1IMEA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imeA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imeA02
1RDXA 2P3VA 3T0JA 1IMDA 2WEFA 3LV0A 3RYDA 1NV2A 1XI6A 1LBWA 3D1RA 1FBDA 5J16A 2BJIA 2QVUA 4MJOA 2Q8MA 1NUXA 1KA0A 4O7IA 5ET8A 1KZ8A 4HE2A 1FRPA 3BIGA 5ESYA 1IMCA 1LEVA 4GWYA 5EYHA 1IMFA 4I3EA 3B8BA 2PCRA 4HE0A 2CZIA 2WBDA 1DK4A 2QVRA 5EQ7A 1EYJA 4GWWA 1FBCA 1JP4A 4IR8A 5EQAA 1LBYA 1G0IA 2HHMA 3FBPA 1KA1A 4I3YA 1EYIA 2R8TA 2CZKA 4GBVA 1FPKA 2QFLA 1RDZA 1FBEA 1BK4A 2VT5A 4GBWA 4H46A 1IMAA 1AWBA 1NV6A 1SPIA 4KXPA 5T3JA 1FBFA 2FIEA 4QXDA 4GX6A 4AS5A 4I40A 1YYZA 1NV3A 3KC1A 4GX3A 3KBZA 5IZ1A 1LBXA 2FVZA 1D9QA 2OX3A 2F3BA 5EQ8A 4GWUA 1FPFA 3LUZA 3RPLB 4G61A 1NV1A 1NV4A 5A5LA 5F24A 1FPLA 1FPJA 5ET5A 2Y5LA 1FPEA 1DBZA 4GWZA 1RDYA 5DW8A 1DCUA 1FPIA 1NV5A 3BIHA 1FBPA 1FPDA 4PTKA 3IFAA 2JJKA 2FHYA 1IMBA 2OWZA 1NUZA 3RPLA 5FBPA 1FTAA 1YZ0A 3QMFA 5LDZA 2Y5KA 1FJ9A 2GQ1A 1QGXA 2FIXA 3IFCA 4GWXA 4FBPA 1LBZA 2QVVA 1YXIA 1CNQA 4HE1A 1IMEA 1FSAA 5I3SA 1K9ZA 3KC0A 1FPGA 1NUWA 2P3NA 5IZ3B 1NV0A 5ET6A 4N81A 1FJ6A 1EYKA 4GWSA 2DDKA 1G0HA 1LBVA 1NUYA 1Q9DA 1VDWA 1FBGA 4GX4A 1FBHA 2WBBA 4H45A 1INPA 1FPBA 1NI9A 5EYGA 5EQ9A 2Q74A 2F3DA 5ET7A 3ROJA 3A29A 4AS4A 2CZHA 1K9YA 5IZ3A 4HXVA 1NV7A 2FBPA
chains in the Genus database with same CATH superfamily
3U93A 4HTGA 1P1QA 1PB7A 3D1RA 1IXIA 1NNTA 3UGWA 4X48A 1UTBA 4IO5A 5DVIA 4Q8RA 2NWJA 1POTA 3QUJA 3Q28A 3A3CA 5I57B 5AA2D 1I6QA 3N94A 3G3KA 4ZEDA 5CMBA 3TMGA 4FIMA 4GBVA 3CVGA 1SBPA 1RDZA 2VT5A 4KHZE 2V25A 4RJZA 2A5SA 1TT1A 4QSCA 3O6HA 5AA2A 3QXMA 4JWXA 2I0BA 3N6TA 1NV4A 4POXA 4MBPA 1Y3QA 1MY4A 4OVSA 4ISUA 1Y3PA 4NF8B 1BIYA 1QVSA 2QS1A 1JEVA 4IGTA 3IOVA 3HCQA 5CMKA 4DXUA 3QYTA 3W15C 4N15A 2ZYOA 1AIVA 3KJTA 1IMBA 1FTAA 1FTMA 4N4UA 4ZEFA 5AA3A 4NX1A 3SEVA 2WX9A 3MW0A 3IFCA 2XXYA 2X26A 3IB0A 1EZPA 1FSAA 4JWYA 2XWOA 1O64A 1NMUA 1B5IA 3K00A 1BTJA 3S9MC 3TAJA 3FVNA 3JYRA 3HPIA 3GYYA 5ICTA 1B6HA 2XX9A 2KR0A 3O97A 4ELPA 2UYFA 4ZE9A 1DPPA 2D3IA 2XWVA 4LQ5A 1D9YA 2H98A 4YAHX 1P99A 3TQLA 1NNFA 2A5TB 1AMFA 3I5OA 3ODBA 3SZPA 2ZXTA 3MVZA 4OETA 4EXKA 2XD3A 3TZAA 1M5CA 3FBPA 1KA1A 4G68A 4AB5A 4I3YA 1IQ7A 5JEIA 4R6KA 4OXVA 5FTIA 2RC8A 3FVGA 2FIEA 3LUYA 4LATA 4I40A 3WAEA 1YYZA 1DMBA 2NUVA 2Z8FA 3KBZA 3MC2A 2XX8A 4ESWA 2DSFA 4LVQA 1LFGA 3VVEA 5A5LA 3IR1A 5I2NA 5TP9A 4F2OA 3SEYA 4PETA 1II5A 4PE3A 4TQUQ 4BDNA 3IFAA 5TPAA 2YLNA 4WEPA 1B32A 1XT8A 4G8NA 4FBPA 4G4PA 4PCDA 4OFJA 1SYHA 1Z7NE 4ZZEA 2RC9A 2E0SA 3IK6B 4LN5A 5IM2A 5ITOA 1CB6A 4H45A 5I2KB 2PBWA 1VR5A 3V83A 4H67A 3GBAA 2MKZA 2OK2A 2OBGA 4FECA 3VLWA 3U94A 3TCGA 3TTKA 1JVYA 1NNPA 1UQWA 3SKPA 1BLFA 4DI3D 4PFTA 3MVWA 1PBPA 5FTHA 4GVOA 1USYH 1UTHB 3HN0A 5A5XA 3EQ1A 1SW1A 3E3KA 2PVUA 2Y7RA 2HEUA 1LAFE 4Z0IA 2O84X 1VE4A 3L6GA 2DWHA 2R8TA 1R9QA 4BDMA 2AL5A 4UABA 3TYHA 4KXPA 2ONKE 3FXQA 4BDRA 3G3JA 2F3BA 3MUQA 1QUKA 2Y7WA 4EQBA 3RGYA 1TFDA 1N3WA 5ELVA 5I56B 1FW0A 4TOZA 4JVDA 4MH5A 2F5XA 4F31B 1R9LA 4QSEA 2Z22A 4KPTA 1FBPA 1GV8A 1VFDA 2F34A 4PTKA 4JDFA 2WYPA 2JJKA 1NUZA 2OPEA 3I6VA 1B3LA 2GQ1A 4U23A 1FTJA 3EHSA 4ZEIA 5FHNA 2F35A 4MNIA 4K3FA 5CM6A 1VDWA 1TXFA 3LR1A 3HO7A 5EHMA 1Z7ME 3PV0E 2V3QA 3WAFA 4GOTA 5BWJA 5CRYA 4MFIA 4EQ7A 5JTYA 2ZYKA 1NV2A 4R2FA 4IO7A 4PF8A 1OLAA 3IJOB 3V5AA 3H7MA 4F3GA 2O7UA 5DVJA 1XVYA 1NFTA 2ZYMA 3MAMA 3HHGA 3TCFA 2WBDA 2I58A 1OQHA 1ATGA 5K2XA 2HHMA 2UVGA 4HS7A 2Y84A 4QXDA 4OWDA 4IO3A 1NV3A 1JW5A 4LP2B 3O9PA 4ND9A 3DELB 4DIGA 2QL3A 5H8HB 2GH9A 3PD8A 1B5HA 3U1OA 4U1ZA 3FD3A 1LAGE 3LSLA 1T0KA 3TTMA 4PBHA 1B40A 4MX6A 3C34A 1MDP1 5L9OA 3EHUA 3K6UA 3CIJA 3M3KA 3L6HA 5H8QA 2HAVA 3OOAA 1JQFA 1K9ZA 4M1VA 3G3HA 1ZLQA 5LOMA 4XKNA 1US4A 3B7DA 4H5FA 3PPPA 5M2VA 4XXUA 3FATA 1B4HA 2DWAA 3MZ9A 1NI9A 4MAGA 2UYEA 3ZKLA 2DOJA 2GHAA 3KG2A 2CZHA 5ISUA 1NKXA 5IZ3A 5I59B 1B3FA 1MH4A 4GQOA 1A54A 3IJXB 1A8FA 4XKRA 4NF4B 1XI6A 4QFPA 4KCDA 3RLFE 4JVIA 4HW8A 5AA4A 4QBAA 1MPCA 2NVUB 3PUWE 4P47A 5IKBA 4GD5A 4JXIA 1H44A 1MXVA 2DWIA 3KSXA 3KZGA 3LSXA 4IGRA 1G0IA 3MZBA 3KN3A 3A09A 2O68A 4POWA 3AXFA 2Q2CA 1BK4A 4GBWA 3VXBA 2ZNUA 1NNKA 4G2ZA 4Z7EA 2CMOA 1SI1A 4IO6A 2XA5A 4ECFA 3USDA 5KDTA 4KYDA 1EH3A 1JEUA 4XIGQ 4F2QA 4N91A 3RY3A 5DVFA 5L8DA 2OZZA 1MY3A 3PMWA 