3T0JA

Crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
266
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNLTPNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of inositol monophosphatase - II from Staphylococcus aureus MSSA476
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 83
structure length 266
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3t0jA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t0jA02
2P3NA 3LV0A 4FBPA 3IFAA 5A5LA 4GX6A 5IZ1A 2FIEA 1LBZA 4N81A 4GWWA 2PCRA 1FPFA 4GWUA 4GWXA 1NV1A 1BK4A 1AWBA 2Q8MA 1EYJA 1LBWA 2BJIA 1EYKA 4G61A 2HHMA 3KBZA 1NV6A 4I3EA 3RPLB 3T0JA 1FBDA 1KZ8A 1RDYA 1NUWA 5EYGA 1YXIA 1K9YA 4GWZA 2FIXA 1IMBA 1G0IA 1SPIA 1NV4A 1YYZA 5EYHA 2F3DA 2FVZA 5IZ3A 1FPIA 1FSAA 1IMDA 1NV7A 1IMEA 2CZHA 4GWYA 4QXDA 4H45A 5T3JA 5FBPA 1FPBA 2VT5A 3IFCA 4HXVA 5EQ7A 1FBHA 3KC1A 4O7IA 1FBFA 1FJ6A 4AS5A 5LDZA 4MJOA 2Y5LA 4GWSA 4HE1A 1DBZA 1QGXA 2Q74A 2Y5KA 1FBGA 1EYIA 5ET8A 1FBEA 1FPKA 5EQ9A 4I3YA 4H46A 3QMFA 2P3VA 5EQAA 1XI6A 4PTKA 2CZKA 1KA0A 1LEVA 3B8BA 2GQ1A 1FTAA 1NUXA 1FRPA 4KXPA 1NUZA 4GX3A 3FBPA 1IMFA 1CNQA 2QVRA 2QFLA 3ROJA 1NUYA 2OWZA 2WBBA 4IR8A 5ET7A 1RDZA 4I40A 5ET5A 1DCUA 1FPJA 2QVVA 4GBWA 1FPLA 3A29A 1D9QA 1IMCA 1INPA 2FBPA 4HE0A 4HE2A 3BIGA 5ESYA 2JJKA 1LBVA 1NV5A 2R8TA 5I3SA 1G0HA 1FPGA 3BIHA 1RDXA 3KC0A 1KA1A 1DK4A 5F24A 3RYDA 4AS4A 1VDWA 1YZ0A 1FPDA 1LBYA 2FHYA 2WEFA 1FPEA 5EQ8A 1JP4A 1LBXA 1NV3A 2CZIA 1IMAA 1FBPA 2DDKA 3LUZA 3D1RA 5DW8A 1NV0A 5J16A 2F3BA 4GX4A 2WBDA 2OX3A 2QVUA 1NV2A 1NI9A 3RPLA 1Q9DA 5ET6A 1K9ZA 1FBCA 5IZ3B 1FJ9A 4GBVA
chains in the Genus database with same CATH superfamily
