3T0JA

Crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
266
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNLTPNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of inositol monophosphatase - II from Staphylococcus aureus MSSA476
rcsb
source organism Staphylococcus aureus
total genus 83
structure length 266
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3t0jA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t0jA02
3KC0A 4IR8A 1LBXA 2FVZA 3IFCA 5T3JA 1FBCA 3FBPA 5I3SA 5EQ8A 1IMAA 2Y5KA 1YZ0A 1FTAA 2OWZA 5EYGA 4I40A 1KA1A 2QVVA 1LBYA 1FPBA 2QVUA 4AS5A 3LUZA 1LBVA 1RDXA 1RDZA 2OX3A 2BJIA 3KC1A 1NUZA 2WEFA 2Q8MA 2CZKA 5LDZA 1FJ9A 1SPIA 3BIHA 2F3DA 1DK4A 5FBPA 3T0JA 2FIEA 5ET8A 1NV6A 1IMEA 4O7IA 1FBPA 1KZ8A 1NV5A 1NUWA 1EYKA 2WBBA 2Q74A 2FHYA 2WBDA 4HE0A 5EQ7A 1YYZA 5EQAA 1FBGA 1FPIA 4GWUA 3LV0A 4GWXA 5IZ1A 5J16A 3D1RA 3QMFA 5ET6A 2VT5A 2CZHA 1NV2A 1EYIA 1FRPA 5F24A 1FBDA 1LBWA 1FPKA 2FIXA 3RYDA 1QGXA 4AS4A 1JP4A 2CZIA 1LEVA 1NV7A 4GWSA 1FPEA 1FPLA 3IFAA 1K9YA 1G0HA 4FBPA 4H46A 1FBEA 5ET5A 1NV4A 4GX6A 1NV1A 5EYHA 4GWZA 4G61A 1CNQA 1Q9DA 2P3VA 2P3NA 2Y5LA 1DBZA 1YXIA 3RPLA 4GWWA 5ET7A 4H45A 1NUYA 1EYJA 5A5LA 5EQ9A 4PTKA 1K9ZA 4GBWA 4GX3A 1FBFA 1KA0A 1NV3A 3B8BA 1IMCA 2FBPA 1IMDA 5ESYA 1FPJA 1FPFA 4GWYA 4HXVA 1FJ6A 3RPLB 2HHMA 1FPDA 1LBZA 2QFLA 2DDKA 5IZ3A 4HE2A 2R8TA 1FBHA 3A29A 4GBVA 2F3BA 1DCUA 3KBZA 3ROJA 4I3EA 4MJOA 1NI9A 2QVRA 5DW8A 1VDWA 1BK4A 1XI6A 1AWBA 1FPGA 2PCRA 1IMFA 1NUXA 1INPA 1NV0A 1IMBA 5IZ3B 1D9QA 3BIGA 1G0IA 4N81A 1RDYA 1FSAA 2JJKA 4HE1A 2GQ1A 4QXDA 4GX4A 4KXPA 4I3YA
chains in the Genus database with same CATH superfamily
3SERA 1OLCA 3IO4A 1LBXA 2QRYA 1LGBC 4ZEFA 4U4SA 3K2DA 1FQFA 1OVTA 2IA4A 1IITA 2V4CA 1RDZA 1YTVA 2I4CA 2F3DA 3UA8A 1JVXA 1P1NA 3K6VA 3QUJA 4N6KA 1SVXB 2OJTA 2X7QA 5EQ7A 3CFLA 1XHYA 3O66A 1DPPA 4ECFA 4TLLB 3HPIA 1LBCA 5IGAA 2XWVA 1EYIA 4DDDA 5ITPA 5ISUA 2QMXA 3UP9A 1IUDA 4NEDA 3TCGA 3N94A 1OQHA 1S9TA 3VVDA 4KCCA 4P1LA 3TAJA 4OVTA 3MSTA 2DE3A 4QBAA 4F2OA 4RK9A 1MPDA 4F3BA 1NH7A 3KZGA 3R26A 3O29A 1MPBA 4QSCA 5EQ9A 3K02A 4GX3A 4F2QA 4U21A 4N8GA 5JTYB 1IMDA 3F11A 4LQ2A 3N26A 4NHBA 1B7HA 1EZPA 2XXIA 4HE2A 1DCUA 3H03A 2AIXA 5CMKA 4OFOA 4HCWA 4LP2B 4Q8RA 1UIVA 1IMFA 3C31A 1Y3QA 1RKMA 4N91A 5LTCA 2GQ1A 2ZNTA 2F7BA 1B40A 2FVZA 2V84A 2Y7RA 5IM2A 3OOAA 4OVRA 4IO4A 1VFEA 1JVYA 2DOJA 3U65A 1YAEA 1RYXA 1MXVA 1SW5A 4KYSA 4F18A 4UABA 2I0BA 4R6KA 5TP9B 3IO6A 3RTWB 4NF4A 4BDOA 1EYKA 3E78A 4XF5A 1B6HA 1FPIA 4GWUA 3VLUA 1DSNA 3MZ1A 3G3IA 2Y7KA 1NV2A 5L9MA 4NF4B 1PB8A 4NX1A 1MM7A 2F5XA 4M1VA 1PDAA 5CMBA 4U1ZA 2VHAA 2VOZA 1G0HA 4H46A 3M8UA 2GRVA 3E9XA 4GWZA 4XEQA 3TKDA 1Y1ZA 2MKZA 4JVIA 4LZ7A 5HPQA 3MC2A 4U22A 4TOZA 1B3GA 2UVJA 3FATA 4RYAA 3VXCA 4RPOA 1FJ6A 2F78A 1ZLQA 3V5AA 2M8CA 4GBVA 3VLWA 3IOTA 5KCJB 2DYXA 4JWOA 3WAFA 1TT1A 4QFNA 5KDTB 2ONSA 1Y1MA 2ZNSA 4HE1A 1LFHA 1FTMA 1MH4A 2ALUA 4MLQA 5I59B 3EHUA 1FPBA 1LBVA 2WEFA 1YCJA 2V25A 3C9HA 1L5TA 5CC2A 4PGPA 2O84X 5ICTA 2HEUA 3B6WA 1DPEA 5J16A 1OIBA 1F9BA 1FTJA 1Q35A 1XVXA 4WKMA 4ZDMA 1LBWA 4PAKA 4AS4A 3C36A 1MXUA 1FPEA 5TU0A 3W9WA 4FBPA 2RC8A 4NN3A 3C34A 1A8EA 1MY1A 1Q9DA 1UTBA 2FNCA 2QS1A 3N6UA 3VVEA 3K0VA 2QPQA 2F34A 4FJPA 4O3BA 3OELA 2HHMA 3CVGA 3LUYA 1A7LA 1FBHA 3C35A 1SQYA 5M2VA 4E0XA 3G3JA 2DSFA 4AB6A 4Z0IA 1QUIA 1I6QA 3KEIA 3UIFA 2XX7A 5FHOA 4ONYA 1ANFA 5CMCA 2GHAA 2HZKA 3CI8A 3I5OA 3FBPA 2RC9A 4N17A 4RY1A 3AXFA 2F8DA 1IMAA 3TELA 1XVYA 4N15A 2I58A 3H06B 1IXGA 2QVVA 2DWIA 4U23A 3ZKLA 4E0WA 3TCHA 1B4ZA 4F3GA 1QKAA 3EN3A 1ZIUA 2Q88A 3Q29A 1KZ8A 1URDA 5K2YA 2WBDA 3QIMA 3D1RA 3OSRA 1B32A 1POY1 3USDA 4PETA 4IGTA 4ZEKA 2CZHA 3C4MA 4BDMA 1FPKA 1JP4A 4XKQA 1NV7A 1TXFA 4AB5A 5LOMA 3HSTA 3BBRA 5EYHA 1PB7A 3IB0A 2XXQA 2F7CA 4KYDA 1LFGA 3PU5A 3PUZE 4MEVA 3HO7A 1K9ZA 2OPDA 2QS3A 3MP6A 1KA0A 1MQIA 3OO8A 1CE2A 1B2HA 4HXVA 2ESNA 2I49A 1SDXA 1NNFA 1Y4TA 2VPNA 2DDKA 2G29A 2L5VA 2E1SA 2R8TA 3A29A 3ONMA 2X26A 4FE8A 2Q9TA 3TTNA 2B4MA 4G77A 4HW8A 2QVRA 4MMPA 2XXWA 2FA7A 1NV0A 3EKIA 1IMBA 4X9TA 3IFCA 3FXBA 3T9XB 4G68A 4P3LA 3V8XB 4JB7A 3OD7A 5T3JA 1UTHA 5H8FB 4G4PA 4IO5A 4PE3A 3L6GA 4G68B 5FBPA 1MXZA 4U4XA 2XWOA 1VE4A 1IEJA 3HV1A 2H99A 5EHMA 3C32A 1FBPA 3K1PA 3PGFA 1N04A 2WYKA 3IOUA 3W15C 