1IMEA

Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 91
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1imeA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1imeA02
2R8TA 1FPFA 5LDZA 1FRPA 5ET7A 2FBPA 5EQ7A 1NI9A 1DCUA 2VT5A 2HHMA 1YZ0A 3KC0A 2Y5KA 1LBZA 4KXPA 2DDKA 1Q9DA 5ET5A 5IZ3B 5DW8A 4PTKA 1FBGA 5J16A 1G0HA 1LBWA 5FBPA 1EYKA 1AWBA 1IMCA 4HXVA 2WBBA 1FPBA 1NV4A 1EYIA 1FBPA 1IMFA 1LBXA 1NUWA 1FJ9A 1KZ8A 4O7IA 4GX6A 4GWXA 1FPJA 4GWZA 1FSAA 2F3BA 4IR8A 2FVZA 4GBWA 4G61A 4HE0A 1FBEA 3IFCA 2F3DA 4I40A 1BK4A 2Y5LA 4FBPA 4GX3A 1LBVA 4HE1A 1NV3A 1YXIA 3B8BA 2WBDA 4I3YA 1FBFA 3KBZA 1FTAA 1FBCA 5IZ1A 1QGXA 1KA0A 3IFAA 1SPIA 4QXDA 1NUXA 2QVUA 4MJOA 1FPEA 1KA1A 1LBYA 2P3VA 1NV7A 2QVVA 1K9YA 1K9ZA 1NV1A 4GWSA 4H46A 5IZ3A 5EYHA 2FIXA 1FPGA 1NV5A 2BJIA 3RPLB 5A5LA 2JJKA 1DK4A 3RYDA 2QFLA 4I3EA 2OX3A 2FHYA 1FPIA 2OWZA 3LV0A 5EQ9A 1FPKA 2P3NA 3RPLA 1RDYA 5ESYA 3LUZA 1XI6A 5EYGA 1CNQA 3KC1A 1NV0A 4GBVA 1FBHA 5ET8A 2GQ1A 4H45A 2PCRA 3ROJA 1NV6A 4GWUA 2CZIA 5I3SA 1RDZA 2Q74A 4GWYA 1IMDA 5EQAA 1FPDA 1D9QA 3QMFA 4GX4A 4AS4A 1IMAA 1INPA 4AS5A 1DBZA 4GWWA 5T3JA 2CZKA 3T0JA 2Q8MA 1IMBA 2CZHA 1G0IA 1FJ6A 1NV2A 1NUYA 3D1RA 1RDXA 4N81A 5EQ8A 3BIHA 1FBDA 1EYJA 2FIEA 1LEVA 1VDWA 5F24A 1FPLA 2WEFA 3FBPA 2QVRA 5ET6A 1NUZA 3A29A 1YYZA 1IMEA 1JP4A 4HE2A 3BIGA
chains in the Genus database with same CATH superfamily
1IIWA 3MSTA 3OENA 2UVIA 5IKBA 2QPQA 1FTMA 2F7CA 1Q9DA 4HW8A 4HCYA 4KQPA 4LN5A 1FPBA 1SBPA 5H8QA 4ZECA 5B70A 2YPNA 4OWDA 3TTMA 4IR8A 4G61A 4U2RA 3ZS6A 4RJZA 1SW1A 3KBZA 3FVNA 2CZLA 3GLBA 3DP8A 5ITOA 4G68C 3H7MA 1K9YA 3K4UA 4OENA 4ZEBA 3PPQA 1NV5A 5A5LA 1MDP1 1P1WA 1N04A 3EHTA 4G2ZA 3RTFB 5EQ9A 4JWXA 1MY3A 3V5AA 1URDA 4P8BA 3UIFA 5L9SA 2ZZXA 4TOZA 1NV0A 3O9PA 3ZSFA 1MY1A 3T66A 4G68A 5TP9B 4PFYA 1VFEA 3PPPA 1S50A 1ZLQA 3QUJA 4OVRA 2RCAA 4UACA 4JVCA 3H4ZA 4E0XA 4PE3A 4IO5A 1G0IA 3PPRA 3K00A 1FTKA 3F11A 3D4CA 2UVGA 2XD2A 5AA1A 5FHOA 1Y4CA 1NFTA 3FASA 4RPNA 4R6YA 1B3HA 1DCUA 4U1ZA 2DDKA 5IZ3B 4PBQA 4PFTA 3QIMA 1ZKBA 3TQWA 2F7BA 4NAPA 1KZ8A 1VFDA 4IGRA 5CMMA 3TYHA 3IORA 1PB8A 1ATGA 4QSDA 1LB8A 1I6QA 1WVJA 1N0TA 3EN3A 4JSOA 4DDDA 1IZ1A 2F6GA 3IFAA 3KN8A 3H6VA 1B3EA 1IXIA 3MBPA 5ICQA 4OHNA 4I9DA 3I5OA 1PBQA 4THIA 3K6UA 3UORA 3BBRA 4QFPA 4EDPA 1PB7A 1DPEA 1FQAA 5AA2B 2Y7PA 4Q5TA 5H8HB 2BJJX 3KBRA 4KPTA 4GVOA 1POY1 3MAMA 2OWZA 3S9MC 1B7UA 4FORA 1DOTA 2QSXA 4GIZA 1P1NA 1SYHA 3KN7A 3OO7A 3GXAA 1FBHA 3VVFA 1Y3PA 3H06B 2PCRA 1KWHA 3SDFA 3T93B 4MLQA 1D4NA 4OEUA 5HPQA 4R2FA 4WKMA 2Q8MA 4P11A 2CMOA 3CVGA 1PB9A 3Q29A 1S7YA 3CFLA 3EPEA 2QS2A 5LTCA 4O3CA 4DCXA 4PBHA 3MPLA 4KI0E 2A5SA 4QSEA 2XXQA 3KC0A 4KYDA 1QULA 4ELRA 3ZKLA 4OANA 1Y3NA 4FIMA 3RTWB 3OOAA 2DXRA 4HS7A 4M4GA 3GZGA 3M3LA 4MMPA 2DE3A 1YXIA 2HQ0A 1B3GA 1SW2A 3FUZA 3K1PA 3I3VA 1NUXA 4XKNA 5K2XA 3R7XA 4JBZA 1A8EA 1NMUA 1A8FA 2KLFA 4DE8A 2BJIA 1A54A 5KDTA 1NH7A 4UA8A 4QHQA 3TCFA 3FJMA 2OX3A 4RNSA 1NH8A 3HHGA 4JVDA 3VLWA 5I5PA 5EHSA 4ZE8A 3FGSA 5J1DA 4OVPA 4DCYA 5ESYA 1A40A 1XI6A 3U93A 4ECFA 3RT8A 2GHBA 2ZMBA 5IZZA 3KG2A 1FQCA 3IB0A 4AS5A 2F8DA 3KGCA 2AIXA 5LOMA 4U1OA 2A5TB 3BIHA 3JZJA 3THIA 1LEVA 3AXFA 5DEXA 3TTKA 1FTLA 3IOWA 2QMWA 3PUVE 4MH5A 1FPFA 5I56B 3FVGA 1M5BA 1MDQA 2Y5KA 2DQVA 1LBZA 2F5XA 2Z22A 5TP9A 4DXUA 3E9XA 1IITA 1FBGA 1LB9A 1EYKA 4XKQA 3PUYE 1MM6A 2ZZVA 4ZE9A 4NF8B 1FBPA 1IMFA 4ZS9A 1FQDA 1B2HA 3KFMA 2F34A 2FVZA 2QS4A 1ELJA 1GVCA 2H25A 1B7ZA 1ZIUA 4GX3A 3B6WA 3ISPA 2MKZA 1FTAA 1QVSA 3PMXA 1SPIA 2I4BA 4MJOA 3B6QA 2QRYA 5FHNA 3ILUB 3SEWA 4AB6A 3HN0A 5B7DA 5IZ3A 1B6HA 3KEIA 4IY5A 1YCJA 3PU5A 3UA8A 2PVUA 1MXXA 4YKPA 4G8MA 4ND9A 4G68B 1UIVA 2THIA 2B4MA 4QSCA 2XXYA 3Q26A 3T1BA 3MPKA 3C32A 5I59B 1CNQA 4KFQA 4RYAA 1RDZA 3TQLA 4F2QA 4IO7A 2Z23A 2FYIA 3LR1A 4GWWA 3H6UA 4IY6A 5EYFA 5IAIA 1XS5A 4O94A 4N17A 3LSWA 4F3GA 1RDXA 3KJTA 4BDRA 2D3IA 1RYXA 5AA2A 3LUYA 3VLUA 4EQ9A 5H8HA 2WEFA 5ET6A 3MQ9A 3ILTB 3JV9A 1JW5A 3BIGA 3FV1A 2Q88A 2IEEA 1B9JA 1DTZA 3TTNA 1EZPA 4ONYA 4QFLA 3CIJA 5ELVA 1S9TA 5FHMA 2DVCA 4PTKA 3IB1A 2H99A 2PX1A 4NTLA 3EKIA 4LZ8A 3S9EA 1GR2A 1O7TA 4ZZAA 4P3LA 3IFCA 4N6KA 1AOVA 1MPDA 1NV3A 1II5A 3IB2A 4XF5A 4Z0IA 1P1QA 1FBCA 4LATA 5CBSA 4BDQA 2UYFA 2OLBA 5M2VA 4NWDA 5I2KB 