3OO9A 1LB9A 2Z8FA 4XXUA 5A5LA 2FIEA 1LBZA 3OELA 1FTJA 5CMCA 4NTLA 1M5EA 3FVOA 4YKPA 3TELA 2XXIA 4PAIA 3E4RA 1TXFA 4NF6B 4F3PA 2GFEA 3MBPA 4NF4B 2QRYA 2QJEA 5T3JA 4MBPA 3Q27A 1NNKA 3OD7A 1MQIA 1BTJA 4Q0CA 3WAEA 2VT5A 2Y7IA 1FTKA 4LATA 4LN5A 2ALUA 1FJ6A 4JB7A 4MJOA 1DMBA 2DOJA 4NF6A 3K1NA 3W15C 2HAUA 4I3YA 4H46A 1H45A 1B5JA 4O7MA 4M4GA 3KJ7A 1S9TA 4NF8B 2VD3A 3C35A 2RCBA 1FRPA 4OMBA 1AMFA 3IB2A 4NEDA 4Z7EA 1S7YA 1B3GA 4ELPA 5AA4B 2WBBA 2VHAA 3CIJA 1JEVA 2WYKA 4K3FA 4NF5B 4HCWA 1GR2A 4POWA 3HCQA 1N3WA 2PYYA 3IO4A 3RTFB 4IO7A 4X1DA 1OVTA 2DWHA 3GXAA 1NV3A 1IMAA 4BDOA 4DI3D 4BDMA 1NV0A 1YAEA 2ZYOA 2XXUA 5FTIA 3IAZA 3OO7A 4KCDA 4P1LA 1Q9DA 1POTA 1FBCA 3H6UA 3ECRA 1FCKA 2D3IA 1P1OA 1I69A 3LC8A 5TU0A 3G3JA 4YZZA 2THIA 1N0TA 2ZXTA 3DELB 4ZE8A 4R6KA 2H9BA 5ICTA 3BFUA 1II5A 3S4UA 4KYSA 4QXDA 1CB6A 5IZZA 3FXUA 2GRVA 4X8RA 1PDAA 3TQLA 2NUVA 2E0SA 4DE8A 4Z0IA 3MYUA 4GL0A 4O3AA 2F97A 3PUXE 4N17A 1AIVA 2MKZA 1B0LA 4ZS9A 4R72A 1N76A 4F18A 3FBPA 3IJOB 2GH9A 1IMFA 2NWJA 2F6PA 3QSLA 1TFAA 3T96B 3SESA 4P0GA 1NUYA 3O6IA 3PUVE 4TQUQ 4F1YA 4F39A 3RT8A 4YICA 1PEBA 4MIJA 1FQBA 3ZKKA 3MP8A 5JEIA 4QF9A 4PBHA 4LONB 2A5TA 3O6HA 1LAFE 5ISUA 1YZ0A 1LBYA 2FHYA 1F9BA 1BP5A 1MM6A 1B7HA 1RYXA 1IEJA 5L9SA 1UIVA 2WBDA 2OX3A 4MEVA 1KWHA 4U22A 3SERA 3UA8A 1GV8A 3CG1A 4IB2A 4F3SA 1I6AA 3OENA 3FZVA 3RT6B 2V3TA 3KOTA 4PQJA 4MCOA 2PT2A 1MXVA 3LSWA 1NV1A 3SEYA 4BDNA 2ZZVA 5F1QA 1RKMA 1KZ8A 5H8QA 1H76A 1YYZA 2REJA 3M3LA 4P9KA 4QFLA 1LCFA 4WEDA 4UA8A 3PUZE 2RCAA 2WX9A 3BFTA 4TLMB 4LZ5A 4YAHX 2Q89A 5CBRA 1XOCA 1IXHA 2CMOA 3MP1A 4AB5A 1SW4A 4GXAA 1QGXA 4NF0A 4QHQA 4ELQA 3H6WA 2XWVA 4QSDA 3SKPA 3GBBA 3S2VA 1ZMGA 5TPAA 1IIWA 2ZYNA 4H5FA 1B4ZA 2A5TB 1IXIA 2O51A 1JW5A 1BLFA 1LBVA 1LAGE 4FE8A 5I84A 1FPGA 1JETA 1LLSA 4NHBA 3FJ7A 3TTLA 1LBXA 1AH5A 5HM4B 5JTYA 4FEDA 4NWDA 3UORA 2HQ0A 5ET6A 1SBPA 3IR1A 5IGAA 4FBPA 1H44A 5FTHA 3KZGA 4PF8A 3IL1B 