2ABHA 3K0VA 5B7DA 4PFRA 3IB1A 5LTCA 4F39A 3H6VA 4RNSA 1H45A 4FORA 5BUUA 4NF5A 1FQAA 2V4CA 1B1XA 3RNNA 4ELOA 4OYVA 2PFYA 3R26A 3B6QA 5H8FA 3DLNA 1NV0A 4N81A 4Q5TA 2XXQA 4N07A 4XTCQ 1FTOA 3IX1A 4NGUA 3SERA 3G7WA 3BFUA 2PT1A 2I48A 3UIFA 3EKIA 1QUJA 1USYE 2R71A 2HQ0A 3KSJA 4KI0E 3BFTA 3DP8A 1FBDA 3KBRA 3FUZA 1H43A 1B9JA 5ESYA 1N76A 3MP6A 4FATA 2H4IA 3FGSA 1IMFA 3B8BA 2ALUA 1MXYA 5L9SA 3H4ZA 3F11A 1FQDA 4F1UA 3EF7A 2GFEA 3N26A 4IB2A 3PPNA 2Q89A 2UVHA 3C35A 3KOTA 4ONYA 1BKAA 4DCXA 4H46A 3TQWA 1NV6A 3CHGA 2M8CA 5FHOA 2Q88A 2OX3A 5EQ8A 1FPFA 4RYAA 3RPLB 3CR9A 5F24A 3K1MA 3HFUA 2QS2A 1PB8A 1MXUA 3CSBA 5F7VA 1QW0A 1RKMA 2OCUA 2XXUA 5KCJB 4U4SA 4N6DA 2ANJA 3T9UA 4U22A 2H9BA 1MG1A 3MP8A 1B3HA 2ZZWA 3IAZA 4F29A 4PGPA 5CC2A 4YMBA 1FJ6A 4PFBA 4MEVA 1EYKA 3S9LC 2DDKA 4YICA 2HXRA 1Y1ZA 3EPEA 1INPA 4XKPA 4DXCA 4LZ7A 1J1NA 5IAIA 4NF6B 3O2AA 4GXAA 5FBPA 4C1TA 1SW4A 3E79A 2V3TA 2G29A 3LSFB 3Q27A 1RYOA 5EHSA 4DE8A 3QUFA 1URDA 2V84A 1N0TA 1UIVA 1ZJLA 3M8UA 2G93A 2H99A 4IR8A 2DXRA 5FHMA 2XWIA 3T9VA 1LFIA 4NWCA 3S2VA 4YKKA 1EYIA 1MY1A 3M3FA 4QFLA 1FBEA 1QUIA 4OHNA 4P1EA 3JZJA 3KC1A 2O1MA 2O6AA 2RCAA 1B7ZA 1B5JA 1WVJA 3UK4A 3SDFA 4P56A 3LUZA 2VP1A 5H8SA 2ZYNA 2HPGA 2HZKA 4OQOA 4NQ8A 3K1NA 5DW8A 2KQZA 1UIUA 1SDXA 1MXXA 3E78A 4RPNA 4PAIA 1IEJA 1VFEA 4KFQA 2F8DA 4PDDA 1AH5A 3UN6A 2O7IA 2XXXA 3KN8A 1M5DA 4MIJA 1CNQA 5I3SA 1N04A 3UA8A 4L17A 3P7IA 2X7PA 3S9NC 4GF8A 1FBHA 2WBBA 3OO8A 2B4MA 4GRKA 3ISPA 2P0SA 4H8IA 4UACA 1GTKA 2I3VA 2WKYA 4P0IA 2OWZA 2QJEA 2XHDA 3PPOA 4XEQA 4DXBA 3IOTA 2PT2A 5I58B 1ELJA 1FQBA 3BIGA 1B52A 4N8GA 1IMCA 1B05A 3QIMA 4I3EA 4ZEKA 3H6WA 2PCRA 2CZIA 4PFWA 5EQ7A 2GHBA 5CBSA 4P3LA 5EQAA 4FAJA 4DLDA 1MPDA 4E0WA 5I7IA 2CZKA 3FVOA 1ZKBA 1IMAA 2VPNA 3V89B 4OVQA 2D5WA 5IZ1A 5I57A 1GGGA 4GWOA 3QAXA 1NV1A 1LCTA 3PGFA 4QHQA 5ET5A 3E13X 1OVTA 1DBZA 4O3BA 2REGA 1MPBA 1LCFA 4I1DA 3FXRA 1FTLA 2Z23A 5JK4A 3OSRA 4H5GA 5H8NB 4U1OA 3O6IA 4AB6A 4KD5A 2H25A 4JBZA 2ONRA 4NF8A 1YXIA 3LC8A 1IMEA 2OLBA 1IIWA 4MHFA 1P1OA 2I0CA 1LAHE 4KYEA 4LONB 2AYSA 2W7YA 4HCYA 5K2YA 5DT6A 3M3LA 2VD2A 2QS4A 4YKPA 4F3BA 2QS3A 1K9YA 4HXVA 3MBPA 2P3VA 2PFZA 1IMDA 4R74A 4JSDA 4NHBA 3FV2A 5DTBA 4GXSB 3T93B 1M5BA 3MVXA 3MVYA 4P8BA 4PE5B 4WKMA 3GBBA 1DK4A 4H0WA 1JP4A 2DYXA 2DE3A 4DI4B 5EYFA 1IXHA 1IXCA 1QULA 4R72A 4PQJA 3GLBA 1S9TA 2DE4A 3U65A 4RXLA 2A5TA 3TTLA 4AS5A 2NOOA 4MLVA 1B2HA 4R6HA 2F78A 2F7CA 3MJNA 5IGAA 4P9KA 2F7BA 3MPLA 4MMPA 4NE4A 3TDJA 1EU8A 1A99A 3C9HA 3G3GA 3B6TA 4OERA 4QSDA 3VXCA 4OEVA 5HM4B 5DEXB 3VFJA 2XXVA 3CFZA 2X7QA 4F3PA 2P3NA 3OMBA 3UORA 3U8QA 1N7XA 1LBVA 1DTGA 1Y1MA 2I4BA 3BKIB 5ITPA 5EYGA 3Q29A 3VLVA 3ECRA 2Q74A 1A8EA 1IITA 4FEBA 2F6GA 2FBPA 1XC1A 2UVJA 1B0LA 2F6PA 1RDXA 3TELA 4KR5A 3LV0A 3SEXA 3ZKKA 3FVKA 5J16A 4OTEA 2BJIA 5I2KA 2VHAA 3PUXE 1KA0A 4O7IA 1EZ9A 4JSOA 2XXWA 2KLFA 3W9WA 1FQFA 1AL3A 3O28A 1A40A 2QVRA 4U2RA 1FBCA 4OVTA 5AA2B 4R2BA 1FCKA 2B3FA 4EDPA 1N7WA 1QKBA 3N6UA 4F19A 1UTHA 1P1NA 3T9XB 1Y4TA 4KQPA 1H3DA 3H06B 2XXHA 1MH3A 3TFLA 3PUYE 2I3WA 1LB8A 5L9MA 1F9BA 4GL8A 4QFOA 3K6XA 3VLUA 4N17A 3CFXA 1NH8A 1M5EA 4IY5A 3T1BA 4FEDA 1XOCA 4GIZA 3MP1A 4NF0A 1FPDA 2WYKA 4OVRA 1HSLA 4P1LA 2Y7IA 5I56A 3H03A 4GL0A 3U72A 4I62A 2AL4A 3PPRA 1YTVA 3G3IA 3FZVA 4PBQA 3SETA 3N5LA 4N6PA 2XXRA 3DP4A 3KGCA 4GX4A 4YB5A 2QMWA 1MY0A 4OA4A 1XHYA 3OELA 1LBZA 2QVVA 3ONMA 2UVIA 3T0JA 1URGA 3RT6B 4RY1A 2B3BA 4MJOA 1KZ8A 2Y7KA 5I84A 1YPNA 5AA1A 1Y9UA 2L5VA 2ZMBA 4G8MA 3MZ1A 1PEBA 4O7MA 1TWYA 4X8RA 1B0HA 2DXYA 4R9FA 1B4ZA 3TODA 4PP0A 1HSEA 2HAUA 5I2NB 4R6YA 1OLCA 1MM7A 4QFKA 4U21A 1FBFA 4TLMB 2XD2A 4YU0A 3OEKA 2R6GE 5J1DA 3MQ9A 4GWUA 5TPAB 4E0XA 5KZTA 2DVZA 1YCJA 3CG3A 4GWZA 2CZLA 1D3KA 3K01A 3RPWA 4ELQA 2FHYA 2D21A 1XS5A 2CEYA 3IO6A 5H8HA 3K4UA 3QMFA 2I49A 4C0RA 3C36A 4GWXA 4N8YA 4EF1A 1SW2A 3VVFA 1LAXA 1LGBC 1MQHA 2FYIA 1G0HA 4RA1A 4X1BA 3RN8A 1ZIUA 1OMPA 1JVXA 4LZ5A 2VPOA 4ZEBA 2PYYA 3FXBA 4MF3A 1I6AA 1ZMGA 1SVXB 2IEEA 4DDDA 1B3EA 4C1UA 3UP9A 5F1QA 2XWKA 5A5XB 3TKDA 2P2AA 1LBWA 4Q0CA 3H6UA 3PMXA 4JB7A 2OWTA 2Q8MA 1OIBA 3CI8A 2F97A 4WEDA 4HE2A 3C32A 5I59A 4H65A 2Z8EA 4R73A 1URSA 3CRBA 4IY6A 2ESNA 4NF4A 1EYJA 4GWWA 4P0GA 1Q1KA 5HPQA 3B6WA 4KCCA 4OMBA 4G8HA 1JETA 