5F1QA 1A55A 4POWA 4YB7A 4GVOA 3SESA 4PBQA 1HSEA 3VV5A 3QAXA 1Q1KA 2F6PA 2WYPA 5CI5A 1MY0A 3FD3A 3PUVE 4YMBA 4TQUQ 2XX9A 2D3IA 4ZEBA 2IEEA 2DVCA 2OWTA 4YKIA 1MPCA 1N3XA 2F6GA 1YXIA 1N84A 3KSXA 4H65A 4ISUA 5H8QA 4BDNA 3S2VA 5L8DA 3FVGA 4ELQA 3HHFA 4YB6A 3R7XA 3TZAA 3DP6A 3O9PA 4DCYA 3K6XA 3TTKA 1MY2A 1I6BA 1VR5A 3CHGA 4LATA 3O6IA 2DVZA 4P47A 1GR2A 1MH3A 4XFEA 1UIUA 2THIA 3TTLA 4OEUA 4LVQA 2Z23A 1LAXA 2F7AA 3K4UA 2ZZXA 4I1DA 1SYHA 3VLVA 3SEUA 1II5A 2REJA 3U93A 2NUVA 5EQ8A 2Y5KA 4ZECA 3TFLA 1Z7NE 1FTAA 3VE1B 4WEPA 5EYGA 3W9VA 2I3WA 2B3FA 3FIRA 2ZZVA 1NUZA 2I6EA 1SW4A 1DK4A 1R9QA 4PDHA 4NF0A 1B3EA 2DP8A 2YLNA 1B0HA 2ZXTA 2DXRA 3H6VA 5DYHA 4P0GA 4F31B 3Q28A 2Y7IA 2NXOA 1B52A 2NOOA 3NOHA 4Q0CA 1B51A 1YPNA 3H6WA 2O6AA 4PQJA 1B0LA 4YMAA 4PFUA 4AQ4A 3K6UA 3R6UA 2A5TA 3T9HB 1BIYA 2P3NA 3GZGA 1FQDA 4BDRA 5FHMA 4GL8A 1N3WA 5ESYA 3ECRA 3T1BA 2I3VA 1PB9A 3MWBA 2NWJA 1ZJLA 2QFLA 3SEWA 5AA4A 4C1UA 4GD5A 3M3KA 3KBZA 3RUMA 1MQDA 3CSGA 4KHZE 2Y7PA 1VDWA 4KD5A 1XS5A 2HAUA 1B9JA 2O1LA 4ZZEA 4OFLA 3N6TA 4IO7A 1UQWA 1LAFE 2CMOA 5AA4B 3T96B 1R9LA 1RDYA 1FSAA 1LAHE 4IY6A 2HCAA 3DLNA 1MDQA 4Z7EA 1Y3NA 1JEUA 4KR5A 1YZ0A 4M4GA 1MRPA 4I40A 5KZTA 3LUZA 2CZKA 4DI4B 2QSXA 1S50A 4OENA 4YAHX 1I6AA 2WBBA 3G3FA 4GL0A 4JXIA 5CM6A 3SKPA 4GWXA 2O51A 2OPEA 1FRPA 4YKJA 1OMPA 1NFTA 4OVJA 3KJ7A 4EXKA 1FBEA 5ET5A 4MCOA 4GX6A 5AA2A 1H44A 1R1NA 4KI0E 1WVJA 2Y5LA 3B50A 4PTKA 1PC3A 3RY3A 1P1QA 4PP0A 3G3KA 5AA2B 4GWYA 5DTBA 1EH3A 3HFUA 4F1UA 3GBAA 3QYTA 4JWXA 4KFQA 3QXMA 4O3AA 3V89B 2YPNA 1JETA 3E79A 1BK4A 1USYH 3VDFA 1J1NA 2OWSA 2PT1A 1D9QA 4HCYA 1QVSA 2RCBA 1B4HA 2XXHA 3N5LA 3UK4A 4JWYA 1MXWA 4QFPA 3O6GA 3PUWE 1XT8A 4GOTA 2I4BA 5JEIA 3DP4A 3RT8A 3MPLA 2Q8MA 4LONB 3LR1A 3U72A 1ZBMA 5ET8A 3MP8A 2UYEA 1B1HA 2LAOA 2H9BA 4FATA 3RGYA 2ZYOA 3S9NC 1HSJA 3V83A 4P0IA 3S9MC 4NE4A 1FTOA 3T93B 4FEDA 4ND9A 4OWDA 3B6TA 1US4A 1WDNA 1I69A 4N4UA 1P1UA 4EF1A 1CB6A 4RA1A 4ELPA 4ZEDA 2QL3A 4NAPA 5ELVA 4OVPA 1B5HA 4DLDA 4DXBA 2XXUA 1KWHA 1QUKA 2REGA 1LB8A 2DWJA 4DE8A 4GBWA 1T0KA 3O28A 5DEXA 4YB5A 2HZLA 1QKBA 1FPJA 3MZ9A 1TFAA 5I5PA 3T22A 1FTKA 4UACA 2F3BA 4OERA 5DVFA 3EHTA 5DEXB 1JEVA 3LSWA 4I3EA 4MIJA 3ISPA 1LAGE 4NWDA 3KOTA 5J1DA 1Y20A 3PMWA 2D21A 4KPTA 3CR9A 3KBRA 3LSFB 4N81A 4LQ5A 2JJKA 3IOVA 4U2RA 1AL3A 5AA2D 3IORA 1UTBB 3ZS6A 4LZ5A 2HFBA 4THIA 5ITOA 1N0TA 2PMSA 4F39A 3K1MA 1LBYA 3FV1A 1FQCA 3O6HA 4F19A 3OO6A 2DWHA 3KC1A 4BDLA 2V3UA 5TPAA 1GTKA 2XD3A 2UVGA 4X48A 3EQ1A 2W7YA 3KFMA 4OA4A 4MF3A 3G3GA 4H1XA 5CBRA 1ZU0A 2VT5A 3OXNA 3FXQA 5IZZA 4R72A 3VXBA 1AMFA 1O63A 5AE4A 1AIVA 2Z22A 3SEYA 4EQBA 1Y3PA 3MBPA 1FQAA 4G2ZA 4PAFA 3QSLA 2A5SA 5DT6A 4NTLA 2PBWA 4ZZAA 1DMBA 1EYJA 4X8RA 1NV3A 1RYOA 3FZVA 2ZNUA 1FPFA 2RKMA 2XXTA 3B7DA 1B7ZA 4R2BA 4OTEA 1OLAA 4MNIA 3TMGA 3JV9A 2QS4A 5DW8A 4P56A 1EU8A 4K3FA 3TQWA 3CRBA 3IX1A 3ODBA 3ILTB 4PF8A 4F22A 2DE4A 5H8HA 2PX1A 1FCKA 4PFRA 3QUFA 3MYUA 5I3SA 1TFDA 2ZMBA 1XC1A 2I48A 3FXUA 4DXCA 4PFBA 2GFEA 2VD2A 4P11A 3OMBA 1RDXA 2BJIA 4ESXA 4JSDA 3EHSA 4MH5A 4OHNA 2AL5A 1NV5A 1NUWA 2BJJX 2OBGA 2OLBA 2ONKE 3FJ7A 4GIZA 4HE0A 1FTLA 4WEDA 2HXWA 1PEBA 4EDPA 3A09A 4NF5A 4XKRA 4RJZA 1MQHA 2GH9A 3GLBA 3MQ9A 1SYIA 2D5WA 2ZYNA 1UTHB 3U1OA 4ZE8A 3PPNA 3JYRA 2VPOA 4YZZA 1NNTA 1NV4A 4H8JA 3PPPA 1AH5A 3CSBA 4H5FA 1NUYA 5A5LA 3RPWA 1NMUA 3S9EA 1GV8A 1B5JA 3ZSFA 4NMYA 4P9KA 4FAJA 5IZ3A 2H4IA 2F36A 4H8IA 3FJGA 4OMBA 5I84A 3PPOA 4F29A 4L17A 5B70A 4NF6A 3FJMA 1QW0A 5I7IA 2PCRA 2XHDA 5IZ3B 4QRZA 3THIA 1IIWA 4RPNA 3IAZA 4G8MA 1MS7A 1US5A 4MHFA 3KN3A 1BTJA 3MVXA 3RLFE 5H8QB 3SEVA 3I3VA 5HBCA 1M5EA 2FYIA 2OWZA 4R6YA 3FVKA 4OVQA 4YKKA 1D9VA 4AS5A 4I8CA 4JVCA 3TCFA 3OEMA 2XXRA 1DTGA 3LSLA 2XXXA 4LN5A 4FORA 4OYVA 3T9UA 3IB1A 1NV6A 3PPRA 4IO6A 3RN8A 2DXYA 1AOVA 3RNNA 3IR1A 2FHYA 5I56A 4ELRA 1IXIA 1ELJA 2WX9A 3QMFA 5FHNA 2Z8EA 3UORA 1LB9A 2V93A 3PD9A 3OENA 4LA9A 2FIXA 2O7IA 5I56B 2R6GE 1LEVA 3FASA 1FPLA 1TWYA 4DIGA 1S7YA 1M5FA 5AA3A 1IXCA 5AA1A 1A40A 4PFIA 4WXJA 5H8NA 1OVBA 1ZTYA 1O64A 2P3VA 1P1WA 1DBZA 5ET7A 1QJMA 2UXAA 2XXVA 1H45A 4EF2A 4NWCA 3MUQA 2VGQA 3K1NA 1JW4A 3MVWA 1EZ9A 5K2XA 3IB2A 1FPDA 1USYE 3OEKA 1H76A 4N6DA 4DI3D 4OETA 3K00A 4JDFA 3E13X 1AWBA 1SI0A 3T9VA 2I0CA 2CEXA 2R9JA 4GWOA 4MAGA 2PVUA 1G0IA 2Q8JA 4XKPA 