5I2NA 4HS7A 3EHUA 4Q5TA 1LCTA 3RPWA 4YMAA 1BIYA 2DE3A 4RK9A 4IY5A 4EQBA 3SEWA 2W7YA 2VP1A 5H8QB 2F7AA 4KR5A 1MM7A 2XXTA 4JWOA 5EHSA 2NOOA 1ZKBA 3KBRA 1QUKA 5FHOA 3U8QA 4JVCA 3VLUA 1UTHB 5KCJA 4BDQA 2QS4A 3PUYE 5JK4A 3SEVA 5EQ7A 1MQGA 1OVBA 1A55A 4QFPA 4P0IA 4PE5B 3O28A 5AE4A 5I2KA 4QRZA 3VXCA 1MXUA 5K2YA 4EF2A 3VDFA 1US5A 3TCFA 2XXVA 4DI4B 1KA0A 3B50A 1AOVA 1O64A 1B40A 2RINA 3F11A 3DLNA 4OESA 5H8HA 3E78A 4H1XA 2Y7PA 3Q28A 2RC7A 2P0SA 1NMUA 4I9DA 1MY2A 2DWIA 1HSLA 5EYFA 1RDXA 2Y7WA 3H7MA 4MX6A 4DCYA 4EF1A 1MPCA 4KYDA 3HPIA 2ONSA 4DIGA 2PFYA 1LSTA 2ZZWA 4PFWA 5J16A 2QMXA 3PPPA 2Q9TA 1A8EA 4G77A 4OERA 2XXHA 1EZOA 1NNPA 4FAJA 2Q2AA 4ONYA 4P47A 1FTMA 4PGPA 1VE4A 4N07A 1VR5A 3KN3A 2Q8MA 3L6HA 1EYKA 1FBDA 2DS9A 1RDYA 3IB0A 1NUWA 1SVXB 5FHMA 4EUOA 2HZKA 4NMYA 1G0IA 1Y4CA 3CR9A 3O2AA 2ESNA 3KN7A 1Y1ZA 1NH8A 5L9MA 3U1OA 3ILUB 1Z7ME 2HEUA 4O3CA 4O7IA 1B3EA 3K6XA 3SETA 4FORA 4F19A 1AL3A 4PAFA 4GWOA 2Y5KA 1YPNA 4THIA 5EQ9A 1FQFA 3RN8A 2V4CA 3FD3A 4IGRA 2DWAA 3G3GA 3IO6A 4WEPA 4BDRA 2GHAA 3TEPA 3PD8A 5IM2A 2QVRA 4IO2A 4XEQA 3GLBA 5H8FA 5IAIA 4G2ZA 4F2QA 4U1OA 5H8HB 4IR8A 1M5CA 5ET5A 3EPEA 1Y4TA 3G7WA 3A3UA 5DTBA 3B6TA 4RNSA 1NV5A 1LB8A 2Z23A 4G4PA 3C33A 5EQ8A 4JDFA 4ELRA 2F7CA 3OOAA 2CZIA 1SYHA 3MVYA 3TCHA 4PBQA 1MH4A 2PBWA 1OQHA 1QVSA 3U93A 4C1UA 1IXCA 4H65A 4OVJA 4E0WA 3N6UA 1FJ9A 3DP6A 4GBVA 2P3NA 4NF8A 3K02A 2XHDA 3MAMA 1B2HA 1MS7A 2DXYA 1SDXA 5DEXA 3FVGA 3VV5A 4RJZA 3RLFE 4KD5A 4RYAA 3QAXA 3Q26A 5LTCA 1IUDA 2FVZA 2QS2A 1XVXA 1IMDA 3FUZA 4KYEA 4NE4A 2ZNUA 4H0WA 3TTKA 2Q8JA 4OVPA 3G3KA 2HAVA 2WKYA 1FBFA 4JSDA 1R1NA 1XT8A 5L8DA 3FVNA 2F78A 4XIGQ 4GL8A 4ZDMA 4QFNA 1OLAA 3T1BA 3CG3A 4MLVA 2ZZXA 3VE1B 2I6EA 3C36A 1B5IA 4OANA 1ZLQA 3TCGA 1N7WA 3VXBA 4XFEA 4I40A 2QVVA 4OFOA 1A54A 2Y7KA 