3IB2A 1R1NA 1LSTA 1MXWA 4H6DA 5CMCA 4KYSA 5HBCA 3THIA 3OO7A 3MPKA 2DWJA 3TCHA 1DTZA 1NH7A 4G61A 3O6GA 3GXAA 4PC9A 1H76A 1PDAA 1B7HA 2H5YA 3FJMA 1SYIA 1NV5A 2FNCA 2LAOA 4QF9A 2THIA 4PAKA 4PFUA 4OENA 1YZ0A 1MY2A 1LBBA 4MLQA 4OZ9A 4MCOA 1P1WA 2F7AA 4YKIA 3MYUA 3S9EA 4PAFA 3KC0A 3U92A 5DYHA 3HSTA 1GR2A 2QRYA 2XXTA 3RT8A 5JTYB 1Q9DA 1IUDA 2XXIA 2XXKA 3SEWA 1QJMA 5ET7A 4AS4A 1B46A 4NAPA 3OD7A 4RPOA 1NV7A 3E4RA 2V93A 2WEFA 4FJPA 4EXLA 1ANFA 4M4GA 4OANA 2VGQA 3A3UA 1MQJA 4GWYA 2OJTA 5EYHA 1TFAA 4BDOA 4EF2A 4HE0A 2PMSA 3TEPA 1MQDA 3FASA 2O1LA 2HCAA 1HSJA 1CE2A 2ONSA 1IZ1A 2RC7A 4YMAA 2Z8DA 1R6ZA 4NMYA 5IZZA 1FPKA 1US5A 3IORA 1LLSA 4BDQA 1LBCA 3KEIA 2Q9TA 3OO9A 3V8XB 1D9QA 3LBSA 1S7YA 4ZDMA 2YJPA 4PFYA 2B4LA 3FXUA 1KWHA 1FPJA 1JW1A 2NXOA 3TTNA 1FPEA 5H8QB 2OPDA 4QRZA 3OXNA 1Q35A 4OVPA 1DPEA 4ZZAA 4PFIA 4U4XA 3RPLA 3ZSFA 4RK2A 1MM6A 5LDZA 2PX1A 4N13A 2FIXA 1D9VA 1MXZA 2YPNA 2VOZA 3H6TA 1BP5A 2ZZXA 2O51A 1L5TA 4BLAA 1FPGA 5IZ3B 5ET6A 3HV1A 5KCJA 1B58A 1SD3A 1N84A 3VE1B 4OESA 3ZS6A 5AA4B 4OFLA 3H3GA 2P1SA 3A29A 3TPAA 5ICQA 1Y3NA 3E9XA 1PBQA 2RCBA 3RYDA 4H8JA 4NEDA 4OFOA 1B7UA 3K2DA 3PU5A 2XXPA 1O63A 5ET8A 3PUVE 3S4UA 4NF6A 1FQCA 2DE2A 2AIXA 3HHFA 4LA9A 2Y7PA 4X9TA 3PUZE 1SQYA 2I4CA 3RTFB 5KDTB 4EQ9A 4THIA 4ELRA 4DZ1A 3C31A 3MWBA 1LB9A 3SESA 2V3UA 3OEMA 2O69A 2QFLA 1MRPA 3FV1A 1SPIA 1MQIA 4IO4A 1P1UA 5AE4A 2VD3A 2QSXA 3TUSA 4GX3A 1JW4A 4WXJA 1D4NA 4F3SA 2FVZA 3Q25A 4X1DA 4FE8A 1YAEA 1B51A 4PGNA 4EUOA 1OQGA 1WODA 4NF5B 4NG7A 3PMVA 1N3XA 3CG1A 3R7XA 4LQ2A 2RKMA 5B70A 1DCUA 4AQ4A 3R6UA 3BIHA 5H8FB 4XF5A 4RK9A 3G3FA 2DS9A 3K1PA 3QK6A 1ZTYA 2QPQA 2R9JA 4MNPA 4F22A 4H1XA 2QMXA 2Q2AA 3CSGA 3K02A 1NUWA 3VDFA 1WDNA 2B65A 1NUYA 1OVBA 1FBGA 3T22A 3JV9A 1FPBA 1RYXA 1Y4CA 4XFEA 3PD9A 2F3DA 3K6WA 5T3JA 1Y20A 3LSWA 5TU0A 4O8MA 4XKQA 4ZS9A 3OO6A 2QVUA 1NUXA 1B3GA 2DQVA 3OSQA 1FRPA 3RQTA 1PC3A 1UTBB 4NN3A 3IOUA 4DCYA 2RF1A 4NTLA 3O66A 3Q26A 1SI0A 3I3VA 1LBYA 4O3AA 4N6KA 5I58A 2HFBA 3T96B 1O7TA 5CI5A 4UA8A 1AWBA 3BBRA 4R75A 1DSNA 4LUBA 4GX6A 4X04A 3SEUA 1LBXA 3K6VA 4P11A 5I5PA 4JWOA 4PDHA 4NWDA 2DP8A 4ZECA 1XVXA 4ESXA 3DM0A 4TLLB 3KFMA 3FIRA 3MSTA 1RDYA 4LZ8A 1I6BA 2IA4A 3IL1B 2ZNSA 2FA7A 3T9HB 3C4MA 1B1HA 4YB6A 1SW5A 3ILTB 4PF6A 3DP6A 3PTYA 3T66A 1JNFA 2HXWA 2UXAA 4OVJA 4HE1A 1ZBMA 1PB9A 3EHTA 1S50A 5H8NA 1POY1 2XX7A 1NL5A 3PPQA 1GVCA 3D4CA 2REJA 3W9VA 3O29A 1MQGA 4F1YA 3KJ7A 4G77A 1VSOA 3ILUB 4F18A 3FJGA 4I9DA 1LEVA 2Q8JA 1A55A 3GZGA 2I6EA 5CBRA 1LFHA 3C33A 4I8CA 5CMMA 4R9GA 4Q30B 3EN3A 1EZOA 4F1VA 2DVCA 4GFRA 4O94A 2BJJX 3FJ7A 3KOSA 4G68B 2GRVA 1ZU0A 1FTKA 4YB7A 2F36A 1IXGA 3OENA 4QFNA 2OWSA 2ZZVA 1M5FA 2HZLA 3IOWA 1FPLA 1I69A 2Y5LA 3VVDA 3QSLA 1AOVA 1FPIA 4O3CA 2ZNTA 4BDLA 5TP9B 1MDQA 1DOTA 4YZZA 1MS7A 4ZE8A 1FQEA 2Y5KA 1FJ9A 1QGXA 4OEUA 3B50A 4GLIA 4JVCA 4HCWA 3RTWB 3NOHA 4YKJA 3D4GA 2RINA 2E1SA 3RUMA 2CEXA 4GWSA 4MNCA 3VV5A 3CFLA 4IO2A 1QKAA 5DEXA 1A7LA 5EQ9A 4G68C 3ROJA 3KN7A 3TTRA 3IO4A
chains in the Genus database with same CATH topology
2P3VA 2PFZA 1IMDA 2WEFA 1XI6A 3D1RA 4JVIA 4NHBA 4OANA 4QBAA 4P47A 4P8BA 4GWYA 5EYHA 4HE0A 1DK4A 1JP4A 2DE3A 1G0IA 4DI4B 5IZZA 4GBVA 1FPKA 2DE4A 1RDZA 1BK4A 2VT5A 4GBWA 3U65A 4AS5A 2Q9TA 2XA5A 1D9QA 4N91A 2B4LA 1NV4A 1FPJA 5IGAA 4P9KA 1FPEA 4MMPA 4OVSA 4OVPA 4PFRA 4N15A 5LTCA 4PFIA 1IMBA 3RPLA 1FTAA 4N4UA 4NX1A 5LDZA 2V4CA 2WX9A 2FIXA 3IFCA 2PFYA 1FSAA 2ZZXA 1FPGA 2XWOA 2P3NA 5IZ3B 1NV0A 5ET6A 4N81A 1LBVA 4NGUA 5EYGA 3GYYA 2Q74A 3A29A 3EKIA 2FBPA 2KR0A 1RDXA 2XWVA 3LV0A 3RYDA 1FBDA 5J16A 2BJIA 1KA0A 4O7IA 5ET8A 5ESYA 2DE2A 3W9WA 1IMFA 4X9TA 3B8BA 2QVRA 3SZPA 1FBCA 4OVTA 4F1UA 3FBPA 1KA1A 4I3YA 4F19A 2QFLA 4H46A 1NV6A 1SPIA 3CHGA 2FIEA 4I40A 1YYZA 4GX3A 3KBZA 2FVZA 2OX3A 5EQ8A 1FPFA 3RPLB 4PGNA 5A5LA 5F24A 4NG7A 3HFUA 4N17A 3T1BA 4PETA 4PE3A 1DCUA 3BIHA 4NF0A 4XF5A 1FPDA 2WYKA 3IFAA 4OVRA 4N6DA 4P1LA 2QPQA 4MNPA 4FBPA 2ZZWA 4PCDA 4PGPA 4PBQA 1NUWA 1FJ6A 4PFBA 4MEVA 1EYKA 4LN5A 2DDKA 4YICA 1NUYA 2HXRA 5IM2A 1FBGA 4GX4A 4H45A 1INPA 1FPBA 4XFEA 4OA4A 2F3DA 2MKZA 1LBZA 5T3JA 2QVVA 5FBPA 3T0JA 3E79A 4O8MA 2QVUA 4MJOA 1NUXA 4DI3D 1KZ8A 1FRPA 2L5VA 4O7MA 4X8RA 4NN3A 4IR8A 2XWIA 1LBYA 4N6KA 1EYIA 2R8TA 4UABA 1FBEA 