2A5TB 5I2NA 3A3CA 4H0WA 4O8MA 4I3YA 2O7UA 3MAMA 2B65A 4GF8A 4X1DA 1B46A 3K01A 3FUZA 4DZ1A 2QMWA 5I2NB 4OESA 1N76A 5LDZA 5BWJA 5DVJA 1MM6A 4F3SA 2FIEA 4U1OA 3HN0A 4ZS9A 4GLIA 4QF9A 1D3KA 3LSXA 5JTYA 1O7TA 2Q74A 4I9DA 1FBGA 2VP1A 2XXPA 3LC8A 3RQTA 4G8NA 2P1SA 5FTIA 1QUJA 3H4ZA 4X04A 2UVHA 4IGRA 4MLVA 2DE2A 2PYYA 4F1YA 4Q5TA 4ESWA 4GWSA 3SETA 3CG3A 3IFAA 1MDP1 4OFJA 3S9LC 4FEBA 2QS2A 3BKIB 3RPLA 5JK4A 4GWWA 4YU0A 3M3LA 2UYFA 1FBFA 3KJTA 2B4LA 5I57A 5EHSA 2RCAA 4LUBA 3RPLB 4N07A 4MNCA 5TP9A 1N7XA 4OANA 1B7UA 3U92A 5I57B 4R9FA 1NNPA 4F1VA 3ZKKA 1B3FA 1NI9A 3O97A 4RNSA 2HAVA 5ICQA 3P7IA 1JQFA 2GHBA 1NUXA 2RC7A 2DQVA 4IB2A 1EZOA 3TEPA 5I58A 1Z7ME 4GX4A 2OK2A 4KXPA 4POXA 4DCXA 3KN8A 2ANJA 3HHGA 3DM0A 3TYHA 4O7MA 1MG1A 4RXLA 5I58B 3G7WA 1KA1A 2DS9A 2AL4A 3H6TA 1FQEA 1PBPA 1B05A 4H6DA 3OSQA 4OVSA 2H98A 1A54A 3VFJA 4PGNA 3UN6A 3TDJA 4RK2A 2PT2A 1Y4CA 5H8SA 1SW2A 4BDQA 2HPGA 4NF8A 3D4CA 3MP1A 4OQOA 3PV0E 1YYZA 5EQAA 1P99A 2QJEA 4N6PA 4R2FA 1LLSA 1B1XA 1M5DA 4G8HA 3I6VA 1FBDA 4XXUA 4NF8B 1IZ1A 5KCJA 3ILUB 1DTZA 3SZPA 2V3TA 3OO7A 1K9YA 4GRKA 5KDTA 3PMVA 5CRYA 3FXRA 3CFZA 4H45A 1LBBA 2XWKA 1N7WA 3FVOA 4QFKA 3U8QA 3IK6B 1IMCA 4P1EA 1XOCA 3GBBA 5I59A 1SW1A 5BUUA 5I2KA 4EQ7A 4QFOA 5L9OA 4PCDA 2O68A 4OZ9A 1QULA 1MY4A 2PFYA 4GXSB 4MNPA 1B5IA 4JSOA 5A5XA 1FQBA 5I2KB 3EF7A 3CG1A 1FPGA 1PBQA 4PE5B 3TQLA 3S4UA 3SEXA 2H5YA 5A5XB 4NG7A 3TTRA 1POTA 4O3CA 3C33A 4IR8A 1FBCA 5B7DA 2B3BA 5CMMA 1R6ZA 2VD3A 4PBHA 2XXKA 2OX3A 1JW5A 3Q27A 2WKYA 3E4RA 3DELB 1FJ9A 3IL1B 1H3DA 3MVZA 1LSTA 3UGWA 1A99A 2XXYA 1IXHA 4IO3A 1IMEA 1BP5A 2Y7WA 3PUYE 4TLMB 4EXLA 1JNFA 1LCTA 3L6HA 1MY3A 5CBSA 2F97A 2UVIA 3RTFB 4N13A 2ZZWA 3DP8A 3RYDA 1QGXA 4KCDA 4UA8A 3RT6B 1B3HA 3IJOB 2Q2CA 3OO9A 2KLFA 3KSJA 1GVCA 1M5CA 2AYSA 2P2AA 3BFUA 4HS7A 5TPAB 3H3GA 4GFRA 2DWAA 3PD8A 4JVDA 3VVFA 4R75A 3Q25A 2E0SA 3KGCA 4PF6A 2HQ0A 3TTMA 3CFXA 4OEVA 4BLAA 4G68C 3GXAA 3TODA 5HM4B 4GXAA 4MFIA 4MJOA 1ATGA 4R9GA 3KOSA 2CEYA 2KQZA 1Y9UA 2Y84A 1M5BA 4QSEA 4PFWA 1SI1A 1B3LA 4N8YA 4QXDA 2H25A 4QSDA 4PDDA 5FTHA 1LCFA 3M3FA 1MXYA 1B58A 4KYEA 5DVIA 1P1OA 1NNKA 4ELOA 4C0RA 3MJNA 4DXUA 4YKPA 1NL5A 3T66A 1A8FA 3T0JA 4XIGQ 2OZZA 3FV2A 3MW0A 1HSLA 2ZYMA 4H5GA 1VSOA 2Z8DA 2PFZA 3PMXA 2OCUA 2XD2A 1IQ7A 3PPQA 2HXRA 1URSA 2YJPA 2RF1A 4FIMA 3KG2A 3TPAA 5F24A 5H8HB 4ZEIA 2CZLA 2KR0A 3JZJA 3GYYA 2ABHA 1NV1A 1OQGA 4G61A 1CNQA 1D4NA 3O2AA 3MZBA 4XTCQ 1VFDA 3WAEA 4X1BA 5H8FA 3B8BA 4NGUA 2FBPA 3KN7A 4R73A 3D4GA 3IOWA 1WODA 2NVUB 2G93A 2Q2AA 4NQ8A 3E3KA 4KQPA 2O1MA 2XA5A 4NF5B 4OXVA 2R71A 1SD3A 1MQJA 5F7VA 1LFIA 1XI6A 4MX6A 2Q89A 4IO2A 1INPA 4R6HA 4H67A 2P0SA 3FVNA 3Q26A 4ZE9A 4MBPA 3KC0A 1JW1A 1NKXA 2V3QA 4FECA 3HCQA 3IJXB 4GQOA 2QVUA 1NH8A 3SDFA 1SPIA 3BIHA 3U94A 3EPEA 3G3HA 4QFLA 1FW0A 1DOTA 4LZ8A 4PFYA 5IKBA 4PFTA 4O7IA 4NF6B 3LBSA 4YICA 4Q30B 3H7MA 3MVYA 3LV0A 5IZ1A 4XKNA 1BKAA 5ET6A 1D9YA 4P8BA 4C1TA 3CIJA 4EUOA 3QK6A 5EYFA 2CZIA 4R74A 4EQ9A 3FGSA 1ZMGA 4IY5A 3PTYA 2F35A 3MPKA 1H43A 5L9SA 1GGGA 1MXXA 1ZKBA 3H6UA 4JBZA 1BLFA 3PUXE 4QHQA 3BFTA 1MQGA 5IAIA 1LBZA 2XWIA 3TUSA 4F3PA 3ROJA 2Z8FA 4PC9A 4O94A 2XX8A 2ONRA 2RINA 4HTGA 4I62A 4PAIA 1URGA 3BIGA 2X7PA 1SBPA 2O69A 3A3UA 5H8NB 3K6WA 2ZYKA 3B6QA
chains in the Genus database with same CATH topology
4P3LA 1LBXA 5T3JA 4O7MA 4PE3A 1KA1A 1LBYA 2V4CA 1RDZA 4F19A 3KC1A 2F3DA 5FBPA 4OVSA 2XWOA 4PGNA 1FBPA 4N6KA 2WYKA 2HPGA 4OA4A 5EQ7A 1YYZA 5EQAA 4GX4A 4PBQA 2VT5A 2WYPA 5IGAA 2XWVA 5IZZA 1EYIA 1FBDA 3SZPA 1K9YA 4P1LA 4OVTA 3MSTA 2DE3A 4PAFA 4QBAA 1YXIA 4H45A 1EYJA 5EQ9A 2XWKA 4GX3A 4X8RA 1NV3A 1IMCA 4N8GA 4P1EA 1IMDA 1FPFA 4NHBA 4PCDA 4MNIA 4HE2A 3CHGA 2PFYA 4MNPA 1DCUA 2DVZA 4P47A 5DW8A 4P56A 1FPGA 4HCWA 4XFEA 1IMFA 4PF8A 4N91A 5LTCA 2GQ1A 4NG7A 2DE4A 2ZZXA 4PFRA 4IR8A 2FVZA 1FBCA 3MYUA 5I3SA 5EQ8A 5IM2A 2Y5KA 4OVRA 1FTAA 4PFBA 3W9VA 5EYGA 4PBHA 3U65A 2XXKA 1RDXA 2OX3A 2ZZVA 2BJIA 4F18A 1NUZA 4UABA 1FJ9A 1DK4A 4PDHA 4NF0A 1IMEA 1NV5A 1NUWA 1EYKA 3E78A 4HE0A 4XF5A 1FPIA 4GWUA 1NV2A 3NOHA 2ZZWA 4NX1A 3RYDA 1QGXA 2F5XA 4M1VA 1G0HA 4H46A 2VPOA 4YZZA 1NV4A 4GWZA 2P3NA 4XEQA 1NUYA 5A5LA 4JVDA 2MKZA 4JVIA 4PF6A 5ESYA 3T1BA 1FJ6A 4P9KA 2QFLA 5IZ3A 4GBVA 3KBZA 4MJOA 1VDWA 2CEYA 5I7IA 2PCRA 2KQZA 5IZ3B 1RDYA 1FSAA 