3PV0E 3TZAA 1JW4A 4LZ7A 2XX9A 4P3LA 4R2BA 1A99A 2ZNTA 4NGUA 4AS4A 3MUQA 2X7PA 1XHYA 1PBPA 1FW0A 4YU0A 3S9LC 2O84X 1J1NA 1ZIUA 3H03A 4JWYA 4KFQA 2R71A 3B6WA 3S9NC 2V25A 1QULA 1Q1KA 1NV2A 3RPLA 1MQDA 4Q30B 3Q29A 4PFRA 1RYOA 4EDPA 3MZ9A 4OVQA 3TUSA 3FV2A 5KDTB 4PP0A 5I58B 1EZPA 1MDQA 4F22A 1UTBB 4JXIA 1NV4A 1SW2A 1LBCA 5AA2D 2QPQA 2ONKE 4ZEFA 4GRKA 5FBPA 3KFMA 3MVZA 2WYPA 4LZ8A 4BDLA 2I49A 1B3FA 1NH7A 4EQ9A 1B9JA 3HV1A 3IFCA 3OMBA 1SI0A 1JW1A 4X04A 4M1VA 1DOTA 4FEBA 3KG2A 2A5SA 2PT1A 1DPPA 1FBGA 4PF6A 1FBEA 2H99A 4ESWA 1VFEA 1I6BA 2I0BA 3EHSA 4OETA 3MJNA 1P1NA 5BWJA 3ROJA 1ZJLA 5ET7A 3TTNA 2OPDA 4ESXA 4IO4A 5M2VA 3FASA 2REGA 3IORA 1IMCA 3IJXB 2I4CA 2XD3A 1A8FA 1VFDA 2OK2A 3PMXA 5ELVA 3IB1A 2ZMBA 4UABA 3SEUA 2XD2A 1B7UA 3K6UA 1QUIA 5K2XA 3V89B 5I58A 3O6GA 3JYRA 4ND9A 4FATA 1JNFA 1Y20A 4PDHA 5CRYA 2XXXA 4KCCA 4I62A 3PMVA 1UIUA 5DVJA 4GWUA 3HHGA 2QS3A 3RPLB 4RY1A 3K01A 1MY1A 3RNNA 1K9YA 5EYHA 1SPIA 1SW5A 2FA7A 3M8UA 1CE2A 4P8BA 2VPOA 1OQGA 1NV7A 5H8FB 4WKMA 3BKIB 3FXQA 1SW1A 3CSGA 2I48A 2H98A 2O6AA 2O69A 1OIBA 4HW8A 5KDTA 3KN8A 2Y84A 4G68B 4FIMA 3RQTA 2ZYKA 4G68C 5HPQA 3CFZA 1T0KA 5EQAA 1USYE 3B8BA 1TFDA 4KXPA 1NKXA 1Y3NA 3OSQA 4PAKA 4L17A 3FV1A 4GFRA 2NXOA 1LAXA 1SI1A 1RDZA 3JZJA 5TP9B 2DWJA 3CVGA 3FGSA 4DZ1A 3O29A 1PB7A 4EXLA 3BIGA 2VGQA 4MHFA 4X9TA 4R73A 1G0HA 1QUJA 4RK2A 3CSBA 4FECA 4ZECA 5F24A 5I2NB 3OSRA 5DVFA 1P1UA 3CFXA 4XTCQ 2DDKA 3MWBA 5F7VA 4JWXA 1HSJA 1S50A 5B7DA 3H6VA 4R9GA 2GHBA 2HXRA 3IX1A 3LSXA 3H4ZA 4OTEA 2BJIA 5CBSA 4G61A 3FATA 3KBZA 4NF4A 4R9FA 3HN0A 4FJPA 4TLLB 2FIXA 1D9YA 2V93A 2I3VA 5IZ3A 2DSFA 5A5XB 3T9VA 2PMSA 2QL3A 1MH3A 5H8SA 4P11A 1TWYA 1FPBA 4ZEDA 2OLBA 1IQ7A 3D4CA 3O66A 3KC1A 3QK6A 4AS5A 5LDZA 2PX1A 3ZS6A 4QFKA 5I2KB 3VLWA 4LVQA 4YB5A 2QS1A 2B3FA 2GQ1A 