3TAJA 4EXKA 3TFLA 3H6WA 2ANJA 3RYDA 1I6BA 2FA7A 1FQEA 3LV0A 2Q9TA 1RDYA 2DWJA 2LAOA 1MPBA 4PAIA 4JDFA 4MX6A 1IMDA 5EQAA 3C31A 4FE8A 4ZEDA 3PUWE 2XHDA 4O7MA 2ONKE 3KJ7A 3FXUA 1CB6A 3VDFA 3TMGA 2CZHA 1A7LA 1NV2A 3T9XB 2ESNA 4BLAA 1JVYA 3RT6B 3QK6A 4HE2A 5DTBA 3OXNA 5ET7A 5EQ7A 1NI9A 5DT6A 2RC8A 1B05A 1N7XA 2W7YA 2PFYA 3PMVA 5J16A 2DVZA 1G0HA 1LFHA 5FBPA 1B3FA 4OETA 1O63A 3U65A 2UVJA 3O29A 3CSGA 3A3UA 2A5TA 2DSFA 5AA3A 3MZ9A 2F3BA 4PFRA 1MPCA 4LZ7A 4PP0A 3N6TA 3MUQA 3JYRA 3S9NC 3FATA 2Y5LA 4XIGQ 2IA4A 1HSLA 4N8GA 1Q35A 1MXUA 4RK9A 2HAVA 2ONRA 5I56A 1FPEA 5KDTB 2ZYNA 3CG3A 5L9MA 3K2DA 3MZBA 1J1NA 3RPWA 4OMBA 5TPAB 4I62A 3DELB 1FTJA 3ZKKA 4H46A 4QFNA 2Q2AA 4ELOA 3O66A 4YAHX 4NF8A 2ZNTA 3QXMA 1MY4A 1R9QA 3RPLA 1TWYA 4Z7EA 2KQZA 2XX7A 3PV0E 3G3HA 3C34A 5HBCA 1VE4A 3MW0A 2WX9A 4E0WA 3EF7A 4PFIA 2Q74A 1FCKA 3MWBA 1AH5A 1TXFA 2HEUA 4DIGA 3UP9A 1B4ZA 3E4RA 2H98A 4MLVA 5DEXB 3PPNA 1FQFA 1R6ZA 3D1RA 1EYJA 2DE4A 3FIRA 3QYTA 2G29A 3GBBA 3ECRA 3A09A 2V3TA 4FATA 5I59A 3OMBA 3G3KA 4U4XA 1TFDA 4PDDA 4Q30B 4YMBA 4PDHA 1MG1A 3TCGA 1H43A 2I58A 2OBGA 3LSXA 4OVQA 1Y4TA 3T9HB 4JB7A 2DS9A 4NX1A 3O6HA 3CG1A 4Q8RA 1FJ9A 1SW5A 4GBWA 3KN3A 3IK6B 3T22A 3ODBA 1SQYA 2DWIA 4U23A 2I3VA 4I3YA 2XXVA 1MRPA 1H76A 2DP8A 2I0BA 4IGTA 1CE2A 1NV1A 4C1TA 1D9VA 1WDNA 3CI8A 4XFEA 3RQTA 4NN3A 4O3AA 1P99A 1LBBA 3OSQA 2R6GE 1TT1A 3BFUA 4X1DA 2GQ1A 5K2YA 4PFWA 4MCOA 3PGFA 1H44A 1B5IA 3U72A 3FV2A 4GRKA 1NNPA 3CSBA 4BDMA 4PF6A 4LUBA 5AA4A 2QS3A 2HFBA 1SW4A 4H0WA 5I2KA 3BKIB 3PMWA 4N07A 1B5JA 2X26A 3TEPA 1R9LA 4M1VA 1IEJA 3K6VA 5H8NA 1L5TA 1FPLA 4NMYA 2O7UA 4I8CA 2QMXA 3SESA 1UTBB 1YYZA 1IMEA 4X48A 3V83A 2O51A 5DVJA 4R9FA 1JVXA 3O28A 3R6UA 4MFIA 3O6IA 3S2VA 2XWKA 3HCQA 2REJA 5KCJB 3V8XB 3C4MA 3MP8A 5F7VA 3M3FA 5BWJA 4O7IA 3DLNA 4RXLA 2F78A 1FSAA 3RNNA 4O3BA 3S9LC 4HTGA 1T0KA 2Q8JA 2X7PA 5CBRA 4OFJA 5A5XB 2WYPA 2CEYA 2YJPA 2O1MA 3TDJA 4OZ9A 4IO3A 3B50A 4YMAA 2O84X 4PGNA 4BDOA 4PQJA 4YKJA 4OVTA 3FJ7A 2RKMA 1FPGA 1URGA 3LBSA 4KCCA 1MH4A 4NEDA 4R72A 1I6AA 3MVWA 4I3EA 4G8NA 2F36A 5I57B 5FTIA 5JK4A 3CFZA 4XEQA 2AL5A 2OK2A 4GXSB 2B3BA 4N4UA 2CZIA 1PC3A 2GH9A 1PBPA 4R75A 4P0GA 1B3LA 2PYYA 4P1LA 2Z8FA 1RKMA 5TPAA 3O6GA 4PAFA 3C9HA 3VV5A 4NGUA 4N15A 4N8YA 4H67A 1SI1A 4MNCA 4F39A 1NUZA 2H9BA 4ZDMA 2R8TA 2O1LA 3TTLA 1IXGA 1YZ0A 4R2BA 4WEDA 4YKIA 4H5GA 3KOSA 4N6DA 3SEYA 1EH3A 5DW8A 4H65A 1IMCA 1ZJLA 4MEVA 3W15C 3HHFA 1NV4A 4ESXA 1LAFE 1UTHB 4N6PA 4ELQA 4GWXA 4PFUA 4MAGA 3O2AA 3OEMA 2Z8DA 1SDXA 1XVXA 2ABHA 1FBEA 1I69A 1AIVA 4POWA 4NQ8A 4FBPA 4H1XA 4EQ7A 4EQBA 5CC2A 3DP4A 1QGXA 5IGAA 1MY0A 3W9WA 4JXIA 2ZXTA 4OVJA 4NF6B 3PTYA 1Y3QA 3MVZA 4GD5A 3K6WA 4YB7A 2ZNUA 3RPLB 2X7QA 3MC2A 3U92A 2RF1A 2JJKA 3P7IA 3M8UA 1VSOA 2OPDA 4KCDA 4RY1A 1FPKA 1XOCA 5CM6A 2AYSA 4F1YA 3USDA 2D5WA 2HXWA 2DE2A 4NG7A 2R9JA 2GFEA 4H45A 4AQ4A 3OELA 1D9QA 1MQIA 1A55A 1B58A 4XKRA 1JW1A 4R6HA 4PC9A 4PETA 2O7IA 2HPGA 3OO6A 1HSEA 2I49A 4RPOA 3A29A 3C33A 4G4PA 2I6EA 5IM2A 4MBPA 2NXOA 3IJOB 3MP1A 3SEXA 2XXWA 4R9GA 1BP5A 2DWAA 4FJPA 1OQHA 1DTGA 2OJTA 3K1NA 3HV1A 3PUZE 1LFIA 2F7AA 3KZGA 4GOTA 5CMCA 4XTCQ 1OLCA 2WYKA 4LA9A 4BDLA 4OQOA 1UTBA 2ONSA 4QXDA 4ZZEA 1MM7A 3SETA 1MXWA 1FTOA 3O97A 4IB2A 5KCJA 5EYHA 2RCBA 3KSXA 2Y7RA 2AL4A 3EQ1A 3MVYA 5I7IA 1DK4A 2QFLA 3UN6A 5CRYA 4LVQA 2GHAA 5I58B 4KYSA 2HAUA 4NF0A 2OWTA 4LZ5A 4YKKA 3PD9A 5DYHA 3WAEA 1H3DA 5A5XA 1BTJA 4H8JA 5AA4B 3G3GA 4OERA 4GWUA 2RC9A 3N94A 5L8DA 3VVEA 4GX4A 1IMAA 1MQHA 2P0SA 4DXBA 5DVFA 1HSJA 4OA4A 5H8NB 1B0LA 4FECA 1XC1A 3N6UA 4OTEA 4GL0A 4MIJA 3PPOA 1FJ6A 3I6VA 4N81A 1QUJA 2P1SA 4TQUQ 2DOJA 2QVRA 2I4CA 4F1VA 1M5DA 1Y9UA 5I57A 5LDZA 1NNKA 4QBAA 3R26A 1POTA 4U21A 3TELA 5TU0A 2V3QA 2E1SA 1JQFA 1M5CA 4K3FA 1SVXB 3L6GA 3IL1B 2VOZA 4GWZA 1JNFA 2V25A 1YPNA 4ELPA 4R73A 5BUUA 2HZLA 2F3DA 5H8SA 2GRVA 3ONMA 1RYOA 4LONB 1KA1A 2O68A 2QJEA 3K02A 4RK2A 2H5YA 3B7DA 1B46A 4OESA 1UQWA 2WKYA 2VP1A 5JTYA 4LP2B 1UTHA 1LCTA 1USYH 1Y1ZA 4LQ2A 1VR5A 1MXVA 4GBVA 4HCWA 4QFOA 2ZYMA 3SZPA 5H8FB 4N91A 4KD5A 2QS1A 1N76A 4YU0A 2UXAA 1MQGA 4X9TA 1B32A 3A3CA 4PE5B 4NHBA 4NF6A 1JEUA 3V89B 1OVTA 1FW0A 3H3GA 1MQDA 1MY2A 2Y7WA 1B52A 1LGBC 1VDWA 4IO2A 2PBWA 1LAXA 2V3UA 1JETA 1M5FA 4POXA 5I2NB 1LSTA 3G3IA 