1AWBA 4KXPA 4P1EA 1FBFA 4GX6A 4X04A 3KC1A 1LBXA 5J1DA 5I5PA 2F3BA 4PDHA 4P56A 4GWUA 3LUZA 2DVZA 2HPGA 3MSTA 2HZKA 4NQ8A 4JVDA 4GWZA 1RDYA 5DW8A 2KQZA 2F5XA 3E78A 1FBPA 4PTKA 4PAIA 2WYPA 2JJKA 2FHYA 1NUZA 4PDDA 2CEYA 4PF6A 3QMFA 3PTYA 2GQ1A 4GWXA 4MIJA 1CNQA 4HE1A 5I3SA 4N8YA 4MNIA 1G0HA 5CM6A 1VDWA 1FBHA 2WBBA 2B4MA 2VPOA 3FXBA 3ISPA 3W9VA 2V3QA 2OWZA 2XWKA 4XEQA 1NV2A 1LBWA 4PF8A 4F18A 2Q8MA 4HE2A 3BIGA 4N8GA 1IMCA 1LEVA 4I3EA 2PCRA 2CZIA 2WBDA 5EQ7A 1EYJA 4GWWA 4P3LA 5EQAA 2HHMA 5I7IA 2CZKA 4F1VA 4O94A 1IMAA 2VPNA 4QXDA 4OVQA 1NV3A 5IZ1A 2ZZVA 4G61A 2HZLA 1NV1A 1FPLA 5ET5A 2Y5LA 4PC9A 1DBZA 1FPIA 1NV5A 4PAKA 5JK4A 4PBHA 4YZZA 1YZ0A 4MX6A 2Y5KA 1FJ9A 1QGXA 4MCOA 3B50A 1YXIA 4JVCA 3MYUA 1IMEA 4PAFA 1K9ZA 3KC0A 4M1VA 4HCWA 3NOHA 4MHFA 2CEXA 4GWSA 4MNCA 1Q9DA 4HCYA 2XXKA 1NI9A 4MAGA 5EQ9A 5ET7A 3ROJA 4AS4A 4NAPA 2CZHA 1K9YA 5IZ3A 4HXVA 1NV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDX A;  2P3V A;  3T0J A;  1IMD A;  2WEF A;  3LV0 A;  3RYD A;  1NV2 A;  1XI6 A;  1LBW A;  3D1R A;  1FBD A;  5J16 A;  2BJI A;  2QVU A;  4MJO A;  2Q8M A;  1NUX A;  1KA0 A;  4O7I A;  5ET8 A;  1KZ8 A;  4HE2 A;  1FRP A;  3BIG A;  5ESY A;  1IMC A;  1LEV A;  4GWY A;  5EYH A;  1IMF A;  4I3E A;  3B8B A;  2PCR A;  4HE0 A;  2CZI A;  2WBD A;  1DK4 A;  2QVR A;  5EQ7 A;  1EYJ A;  4GWW A;  1FBC A;  1JP4 A;  4IR8 A;  5EQA A;  1LBY A;  1G0I A;  2HHM A;  3FBP A;  1KA1 A;  4I3Y A;  1EYI A;  2R8T A;  2CZK A;  4GBV A;  1FPK A;  2QFL A;  1RDZ A;  1FBE A;  1BK4 A;  2VT5 A;  4GBW A;  4H46 A;  1IMA A;  1AWB A;  1NV6 A;  1SPI A;  4KXP A;  5T3J A;  1FBF A;  2FIE A;  4QXD A;  4GX6 A;  4AS5 A;  4I40 A;  1YYZ A;  1NV3 A;  3KC1 A;  4GX3 A;  3KBZ A;  5IZ1 A;  1LBX A;  2FVZ A;  1D9Q A;  2OX3 A;  2F3B A;  5EQ8 A;  4GWU A;  1FPF A;  3LUZ A;  3RPL B;  4G61 A;  1NV1 A;  1NV4 A;  5A5L A;  5F24 A;  1FPL A;  1FPJ A;  5ET5 A;  2Y5L A;  1FPE A;  1DBZ A;  4GWZ A;  1RDY A;  5DW8 A;  1DCU A;  1FPI A;  1NV5 A;  3BIH A;  1FBP A;  1FPD A;  4PTK A;  3IFA A;  2JJK A;  2FHY A;  1IMB A;  2OWZ A;  1NUZ A;  3RPL A;  5FBP A;  1FTA A;  1YZ0 A;  3QMF A;  5LDZ A;  2Y5K A;  1FJ9 A;  2GQ1 A;  1QGX A;  2FIX A;  3IFC A;  4GWX A;  4FBP A;  1LBZ A;  2QVV A;  1YXI A;  1CNQ A;  4HE1 A;  1IME A;  1FSA A;  5I3S A;  1K9Z A;  3KC0 A;  1FPG A;  1NUW A;  2P3N A;  5IZ3 B;  1NV0 A;  5ET6 A;  4N81 A;  1FJ6 A;  1EYK A;  4GWS A;  2DDK A;  1G0H A;  1LBV A;  1NUY A;  1Q9D A;  1VDW A;  1FBG A;  4GX4 A;  1FBH A;  2WBB A;  4H45 A;  1INP A;  1FPB A;  1NI9 A;  5EYG A;  5EQ9 A;  2Q74 A;  2F3D A;  5ET7 A;  3ROJ A;  3A29 A;  4AS4 A;  2CZH A;  1K9Y A;  5IZ3 A;  4HXV A;  1NV7 A;  2FBP A; 
#chains in the Genus database with same CATH topology
 3U93 A;  4HTG A;  1P1Q A;  1PB7 A;  3D1R A;  1IXI A;  1NNT A;  3UGW A;  4X48 A;  1UTB A;  4IO5 A;  5DVI A;  4Q8R A;  2NWJ A;  1POT A;  3QUJ A;  3Q28 A;  3A3C A;  5I57 B;  5AA2 D;  1I6Q A;  3N94 A;  3G3K A;  4ZED A;  5CMB A;  3TMG A;  4FIM A;  4GBV A;  3CVG A;  1SBP A;  1RDZ A;  2VT5 A;  4KHZ E;  2V25 A;  4RJZ A;  2A5S A;  1TT1 A;  4QSC A;  3O6H A;  5AA2 A;  3QXM A;  4JWX A;  2I0B A;  3N6T A;  1NV4 A;  4POX A;  4MBP A;  1Y3Q A;  1MY4 A;  4OVS A;  4ISU A;  1Y3P A;  4NF8 B;  1BIY A;  1QVS A;  2QS1 A;  1JEV A;  4IGT A;  3IOV A;  3HCQ A;  5CMK A;  4DXU A;  3QYT A;  3W15 C;  4N15 A;  2ZYO A;  1AIV A;  3KJT A;  1IMB A;  1FTA A;  1FTM A;  4N4U A;  4ZEF A;  5AA3 A;  4NX1 A;  3SEV A;  2WX9 A;  3MW0 A;  3IFC A;  2XXY A;  2X26 A;  3IB0 A;  1EZP A;  1FSA A;  4JWY A;  2XWO A;  1O64 A;  1NMU A;  1B5I A;  3K00 A;  1BTJ A;  3S9M C;  3TAJ A;  3FVN A;  3JYR A;  3HPI A;  3GYY A;  5ICT A;  1B6H A;  2XX9 A;  2KR0 A;  3O97 A;  4ELP A;  2UYF A;  4ZE9 A;  1DPP A;  2D3I A;  2XWV A;  4LQ5 A;  1D9Y A;  2H98 A;  4YAH X;  1P99 A;  3TQL A;  1NNF A;  2A5T B;  1AMF A;  3I5O A;  3ODB A;  3SZP A;  2ZXT A;  3MVZ A;  4OET A;  4EXK A;  2XD3 A;  3TZA A;  1M5C A;  3FBP A;  1KA1 A;  4G68 A;  4AB5 A;  4I3Y A;  1IQ7 A;  5JEI A;  4R6K A;  4OXV A;  5FTI A;  2RC8 A;  3FVG A;  2FIE A;  3LUY A;  4LAT A;  4I40 A;  3WAE A;  1YYZ A;  1DMB A;  2NUV A;  2Z8F A;  3KBZ A;  3MC2 A;  2XX8 A;  4ESW A;  2DSF A;  4LVQ A;  1LFG A;  3VVE