4HE1A 4N8YA 4QXDA 4MHFA 4PDDA 1YZ0A 2OWZA 4I40A 4OVQA 1FPBA 4AS5A 4JVCA 3LUZA 1LBVA 2WEFA 2CZKA 4DI4B 3T0JA 4LN5A 1NV6A 4PGPA 2PFZA 2WBBA 2FHYA 5CM6A 2HXRA 2WX9A 5J16A 4GWXA 3QMFA 1FRPA 5F24A 1LBWA 2FIXA 4PAKA 4AS4A 2KR0A 1LEVA 1FPEA 1FPLA 3W9WA 3GYYA 4FBPA 1FBEA 4NN3A 5ET5A 4MCOA 4GX6A 1NV1A 4PFIA 4G61A 1CNQA 1Q9DA 2P3VA 2Y5LA 1DBZA 5ET7A 3B50A 4PTKA 3B8BA 2QPQA 4NGUA 2FBPA 4GWYA 3HFUA 4F1UA 2HHMA 4NQ8A 1FPDA 2XA5A 1FBHA 4N6DA 4DI3D 3E79A 1BK4A 1XI6A 4MX6A 1AWBA 1INPA 2CEXA 1D9QA 4HCYA 4MAGA 1G0IA 4O8MA 4I3YA 2HZKA 3KC0A 3FBPA 4N17A 2V3QA 1IMAA 4N15A 2QVVA 2QVUA 5LDZA 2Q8MA 1SPIA 3BIHA 2FIEA 5ET8A 4O7IA 1KZ8A 2Q74A 2WBDA 4YICA 1FBGA 3LV0A 5IZ1A 3D1RA 4X04A 5ET6A 4PETA 2DE2A 2CZHA 4P8BA 1FPKA 1JP4A 2CZIA 4N4UA 1NV7A 4GWSA 3IFAA 3PTYA 4NAPA 5EYHA 4OVPA 3RPLA 5JK4A 4GWWA 4MEVA 1K9ZA 4GBWA 1FBFA 1KA0A 2B4LA 2HZLA 1FPJA 4HXVA 5I5PA 3RPLB 1LBZA 4MNCA 2VPNA 2DDKA 2L5VA 4OANA 2R8TA 3A29A 2XWIA 2F3BA 4F1VA 2Q9TA 3ROJA 2B4MA 4I3EA 1NI9A 4MIJA 3ISPA 4PC9A 2QVRA 4MMPA 4O94A 4PAIA 5J1DA 1NUXA 1NV0A 3EKIA 1IMBA 3BIGA 4N81A 4X9TA 2JJKA 3IFCA 3FXBA 4KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KC0 A;  4IR8 A;  1LBX A;  2FVZ A;  3IFC A;  5T3J A;  1FBC A;  3FBP A;  5I3S A;  5EQ8 A;  1IMA A;  2Y5K A;  1YZ0 A;  1FTA A;  2OWZ A;  5EYG A;  4I40 A;  1KA1 A;  2QVV A;  1LBY A;  1FPB A;  2QVU A;  4AS5 A;  3LUZ A;  1LBV A;  1RDX A;  1RDZ A;  2OX3 A;  2BJI A;  3KC1 A;  1NUZ A;  2WEF A;  2Q8M A;  2CZK A;  5LDZ A;  1FJ9 A;  1SPI A;  3BIH A;  2F3D A;  1DK4 A;  5FBP A;  3T0J A;  2FIE A;  5ET8 A;  1NV6 A;  1IME A;  4O7I A;  1FBP A;  1KZ8 A;  1NV5 A;  1NUW A;  1EYK A;  2WBB A;  2Q74 A;  2FHY A;  2WBD A;  4HE0 A;  5EQ7 A;  1YYZ A;  5EQA A;  1FBG A;  1FPI A;  4GWU A;  3LV0 A;  4GWX A;  5IZ1 A;  5J16 A;  3D1R A;  3QMF A;  5ET6 A;  2VT5 A;  2CZH A;  1NV2 A;  1EYI A;  1FRP A;  5F24 A;  1FBD A;  1LBW A;  1FPK A;  2FIX A;  3RYD A;  1QGX A;  4AS4 A;  1JP4 A;  2CZI A;  1LEV A;  1NV7 A;  4GWS A;  1FPE A;  1FPL A;  3IFA A;  1K9Y A;  1G0H A;  4FBP A;  4H46 A;  1FBE A;  5ET5 A;  1NV4 A;  4GX6 A;  1NV1 A;  5EYH A;  4GWZ A;  4G61 A;  1CNQ A;  1Q9D A;  2P3V A;  2P3N A;  2Y5L A;  1DBZ A;  1YXI A;  3RPL A;  4GWW A;  5ET7 A;  4H45 A;  1NUY A;  1EYJ A;  5A5L A;  5EQ9 A;  4PTK A;  1K9Z A;  4GBW A;  4GX3 A;  1FBF A;  1KA0 A;  1NV3 A;  3B8B A;  1IMC A;  2FBP A;  1IMD A;  5ESY A;  1FPJ A;  1FPF A;  4GWY A;  4HXV A;  1FJ6 A;  3RPL B;  2HHM A;  1FPD A;  1LBZ A;  2QFL A;  2DDK A;  5IZ3 A;  4HE2 A;  2R8T A;  1FBH A;  3A29 A;  4GBV A;  2F3B A;  1DCU A;  3KBZ A;  3ROJ A;  4I3E A;  4MJO A;  1NI9 A;  2QVR A;  5DW8 A;  1VDW A;  1BK4 A;  1XI6 A;  1AWB A;  1FPG A;  2PCR A;  1IMF A;  1NUX A;  1INP A;  1NV0 A;  1IMB A;  5IZ3 B;  1D9Q A;  3BIG A;  1G0I A;  4N81 A;  1RDY A;  1FSA A;  2JJK A;  4HE1 A;  2GQ1 A;  4QXD A;  4GX4 A;  4KXP A;  4I3Y A; 
#chains in the Genus database with same CATH topology
 3SER A;  1OLC A;  3IO4 A;  1LBX A;  2QRY A;  1LGB C;  4ZEF A;  4U4S A;  3K2D A;  1FQF A;  1OVT A;  2IA4 A;  1IIT A;  2V4C A;  1RDZ A;  1YTV A;  2I4C A;  2F3D A;  3UA8 A;  1JVX A;  1P1N A;  3K6V A;  3QUJ A;  4N6K A;  1SVX B;  2OJT A;  2X7Q A;  5EQ7 A;  3CFL A;  1XHY A;  3O66 A;  1DPP A;  4ECF A;  4TLL B;  3HPI A;  1LBC A;  5IGA A;  2XWV A;  1EYI A;  4DDD A;  5ITP A;  5ISU A;  2QMX A;  3UP9 A;  1IUD A;  4NED A;  3TCG A;  3N94 A;  1OQH A;  1S9T A;  3VVD A;  4KCC A;  4P1L A;  3TAJ A;  4OVT A;  3MST A;  2DE3 A;  4QBA A;  4F2O A;  4RK9 A;  1MPD A;  4F3B A;  1NH7 A;  3KZG A;  3R26 A;  3O29 A;  1MPB A;  4QSC A;  5EQ9 A;  3K02 A;  4GX3 A;  4F2Q A;  4U21 A;  4N8G A;  5JTY B;  1IMD A;  3F11 A;  4LQ2 A;  3N26 A;  4NHB A;  1B7H A;  1EZP A;  2XXI A;  4HE2 A;  1DCU A;  3H03 A;  2AIX A;  5CMK A;  4OFO A;  4HCW A;  4LP2 B;  4Q8R A;  1UIV A;  1IMF A;  3C31 A;  1Y3Q A;  1RKM A;  4N91 A;  5LTC A;  2GQ1 A;  2ZNT A;  2F7B A;  1B40 A;  2FVZ A;  2V84 A;  2Y7R A;  5IM2 A;  3OOA A;  4OVR A;  4IO4 A;  1VFE A;  1JVY A;  2DOJ A;  3U65 A;  1YAE A;  1RYX A;  1MXV A;  1SW5 A;  4KYS A;  4F18 A;  4UAB A;  2I0B A;  4R6K A;  5TP9 B;  3IO6 A;  3RTW B;  4NF4 A;  4BDO A;  1EYK A;  3E78 A;  4XF5 A;  1B6H A;  1FPI A;  4GWU A;  3VLU A;  1DSN A;  3MZ1 A;  3G3I A;  