1FRPA 1SI0A 3MZ1A 1LAGE 4MNIA 3VE1B 1XHYA 3BFTA 1AWBA 4P9KA 4F3PA 4PF8A 3QSLA 3G3FA 1FPJA 4QRZA 3HPIA 1SD3A 3VFJA 5JEIA 1AL3A 1B51A 4WEPA 4H5FA 5AE4A 2ZZWA 2VHAA 2PT2A 1IXCA 2OCUA 3LSFB 1XVYA 2XXXA 1OQGA 2E0SA 4AB5A 3U1OA 1KA0A 3PUXE 2QVUA 5DVIA 1NV7A 3T9VA 4C0RA 3Q25A 2V84A 1P1OA 4P56A 4F3SA 4DLDA 3NOHA 2H4IA 2FNCA 4G77A 3TPAA 1JW4A 3SKPA 3TCHA 3MJNA 3LUZA 3DM0A 1EU8A 2YLNA 4X1BA 2Q2CA 1FQBA 3FXBA 4FEDA 1NL5A 2DWHA 1OMPA 4YICA 4F31B 1DBZA 4MHFA 4NF5B 3MP6A 2Z8EA 4OXVA 4KR5A 3DP6A 1B40A 1OLAA 2D21A 2XXIA 2HXRA 3IJXB 4O8MA 4PGPA 1FBDA 3L6HA 4XXUA 3FXQA 2XA5A 4FAJA 3GYYA 4F18A 1QUKA 5I58A 3GBAA 3M3KA 4FEBA 1B7HA 3UK4A 4ZEFA 4KXPA 1H45A 1US5A 4KYEA 2F35A 1B1XA 1LBWA 3E3KA 4HXVA 2P2AA 4G8HA 2F97A 2UYEA 3E78A 3VVDA 1MS7A 5ITPA 3KSJA 2PMSA 4PFBA 4HE0A 4ZEKA 3CHGA 3H6TA 4PAKA 2B4LA 4I40A 3IOTA 1LBVA 2WBDA 1FBFA 1YTVA 1N3WA 3TKDA 2F6PA 3S4UA 4P1EA 1Z7ME 4GQOA 3B6TA 1LBYA 1PDAA 4X8RA 2XXTA 2ZNSA 1ZBMA 4DI4B 3IOUA 5CI5A 4PCDA 4YZZA 3OD7A 3E79A 3IX1A 2FHYA 5F1QA 4QFKA 3RUMA 3K0VA 4OVSA 2XXPA 3RLFE 2Y7IA 3W9VA 1USYE 2UVHA 3OO9A 3RGYA 1ANFA 3LC8A 3MYUA 3CFXA 3ROJA 1OIBA 3C35A 4TLLB 3HO7A 4EXLA 4GWYA 1OVBA 4IO6A 1LFGA 1FPDA 1INPA 3IOVA 4LQ5A 4F29A 3IR1A 1F9BA 2KR0A 2V93A 2XXRA 3FJGA 2Y84A 3IAZA 2G93A 3FBPA 1ZU0A 1BIYA 3T9UA 1AMFA 1SYIA 1XT8A 2OZZA 1BLFA 1EZOA 5H8FA 4GL8A 5HM4B 4X04A 1IQ7A 5L9OA 3SEUA 4GX6A 3TODA 2V4CA 2VGQA 4JSDA 4NE4A 2I48A 3UGWA 3CR9A 2DXYA 4ESWA 1P1UA 1QW0A 4NF4B 4OYVA 3SEVA 1JEVA 1Y1MA 2XWIA 4H6DA 1BK4A 3CRBA 2O6AA 2REGA 2XWOA 4YB5A 5I2NA 3N5LA 4UABA 2R71A 3LSLA 4H8IA 3K01A 3QAXA 2NVUB 2RC7A 4GXAA 5JTYB 3U94A 1A99A 3T96B 3EHUA 1TFAA 3FZVA 1ZMGA 3HFUA 4C1UA 1WODA 1D3KA 2XX8A 4R6KA 4DXCA 4RA1A 2B65A 5I3SA 2OWSA 1US4A 2VD3A 4AS4A 3QMFA 2Q89A 2B3FA 2NUVA 2NOOA 5T3JA 2CZKA 3T0JA 5H8QB 1IMBA 4DI3D 1LCFA 1NUYA 1DSNA 1NNTA 4JVIA 3TTRA 1Z7NE 2FIEA 4OFLA 1IXHA 3K6XA 3VXBA 1MH3A 5I84A 5ISUA 4TLMB 1QUIA 3TUSA 2FBPA 4BDNA 3EHSA 2HHMA 1N84A 3OO8A 2NWJA 4OEVA 5ET5A 2XWVA 1NKXA 1PEBA 1O64A 2WBBA 1LLSA 4NF5A 1LBXA 4EF1A 3G7WA 5KZTA 4L17A 1IUDA 4F19A 3HSTA 1GTKA 3TZAA 5CMKA 3VXCA 2Y7KA 4EF2A 4HE1A 1N7WA 3IO4A 4JWYA 2XX9A 5IZ1A 3G3JA 3E13X 2P3VA 4P0IA 2QVVA 2VD2A 2I3WA 5ICTA 3FVOA 2FIXA 1MQJA 4IO4A 1Q1KA 2VPNA 1B1HA 1GV8A 3KOTA 2P3NA 5FTHA 4GFRA 4F2OA 4Q0CA 3MVXA 3D4GA 3C36A 1LBCA 3K1MA 1NV6A 2O69A 2L5VA 5EHMA 3FD3A 3OEKA 1B4HA 3QUFA 4ISUA 4U22A 4XKPA 3FXRA 2DYXA 4R74A 3SERA 5EQ8A 3RY3A 1DMBA 4GWOA 2PFZA 5F24A 2XXUA 5AA2D 3H03A 1QJMA 4DZ1A 2QL3A 1QKBA 4NWCA 3N26A 2VT5A 1URSA 4I1DA 1NNFA 1B0HA 3Q27A 1M5EA 4GF8A 3PD8A 4WXJA 1R1NA 1EYIA 3U8QA 1NUWA 2RINA 1LAHE 1GGGA 2PT1A 3WAFA 2ZYKA 1N3XA 3FVKA 3OSRA 4ZEIA 1MXZA 3B8BA 1MXYA 4MNPA 2CEXA 4U4SA 4F3BA 2I0CA 2ZYOA 4QF9A 4P47A 4YB6A 1K9ZA 2XXKA 4GWSA 1QKAA 5CMBA 4EUOA 1ZTYA 4F1UA 1FPIA 1D9YA 3IO6A 1UIUA 4NF4A 2VPOA 5EYGA 3KC1A 2ALUA 1DPPA 5ET8A 1Y20A 1B5HA 4KHZE 1EZ9A 4MF3A 4F22A 2OPEA 2XXHA 2HCAA 3VLVA 3RN8A 1BKAA 4JWOA 2M8CA 2XD3A 3Q28A 4OFOA 4N13A 1YAEA 2HZKA 4GLIA 1JP4A
chains in the Genus database with same CATH topology
2R8TA 3MSTA 1YZ0A 2QPQA 4KXPA 1Q9DA 4N6DA 4HCYA 5DW8A 4PTKA 1LBWA 1IMCA 4LN5A 4HXVA 4MEVA 1FPBA 1NV4A 3E78A 4GWXA 4MAGA 3EKIA 4IR8A 4G61A 4PFBA 4HE0A 1FBEA 4P3LA 3CHGA 4PAKA 3IFCA 2B4LA 4N6KA 4I40A 4NQ8A 4FBPA 1LBVA 1NV3A 2WBDA 1FBFA 4XF5A 3KBZA 1FBCA 1QGXA 5IGAA 4P1EA 3W9WA 1LBYA 4X8RA 1K9YA 4DI4B 3PTYA 4PCDA 4YZZA 1NV5A 3RPLB 5A5LA 2JJKA 3E79A 3RYDA 2FHYA 4OVSA 3LV0A 5EQ9A 1FPKA 5CM6A 2Q9TA 4P8BA 1RDYA 3W9VA 2ZZXA 2DE2A 1NV0A 4NG7A 4PAIA 3MYUA 4H45A 3ROJA 4MX6A 4GWYA 1IMDA 5EQAA 4OVRA 1FPDA 1D9QA 4O7MA 1INPA 4JVCA 2KR0A 4PE3A 2CZHA 1G0IA 4PC9A 1NV2A 4PETA 2HPGA 3FBPA 3A29A 4HE2A 5IM2A 5ET7A 5EQ7A 1NI9A 1DCUA 2DDKA 2PFYA 5IZ3B 5J16A 4PBQA 2DVZA 1G0HA 5FBPA 4X04A 4NAPA 1KZ8A 3U65A 4GX6A 2V4CA 2F3BA 4PFRA 2WYKA 2XWIA 1BK4A 2Y5LA 2XWOA 4N8GA 4UABA 3IFAA 4QXDA 1FPEA 4H46A 5EYHA 5I7IA 1DK4A 2QFLA 2OWZA 4NF0A 3RPLA 3HFUA 2KQZA 1FBHA 2WX9A 2PCRA 4PFIA 4GWUA 5I3SA 2Q74A 4GX4A 3QMFA 4AS4A 1IMAA 4OA4A 5T3JA 2CZKA 3T0JA 2Q8MA 1IMBA 4MIJA 4DI3D 1FJ6A 1NUYA 3D1RA 4JVIA 4N81A 1EYJA 2FIEA 2DE4A 2QVRA 5LTCA 4F1VA 4PBHA 5LDZA 2FBPA 4QBAA 2HHMA 4PDDA 3KC0A 4PDHA 5ET5A 2XWVA 2V3QA 4OVQA 