A;  5A5L A;  3IR1 A;  5I2N A;  5TP9 A;  4F2O A;  3SEY A;  4PET A;  1II5 A;  4PE3 A;  4TQU Q;  4BDN A;  3IFA A;  5TPA A;  2YLN A;  4WEP A;  1B32 A;  1XT8 A;  4G8N A;  4FBP A;  4G4P A;  4PCD A;  4OFJ A;  1SYH A;  1Z7N E;  4ZZE A;  2RC9 A;  2E0S A;  3IK6 B;  4LN5 A;  5IM2 A;  5ITO A;  1CB6 A;  4H45 A;  5I2K B;  2PBW A;  1VR5 A;  3V83 A;  4H67 A;  3GBA A;  2MKZ A;  2OK2 A;  2OBG A;  4FEC A;  3VLW A;  3U94 A;  3TCG A;  3TTK A;  1JVY A;  1NNP A;  1UQW A;  3SKP A;  1BLF A;  4DI3 D;  4PFT A;  3MVW A;  1PBP A;  5FTH A;  4GVO A;  1USY H;  1UTH B;  3HN0 A;  5A5X A;  3EQ1 A;  1SW1 A;  3E3K A;  2PVU A;  2Y7R A;  2HEU A;  1LAF E;  4Z0I A;  2O84 X;  1VE4 A;  3L6G A;  2DWH A;  2R8T A;  1R9Q A;  4BDM A;  2AL5 A;  4UAB A;  3TYH A;  4KXP A;  2ONK E;  3FXQ A;  4BDR A;  3G3J A;  2F3B A;  3MUQ A;  1QUK A;  2Y7W A;  4EQB A;  3RGY A;  1TFD A;  1N3W A;  5ELV A;  5I56 B;  1FW0 A;  4TOZ A;  4JVD A;  4MH5 A;  2F5X A;  4F31 B;  1R9L A;  4QSE A;  2Z22 A;  4KPT A;  1FBP A;  1GV8 A;  1VFD A;  2F34 A;  4PTK A;  4JDF A;  2WYP A;  2JJK A;  1NUZ A;  2OPE A;  3I6V A;  1B3L A;  2GQ1 A;  4U23 A;  1FTJ A;  3EHS A;  4ZEI A;  5FHN A;  2F35 A;  4MNI A;  4K3F A;  5CM6 A;  1VDW A;  1TXF A;  3LR1 A;  3HO7 A;  5EHM A;  1Z7M E;  3PV0 E;  2V3Q A;  3WAF A;  4GOT A;  5BWJ A;  5CRY A;  4MFI A;  4EQ7 A;  5JTY A;  2ZYK A;  1NV2 A;  4R2F A;  4IO7 A;  4PF8 A;  1OLA A;  3IJO B;  3V5A A;  3H7M A;  4F3G A;  2O7U A;  5DVJ A;  1XVY A;  1NFT A;  2ZYM A;  3MAM A;  3HHG A;  3TCF A;  2WBD A;  2I58 A;  1OQH A;  1ATG A;  5K2X A;  2HHM A;  2UVG A;  4HS7 A;  2Y84 A;  4QXD A;  4OWD A;  4IO3 A;  1NV3 A;  1JW5 A;  4LP2 B;  3O9P A;  4ND9 A;  3DEL B;  4DIG A;  2QL3 A;  5H8H B;  2GH9 A;  3PD8 A;  1B5H A;  3U1O A;  4U1Z A;  3FD3 A;  1LAG E;  3LSL A;  1T0K A;  3TTM A;  4PBH A;  1B40 A;  4MX6 A;  3C34 A;  1MDP 1;  5L9O A;  3EHU A;  3K6U A;  3CIJ A;  3M3K A;  3L6H A;  5H8Q A;  2HAV A;  3OOA A;  1JQF A;  1K9Z A;  4M1V A;  3G3H A;  1ZLQ A;  5LOM A;  4XKN A;  1US4 A;  3B7D A;  4H5F A;  3PPP A;  5M2V A;  4XXU A;  3FAT A;  1B4H A;  2DWA A;  3MZ9 A;  1NI9 A;  4MAG A;  2UYE A;  3ZKL A;  2DOJ A;  2GHA A;  3KG2 A;  2CZH A;  5ISU A;  1NKX A;  5IZ3 A;  5I59 B;  1B3F A;  1MH4 A;  4GQO A;  1A54 A;  3IJX B;  1A8F A;  4XKR A;  4NF4 B;  1XI6 A;  4QFP A;  4KCD A;  3RLF E;  4JVI A;  4HW8 A;  5AA4 A;  4QBA A;  1MPC A;  2NVU B;  3PUW E;  4P47 A;  5IKB A;  4GD5 A;  4JXI A;  1H44 A;  1MXV A;  2DWI A;  3KSX A;  3KZG A;  3LSX A;  4IGR A;  1G0I A;  3MZB A;  3KN3 A;  3A09 A;  2O68 A;  4POW A;  3AXF A;  2Q2C A;  1BK4 A;  4GBW A;  3VXB A;  2ZNU A;  1NNK A;  4G2Z A;  4Z7E A;  2CMO A;  1SI1 A;  4IO6 A;  2XA5 A;  4ECF A;  3USD A;  5KDT A;  4KYD A;  1EH3 A;  1JEU A;  4XIG Q;  4F2Q A;  4N91 A;  3RY3 A;  5DVF A;  5L8D A;  2OZZ A;  1MY3 A;  3PMW A;  2ABH A;  3K0V A;  5B7D A;  4PFR A;  3IB1 A;  5LTC A;  4F39 A;  3H6V A;  4RNS A;  1H45 A;  4FOR A;  5BUU A;  4NF5 A;  1FQA A;  2V4C A;  1B1X A;  3RNN A;  4ELO A;  4OYV A;  2PFY A;  3R26 A;  3B6Q A;  5H8F A;  3DLN A;  1NV0 A;  4N81 A;  4Q5T A;  2XXQ A;  4N07 A;  4XTC Q;  1FTO A;  3IX1 A;  4NGU A;  3SER A;  3G7W A;  3BFU A;  2PT1 A;  2I48 A;  3UIF A;  3EKI A;  1QUJ A;  1USY E;  2R71 A;  2HQ0 A;  3KSJ A;  4KI0 E;  3BFT A;  3DP8 A;  1FBD A;  3KBR A;  3FUZ A;  1H43 A;  1B9J A;  5ESY A;  1N76 A;  3MP6 A;  4FAT A;  2H4I A;  3FGS A;  1IMF A;  3B8B A;  2ALU A;  1MXY A;  5L9S A;  3H4Z A;  3F11 A;  1FQD A;  4F1U A;  3EF7 A;  2GFE A;  3N26 A;  4IB2 A;  3PPN A;  2Q89 A;  2UVH A;  3C35 A;  3KOT A;  4ONY A;  1BKA A;  4DCX A;  4H46 A;  3TQW A;  1NV6 A;  3CHG A;  2M8C A;  5FHO A;  2Q88 A;  2OX3 A;  5EQ8 A;  1FPF A;  4RYA A;  3RPL B;  3CR9 A;  5F24 A;  3K1M A;  3HFU A;  2QS2 A;  1PB8 A;  1MXU A;  3CSB A;  5F7V A;  1QW0 A;  1RKM A;  2OCU A;  2XXU A;  5KCJ B;  4U4S A;  4N6D A;  2ANJ A;  3T9U A;  4U22 A;  2H9B A;  1MG1 A;  3MP8 A;  1B3H A;  2ZZW A;  3IAZ A;  4F29 A;  4PGP A;  5CC2 A;  4YMB A;  1FJ6 A;  4PFB A;  4MEV A;  1EYK A;  3S9L C;  2DDK A;  4YIC A;  2HXR A;  1Y1Z A;  3EPE A;  1INP A;  4XKP A;  4DXC A;  4LZ7 A;  1J1N A;  5IAI A;  4NF6 B;  3O2A A;  4GXA A;  5FBP A;  4C1T A;  1SW4 A;  3E79 A;  2V3T