2Y7K A;  1NV2 A;  5L9M A;  4NF4 B;  1PB8 A;  4NX1 A;  1MM7 A;  2F5X A;  4M1V A;  1PDA A;  5CMB A;  4U1Z A;  2VHA A;  2VOZ A;  1G0H A;  4H46 A;  3M8U A;  2GRV A;  3E9X A;  4GWZ A;  4XEQ A;  3TKD A;  1Y1Z A;  2MKZ A;  4JVI A;  4LZ7 A;  5HPQ A;  3MC2 A;  4U22 A;  4TOZ A;  1B3G A;  2UVJ A;  3FAT A;  4RYA A;  3VXC A;  4RPO A;  1FJ6 A;  2F78 A;  1ZLQ A;  3V5A A;  2M8C A;  4GBV A;  3VLW A;  3IOT A;  5KCJ B;  2DYX A;  4JWO A;  3WAF A;  1TT1 A;  4QFN A;  5KDT B;  2ONS A;  1Y1M A;  2ZNS A;  4HE1 A;  1LFH A;  1FTM A;  1MH4 A;  2ALU A;  4MLQ A;  5I59 B;  3EHU A;  1FPB A;  1LBV A;  2WEF A;  1YCJ A;  2V25 A;  3C9H A;  1L5T A;  5CC2 A;  4PGP A;  2O84 X;  5ICT A;  2HEU A;  3B6W A;  1DPE A;  5J16 A;  1OIB A;  1F9B A;  1FTJ A;  1Q35 A;  1XVX A;  4WKM A;  4ZDM A;  1LBW A;  4PAK A;  4AS4 A;  3C36 A;  1MXU A;  1FPE A;  5TU0 A;  3W9W A;  4FBP A;  2RC8 A;  4NN3 A;  3C34 A;  1A8E A;  1MY1 A;  1Q9D A;  1UTB A;  2FNC A;  2QS1 A;  3N6U A;  3VVE A;  3K0V A;  2QPQ A;  2F34 A;  4FJP A;  4O3B A;  3OEL A;  2HHM A;  3CVG A;  3LUY A;  1A7L A;  1FBH A;  3C35 A;  1SQY A;  5M2V A;  4E0X A;  3G3J A;  2DSF A;  4AB6 A;  4Z0I A;  1QUI A;  1I6Q A;  3KEI A;  3UIF A;  2XX7 A;  5FHO A;  4ONY A;  1ANF A;  5CMC A;  2GHA A;  2HZK A;  3CI8 A;  3I5O A;  3FBP A;  2RC9 A;  4N17 A;  4RY1 A;  3AXF A;  2F8D A;  1IMA A;  3TEL A;  1XVY A;  4N15 A;  2I58 A;  3H06 B;  1IXG A;  2QVV A;  2DWI A;  4U23 A;  3ZKL A;  4E0W A;  3TCH A;  1B4Z A;  4F3G A;  1QKA A;  3EN3 A;  1ZIU A;  2Q88 A;  3Q29 A;  1KZ8 A;  1URD A;  5K2Y A;  2WBD A;  3QIM A;  3D1R A;  3OSR A;  1B32 A;  1POY 1;  3USD A;  4PET A;  4IGT A;  4ZEK A;  2CZH A;  3C4M A;  4BDM A;  1FPK A;  1JP4 A;  4XKQ A;  1NV7 A;  1TXF A;  4AB5 A;  5LOM A;  3HST A;  3BBR A;  5EYH A;  1PB7 A;  3IB0 A;  2XXQ A;  2F7C A;  4KYD A;  1LFG A;  3PU5 A;  3PUZ E;  4MEV A;  3HO7 A;  1K9Z A;  2OPD A;  2QS3 A;  3MP6 A;  1KA0 A;  1MQI A;  3OO8 A;  1CE2 A;  1B2H A;  4HXV A;  2ESN A;  2I49 A;  1SDX A;  1NNF A;  1Y4T A;  2VPN A;  2DDK A;  2G29 A;  2L5V A;  2E1S A;  2R8T A;  3A29 A;  3ONM A;  2X26 A;  4FE8 A;  2Q9T A;  3TTN A;  2B4M A;  4G77 A;  4HW8 A;  2QVR A;  4MMP A;  2XXW A;  2FA7 A;  1NV0 A;  3EKI A;  1IMB A;  4X9T A;  3IFC A;  3FXB A;  3T9X B;  4G68 A;  4P3L A;  3V8X B;  4JB7 A;  3OD7 A;  5T3J A;  1UTH A;  5H8F B;  4G4P A;  4IO5 A;  4PE3 A;  3L6G A;  4G68 B;  5FBP A;  1MXZ A;  4U4X A;  2XWO A;  1VE4 A;  1IEJ A;  3HV1 A;  2H99 A;  5EHM A;  3C32 A;  1FBP A;  3K1P A;  3PGF A;  1N04 A;  2WYK A;  3IOU A;  3W15 C;  5F1Q A;  1A55 A;  4POW A;  4YB7 A;  4GVO A;  3SES A;  4PBQ A;  1HSE A;  3VV5 A;  3QAX A;  1Q1K A;  2F6P A;  2WYP A;  5CI5 A;  1MY0 A;  3FD3 A;  3PUV E;  4YMB A;  4TQU Q;  2XX9 A;  2D3I A;  4ZEB A;  2IEE A;  2DVC A;  2OWT A;  4YKI A;  1MPC A;  1N3X A;  2F6G A;  1YXI A;  1N84 A;  3KSX A;  4H65 A;  4ISU A;  5H8Q A;  4BDN A;  3S2V A;  5L8D A;  3FVG A;  4ELQ A;  3HHF A;  4YB6 A;  3R7X A;  3TZA A;  3DP6 A;  3O9P A;  4DCY A;  3K6X A;  3TTK A;  1MY2 A;  1I6B A;  1VR5 A;  3CHG A;  4LAT A;  3O6I A;  2DVZ A;  4P47 A;  1GR2 A;  1MH3 A;  4XFE A;  1UIU A;  2THI A;  3TTL A;  4OEU A;  4LVQ A;  2Z23 A;  1LAX A;  2F7A A;  3K4U A;  2ZZX A;  4I1D A;  1SYH A;  3VLV A;  3SEU A;  1II5 A;  2REJ A;  3U93 A;  2NUV A;  5EQ8 A;  2Y5K A;  4ZEC A;  3TFL A;  1Z7N E;  1FTA A;  3VE1 B;  4WEP A;  5EYG A;  3W9V A;  2I3W A;  2B3F A;  3FIR A;  2ZZV A;  1NUZ A;  2I6E A;  1SW4 A;  1DK4 A;  1R9Q A;  4PDH A;  4NF0 A;  1B3E A;  2DP8 A;  2YLN A;  1B0H A;  2ZXT A;  2DXR A;  3H6V A;  5DYH A;  4P0G A;  4F31 B;  3Q28 A;  2Y7I A;  2NXO A;  1B52 A;  2NOO A;  3NOH A;  4Q0C A;  1B51 A;  1YPN A;  3H6W A;  2O6A A;  4PQJ A;  1B0L A;  4YMA A;  4PFU A;  4AQ4 A;  3K6U A;  3R6U A;  2A5T A;  3T9H B;  1BIY A;  2P3N A;  3GZG A;  1FQD A;  4BDR A;  5FHM A;  4GL8 A;  1N3W A;  5ESY A;  3ECR A;  3T1B A;  2I3V A;  1PB9 A;  3MWB A;  2NWJ A;  1ZJL A;  2QFL A;  3SEW A;  5AA4 A;  4C1U A;  4GD5 A;  3M3K A;  3KBZ A;  3RUM A;  1MQD A;  3CSG A;  4KHZ E;  2Y7P A;  1VDW A;  4KD5 A;  1XS5 A;  2HAU A;  1B9J A;  2O1L A;  4ZZE A;  4OFL A;  3N6T A;  4IO7 A;  1UQW A;  1LAF E;  2CMO A;  5AA4 B;  3T96 B;  1R9L A;  1RDY A;  1FSA A;  1LAH E;  4IY6 A;  2HCA A;  3DLN