4OANA 2WBBA 4NX1A 1LBXA 1FJ9A 4GWZA 4F19A 4GBWA 2HZLA 2F3DA 4MMPA 2DE3A 4HE1A 1YXIA 4I3YA 5IZ1A 1NUXA 1KA1A 2P3VA 2QVVA 1NV1A 2FIXA 2BJIA 4XFEA 2OX3A 2VPNA 4NN3A 4JVDA 5I5PA 2P3NA 5J1DA 4OVPA 5ESYA 1XI6A 4GBVA 4HCWA 3SZPA 4N91A 2GQ1A 5IZZA 4MCOA 1NV6A 2L5VA 4X9TA 4AS5A 4PF6A 4NHBA 5EQ8A 3BIHA 4M1VA 1LEVA 1VDWA 2PFZA 5F24A 1FPLA 1YYZA 1IMEA 1FPFA 1FRPA 2VT5A 4MNIA 2Y5KA 2F5XA 1LBZA 2XWKA 1FBGA 1EYKA 1AWBA 4P9KA 2ZZVA 1EYIA 1FBPA 1IMFA 1NUWA 4O7IA 4PF8A 1FPJA 1FSAA 2FVZA 2ZZWA 2WYPA 2CEYA 4GX3A 3B8BA 3ISPA 2MKZA 1FTAA 4MNPA 1KA0A 1SPIA 2CEXA 2QVUA 4MJOA 3B50A 1NV7A 4PGNA 4P47A 1K9ZA 2XXKA 4GWSA 4OVTA 4P56A 5IZ3A 1FPGA 3NOHA 4I3EA 4F1UA 1FPIA 2B4MA 3T1BA 5JK4A 3LUZA 4XEQA 2VPOA 5EYGA 1CNQA 3KC1A 5ET8A 4N4UA 2CZIA 1RDZA 3FXBA 4YICA 4P1LA 1DBZA 4MHFA 4GWWA 4PAFA 4O94A 4NGUA 4N17A 4N15A 4N8YA 2HXRA 1RDXA 4O8MA 4PGPA 1FBDA 4MNCA 2XA5A 3GYYA 2WEFA 4F18A 5ET6A 1NUZA 2HZKA 1JP4A 3BIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8T A;  1FPF A;  5LDZ A;  1FRP A;  5ET7 A;  2FBP A;  5EQ7 A;  1NI9 A;  1DCU A;  2VT5 A;  2HHM A;  1YZ0 A;  3KC0 A;  2Y5K A;  1LBZ A;  4KXP A;  2DDK A;  1Q9D A;  5ET5 A;  5IZ3 B;  5DW8 A;  4PTK A;  1FBG A;  5J16 A;  1G0H A;  1LBW A;  5FBP A;  1EYK A;  1AWB A;  1IMC A;  4HXV A;  2WBB A;  1FPB A;  1NV4 A;  1EYI A;  1FBP A;  1IMF A;  1LBX A;  1NUW A;  1FJ9 A;  1KZ8 A;  4O7I A;  4GX6 A;  4GWX A;  1FPJ A;  4GWZ A;  1FSA A;  2F3B A;  4IR8 A;  2FVZ A;  4GBW A;  4G61 A;  4HE0 A;  1FBE A;  3IFC A;  2F3D A;  4I40 A;  1BK4 A;  2Y5L A;  4FBP A;  4GX3 A;  1LBV A;  4HE1 A;  1NV3 A;  1YXI A;  3B8B A;  2WBD A;  4I3Y A;  1FBF A;  3KBZ A;  1FTA A;  1FBC A;  5IZ1 A;  1QGX A;  1KA0 A;  3IFA A;  1SPI A;  4QXD A;  1NUX A;  2QVU A;  4MJO A;  1FPE A;  1KA1 A;  1LBY A;  2P3V A;  1NV7 A;  2QVV A;  1K9Y A;  1K9Z A;  1NV1 A;  4GWS A;  4H46 A;  5IZ3 A;  5EYH A;  2FIX A;  1FPG A;  1NV5 A;  2BJI A;  3RPL B;  5A5L A;  2JJK A;  1DK4 A;  3RYD A;  2QFL A;  4I3E A;  2OX3 A;  2FHY A;  1FPI A;  2OWZ A;  3LV0 A;  5EQ9 A;  1FPK A;  2P3N A;  3RPL A;  1RDY A;  5ESY A;  3LUZ A;  1XI6 A;  5EYG A;  1CNQ A;  3KC1 A;  1NV0 A;  4GBV A;  1FBH A;  5ET8 A;  2GQ1 A;  4H45 A;  2PCR A;  3ROJ A;  1NV6 A;  4GWU A;  2CZI A;  5I3S A;  1RDZ A;  2Q74 A;  4GWY A;  1IMD A;  5EQA A;  1FPD A;  1D9Q A;  3QMF A;  4GX4 A;  4AS4 A;  1IMA A;  1INP A;  4AS5 A;  1DBZ A;  4GWW A;  5T3J A;  2CZK A;  3T0J A;  2Q8M A;  1IMB A;  2CZH A;  1G0I A;  1FJ6 A;  1NV2 A;  1NUY A;  3D1R A;  1RDX A;  4N81 A;  5EQ8 A;  3BIH A;  1FBD A;  1EYJ A;  2FIE A;  1LEV A;  1VDW A;  5F24 A;  1FPL A;  2WEF A;  3FBP A;  2QVR A;  5ET6 A;  1NUZ A;  3A29 A;  1YYZ A;  1IME A;  1JP4 A;  4HE2 A;  3BIG A; 
#chains in the Genus database with same CATH topology
 1IIW A;  3MST A;  3OEN A;  2UVI A;  5IKB A;  2QPQ A;  1FTM A;  2F7C A;  1Q9D A;  4HW8 A;  4HCY A;  4KQP A;  4LN5 A;  1FPB A;  1SBP A;  5H8Q A;  4ZEC A;  5B70 A;  2YPN A;  4OWD A;  3TTM A;  4IR8 A;  4G61 A;  4U2R A;  3ZS6 A;  4RJZ A;  1SW1 A;  3KBZ A;  3FVN A;  2CZL A;  3GLB A;  3DP8 A;  5ITO A;  4G68 C;  3H7M A;  1K9Y A;  3K4U A;  4OEN A;  4ZEB A;  3PPQ A;  1NV5 A;  5A5L A;  1MDP 1;  1P1W A;  1N04 A;  3EHT A;  4G2Z A;  3RTF B;  5EQ9 A;  4JWX A;  1MY3 A;  3V5A A;  1URD A;  4P8B A;  3UIF A;  5L9S A;  2ZZX A;  4TOZ A;  1NV0 A;  3O9P A;  3ZSF A;  1MY1 A;  3T66 A;  4G68 A;  5TP9 B;  4PFY A;  1VFE A;  3PPP A;  1S50 A;  1ZLQ A;  3QUJ A;  4OVR A;  2RCA A;  4UAC A;  4JVC A;  3H4Z A;  4E0X A;  4PE3 A;  4IO5 A;  1G0I A;  3PPR A;  3K00 A;  1FTK A;  3F11 A;  3D4C A;  2UVG A;  2XD2 A;  5AA1 A;  5FHO A;  1Y4C A;  1NFT A;  3FAS A;  4RPN A;  4R6Y A;  1B3H A;  1DCU A;  4U1Z A;  2DDK A;  5IZ3 B;  4PBQ A;  4PFT A;  3QIM A;  1ZKB A;  3TQW A;  2F7B A;  4NAP A;  1KZ8 A;  1VFD A;  4IGR A;  5CMM A;  3TYH A;  3IOR A;  1PB8 A;  1ATG A;  4QSD A;  1LB8 A;  1I6Q A;  1WVJ A;  1N0T A;  3EN3 A;  4JSO A;  4DDD A;  1IZ1 A;  2F6G A;  3IFA A;  3KN8 A;  3H6V A;  1B3E A;  1IXI A;  3MBP A;  5ICQ A;  4OHN A;  4I9D A;  3I5O A;  1PBQ A;  4THI A;  3K6U A;  3UOR A;  3BBR A;  4QFP A;  4EDP A;  1PB7 A;  1DPE A;  1FQA A;  5AA2 B;  2Y7P A;  4Q5T A;  5H8H B;  2BJJ X;  3KBR A;  4KPT A;  4GVO A;  1POY 