A;  2G29 A;  3LSF B;  3Q27 A;  1RYO A;  5EHS A;  4DE8 A;  3QUF A;  1URD A;  2V84 A;  1N0T A;  1UIV A;  1ZJL A;  3M8U A;  2G93 A;  2H99 A;  4IR8 A;  2DXR A;  5FHM A;  2XWI A;  3T9V A;  1LFI A;  4NWC A;  3S2V A;  4YKK A;  1EYI A;  1MY1 A;  3M3F A;  4QFL A;  1FBE A;  1QUI A;  4OHN A;  4P1E A;  3JZJ A;  3KC1 A;  2O1M A;  2O6A A;  2RCA A;  1B7Z A;  1B5J A;  1WVJ A;  3UK4 A;  3SDF A;  4P56 A;  3LUZ A;  2VP1 A;  5H8S A;  2ZYN A;  2HPG A;  2HZK A;  4OQO A;  4NQ8 A;  3K1N A;  5DW8 A;  2KQZ A;  1UIU A;  1SDX A;  1MXX A;  3E78 A;  4RPN A;  4PAI A;  1IEJ A;  1VFE A;  4KFQ A;  2F8D A;  4PDD A;  1AH5 A;  3UN6 A;  2O7I A;  2XXX A;  3KN8 A;  1M5D A;  4MIJ A;  1CNQ A;  5I3S A;  1N04 A;  3UA8 A;  4L17 A;  3P7I A;  2X7P A;  3S9N C;  4GF8 A;  1FBH A;  2WBB A;  3OO8 A;  2B4M A;  4GRK A;  3ISP A;  2P0S A;  4H8I A;  4UAC A;  1GTK A;  2I3V A;  2WKY A;  4P0I A;  2OWZ A;  2QJE A;  2XHD A;  3PPO A;  4XEQ A;  4DXB A;  3IOT A;  2PT2 A;  5I58 B;  1ELJ A;  1FQB A;  3BIG A;  1B52 A;  4N8G A;  1IMC A;  1B05 A;  3QIM A;  4I3E A;  4ZEK A;  3H6W A;  2PCR A;  2CZI A;  4PFW A;  5EQ7 A;  2GHB A;  5CBS A;  4P3L A;  5EQA A;  4FAJ A;  4DLD A;  1MPD A;  4E0W A;  5I7I A;  2CZK A;  3FVO A;  1ZKB A;  1IMA A;  2VPN A;  3V89 B;  4OVQ A;  2D5W A;  5IZ1 A;  5I57 A;  1GGG A;  4GWO A;  3QAX A;  1NV1 A;  1LCT A;  3PGF A;  4QHQ A;  5ET5 A;  3E13 X;  1OVT A;  1DBZ A;  4O3B A;  2REG A;  1MPB A;  1LCF A;  4I1D A;  3FXR A;  1FTL A;  2Z23 A;  5JK4 A;  3OSR A;  4H5G A;  5H8N B;  4U1O A;  3O6I A;  4AB6 A;  4KD5 A;  2H25 A;  4JBZ A;  2ONR A;  4NF8 A;  1YXI A;  3LC8 A;  1IME A;  2OLB A;  1IIW A;  4MHF A;  1P1O A;  2I0C A;  1LAH E;  4KYE A;  4LON B;  2AYS A;  2W7Y A;  4HCY A;  5K2Y A;  5DT6 A;  3M3L A;  2VD2 A;  2QS4 A;  4YKP A;  4F3B A;  2QS3 A;  1K9Y A;  4HXV A;  3MBP A;  2P3V A;  2PFZ A;  1IMD A;  4R74 A;  4JSD A;  4NHB A;  3FV2 A;  5DTB A;  4GXS B;  3T93 B;  1M5B A;  3MVX A;  3MVY A;  4P8B A;  4PE5 B;  4WKM A;  3GBB A;  1DK4 A;  4H0W A;  1JP4 A;  2DYX A;  2DE3 A;  4DI4 B;  5EYF A;  1IXH A;  1IXC A;  1QUL A;  4R72 A;  4PQJ A;  3GLB A;  1S9T A;  2DE4 A;  3U65 A;  4RXL A;  2A5T A;  3TTL A;  4AS5 A;  2NOO A;  4MLV A;  1B2H A;  4R6H A;  2F78 A;  2F7C A;  3MJN A;  5IGA A;  4P9K A;  2F7B A;  3MPL A;  4MMP A;  4NE4 A;  3TDJ A;  1EU8 A;  1A99 A;  3C9H A;  3G3G A;  3B6T A;  4OER A;  4QSD A;  3VXC A;  4OEV A;  5HM4 B;  5DEX B;  3VFJ A;  2XXV A;  3CFZ A;  2X7Q A;  4F3P A;  2P3N A;  3OMB A;  3UOR A;  3U8Q A;  1N7X A;  1LBV A;  1DTG A;  1Y1M A;  2I4B A;  3BKI B;  5ITP A;  5EYG A;  3Q29 A;  3VLV A;  3ECR A;  2Q74 A;  1A8E A;  1IIT A;  4FEB A;  2F6G A;  2FBP A;  1XC1 A;  2UVJ A;  1B0L A;  2F6P A;  1RDX A;  3TEL A;  4KR5 A;  3LV0 A;  3SEX A;  3ZKK A;  3FVK A;  5J16 A;  4OTE A;  2BJI A;  5I2K A;  2VHA A;  3PUX E;  1KA0 A;  4O7I A;  1EZ9 A;  4JSO A;  2XXW A;  2KLF A;  3W9W A;  1FQF A;  1AL3 A;  3O28 A;  1A40 A;  2QVR A;  4U2R A;  1FBC A;  4OVT A;  5AA2 B;  4R2B A;  1FCK A;  2B3F A;  4EDP A;  1N7W A;  1QKB A;  3N6U A;  4F19 A;  1UTH A;  1P1N A;  3T9X B;  1Y4T A;  4KQP A;  1H3D A;  3H06 B;  2XXH A;  1MH3 A;  3TFL A;  3PUY E;  2I3W A;  1LB8 A;  5L9M A;  1F9B A;  4GL8 A;  4QFO A;  3K6X A;  3VLU A;  4N17 A;  3CFX A;  1NH8 A;  1M5E A;  4IY5 A;  3T1B A;  4FED A;  1XOC A;  4GIZ A;  3MP1 A;  4NF0 A;  1FPD A;  2WYK A;  4OVR A;  1HSL A;  4P1L A;  2Y7I A;  5I56 A;  3H03 A;  4GL0 A;  3U72 A;  4I62 A;  2AL4 A;  3PPR A;  1YTV A;  3G3I A;  3FZV A;  4PBQ A;  3SET A;  3N5L A;  4N6P A;  2XXR A;  3DP4 A;  3KGC A;  4GX4 A;  4YB5 A;  2QMW A;  1MY0 A;  4OA4 A;  1XHY A;  3OEL A;  1LBZ A;  2QVV A;  3ONM A;  2UVI A;  3T0J A;  1URG A;  3RT6 B;  4RY1 A;  2B3B A;  4MJO A;  1KZ8 A;  2Y7K A;  5I84 A;  1YPN A;  5AA1 A;  1Y9U A;  2L5V A;  2ZMB A;  4G8M A;  3MZ1 A;  1PEB A;  4O7M A;  1TWY A;  4X8R A;  1B0H A;  2DXY A;  4R9F A;  1B4Z A;  3TOD A;  4PP0 A;  1HSE A;  2HAU A;  5I2N B;  4R6Y A;  1OLC A;  1MM7 A;  4QFK A;  4U21 A;  1FBF A;  4TLM B;  2XD2 A;  4YU0 A;  3OEK A;  2R6G E;  5J1D A;  3MQ9 A;  4GWU A;  5TPA B;  4E0X A;  5KZT A;  2DVZ A;  1YCJ A;  3CG3 A;  4GWZ A;  2CZL A;  1D3K A;  3K01 A;  3RPW A;  4ELQ A;  2FHY A;  2D21 