1BKAA 1GVCA 1MXZA 4OQOA 4N6PA 2VD2A 5KZTA 4G68A 2OWZA 2F34A 4ZEIA 2B3BA 5AA4A 3G3FA 4IO5A 3A29A 2M8CA 3U65A 3CFLA 1B51A 4ZE9A 1MXYA 4NQ8A 1B58A 3B7DA 3S9MC 4XKRA 3RUMA 3FIRA 1M5BA 3CHGA 1VDWA 1FQDA 3AXFA 1EU8A 3K6VA 1JP4A 4NAPA 2ABHA 4GF8A 1FBPA 3MC2A 1A7LA 1B05A 4GX4A 4N13A 1FQCA 3C34A 4OWDA 1NI9A 2AYSA 2HXWA 3MVWA 4GX6A 1XVYA 2O1LA 2VPNA 4OVRA 4PFUA 3IOUA 3UIFA 4OVTA 5I56A 5I57B 3KGCA 4H8JA 4F1VA 3N94A 3V83A 3MVXA 1YTVA 1DSNA 4H45A 2RC9A 4HTGA 5J1DA 3K1PA 2KR0A 3TODA 3C4MA 4U4SA 4PETA 3ODBA 1FQAA 1MPBA 4DCXA 4IGTA 2F36A 1PC3A 3Q25A 3U72A 1LEVA 1ZBMA 4GX3A 3NOHA 3EN3A 2OWTA 1CNQA 3T9UA 2QFLA 4OZ9A 3R26A 1ZTYA 4RPNA 3MP6A 2QSXA 4JVDA 3W9WA 3TKDA 1D9QA 5IKBA 3RY3A 1R9QA 3HO7A 3OO6A 3GBAA 4EQ7A 4HE2A 3HFUA 4QSCA 4KPTA 3SZPA 3PPQA 1MQJA 1FQEA 1OMPA 3K0VA 3PUWE 1DK4A 4PDDA 3THIA 1Y3PA 2Q88A 4DLDA 4MNIA 1UTHA 3A3CA 1VSOA 2XA5A 4PFBA 2OBGA 5JTYB 3K4UA 2NVUB 2O1MA 4IO3A 2F3BA 3KEIA 4Q8RA 1K9ZA 4BLAA 4LP2B 2D5WA 5AA2A 2DYXA 4XKPA 3PD9A 4N6DA 1JVXA 5CI5A 2ZYMA 5AA3A 2B4LA 4PFIA 4IO6A 4GOTA 3T0JA 4N6KA 1PBQA 4JBZA 4U2RA 4MNPA 4MFIA 1LFIA 4GVOA 2F3DA 1UQWA 3R6UA 1FSAA 3TAJA 2O7IA 1IMEA 1MXWA 3S9EA 1Q35A 3LR1A 4OEVA 3K2DA 4GWSA 2KLFA 2F8DA 2I3WA 1URGA 4XKNA 2XWOA 2L5VA 2ZNSA 3LSFB 1LFHA 3UP9A 4AQ4A 3I5OA 4F31B 4U23A 3VFJA 3N5LA 1L5TA 4O3BA 2I4BA 1FPLA 3G3IA 1QJMA 4I1DA 3ILTB 1XS5A 5B70A 4DXCA 5I3SA 4MMPA 3BIHA 3U94A 3PGFA 4F1UA 4EXKA 1PB8A 2G93A 4OENA 1ATGA 1M5DA 2RC8A 2AIXA 4R6YA 1DTZA 3C9HA 3V8XB 5I7IA 1URSA 2DVZA 1B6HA 2H25A 2QVUA 3R7XA 3QUJA 2R9JA 2UYEA 4DXBA 2OWSA 3WAFA 2XWIA 1P1WA 4WXJA 1MRPA 4LQ2A 4YMBA 2E1SA 5H8NB 1B46A 2OCUA 3N26A 1D3KA 1IMBA 5TPAB 2RKMA 1FPIA 2I0CA 2CZHA 3RGYA 4PC9A 1JEUA 4F29A 1IZ1A 2O68A 1EZ9A 3H6TA 4X1BA 3C31A 4ZEKA 1D9VA 4XF5A 5ITOA 4P1EA 4HE1A 1DBZA 