1;  3MAM A;  2OWZ A;  3S9M C;  1B7U A;  4FOR A;  1DOT A;  2QSX A;  4GIZ A;  1P1N A;  1SYH A;  3KN7 A;  3OO7 A;  3GXA A;  1FBH A;  3VVF A;  1Y3P A;  3H06 B;  2PCR A;  1KWH A;  3SDF A;  3T93 B;  4MLQ A;  1D4N A;  4OEU A;  5HPQ A;  4R2F A;  4WKM A;  2Q8M A;  4P11 A;  2CMO A;  3CVG A;  1PB9 A;  3Q29 A;  1S7Y A;  3CFL A;  3EPE A;  2QS2 A;  5LTC A;  4O3C A;  4DCX A;  4PBH A;  3MPL A;  4KI0 E;  2A5S A;  4QSE A;  2XXQ A;  3KC0 A;  4KYD A;  1QUL A;  4ELR A;  3ZKL A;  4OAN A;  1Y3N A;  4FIM A;  3RTW B;  3OOA A;  2DXR A;  4HS7 A;  4M4G A;  3GZG A;  3M3L A;  4MMP A;  2DE3 A;  1YXI A;  2HQ0 A;  1B3G A;  1SW2 A;  3FUZ A;  3K1P A;  3I3V A;  1NUX A;  4XKN A;  5K2X A;  3R7X A;  4JBZ A;  1A8E A;  1NMU A;  1A8F A;  2KLF A;  4DE8 A;  2BJI A;  1A54 A;  5KDT A;  1NH7 A;  4UA8 A;  4QHQ A;  3TCF A;  3FJM A;  2OX3 A;  4RNS A;  1NH8 A;  3HHG A;  4JVD A;  3VLW A;  5I5P A;  5EHS A;  4ZE8 A;  3FGS A;  5J1D A;  4OVP A;  4DCY A;  5ESY A;  1A40 A;  1XI6 A;  3U93 A;  4ECF A;  3RT8 A;  2GHB A;  2ZMB A;  5IZZ A;  3KG2 A;  1FQC A;  3IB0 A;  4AS5 A;  2F8D A;  3KGC A;  2AIX A;  5LOM A;  4U1O A;  2A5T B;  3BIH A;  3JZJ A;  3THI A;  1LEV A;  3AXF A;  5DEX A;  3TTK A;  1FTL A;  3IOW A;  2QMW A;  3PUV E;  4MH5 A;  1FPF A;  5I56 B;  3FVG A;  1M5B A;  1MDQ A;  2Y5K A;  2DQV A;  1LBZ A;  2F5X A;  2Z22 A;  5TP9 A;  4DXU A;  3E9X A;  1IIT A;  1FBG A;  1LB9 A;  1EYK A;  4XKQ A;  3PUY E;  1MM6 A;  2ZZV A;  4ZE9 A;  4NF8 B;  1FBP A;  1IMF A;  4ZS9 A;  1FQD A;  1B2H A;  3KFM A;  2F34 A;  2FVZ A;  2QS4 A;  1ELJ A;  1GVC A;  2H25 A;  1B7Z A;  1ZIU A;  4GX3 A;  3B6W A;  3ISP A;  2MKZ A;  1FTA A;  1QVS A;  3PMX A;  1SPI A;  2I4B A;  4MJO A;  3B6Q A;  2QRY A;  5FHN A;  3ILU B;  3SEW A;  4AB6 A;  3HN0 A;  5B7D A;  5IZ3 A;  1B6H A;  3KEI A;  4IY5 A;  1YCJ A;  3PU5 A;  3UA8 A;  2PVU A;  1MXX A;  4YKP A;  4G8M A;  4ND9 A;  4G68 B;  1UIV A;  2THI A;  2B4M A;  4QSC A;  2XXY A;  3Q26 A;  3T1B A;  3MPK A;  3C32 A;  5I59 B;  1CNQ A;  4KFQ A;  4RYA A;  1RDZ A;  3TQL A;  4F2Q A;  4IO7 A;  2Z23 A;  2FYI A;  3LR1 A;  4GWW A;  3H6U A;  4IY6 A;  5EYF A;  5IAI A;  1XS5 A;  4O94 A;  4N17 A;  3LSW A;  4F3G A;  1RDX A;  3KJT A;  4BDR A;  2D3I A;  1RYX A;  5AA2 A;  3LUY A;  3VLU A;  4EQ9 A;  5H8H A;  2WEF A;  5ET6 A;  3MQ9 A;  3ILT B;  3JV9 A;  1JW5 A;  3BIG A;  3FV1 A;  2Q88 A;  2IEE A;  1B9J A;  1DTZ A;  3TTN A;  1EZP A;  4ONY A;  4QFL A;  3CIJ A;  5ELV A;  1S9T A;  5FHM A;  2DVC A;  4PTK A;  3IB1 A;  2H99 A;  2PX1 A;  4NTL A;  3EKI A;  4LZ8 A;  3S9E A;  1GR2 A;  1O7T A;  4ZZA A;  4P3L A;  3IFC A;  4N6K A;  1AOV A;  1MPD A;  1NV3 A;  1II5 A;  3IB2 A;  4XF5 A;  4Z0I A;  1P1Q A;  1FBC A;  4LAT A;  5CBS A;  4BDQ A;  2UYF A;  2OLB A;  5M2V A;  4NWD A;  5I2K B;  3TAJ A;  4EXK A;  3TFL A;  3H6W A;  2ANJ A;  3RYD A;  1I6B A;  2FA7 A;  1FQE A;  3LV0 A;  2Q9T A;  1RDY A;  2DWJ A;  2LAO A;  1MPB A;  4PAI A;  4JDF A;  4MX6 A;  1IMD A;  5EQA A;  3C31 A;  4FE8 A;  4ZED A;  3PUW E;  2XHD A;  4O7M A;  2ONK E;  3KJ7 A;  3FXU A;  1CB6 A;  3VDF A;  3TMG A;  2CZH A;  1A7L A;  1NV2 A;  3T9X B;  2ESN A;  4BLA A;  1JVY A;  3RT6 B;  3QK6 A;  4HE2 A;  5DTB A;  3OXN A;  5ET7 A;  5EQ7 A;  1NI9 A;  5DT6 A;  2RC8 A;  1B05 A;  1N7X A;  2W7Y A;  2PFY A;  3PMV A;  5J16 A;  2DVZ A;  1G0H A;  1LFH A;  5FBP A;  1B3F A;  4OET A;  1O63 A;  3U65 A;  2UVJ A;  3O29 A;  3CSG A;  3A3U A;  2A5T A;  2DSF A;  5AA3 A;  3MZ9 A;  2F3B A;  4PFR A;  1MPC A;  4LZ7 A;  4PP0 A;  3N6T A;  3MUQ A;  3JYR A;  3S9N C;  3FAT A;  2Y5L A;  4XIG Q;  2IA4 A;  1HSL A;  4N8G A;  1Q35 A;  1MXU A;  4RK9 A;  2HAV A;  2ONR A;  5I56 A;  1FPE A;  5KDT B;  2ZYN A;  3CG3 A;  5L9M A;  3K2D A;  3MZB A;  1J1N A;  3RPW A;  4OMB A;  5TPA B;  4I62 A;  3DEL B;  1FTJ A;  3ZKK A;  4H46 A;  4QFN A;  2Q2A A;  4ELO A;  3O66 A;  4YAH X;  4NF8 A;  2ZNT A;  3QXM A;  1MY4 A;  1R9Q A;  3RPL A;  1TWY A;  4Z7E A;  2KQZ A;  2XX7 A;  3PV0 E;  3G3H A;  3C34 A;  5HBC A;  1VE4 A;  3MW0 A;  2WX9 A;  4E0W A;  3EF7 A;  4PFI A;  2Q74 A;  1FCK A;  3MWB A;  1AH5 A;  1TXF A;  2HEU A;  4DIG A;  3UP9 A;  1B4Z A;  3E4R A;  2H98 A;  4MLV A;  5DEX B;  3PPN A;  1FQF A;  1R6Z A;  3D1R A;  1EYJ A;  