A;  1MDQ A;  4Z7E A;  1Y3N A;  1JEU A;  4KR5 A;  1YZ0 A;  4M4G A;  1MRP A;  4I40 A;  5KZT A;  3LUZ A;  2CZK A;  4DI4 B;  2QSX A;  1S50 A;  4OEN A;  4YAH X;  1I6A A;  2WBB A;  3G3F A;  4GL0 A;  4JXI A;  5CM6 A;  3SKP A;  4GWX A;  2O51 A;  2OPE A;  1FRP A;  4YKJ A;  1OMP A;  1NFT A;  4OVJ A;  3KJ7 A;  4EXK A;  1FBE A;  5ET5 A;  4MCO A;  4GX6 A;  5AA2 A;  1H44 A;  1R1N A;  4KI0 E;  1WVJ A;  2Y5L A;  3B50 A;  4PTK A;  1PC3 A;  3RY3 A;  1P1Q A;  4PP0 A;  3G3K A;  5AA2 B;  4GWY A;  5DTB A;  1EH3 A;  3HFU A;  4F1U A;  3GBA A;  3QYT A;  4JWX A;  4KFQ A;  3QXM A;  4O3A A;  3V89 B;  2YPN A;  1JET A;  3E79 A;  1BK4 A;  1USY H;  3VDF A;  1J1N A;  2OWS A;  2PT1 A;  1D9Q A;  4HCY A;  1QVS A;  2RCB A;  1B4H A;  2XXH A;  3N5L A;  3UK4 A;  4JWY A;  1MXW A;  4QFP A;  3O6G A;  3PUW E;  1XT8 A;  4GOT A;  2I4B A;  5JEI A;  3DP4 A;  3RT8 A;  3MPL A;  2Q8M A;  4LON B;  3LR1 A;  3U72 A;  1ZBM A;  5ET8 A;  3MP8 A;  2UYE A;  1B1H A;  2LAO A;  2H9B A;  4FAT A;  3RGY A;  2ZYO A;  3S9N C;  1HSJ A;  3V83 A;  4P0I A;  3S9M C;  4NE4 A;  1FTO A;  3T93 B;  4FED A;  4ND9 A;  4OWD A;  3B6T A;  1US4 A;  1WDN A;  1I69 A;  4N4U A;  1P1U A;  4EF1 A;  1CB6 A;  4RA1 A;  4ELP A;  4ZED A;  2QL3 A;  4NAP A;  5ELV A;  4OVP A;  1B5H A;  4DLD A;  4DXB A;  2XXU A;  1KWH A;  1QUK A;  2REG A;  1LB8 A;  2DWJ A;  4DE8 A;  4GBW A;  1T0K A;  3O28 A;  5DEX A;  4YB5 A;  2HZL A;  1QKB A;  1FPJ A;  3MZ9 A;  1TFA A;  5I5P A;  3T22 A;  1FTK A;  4UAC A;  2F3B A;  4OER A;  5DVF A;  3EHT A;  5DEX B;  1JEV A;  3LSW A;  4I3E A;  4MIJ A;  3ISP A;  1LAG E;  4NWD A;  3KOT A;  5J1D A;  1Y20 A;  3PMW A;  2D21 A;  4KPT A;  3CR9 A;  3KBR A;  3LSF B;  4N81 A;  4LQ5 A;  2JJK A;  3IOV A;  4U2R A;  1AL3 A;  5AA2 D;  3IOR A;  1UTB B;  3ZS6 A;  4LZ5 A;  2HFB A;  4THI A;  5ITO A;  1N0T A;  2PMS A;  4F39 A;  3K1M A;  1LBY A;  3FV1 A;  1FQC A;  3O6H A;  4F19 A;  3OO6 A;  2DWH A;  3KC1 A;  4BDL A;  2V3U A;  5TPA A;  1GTK A;  2XD3 A;  2UVG A;  4X48 A;  3EQ1 A;  2W7Y A;  3KFM A;  4OA4 A;  4MF3 A;  3G3G A;  4H1X A;  5CBR A;  1ZU0 A;  2VT5 A;  3OXN A;  3FXQ A;  5IZZ A;  4R72 A;  3VXB A;  1AMF A;  1O63 A;  5AE4 A;  1AIV A;  2Z22 A;  3SEY A;  4EQB A;  1Y3P A;  3MBP A;  1FQA A;  4G2Z A;  4PAF A;  3QSL A;  2A5S A;  5DT6 A;  4NTL A;  2PBW A;  4ZZA A;  1DMB A;  1EYJ A;  4X8R A;  1NV3 A;  1RYO A;  3FZV A;  2ZNU A;  1FPF A;  2RKM A;  2XXT A;  3B7D A;  1B7Z A;  4R2B A;  4OTE A;  1OLA A;  4MNI A;  3TMG A;  3JV9 A;  2QS4 A;  5DW8 A;  4P56 A;  1EU8 A;  4K3F A;  3TQW A;  3CRB A;  3IX1 A;  3ODB A;  3ILT B;  4PF8 A;  4F22 A;  2DE4 A;  5H8H A;  2PX1 A;  1FCK A;  4PFR A;  3QUF A;  3MYU A;  5I3S A;  1TFD A;  2ZMB A;  1XC1 A;  2I48 A;  3FXU A;  4DXC A;  4PFB A;  2GFE A;  2VD2 A;  4P11 A;  3OMB A;  1RDX A;  2BJI A;  4ESX A;  4JSD A;  3EHS A;  4MH5 A;  4OHN A;  2AL5 A;  1NV5 A;  1NUW A;  2BJJ X;  2OBG A;  2OLB A;  2ONK E;  3FJ7 A;  4GIZ A;  4HE0 A;  1FTL A;  4WED A;  2HXW A;  1PEB A;  4EDP A;  3A09 A;  4NF5 A;  4XKR A;  4RJZ A;  1MQH A;  2GH9 A;  3GLB A;  3MQ9 A;  1SYI A;  2D5W A;  2ZYN A;  1UTH B;  3U1O A;  4ZE8 A;  3PPN A;  3JYR A;  2VPO A;  4YZZ A;  1NNT A;  1NV4 A;  4H8J A;  3PPP A;  1AH5 A;  3CSB A;  4H5F A;  1NUY A;  5A5L A;  3RPW A;  1NMU A;  3S9E A;  1GV8 A;  1B5J A;  3ZSF A;  4NMY A;  4P9K A;  4FAJ A;  5IZ3 A;  2H4I A;  2F36 A;  4H8I A;  3FJG A;  4OMB A;  5I84 A;  3PPO A;  4F29 A;  4L17 A;  5B70 A;  4NF6 A;  3FJM A;  1QW0 A;  5I7I A;  2PCR A;  2XHD A;  5IZ3 B;  4QRZ A;  3THI A;  1IIW A;  4RPN A;  3IAZ A;  4G8M A;  1MS7 A;  1US5 A;  4MHF A;  3KN3 A;  1BTJ A;  3MVX A;  3RLF E;  5H8Q B;  3SEV A;  3I3V A;  5HBC A;  1M5E A;  2FYI A;  2OWZ A;  4R6Y A;  3FVK A;  4OVQ A;  4YKK A;  1D9V A;  4AS5 A;  4I8C A;  4JVC A;  3TCF A;  3OEM A;  2XXR A;  1DTG A;  3LSL A;  2XXX A;  4LN5 A;  4FOR A;  4OYV A;  3T9U A;  3IB1 A;  1NV6 A;  3PPR A;  4IO6 A;  3RN8 A;  2DXY A;  1AOV A;  3RNN A;  3IR1 A;  2FHY A;  5I56 A;  4ELR A;  1IXI A;  1ELJ A;  2WX9 A;  3QMF A;  5FHN A;  2Z8E A;  3UOR A;  1LB9 A;  2V93 A;  3PD9 A;  3OEN A;  4LA9 A;  2FIX A;  2O7I A;  5I56 B;  2R6G E;  1LEV A;  3FAS A;  1FPL A;  1TWY A;  4DIG A;  1S7Y A;  1M5F A;  5AA3 A;  1IXC A;  5AA1 A;  1A40 A;  4PFI