A;  1XS5 A;  2CEY A;  3IO6 A;  5H8H A;  3K4U A;  3QMF A;  2I49 A;  4C0R A;  3C36 A;  4GWX A;  4N8Y A;  4EF1 A;  1SW2 A;  3VVF A;  1LAX A;  1LGB C;  1MQH A;  2FYI A;  1G0H A;  4RA1 A;  4X1B A;  3RN8 A;  1ZIU A;  1OMP A;  1JVX A;  4LZ5 A;  2VPO A;  4ZEB A;  2PYY A;  3FXB A;  4MF3 A;  1I6A A;  1ZMG A;  1SVX B;  2IEE A;  4DDD A;  1B3E A;  4C1U A;  3UP9 A;  5F1Q A;  2XWK A;  5A5X B;  3TKD A;  2P2A A;  1LBW A;  4Q0C A;  3H6U A;  3PMX A;  4JB7 A;  2OWT A;  2Q8M A;  1OIB A;  3CI8 A;  2F97 A;  4WED A;  4HE2 A;  3C32 A;  5I59 A;  4H65 A;  2Z8E A;  4R73 A;  1URS A;  3CRB A;  4IY6 A;  2ESN A;  4NF4 A;  1EYJ A;  4GWW A;  4P0G A;  1Q1K A;  5HPQ A;  3B6W A;  4KCC A;  4OMB A;  4G8H A;  1JET A;  3IB2 A;  1R1N A;  1LST A;  1MXW A;  4H6D A;  5CMC A;  4KYS A;  5HBC A;  3THI A;  3OO7 A;  3MPK A;  2DWJ A;  3TCH A;  1DTZ A;  1NH7 A;  4G61 A;  3O6G A;  3GXA A;  4PC9 A;  1H76 A;  1PDA A;  1B7H A;  2H5Y A;  3FJM A;  1SYI A;  1NV5 A;  2FNC A;  2LAO A;  4QF9 A;  2THI A;  4PAK A;  4PFU A;  4OEN A;  1YZ0 A;  1MY2 A;  1LBB A;  4MLQ A;  4OZ9 A;  4MCO A;  1P1W A;  2F7A A;  4YKI A;  3MYU A;  3S9E A;  4PAF A;  3KC0 A;  3U92 A;  5DYH A;  3HST A;  1GR2 A;  2QRY A;  2XXT A;  3RT8 A;  5JTY B;  1Q9D A;  1IUD A;  2XXI A;  2XXK A;  3SEW A;  1QJM A;  5ET7 A;  4AS4 A;  1B46 A;  4NAP A;  3OD7 A;  4RPO A;  1NV7 A;  3E4R A;  2V93 A;  2WEF A;  4FJP A;  4EXL A;  1ANF A;  4M4G A;  4OAN A;  2VGQ A;  3A3U A;  1MQJ A;  4GWY A;  2OJT A;  5EYH A;  1TFA A;  4BDO A;  4EF2 A;  4HE0 A;  2PMS A;  3TEP A;  1MQD A;  3FAS A;  2O1L A;  2HCA A;  1HSJ A;  1CE2 A;  2ONS A;  1IZ1 A;  2RC7 A;  4YMA A;  2Z8D A;  1R6Z A;  4NMY A;  5IZZ A;  1FPK A;  1US5 A;  3IOR A;  1LLS A;  4BDQ A;  1LBC A;  3KEI A;  2Q9T A;  3OO9 A;  3V8X B;  1D9Q A;  3LBS A;  1S7Y A;  4ZDM A;  2YJP A;  4PFY A;  2B4L A;  3FXU A;  1KWH A;  1FPJ A;  1JW1 A;  2NXO A;  3TTN A;  1FPE A;  5H8Q B;  2OPD A;  4QRZ A;  3OXN A;  1Q35 A;  4OVP A;  1DPE A;  4ZZA A;  4PFI A;  4U4X A;  3RPL A;  3ZSF A;  4RK2 A;  1MM6 A;  5LDZ A;  2PX1 A;  4N13 A;  2FIX A;  1D9V A;  1MXZ A;  2YPN A;  2VOZ A;  3H6T A;  1BP5 A;  2ZZX A;  2O51 A;  1L5T A;  4BLA A;  1FPG A;  5IZ3 B;  5ET6 A;  3HV1 A;  5KCJ A;  1B58 A;  1SD3 A;  1N84 A;  3VE1 B;  4OES A;  3ZS6 A;  5AA4 B;  4OFL A;  3H3G A;  2P1S A;  3A29 A;  3TPA A;  5ICQ A;  1Y3N A;  3E9X A;  1PBQ A;  2RCB A;  3RYD A;  4H8J A;  4NED A;  4OFO A;  1B7U A;  3K2D A;  3PU5 A;  2XXP A;  1O63 A;  5ET8 A;  3PUV E;  3S4U A;  4NF6 A;  1FQC A;  2DE2 A;  2AIX A;  3HHF A;  4LA9 A;  2Y7P A;  4X9T A;  3PUZ E;  1SQY A;  2I4C A;  3RTF B;  5KDT B;  4EQ9 A;  4THI A;  4ELR A;  4DZ1 A;  3C31 A;  3MWB A;  1LB9 A;  3SES A;  2V3U A;  3OEM A;  2O69 A;  2QFL A;  1MRP A;  3FV1 A;  1SPI A;  1MQI A;  4IO4 A;  1P1U A;  5AE4 A;  2VD3 A;  2QSX A;  3TUS A;  4GX3 A;  1JW4 A;  4WXJ A;  1D4N A;  4F3S A;  2FVZ A;  3Q25 A;  4X1D A;  4FE8 A;  1YAE A;  1B51 A;  4PGN A;  4EUO A;  1OQG A;  1WOD A;  4NF5 B;  4NG7 A;  3PMV A;  1N3X A;  3CG1 A;  3R7X A;  4LQ2 A;  2RKM A;  5B70 A;  1DCU A;  4AQ4 A;  3R6U A;  3BIH A;  5H8F B;  4XF5 A;  4RK9 A;  3G3F A;  2DS9 A;  3K1P A;  3QK6 A;  1ZTY A;  2QPQ A;  2R9J A;  4MNP A;  4F22 A;  4H1X A;  2QMX A;  2Q2A A;  3CSG A;  3K02 A;  1NUW A;  3VDF A;  1WDN A;  2B65 A;  1NUY A;  1OVB A;  1FBG A;  3T22 A;  3JV9 A;  1FPB A;  1RYX A;  1Y4C A;  4XFE A;  3PD9 A;  2F3D A;  3K6W A;  5T3J A;  1Y20 A;  3LSW A;  5TU0 A;  4O8M A;  4XKQ A;  4ZS9 A;  3OO6 A;  2QVU A;  1NUX A;  1B3G A;  2DQV A;  3OSQ A;  1FRP A;  3RQT A;  1PC3 A;  1UTB B;  4NN3 A;  3IOU A;  4DCY A;  2RF1 A;  4NTL A;  3O66 A;  3Q26 A;  1SI0 A;  3I3V A;  1LBY A;  4O3A A;  4N6K A;  5I58 A;  2HFB A;  3T96 B;  1O7T A;  5CI5 A;  4UA8 A;  1AWB A;  3BBR A;  4R75 A;  1DSN A;  4LUB A;  4GX6 A;  4X04 A;  3SEU A;  1LBX A;  3K6V A;  4P11 A;  5I5P A;  4JWO A;  4PDH A;  4NWD A;  2DP8 A;  4ZEC A;  1XVX A;  4ESX A;  3DM0 A;  4TLL B;  3KFM A;  3FIR A;  3MST A;  1RDY A;  4LZ8 A;  1I6B A;  2IA4 A;  3IL1 B;  2ZNS A;  2FA7 A;  3T9H B;  3C4M A;  1B1H A;  4YB6 A;  1SW5 A;  3ILT B;  4PF6 A;  3DP6 A;  3PTY A;  3T66 A;  1JNF A;  2HXW A;  2UXA A;  4OVJ A;  4HE1 A;  1ZBM A;  1PB9 A;  3EHT