2DE4 A;  3FIR A;  3QYT A;  2G29 A;  3GBB A;  3ECR A;  3A09 A;  2V3T A;  4FAT A;  5I59 A;  3OMB A;  3G3K A;  4U4X A;  1TFD A;  4PDD A;  4Q30 B;  4YMB A;  4PDH A;  1MG1 A;  3TCG A;  1H43 A;  2I58 A;  2OBG A;  3LSX A;  4OVQ A;  1Y4T A;  3T9H B;  4JB7 A;  2DS9 A;  4NX1 A;  3O6H A;  3CG1 A;  4Q8R A;  1FJ9 A;  1SW5 A;  4GBW A;  3KN3 A;  3IK6 B;  3T22 A;  3ODB A;  1SQY A;  2DWI A;  4U23 A;  2I3V A;  4I3Y A;  2XXV A;  1MRP A;  1H76 A;  2DP8 A;  2I0B A;  4IGT A;  1CE2 A;  1NV1 A;  4C1T A;  1D9V A;  1WDN A;  3CI8 A;  4XFE A;  3RQT A;  4NN3 A;  4O3A A;  1P99 A;  1LBB A;  3OSQ A;  2R6G E;  1TT1 A;  3BFU A;  4X1D A;  2GQ1 A;  5K2Y A;  4PFW A;  4MCO A;  3PGF A;  1H44 A;  1B5I A;  3U72 A;  3FV2 A;  4GRK A;  1NNP A;  3CSB A;  4BDM A;  4PF6 A;  4LUB A;  5AA4 A;  2QS3 A;  2HFB A;  1SW4 A;  4H0W A;  5I2K A;  3BKI B;  3PMW A;  4N07 A;  1B5J A;  2X26 A;  3TEP A;  1R9L A;  4M1V A;  1IEJ A;  3K6V A;  5H8N A;  1L5T A;  1FPL A;  4NMY A;  2O7U A;  4I8C A;  2QMX A;  3SES A;  1UTB B;  1YYZ A;  1IME A;  4X48 A;  3V83 A;  2O51 A;  5DVJ A;  4R9F A;  1JVX A;  3O28 A;  3R6U A;  4MFI A;  3O6I A;  3S2V A;  2XWK A;  3HCQ A;  2REJ A;  5KCJ B;  3V8X B;  3C4M A;  3MP8 A;  5F7V A;  3M3F A;  5BWJ A;  4O7I A;  3DLN A;  4RXL A;  2F78 A;  1FSA A;  3RNN A;  4O3B A;  3S9L C;  4HTG A;  1T0K A;  2Q8J A;  2X7P A;  5CBR A;  4OFJ A;  5A5X B;  2WYP A;  2CEY A;  2YJP A;  2O1M A;  3TDJ A;  4OZ9 A;  4IO3 A;  3B50 A;  4YMA A;  2O84 X;  4PGN A;  4BDO A;  4PQJ A;  4YKJ A;  4OVT A;  3FJ7 A;  2RKM A;  1FPG A;  1URG A;  3LBS A;  4KCC A;  1MH4 A;  4NED A;  4R72 A;  1I6A A;  3MVW A;  4I3E A;  4G8N A;  2F36 A;  5I57 B;  5FTI A;  5JK4 A;  3CFZ A;  4XEQ A;  2AL5 A;  2OK2 A;  4GXS B;  2B3B A;  4N4U A;  2CZI A;  1PC3 A;  2GH9 A;  1PBP A;  4R75 A;  4P0G A;  1B3L A;  2PYY A;  4P1L A;  2Z8F A;  1RKM A;  5TPA A;  3O6G A;  4PAF A;  3C9H A;  3VV5 A;  4NGU A;  4N15 A;  4N8Y A;  4H67 A;  1SI1 A;  4MNC A;  4F39 A;  1NUZ A;  2H9B A;  4ZDM A;  2R8T A;  2O1L A;  3TTL A;  1IXG A;  1YZ0 A;  4R2B A;  4WED A;  4YKI A;  4H5G A;  3KOS A;  4N6D A;  3SEY A;  1EH3 A;  5DW8 A;  4H65 A;  1IMC A;  1ZJL A;  4MEV A;  3W15 C;  3HHF A;  1NV4 A;  4ESX A;  1LAF E;  1UTH B;  4N6P A;  4ELQ A;  4GWX A;  4PFU A;  4MAG A;  3O2A A;  3OEM A;  2Z8D A;  1SDX A;  1XVX A;  2ABH A;  1FBE A;  1I69 A;  1AIV A;  4POW A;  4NQ8 A;  4FBP A;  4H1X A;  4EQ7 A;  4EQB A;  5CC2 A;  3DP4 A;  1QGX A;  5IGA A;  1MY0 A;  3W9W A;  4JXI A;  2ZXT A;  4OVJ A;  4NF6 B;  3PTY A;  1Y3Q A;  3MVZ A;  4GD5 A;  3K6W A;  4YB7 A;  2ZNU A;  3RPL B;  2X7Q A;  3MC2 A;  3U92 A;  2RF1 A;  2JJK A;  3P7I A;  3M8U A;  1VSO A;  2OPD A;  4KCD A;  4RY1 A;  1FPK A;  1XOC A;  5CM6 A;  2AYS A;  4F1Y A;  3USD A;  2D5W A;  2HXW A;  2DE2 A;  4NG7 A;  2R9J A;  2GFE A;  4H45 A;  4AQ4 A;  3OEL A;  1D9Q A;  1MQI A;  1A55 A;  1B58 A;  4XKR A;  1JW1 A;  4R6H A;  4PC9 A;  4PET A;  2O7I A;  2HPG A;  3OO6 A;  1HSE A;  2I49 A;  4RPO A;  3A29 A;  3C33 A;  4G4P A;  2I6E A;  5IM2 A;  4MBP A;  2NXO A;  3IJO B;  3MP1 A;  3SEX A;  2XXW A;  4R9G A;  1BP5 A;  2DWA A;  4FJP A;  1OQH A;  1DTG A;  2OJT A;  3K1N A;  3HV1 A;  3PUZ E;  1LFI A;  2F7A A;  3KZG A;  4GOT A;  5CMC A;  4XTC Q;  1OLC A;  2WYK A;  4LA9 A;  4BDL A;  4OQO A;  1UTB A;  2ONS A;  4QXD A;  4ZZE A;  1MM7 A;  3SET A;  1MXW A;  1FTO A;  3O97 A;  4IB2 A;  5KCJ A;  5EYH A;  2RCB A;  3KSX A;  2Y7R A;  2AL4 A;  3EQ1 A;  3MVY A;  5I7I A;  1DK4 A;  2QFL A;  3UN6 A;  5CRY A;  4LVQ A;  2GHA A;  5I58 B;  4KYS A;  2HAU A;  4NF0 A;  2OWT A;  4LZ5 A;  4YKK A;  3PD9 A;  5DYH A;  3WAE A;  1H3D A;  5A5X A;  1BTJ A;  4H8J A;  5AA4 B;  3G3G A;  4OER A;  4GWU A;  2RC9 A;  3N94 A;  5L8D A;  3VVE A;  4GX4 A;  1IMA A;  1MQH A;  2P0S A;  4DXB A;  5DVF A;  1HSJ A;  4OA4 A;  5H8N B;  1B0L A;  4FEC A;  1XC1 A;  3N6U A;  4OTE A;  4GL0 A;  4MIJ A;  3PPO A;  1FJ6 A;  3I6V A;  4N81 A;  1QUJ A;  2P1S A;  4TQU Q;  2DOJ A;  2QVR A;  2I4C A;  4F1V A;  1M5D A;  1Y9U A;  5I57 A;  5LDZ A;  1NNK A;  4QBA A;  3R26 A;  1POT A;  4U21 A;  3TEL A;  5TU0 A;  2V3Q A;  2E1S A;  1JQF A;  1M5C A;  4K3F A;  1SVX B;  3L6G A;  3IL1 B;  2VOZ A;  4GWZ A;  1JNF A;  2V25 A;  1YPN A;  