A;  4WXJ A;  5H8N A;  1OVB A;  1ZTY A;  1O64 A;  2P3V A;  1P1W A;  1DBZ A;  5ET7 A;  1QJM A;  2UXA A;  2XXV A;  1H45 A;  4EF2 A;  4NWC A;  3MUQ A;  2VGQ A;  3K1N A;  1JW4 A;  3MVW A;  1EZ9 A;  5K2X A;  3IB2 A;  1FPD A;  1USY E;  3OEK A;  1H76 A;  4N6D A;  4DI3 D;  4OET A;  3K00 A;  4JDF A;  3E13 X;  1AWB A;  1SI0 A;  3T9V A;  2I0C A;  2CEX A;  2R9J A;  4GWO A;  4MAG A;  2PVU A;  1G0I A;  2Q8J A;  4XKP A;  2A5T B;  5I2N A;  3A3C A;  4H0W A;  4O8M A;  4I3Y A;  2O7U A;  3MAM A;  2B65 A;  4GF8 A;  4X1D A;  1B46 A;  3K01 A;  3FUZ A;  4DZ1 A;  2QMW A;  5I2N B;  4OES A;  1N76 A;  5LDZ A;  5BWJ A;  5DVJ A;  1MM6 A;  4F3S A;  2FIE A;  4U1O A;  3HN0 A;  4ZS9 A;  4GLI A;  4QF9 A;  1D3K A;  3LSX A;  5JTY A;  1O7T A;  2Q74 A;  4I9D A;  1FBG A;  2VP1 A;  2XXP A;  3LC8 A;  3RQT A;  4G8N A;  2P1S A;  5FTI A;  1QUJ A;  3H4Z A;  4X04 A;  2UVH A;  4IGR A;  4MLV A;  2DE2 A;  2PYY A;  4F1Y A;  4Q5T A;  4ESW A;  4GWS A;  3SET A;  3CG3 A;  3IFA A;  1MDP 1;  4OFJ A;  3S9L C;  4FEB A;  2QS2 A;  3BKI B;  3RPL A;  5JK4 A;  4GWW A;  4YU0 A;  3M3L A;  2UYF A;  1FBF A;  3KJT A;  2B4L A;  5I57 A;  5EHS A;  2RCA A;  4LUB A;  3RPL B;  4N07 A;  4MNC A;  5TP9 A;  1N7X A;  4OAN A;  1B7U A;  3U92 A;  5I57 B;  4R9F A;  1NNP A;  4F1V A;  3ZKK A;  1B3F A;  1NI9 A;  3O97 A;  4RNS A;  2HAV A;  5ICQ A;  3P7I A;  1JQF A;  2GHB A;  1NUX A;  2RC7 A;  2DQV A;  4IB2 A;  1EZO A;  3TEP A;  5I58 A;  1Z7M E;  4GX4 A;  2OK2 A;  4KXP A;  4POX A;  4DCX A;  3KN8 A;  2ANJ A;  3HHG A;  3DM0 A;  3TYH A;  4O7M A;  1MG1 A;  4RXL A;  5I58 B;  3G7W A;  1KA1 A;  2DS9 A;  2AL4 A;  3H6T A;  1FQE A;  1PBP A;  1B05 A;  4H6D A;  3OSQ A;  4OVS A;  2H98 A;  1A54 A;  3VFJ A;  4PGN A;  3UN6 A;  3TDJ A;  4RK2 A;  2PT2 A;  1Y4C A;  5H8S A;  1SW2 A;  4BDQ A;  2HPG A;  4NF8 A;  3D4C A;  3MP1 A;  4OQO A;  3PV0 E;  1YYZ A;  5EQA A;  1P99 A;  2QJE A;  4N6P A;  4R2F A;  1LLS A;  1B1X A;  1M5D A;  4G8H A;  3I6V A;  1FBD A;  4XXU A;  4NF8 B;  1IZ1 A;  5KCJ A;  3ILU B;  1DTZ A;  3SZP A;  2V3T A;  3OO7 A;  1K9Y A;  4GRK A;  5KDT A;  3PMV A;  5CRY A;  3FXR A;  3CFZ A;  4H45 A;  1LBB A;  2XWK A;  1N7W A;  3FVO A;  4QFK A;  3U8Q A;  3IK6 B;  1IMC A;  4P1E A;  1XOC A;  3GBB A;  5I59 A;  1SW1 A;  5BUU A;  5I2K A;  4EQ7 A;  4QFO A;  5L9O A;  4PCD A;  2O68 A;  4OZ9 A;  1QUL A;  1MY4 A;  2PFY A;  4GXS B;  4MNP A;  1B5I A;  4JSO A;  5A5X A;  1FQB A;  5I2K B;  3EF7 A;  3CG1 A;  1FPG A;  1PBQ A;  4PE5 B;  3TQL A;  3S4U A;  3SEX A;  2H5Y A;  5A5X B;  4NG7 A;  3TTR A;  1POT A;  4O3C A;  3C33 A;  4IR8 A;  1FBC A;  5B7D A;  2B3B A;  5CMM A;  1R6Z A;  2VD3 A;  4PBH A;  2XXK A;  2OX3 A;  1JW5 A;  3Q27 A;  2WKY A;  3E4R A;  3DEL B;  1FJ9 A;  3IL1 B;  1H3D A;  3MVZ A;  1LST A;  3UGW A;  1A99 A;  2XXY A;  1IXH A;  4IO3 A;  1IME A;  1BP5 A;  2Y7W A;  3PUY E;  4TLM B;  4EXL A;  1JNF A;  1LCT A;  3L6H A;  1MY3 A;  5CBS A;  2F97 A;  2UVI A;  3RTF B;  4N13 A;  2ZZW A;  3DP8 A;  3RYD A;  1QGX A;  4KCD A;  4UA8 A;  3RT6 B;  1B3H A;  3IJO B;  2Q2C A;  3OO9 A;  2KLF A;  3KSJ A;  1GVC A;  1M5C A;  2AYS A;  2P2A A;  3BFU A;  4HS7 A;  5TPA B;  3H3G A;  4GFR A;  2DWA A;  3PD8 A;  4JVD A;  3VVF A;  4R75 A;  3Q25 A;  2E0S A;  3KGC A;  4PF6 A;  2HQ0 A;  3TTM A;  3CFX A;  4OEV A;  4BLA A;  4G68 C;  3GXA A;  3TOD A;  5HM4 B;  4GXA A;  4MFI A;  4MJO A;  1ATG A;  4R9G A;  3KOS A;  2CEY A;  2KQZ A;  1Y9U A;  2Y84 A;  1M5B A;  4QSE A;  4PFW A;  1SI1 A;  1B3L A;  4N8Y A;  4QXD A;  2H25 A;  4QSD A;  4PDD A;  5FTH A;  1LCF A;  3M3F A;  1MXY A;  1B58 A;  4KYE A;  5DVI A;  1P1O A;  1NNK A;  4ELO A;  4C0R A;  3MJN A;  4DXU A;  4YKP A;  1NL5 A;  3T66 A;  1A8F A;  3T0J A;  4XIG Q;  2OZZ A;  3FV2 A;  3MW0 A;  1HSL A;  2ZYM A;  4H5G A;  1VSO A;  2Z8D A;  2PFZ A;  3PMX A;  2OCU A;  2XD2 A;  1IQ7 A;  3PPQ A;  2HXR A;  1URS A;  2YJP A;  2RF1 A;  4FIM A;  3KG2 A;  3TPA A;  5F24 A;  5H8H B;  4ZEI A;  2CZL A;  2KR0 A;  3JZJ A;  3GYY A;  2ABH A;  1NV1 A;  1OQG A;  4G61 A;  1CNQ A;  1D4N A;  3O2A A;  3MZB A;  4XTC Q;  1VFD A;  3WAE A;  4X1B A;  5H8F A;  3B8B A;  4NGU A;  2FBP A;  3KN7 A;  4R73 A;  3D4G A;  3IOW A;  1WOD A;  2NVU B;  2G93 A;  2Q2A A;  4NQ8 A;  3E3K A;  4KQP A;  2O1M A;  2XA5 A;  