A;  1NV6 A;  4PF6 A;  3KC1 A;  1LBV A;  1FBE A;  4MJO A;  3ROJ A;  4PGN A;  1RDX A;  2WBB A;  4IR8 A;  2F5X A;  4PC9 A;  4PDH A;  1IMD A;  4GBW A;  1NUX A;  1LBY A;  4AS5 A;  1RDY A;  5EQA A;  4MNC A;  2CEY A;  4N8G A;  2Q9T A;  4NG7 A;  1K9Y A;  4P3L A;  2PCR A;  3D1R A;  1BK4 A;  4GX4 A;  1XI6 A;  1NUZ A;  5EQ7 A;  3BIG A;  1DCU A;  1VDW A;  2WBD A;  4YIC A;  1FBC A;  2CZK A;  2MKZ A;  2XWO A;  3B50 A;  4UAB A;  4NF0 A;  1RDZ A;  2QVV A;  2VT5 A;  4P56 A;  4I3E A;  1FBF A;  2DE2 A;  2XWV A;  4NAP A;  1NV0 A;  5ET8 A;  4OVQ A;  4QBA A;  2R8T A;  4HXV A;  5ESY A;  1KA0 A;  5FBP A;  4PBH A;  3W9V A;  4F1U A;  2DDK A;  4GWX A;  4GWW A;  3LUZ A;  4OVT A;  4N4U A;  3A29 A;  2VPN A;  2FBP A;  2P3V A;  4JVD A;  5F24 A;  4PFB A;  3E78 A;  4I3Y A;  4HE0 A;  2HZK A;  2HXR A;  4N81 A;  1YYZ A;  4GX3 A;  5A5L A;  4O94 A;  1IME A;  2FVZ A;  4MCO A;  4PFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...