4ELP A;  4R73 A;  5BUU A;  2HZL A;  2F3D A;  5H8S A;  2GRV A;  3ONM A;  1RYO A;  4LON B;  1KA1 A;  2O68 A;  2QJE A;  3K02 A;  4RK2 A;  2H5Y A;  3B7D A;  1B46 A;  4OES A;  1UQW A;  2WKY A;  2VP1 A;  5JTY A;  4LP2 B;  1UTH A;  1LCT A;  1USY H;  1Y1Z A;  4LQ2 A;  1VR5 A;  1MXV A;  4GBV A;  4HCW A;  4QFO A;  2ZYM A;  3SZP A;  5H8F B;  4N91 A;  4KD5 A;  2QS1 A;  1N76 A;  4YU0 A;  2UXA A;  1MQG A;  4X9T A;  1B32 A;  3A3C A;  4PE5 B;  4NHB A;  4NF6 A;  1JEU A;  3V89 B;  1OVT A;  1FW0 A;  3H3G A;  1MQD A;  1MY2 A;  2Y7W A;  1B52 A;  1LGB C;  1VDW A;  4IO2 A;  2PBW A;  1LAX A;  2V3U A;  1JET A;  1M5F A;  4POX A;  5I2N B;  1LST A;  3G3I A;  1FRP A;  1SI0 A;  3MZ1 A;  1LAG E;  4MNI A;  3VE1 B;  1XHY A;  3BFT A;  1AWB A;  4P9K A;  4F3P A;  4PF8 A;  3QSL A;  3G3F A;  1FPJ A;  4QRZ A;  3HPI A;  1SD3 A;  3VFJ A;  5JEI A;  1AL3 A;  1B51 A;  4WEP A;  4H5F A;  5AE4 A;  2ZZW A;  2VHA A;  2PT2 A;  1IXC A;  2OCU A;  3LSF B;  1XVY A;  2XXX A;  1OQG A;  2E0S A;  4AB5 A;  3U1O A;  1KA0 A;  3PUX E;  2QVU A;  5DVI A;  1NV7 A;  3T9V A;  4C0R A;  3Q25 A;  2V84 A;  1P1O A;  4P56 A;  4F3S A;  4DLD A;  3NOH A;  2H4I A;  2FNC A;  4G77 A;  3TPA A;  1JW4 A;  3SKP A;  3TCH A;  3MJN A;  3LUZ A;  3DM0 A;  1EU8 A;  2YLN A;  4X1B A;  2Q2C A;  1FQB A;  3FXB A;  4FED A;  1NL5 A;  2DWH A;  1OMP A;  4YIC A;  4F31 B;  1DBZ A;  4MHF A;  4NF5 B;  3MP6 A;  2Z8E A;  4OXV A;  4KR5 A;  3DP6 A;  1B40 A;  1OLA A;  2D21 A;  2XXI A;  2HXR A;  3IJX B;  4O8M A;  4PGP A;  1FBD A;  3L6H A;  4XXU A;  3FXQ A;  2XA5 A;  4FAJ A;  3GYY A;  4F18 A;  1QUK A;  5I58 A;  3GBA A;  3M3K A;  4FEB A;  1B7H A;  3UK4 A;  4ZEF A;  4KXP A;  1H45 A;  1US5 A;  4KYE A;  2F35 A;  1B1X A;  1LBW A;  3E3K A;  4HXV A;  2P2A A;  4G8H A;  2F97 A;  2UYE A;  3E78 A;  3VVD A;  1MS7 A;  5ITP A;  3KSJ A;  2PMS A;  4PFB A;  4HE0 A;  4ZEK A;  3CHG A;  3H6T A;  4PAK A;  2B4L A;  4I40 A;  3IOT A;  1LBV A;  2WBD A;  1FBF A;  1YTV A;  1N3W A;  3TKD A;  2F6P A;  3S4U A;  4P1E A;  1Z7M E;  4GQO A;  3B6T A;  1LBY A;  1PDA A;  4X8R A;  2XXT A;  2ZNS A;  1ZBM A;  4DI4 B;  3IOU A;  5CI5 A;  4PCD A;  4YZZ A;  3OD7 A;  3E79 A;  3IX1 A;  2FHY A;  5F1Q A;  4QFK A;  3RUM A;  3K0V A;  4OVS A;  2XXP A;  3RLF E;  2Y7I A;  3W9V A;  1USY E;  2UVH A;  3OO9 A;  3RGY A;  1ANF A;  3LC8 A;  3MYU A;  3CFX A;  3ROJ A;  1OIB A;  3C35 A;  4TLL B;  3HO7 A;  4EXL A;  4GWY A;  1OVB A;  4IO6 A;  1LFG A;  1FPD A;  1INP A;  3IOV A;  4LQ5 A;  4F29 A;  3IR1 A;  1F9B A;  2KR0 A;  2V93 A;  2XXR A;  3FJG A;  2Y84 A;  3IAZ A;  2G93 A;  3FBP A;  1ZU0 A;  1BIY A;  3T9U A;  1AMF A;  1SYI A;  1XT8 A;  2OZZ A;  1BLF A;  1EZO A;  5H8F A;  4GL8 A;  5HM4 B;  4X04 A;  1IQ7 A;  5L9O A;  3SEU A;  4GX6 A;  3TOD A;  2V4C A;  2VGQ A;  4JSD A;  4NE4 A;  2I48 A;  3UGW A;  3CR9 A;  2DXY A;  4ESW A;  1P1U A;  1QW0 A;  4NF4 B;  4OYV A;  3SEV A;  1JEV A;  1Y1M A;  2XWI A;  4H6D A;  1BK4 A;  3CRB A;  2O6A A;  2REG A;  2XWO A;  4YB5 A;  5I2N A;  3N5L A;  4UAB A;  2R71 A;  3LSL A;  4H8I A;  3K01 A;  3QAX A;  2NVU B;  2RC7 A;  4GXA A;  5JTY B;  3U94 A;  1A99 A;  3T96 B;  3EHU A;  1TFA A;  3FZV A;  1ZMG A;  3HFU A;  4C1U A;  1WOD A;  1D3K A;  2XX8 A;  4R6K A;  4DXC A;  4RA1 A;  2B65 A;  5I3S A;  2OWS A;  1US4 A;  2VD3 A;  4AS4 A;  3QMF A;  2Q89 A;  2B3F A;  2NUV A;  2NOO A;  5T3J A;  2CZK A;  3T0J A;  5H8Q B;  1IMB A;  4DI3 D;  1LCF A;  1NUY A;  1DSN A;  1NNT A;  4JVI A;  3TTR A;  1Z7N E;  2FIE A;  4OFL A;  1IXH A;  3K6X A;  3VXB A;  1MH3 A;  5I84 A;  5ISU A;  4TLM B;  1QUI A;  3TUS A;  2FBP A;  4BDN A;  3EHS A;  2HHM A;  1N84 A;  3OO8 A;  2NWJ A;  4OEV A;  5ET5 A;  2XWV A;  1NKX A;  1PEB A;  1O64 A;  2WBB A;  1LLS A;  4NF5 A;  1LBX A;  4EF1 A;  3G7W A;  5KZT A;  4L17 A;  1IUD A;  4F19 A;  3HST A;  1GTK A;  3TZA A;  5CMK A;  3VXC A;  2Y7K A;  4EF2 A;  4HE1 A;  1N7W A;  3IO4 A;  4JWY A;  2XX9 A;  5IZ1 A;  3G3J A;  3E13 X;  2P3V A;  4P0I A;  2QVV A;  2VD2 A;  2I3W A;  5ICT A;  3FVO A;  2FIX A;  1MQJ A;  4IO4 A;  1Q1K A;  2VPN A;  1B1H A;  1GV8 A;  3KOT A;  2P3N A;  5FTH A;  4GFR A;  4F2O A;  4Q0C A;  3MVX A;  3D4G A;  3C36 A;  1LBC A;  3K1M A;  1NV6 A;  2O69 A;  2L5V A;  5EHM A;  