1N84A 4AB6A 1GGGA 4HCYA 2P3VA 4MLQA 5A5XA 3PTYA 3MSTA 3DM0A 3VVFA 3UGWA 4RPOA 1N04A 5DEXB 1MPDA 5CMMA 1O7TA 4PE3A 1INPA 4N8YA 2O7UA 2Y7RA 3USDA 3MZ1A 3C32A 1SD3A 5I59B 4OA4A 2XXRA 2IA4A 1B0HA 2YJPA 1I6QA 1ANFA 3ZSFA 3ISPA 3TYHA 4RXLA 1WDNA 2XXKA 3U92A 1QKAA 3UN6A 1B1XA 1MQHA 1MY4A 4GWWA 2PCRA 1FPFA 1EYJA 1EH3A 1LBBA 1PB9A 3FVKA 3KSJA 2HHMA 1IITA 4OXVA 1B7ZA 2Q2CA 2XXPA 4G8MA 4GWZA 2VOZA 3VLVA 2P1SA 1MY3A 3H06B 3EF7A 1POY1 3TDJA 1D4NA 2CZLA 2X7QA 2YPNA 1LAHE 4O94A 3E9XA 4OFJA 2Y5LA 4QSEA 5CMBA 3W9VA 5H8NA 1FPKA 2H4IA 2CEYA 3VVEA 2H5YA 4YKJA 4N8GA 4U4XA 4F3GA 1NUXA 1NUZA 3I3VA 1B3HA 3K6WA 4ZZAA 3T22A 4PFYA 3K1MA 4H8IA 4YKKA 1URDA 5I5PA 4GBWA 2IEEA 2HFBA 5ITPA 1JVYA 5LOMA 2OPEA 5AA1A 2F5XA 4MH5A 4POXA 3KC0A 3HHFA 4PGNA 2G29A 3P7IA 2HPGA 3LUYA 3EHTA 1ZU0A 1R6ZA 4U1ZA 3PPNA 5DVIA 3DP8A 5CMKA 1Y1MA 4N91A 1A40A 4ISUA 3LV0A 1R9LA 5I59A 1NL5A 1NNFA 4N15A 4PCDA 2V3UA 2V84A 3E13X 4GD5A 2HCAA 2AL4A 2DXRA 2DE2A 5TP9A 4XKQA 4I3EA 3E79A 4DXUA 1YXIA 2D21A 3IOTA 1O63A 3O97A 4OFLA 1GTKA 1IXGA 3T9HB 5L9OA 4H5GA 2F6GA 3T93B 3MZBA 1FBHA 3I6VA 3SEXA 1LGBC 3TTRA 3MW0A 1UTBA 4JSOA 2AL5A 3K00A 2I58A 2LAOA 3SDFA 3OEMA 1B1HA 5FHNA 4DDDA 1MDP1 2RF1A 3O9PA 2Z8EA 1SYIA 2XX7A 4KHZE 1DPEA 4GIZA 1MY0A 4U21A 1FPJA 2FYIA 4QBAA 3TTMA 1FTOA 3T66A 2FNCA 2V3QA 4YB6A 2DVCA 1B32A 1Z7NE 2DQVA 1H43A 3RYDA 3H3GA 3ONMA 1P99A 4O8MA 3LSLA 2KQZA 1ELJA 4KI0E 4ZZEA 2XXQA 1Y9UA 2B4MA 4LQ5A 4C1TA 4YKIA 1B4HA 2DP8A 1XC1A 3E3KA 3GYYA 4G8HA 1AWBA 1LBWA 3TFLA 2UVGA 4F3BA 3PPRA 4P56A 5EYGA 3FXRA 4OHNA 4GXSB 4ZEBA 4GWYA 1QW0A 5KCJB 1NNTA 4QFOA 2XXYA 4IY6A 3DP4A 4UACA 1WVJA 3VVDA 3EQ1A 4OVSA 4ELOA 2YLNA 3QXMA 3D4GA 3PPOA 1EYIA 3KJTA 3QMFA 1XI6A 2QMWA 2UXAA 2HZLA 2ONRA 3UK4A 5EHMA 1FTAA 2DE4A 1B3LA 2UYFA 1N3XA 1H3DA 4MAGA 3OXNA 4LA9A 