4NF5 B;  4OXV A;  2R71 A;  1SD3 A;  1MQJ A;  5F7V A;  1LFI A;  1XI6 A;  4MX6 A;  2Q89 A;  4IO2 A;  1INP A;  4R6H A;  4H67 A;  2P0S A;  3FVN A;  3Q26 A;  4ZE9 A;  4MBP A;  3KC0 A;  1JW1 A;  1NKX A;  2V3Q A;  4FEC A;  3HCQ A;  3IJX B;  4GQO A;  2QVU A;  1NH8 A;  3SDF A;  1SPI A;  3BIH A;  3U94 A;  3EPE A;  3G3H A;  4QFL A;  1FW0 A;  1DOT A;  4LZ8 A;  4PFY A;  5IKB A;  4PFT A;  4O7I A;  4NF6 B;  3LBS A;  4YIC A;  4Q30 B;  3H7M A;  3MVY A;  3LV0 A;  5IZ1 A;  4XKN A;  1BKA A;  5ET6 A;  1D9Y A;  4P8B A;  4C1T A;  3CIJ A;  4EUO A;  3QK6 A;  5EYF A;  2CZI A;  4R74 A;  4EQ9 A;  3FGS A;  1ZMG A;  4IY5 A;  3PTY A;  2F35 A;  3MPK A;  1H43 A;  5L9S A;  1GGG A;  1MXX A;  1ZKB A;  3H6U A;  4JBZ A;  1BLF A;  3PUX E;  4QHQ A;  3BFT A;  1MQG A;  5IAI A;  1LBZ A;  2XWI A;  3TUS A;  4F3P A;  3ROJ A;  2Z8F A;  4PC9 A;  4O94 A;  2XX8 A;  2ONR A;  2RIN A;  4HTG A;  4I62 A;  4PAI A;  1URG A;  3BIG A;  2X7P A;  1SBP A;  2O69 A;  3A3U A;  5H8N B;  3K6W A;  2ZYK A;  3B6Q A; 
#chains in the Genus database with same CATH homology
 4P3L A;  1LBX A;  5T3J A;  4O7M A;  4PE3 A;  1KA1 A;  1LBY A;  2V4C A;  1RDZ A;  4F19 A;  3KC1 A;  2F3D A;  5FBP A;  4OVS A;  2XWO A;  4PGN A;  1FBP A;  4N6K A;  2WYK A;  2HPG A;  4OA4 A;  5EQ7 A;  1YYZ A;  5EQA A;  4GX4 A;  4PBQ A;  2VT5 A;  2WYP A;  5IGA A;  2XWV A;  5IZZ A;  1EYI A;  1FBD A;  3SZP A;  1K9Y A;  4P1L A;  4OVT A;  3MST A;  2DE3 A;  4PAF A;  4QBA A;  1YXI A;  4H45 A;  1EYJ A;  5EQ9 A;  2XWK A;  4GX3 A;  4X8R A;  1NV3 A;  1IMC A;  4N8G A;  4P1E A;  1IMD A;  1FPF A;  4NHB A;  4PCD A;  4MNI A;  4HE2 A;  3CHG A;  2PFY A;  4MNP A;  1DCU A;  2DVZ A;  4P47 A;  5DW8 A;  4P56 A;  1FPG A;  4HCW A;  4XFE A;  1IMF A;  4PF8 A;  4N91 A;  5LTC A;  2GQ1 A;  4NG7 A;  2DE4 A;  2ZZX A;  4PFR A;  4IR8 A;  2FVZ A;  1FBC A;  3MYU A;  5I3S A;  5EQ8 A;  5IM2 A;  2Y5K A;  4OVR A;  1FTA A;  4PFB A;  3W9V A;  5EYG A;  4PBH A;  3U65 A;  2XXK A;  1RDX A;  2OX3 A;  2ZZV A;  2BJI A;  4F18 A;  1NUZ A;  4UAB A;  1FJ9 A;  1DK4 A;  4PDH A;  4NF0 A;  1IME A;  1NV5 A;  1NUW A;  1EYK A;  3E78 A;  4HE0 A;  4XF5 A;  1FPI A;  4GWU A;  1NV2 A;  3NOH A;  2ZZW A;  4NX1 A;  3RYD A;  1QGX A;  2F5X A;  4M1V A;  1G0H A;  4H46 A;  2VPO A;  4YZZ A;  1NV4 A;  4GWZ A;  2P3N A;  4XEQ A;  1NUY A;  5A5L A;  4JVD A;  2MKZ A;  4JVI A;  4PF6 A;  5ESY A;  3T1B A;  1FJ6 A;  4P9K A;  2QFL A;  5IZ3 A;  4GBV A;  3KBZ A;  4MJO A;  1VDW A;  2CEY A;  5I7I A;  2PCR A;  2KQZ A;  5IZ3 B;  1RDY A;  1FSA A;  4HE1 A;  4N8Y A;  4QXD A;  4MHF A;  4PDD A;  1YZ0 A;  2OWZ A;  4I40 A;  4OVQ A;  1FPB A;  4AS5 A;  4JVC A;  3LUZ A;  1LBV A;  2WEF A;  2CZK A;  4DI4 B;  3T0J A;  4LN5 A;  1NV6 A;  4PGP A;  2PFZ A;  2WBB A;  2FHY A;  5CM6 A;  2HXR A;  2WX9 A;  5J16 A;  4GWX A;  3QMF A;  1FRP A;  5F24 A;  1LBW A;  2FIX A;  4PAK A;  4AS4 A;  2KR0 A;  1LEV A;  1FPE A;  1FPL A;  3W9W A;  3GYY A;  4FBP A;  1FBE A;  4NN3 A;  5ET5 A;  4MCO A;  4GX6 A;  1NV1 A;  4PFI A;  4G61 A;  1CNQ A;  1Q9D A;  2P3V A;  2Y5L A;  1DBZ A;  5ET7 A;  3B50 A;  4PTK A;  3B8B A;  2QPQ A;  4NGU A;  2FBP A;  4GWY A;  3HFU A;  4F1U A;  2HHM A;  4NQ8 A;  1FPD A;  2XA5 A;  1FBH A;  4N6D A;  4DI3 D;  3E79 A;  1BK4 A;  1XI6 A;  4MX6 A;  1AWB A;  1INP A;  2CEX A;  1D9Q A;  4HCY A;  4MAG A;  1G0I A;  4O8M A;  4I3Y A;  2HZK A;  3KC0 A;  3FBP A;  4N17 A;  2V3Q A;  1IMA A;  4N15 A;  2QVV A;  2QVU A;  5LDZ A;  2Q8M A;  1SPI A;  3BIH A;  2FIE A;  5ET8 A;  4O7I A;  1KZ8 A;  2Q74 A;  2WBD A;  4YIC A;  1FBG A;  3LV0 A;  5IZ1 A;  3D1R A;  4X04 A;  5ET6 A;  4PET A;  2DE2 A;  2CZH A;  4P8B A;  1FPK A;  1JP4 A;  2CZI A;  4N4U A;  1NV7 A;  4GWS A;  3IFA A;  3PTY A;  4NAP A;  5EYH A;  4OVP A;  3RPL A;  5JK4 A;  4GWW A;  4MEV A;  1K9Z A;  4GBW A;  1FBF A;  1KA0 A;  2B4L A;  2HZL A;  1FPJ A;  4HXV A;  5I5P A;  3RPL B;  1LBZ A;  4MNC A;  2VPN A;  2DDK A;  2L5V A;  4OAN A;  2R8T A;  3A29 A;  2XWI A;  2F3B A;  4F1V A;  2Q9T A;  3ROJ A;  2B4M A;  4I3E A;  1NI9 A;  4MIJ A;  3ISP A;  4PC9 A;  2QVR A;  4MMP A;  4O94 A;  4PAI A;  5J1D A;  1NUX A;  1NV0 A;  3EKI A;  1IMB A;  3BIG A;  4N81 A;  4X9T A;  2JJK A;  3IFC A;  3FXB A;  4KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...