3FD3 A;  3OEK A;  1B4H A;  3QUF A;  4ISU A;  4U22 A;  4XKP A;  3FXR A;  2DYX A;  4R74 A;  3SER A;  5EQ8 A;  3RY3 A;  1DMB A;  4GWO A;  2PFZ A;  5F24 A;  2XXU A;  5AA2 D;  3H03 A;  1QJM A;  4DZ1 A;  2QL3 A;  1QKB A;  4NWC A;  3N26 A;  2VT5 A;  1URS A;  4I1D A;  1NNF A;  1B0H A;  3Q27 A;  1M5E A;  4GF8 A;  3PD8 A;  4WXJ A;  1R1N A;  1EYI A;  3U8Q A;  1NUW A;  2RIN A;  1LAH E;  1GGG A;  2PT1 A;  3WAF A;  2ZYK A;  1N3X A;  3FVK A;  3OSR A;  4ZEI A;  1MXZ A;  3B8B A;  1MXY A;  4MNP A;  2CEX A;  4U4S A;  4F3B A;  2I0C A;  2ZYO A;  4QF9 A;  4P47 A;  4YB6 A;  1K9Z A;  2XXK A;  4GWS A;  1QKA A;  5CMB A;  4EUO A;  1ZTY A;  4F1U A;  1FPI A;  1D9Y A;  3IO6 A;  1UIU A;  4NF4 A;  2VPO A;  5EYG A;  3KC1 A;  2ALU A;  1DPP A;  5ET8 A;  1Y20 A;  1B5H A;  4KHZ E;  1EZ9 A;  4MF3 A;  4F22 A;  2OPE A;  2XXH A;  2HCA A;  3VLV A;  3RN8 A;  1BKA A;  4JWO A;  2M8C A;  2XD3 A;  3Q28 A;  4OFO A;  4N13 A;  1YAE A;  2HZK A;  4GLI A;  1JP4 A; 
#chains in the Genus database with same CATH homology
 2R8T A;  3MST A;  1YZ0 A;  2QPQ A;  4KXP A;  1Q9D A;  4N6D A;  4HCY A;  5DW8 A;  4PTK A;  1LBW A;  1IMC A;  4LN5 A;  4HXV A;  4MEV A;  1FPB A;  1NV4 A;  3E78 A;  4GWX A;  4MAG A;  3EKI A;  4IR8 A;  4G61 A;  4PFB A;  4HE0 A;  1FBE A;  4P3L A;  3CHG A;  4PAK A;  3IFC A;  2B4L A;  4N6K A;  4I40 A;  4NQ8 A;  4FBP A;  1LBV A;  1NV3 A;  2WBD A;  1FBF A;  4XF5 A;  3KBZ A;  1FBC A;  1QGX A;  5IGA A;  4P1E A;  3W9W A;  1LBY A;  4X8R A;  1K9Y A;  4DI4 B;  3PTY A;  4PCD A;  4YZZ A;  1NV5 A;  3RPL B;  5A5L A;  2JJK A;  3E79 A;  3RYD A;  2FHY A;  4OVS A;  3LV0 A;  5EQ9 A;  1FPK A;  5CM6 A;  2Q9T A;  4P8B A;  1RDY A;  3W9V A;  2ZZX A;  2DE2 A;  1NV0 A;  4NG7 A;  4PAI A;  3MYU A;  4H45 A;  3ROJ A;  4MX6 A;  4GWY A;  1IMD A;  5EQA A;  4OVR A;  1FPD A;  1D9Q A;  4O7M A;  1INP A;  4JVC A;  2KR0 A;  4PE3 A;  2CZH A;  1G0I A;  4PC9 A;  1NV2 A;  4PET A;  2HPG A;  3FBP A;  3A29 A;  4HE2 A;  5IM2 A;  5ET7 A;  5EQ7 A;  1NI9 A;  1DCU A;  2DDK A;  2PFY A;  5IZ3 B;  5J16 A;  4PBQ A;  2DVZ A;  1G0H A;  5FBP A;  4X04 A;  4NAP A;  1KZ8 A;  3U65 A;  4GX6 A;  2V4C A;  2F3B A;  4PFR A;  2WYK A;  2XWI A;  1BK4 A;  2Y5L A;  2XWO A;  4N8G A;  4UAB A;  3IFA A;  4QXD A;  1FPE A;  4H46 A;  5EYH A;  5I7I A;  1DK4 A;  2QFL A;  2OWZ A;  4NF0 A;  3RPL A;  3HFU A;  2KQZ A;  1FBH A;  2WX9 A;  2PCR A;  4PFI A;  4GWU A;  5I3S A;  2Q74 A;  4GX4 A;  3QMF A;  4AS4 A;  1IMA A;  4OA4 A;  5T3J A;  2CZK A;  3T0J A;  2Q8M A;  1IMB A;  4MIJ A;  4DI3 D;  1FJ6 A;  1NUY A;  3D1R A;  4JVI A;  4N81 A;  1EYJ A;  2FIE A;  2DE4 A;  2QVR A;  5LTC A;  4F1V A;  4PBH A;  5LDZ A;  2FBP A;  4QBA A;  2HHM A;  4PDD A;  3KC0 A;  4PDH A;  5ET5 A;  2XWV A;  2V3Q A;  4OVQ A;  4OAN A;  2WBB A;  4NX1 A;  1LBX A;  1FJ9 A;  4GWZ A;  4F19 A;  4GBW A;  2HZL A;  2F3D A;  4MMP A;  2DE3 A;  4HE1 A;  1YXI A;  4I3Y A;  5IZ1 A;  1NUX A;  1KA1 A;  2P3V A;  2QVV A;  1NV1 A;  2FIX A;  2BJI A;  4XFE A;  2OX3 A;  2VPN A;  4NN3 A;  4JVD A;  5I5P A;  2P3N A;  5J1D A;  4OVP A;  5ESY A;  1XI6 A;  4GBV A;  4HCW A;  3SZP A;  4N91 A;  2GQ1 A;  5IZZ A;  4MCO A;  1NV6 A;  2L5V A;  4X9T A;  4AS5 A;  4PF6 A;  4NHB A;  5EQ8 A;  3BIH A;  4M1V A;  1LEV A;  1VDW A;  2PFZ A;  5F24 A;  1FPL A;  1YYZ A;  1IME A;  1FPF A;  1FRP A;  2VT5 A;  4MNI A;  2Y5K A;  2F5X A;  1LBZ A;  2XWK A;  1FBG A;  1EYK A;  1AWB A;  4P9K A;  2ZZV A;  1EYI A;  1FBP A;  1IMF A;  1NUW A;  4O7I A;  4PF8 A;  1FPJ A;  1FSA A;  2FVZ A;  2ZZW A;  2WYP A;  2CEY A;  4GX3 A;  3B8B A;  3ISP A;  2MKZ A;  1FTA A;  4MNP A;  1KA0 A;  1SPI A;  2CEX A;  2QVU A;  4MJO A;  3B50 A;  1NV7 A;  4PGN A;  4P47 A;  1K9Z A;  2XXK A;  4GWS A;  4OVT A;  4P56 A;  5IZ3 A;  1FPG A;  3NOH A;  4I3E A;  4F1U A;  1FPI A;  2B4M A;  3T1B A;  5JK4 A;  3LUZ A;  4XEQ A;  2VPO A;  5EYG A;  1CNQ A;  3KC1 A;  5ET8 A;  4N4U A;  2CZI A;  1RDZ A;  3FXB A;  4YIC A;  4P1L A;  1DBZ A;  4MHF A;  4GWW A;  4PAF A;  4O94 A;  4NGU A;  4N17 A;  4N15 A;  4N8Y A;  2HXR A;  1RDX A;  4O8M A;  4PGP A;  1FBD A;  4MNC A;  2XA5 A;  3GYY A;  2WEF A;  4F18 A;  5ET6 A;  1NUZ A;  2HZK A;  1JP4 A;  3BIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...