2CEXA 1DCUA 1USYH 1B52A 4I8CA 4H6DA 3G3HA 4KQPA 1NFTA 1WODA 4TOZA 5ESYA 2JJKA 1P1QA 2R8TA 2ANJA 1B5HA 4ECFA 3KOSA 1DTGA 1FPDA 2WEFA 3LUZA 2XXWA 3FJGA 2B65A 4MF3A 2PVUA 1QKBA 3QIMA 3BBRA 1JQFA 2Z22A 3A09A 4RA1A 2OZZA 1Y3QA 1TT1A 3IK6B 4NWCA 3V5AA 3IFAA 4E0XA 4R74A 3T9XB 5IZ1A 4N81A 2Z8DA 3TQWA 4GWXA 1BK4A 3IOVA 2UVHA 1NV6A 1M5FA 3M3FA 3ZKLA 5DYHA 3TMGA 3MPKA 2R6GE 2OJTA 4R75A 4NX1A 4R6HA 2F35A 1HSEA 3PU5A 4R2FA 5DT6A 4HXVA 4N4UA 2XX8A 3KSXA 5I56B 2F7BA 3EKIA 4X48A 5BUUA 1US4A 4LUBA 2Q74A 5ET8A 1N7XA 2X26A 2XWKA 4YB7A 4NF5A 4GQOA 4OEUA 2CZKA 5AA2B 4JVIA 5CC2A 3RTWB 1MG1A 4OYVA 1OLCA 3CI8A 1LFGA 3MQ9A 3LBSA 3IOWA 3JV9A 4NG7A 3QUFA 4GLIA 3OEKA 3QYTA 3FXBA 2PFZA 3PMWA 2P2AA 3M3KA 2FBPA 4HE0A 3TPAA 4PFTA 3MPLA 2UVIA 3FJMA 3N6TA 1KA1A 1MXXA 2BJJX 3GZGA 4C0RA 4G8NA 1FPEA 4MNCA 4H67A 5HBCA 3B6QA 3L6GA 1FTLA 3D1RA 5DW8A 1YCJA 3HSTA 3OO8A 5CM6A 1SQYA 2UVJA 4NN3A 4F2OA 5ICQA 5I57A 3CRBA 4PTKA 5IZ3B
chains in the Genus database with same CATH topology
2P3NA 3LV0A 5IGAA 4FBPA 4PFRA 4PDHA 3IFAA 5A5LA 4GX6A 5IZ1A 2HXRA 4P47A 2FIEA 4N6DA 4PF8A 4PGPA 1LBZA 2VPNA 4N15A 4N81A 4OVRA 2XWIA 4PCDA 4MCOA 4GWWA 2PCRA 1FPFA 3GYYA 4OVQA 4GWUA 4YZZA 4GWXA 1NV1A 1BK4A 2B4LA 1AWBA 2Q8MA 2DE2A 1EYJA 2DE3A 1LBWA 4OVTA 2BJIA 2ZZVA 4PAIA 4PFIA 1EYKA 4G61A 2HHMA 3KBZA 1NV6A 4I3EA 3RPLB 3T0JA 1FBDA 1KZ8A 1RDYA 3E79A 4N6KA 1NUWA 4P56A 5EYGA 4F1VA 1YXIA 4MNPA 1K9YA 5LTCA 4GWZA 2FIXA 1IMBA 1G0IA 1SPIA 1NV4A 1YYZA 5EYHA 2HZKA 2F3DA 2FVZA 5IZ3A 4P9KA 1FPIA 1FSAA 4P8BA 2QPQA 2VPOA 1IMDA 1NV7A 1IMEA 2CZHA 4GWYA 4QXDA 4H45A 5T3JA 5FBPA 2WX9A 2WYPA 4JVCA 4NX1A 4PC9A 5IZZA 5J1DA 2KR0A 1FPBA 4OVPA 2VT5A 3IFCA 5JK4A 4X04A 4HXVA 5EQ7A 1FBHA 4LN5A 4N4UA 3KC1A 4PETA 4O7IA 4M1VA 4X8RA 1FBFA 1FJ6A 4AS5A 5LDZA 4MJOA 4O94A 3EKIA 