A;  1S50 A;  5H8N A;  1POY 1;  2XX7 A;  1NL5 A;  3PPQ A;  1GVC A;  3D4C A;  2REJ A;  3W9V A;  3O29 A;  1MQG A;  4F1Y A;  3KJ7 A;  4G77 A;  1VSO A;  3ILU B;  4F18 A;  3FJG A;  4I9D A;  1LEV A;  2Q8J A;  1A55 A;  3GZG A;  2I6E A;  5CBR A;  1LFH A;  3C33 A;  4I8C A;  5CMM A;  4R9G A;  4Q30 B;  3EN3 A;  1EZO A;  4F1V A;  2DVC A;  4GFR A;  4O94 A;  2BJJ X;  3FJ7 A;  3KOS A;  4G68 B;  2GRV A;  1ZU0 A;  1FTK A;  4YB7 A;  2F36 A;  1IXG A;  3OEN A;  4QFN A;  2OWS A;  2ZZV A;  1M5F A;  2HZL A;  3IOW A;  1FPL A;  1I69 A;  2Y5L A;  3VVD A;  3QSL A;  1AOV A;  1FPI A;  4O3C A;  2ZNT A;  4BDL A;  5TP9 B;  1MDQ A;  1DOT A;  4YZZ A;  1MS7 A;  4ZE8 A;  1FQE A;  2Y5K A;  1FJ9 A;  1QGX A;  4OEU A;  3B50 A;  4GLI A;  4JVC A;  4HCW A;  3RTW B;  3NOH A;  4YKJ A;  3D4G A;  2RIN A;  2E1S A;  3RUM A;  2CEX A;  4GWS A;  4MNC A;  3VV5 A;  3CFL A;  4IO2 A;  1QKA A;  5DEX A;  1A7L A;  5EQ9 A;  4G68 C;  3ROJ A;  3KN7 A;  3TTR A;  3IO4 A; 
#chains in the Genus database with same CATH homology
 2P3V A;  2PFZ A;  1IMD A;  2WEF A;  1XI6 A;  3D1R A;  4JVI A;  4NHB A;  4OAN A;  4QBA A;  4P47 A;  4P8B A;  4GWY A;  5EYH A;  4HE0 A;  1DK4 A;  1JP4 A;  2DE3 A;  1G0I A;  4DI4 B;  5IZZ A;  4GBV A;  1FPK A;  2DE4 A;  1RDZ A;  1BK4 A;  2VT5 A;  4GBW A;  3U65 A;  4AS5 A;  2Q9T A;  2XA5 A;  1D9Q A;  4N91 A;  2B4L A;  1NV4 A;  1FPJ A;  5IGA A;  4P9K A;  1FPE A;  4MMP A;  4OVS A;  4OVP A;  4PFR A;  4N15 A;  5LTC A;  4PFI A;  1IMB A;  3RPL A;  1FTA A;  4N4U A;  4NX1 A;  5LDZ A;  2V4C A;  2WX9 A;  2FIX A;  3IFC A;  2PFY A;  1FSA A;  2ZZX A;  1FPG A;  2XWO A;  2P3N A;  5IZ3 B;  1NV0 A;  5ET6 A;  4N81 A;  1LBV A;  4NGU A;  5EYG A;  3GYY A;  2Q74 A;  3A29 A;  3EKI A;  2FBP A;  2KR0 A;  1RDX A;  2XWV A;  3LV0 A;  3RYD A;  1FBD A;  5J16 A;  2BJI A;  1KA0 A;  4O7I A;  5ET8 A;  5ESY A;  2DE2 A;  3W9W A;  1IMF A;  4X9T A;  3B8B A;  2QVR A;  3SZP A;  1FBC A;  4OVT A;  4F1U A;  3FBP A;  1KA1 A;  4I3Y A;  4F19 A;  2QFL A;  4H46 A;  1NV6 A;  1SPI A;  3CHG A;  2FIE A;  4I40 A;  1YYZ A;  4GX3 A;  3KBZ A;  2FVZ A;  2OX3 A;  5EQ8 A;  1FPF A;  3RPL B;  4PGN A;  5A5L A;  5F24 A;  4NG7 A;  3HFU A;  4N17 A;  3T1B A;  4PET A;  4PE3 A;  1DCU A;  3BIH A;  4NF0 A;  4XF5 A;  1FPD A;  2WYK A;  3IFA A;  4OVR A;  4N6D A;  4P1L A;  2QPQ A;  4MNP A;  4FBP A;  2ZZW A;  4PCD A;  4PGP A;  4PBQ A;  1NUW A;  1FJ6 A;  4PFB A;  4MEV A;  1EYK A;  4LN5 A;  2DDK A;  4YIC A;  1NUY A;  2HXR A;  5IM2 A;  1FBG A;  4GX4 A;  4H45 A;  1INP A;  1FPB A;  4XFE A;  4OA4 A;  2F3D A;  2MKZ A;  1LBZ A;  5T3J A;  2QVV A;  5FBP A;  3T0J A;  3E79 A;  4O8M A;  2QVU A;  4MJO A;  1NUX A;  4DI3 D;  1KZ8 A;  1FRP A;  2L5V A;  4O7M A;  4X8R A;  4NN3 A;  4IR8 A;  2XWI A;  1LBY A;  4N6K A;  1EYI A;  2R8T A;  4UAB A;  1FBE A;  1AWB A;  4KXP A;  4P1E A;  1FBF A;  4GX6 A;  4X04 A;  3KC1 A;  1LBX A;  5J1D A;  5I5P A;  2F3B A;  4PDH A;  4P56 A;  4GWU A;  3LUZ A;  2DVZ A;  2HPG A;  3MST A;  2HZK A;  4NQ8 A;  4JVD A;  4GWZ A;  1RDY A;  5DW8 A;  2KQZ A;  2F5X A;  3E78 A;  1FBP A;  4PTK A;  4PAI A;  2WYP A;  2JJK A;  2FHY A;  1NUZ A;  4PDD A;  2CEY A;  4PF6 A;  3QMF A;  3PTY A;  2GQ1 A;  4GWX A;  4MIJ A;  1CNQ A;  4HE1 A;  5I3S A;  4N8Y A;  4MNI A;  1G0H A;  5CM6 A;  1VDW A;  1FBH A;  2WBB A;  2B4M A;  2VPO A;  3FXB A;  3ISP A;  3W9V A;  2V3Q A;  2OWZ A;  2XWK A;  4XEQ A;  1NV2 A;  1LBW A;  4PF8 A;  4F18 A;  2Q8M A;  4HE2 A;  3BIG A;  4N8G A;  1IMC A;  1LEV A;  4I3E A;  2PCR A;  2CZI A;  2WBD A;  5EQ7 A;  1EYJ A;  4GWW A;  4P3L A;  5EQA A;  2HHM A;  5I7I A;  2CZK A;  4F1V A;  4O94 A;  1IMA A;  2VPN A;  4QXD A;  4OVQ A;  1NV3 A;  5IZ1 A;  2ZZV A;  4G61 A;  2HZL A;  1NV1 A;  1FPL A;  5ET5 A;  2Y5L A;  4PC9 A;  1DBZ A;  1FPI A;  1NV5 A;  4PAK A;  5JK4 A;  4PBH A;  4YZZ A;  1YZ0 A;  4MX6 A;  2Y5K A;  1FJ9 A;  1QGX A;  4MCO A;  3B50 A;  1YXI A;  4JVC A;  3MYU A;  1IME A;  4PAF A;  1K9Z A;  3KC0 A;  4M1V A;  4HCW A;  3NOH A;  4MHF A;  2CEX A;  4GWS A;  4MNC A;  1Q9D A;  4HCY A;  2XXK A;  1NI9 A;  4MAG A;  5EQ9 A;  5ET7 A;  3ROJ A;  4AS4 A;  4NAP A;  2CZH A;  1K9Y A;  5IZ3 A;  4HXV A;  1NV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...