4OVSA 4XF5A 4F19A 2Y5LA 4P1EA 4GWSA 3W9VA 4HE1A 1DBZA 3MYUA 4PAFA 1QGXA 2Q74A 2Y5KA 1FBGA 1EYIA 5ET8A 1FBEA 1FPKA 4PF6A 2CEYA 5EQ9A 4NF0A 4I3YA 4H46A 4N17A 3QMFA 2P3VA 5EQAA 1XI6A 4PTKA 2XWKA 2V4CA 2L5VA 2HZLA 2XWOA 4O7MA 2CZKA 1KA0A 1LEVA 3B8BA 4N8GA 2GQ1A 2MKZA 3T1BA 1FTAA 4JVIA 2XWVA 3B50A 1NUXA 2DE4A 1FRPA 2ZZXA 4KXPA 4PAKA 1NUZA 4GX3A 3FBPA 3NOHA 3PTYA 1IMFA 5IM2A 4F18A 1CNQA 2QVRA 3MSTA 2QFLA 4XEQA 4OANA 3ROJA 1NUYA 4MAGA 2OWZA 2WBBA 4IR8A 5ET7A 3E78A 1RDZA 2CEXA 4XFEA 4NG7A 4I40A 4JVDA 5ET5A 1DCUA 1FPJA 2QVVA 4QBAA 3W9WA 4YICA 2WYKA 5I5PA 4GBWA 3FXBA 1FPLA 4HCWA 3A29A 1D9QA 1IMCA 2PFZA 4HCYA 4MIJA 4PE3A 1INPA 2FBPA 4HE0A 2V3QA 3U65A 4HE2A 4N8YA 3BIGA 5ESYA 3HFUA 2JJKA 4MHFA 2F5XA 4NQ8A 4X9TA 1LBVA 3SZPA 1NV5A 2R8TA 5I3SA 4MMPA 1G0HA 4PBHA 1FPGA 3BIHA 1RDXA 3KC0A 4MX6A 1KA1A 4PGNA 4P3LA 3CHGA 1DK4A 5F24A 3RYDA 4NHBA 4AS4A 4NGUA 4OA4A 4PDDA 1VDWA 1YZ0A 1FPDA 1LBYA 4F1UA 2FHYA 2WEFA 1FPEA 5EQ8A 2KQZA 2HPGA 4MNCA 4MNIA 4O8MA 4UABA 1JP4A 1LBXA 4NAPA 2XA5A 1NV3A 2CZIA 1IMAA 1FBPA 2DDKA 4PFBA 3LUZA 3ISPA 3D1RA 2PFYA 4PBQA 5DW8A 1NV0A 2ZZWA 4DI3D 5J16A 5CM6A 5I7IA 4NN3A 2F3BA 4GX4A 2XXKA 2DVZA 2Q9TA 2WBDA 2OX3A 4MEVA 4DI4B 2QVUA 2B4MA 1NV2A 1NI9A 3RPLA 1Q9DA 5ET6A 4N91A 1K9ZA 4P1LA 1FBCA 5IZ3B 1FJ9A 4GBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3N A;  3LV0 A;  4FBP A;  3IFA A;  5A5L A;  4GX6 A;  5IZ1 A;  2FIE A;  1LBZ A;  4N81 A;  4GWW A;  2PCR A;  1FPF A;  4GWU A;  4GWX A;  1NV1 A;  1BK4 A;  1AWB A;  2Q8M A;  1EYJ A;  1LBW A;  2BJI A;  1EYK A;  4G61 A;  2HHM A;  3KBZ A;  1NV6 A;  4I3E A;  3RPL B;  3T0J A;  1FBD A;  1KZ8 A;  1RDY A;  1NUW A;  5EYG A;  1YXI A;  1K9Y A;  4GWZ A;  2FIX A;  1IMB A;  1G0I A;  1SPI A;  1NV4 A;  1YYZ A;  5EYH A;  2F3D A;  2FVZ A;  5IZ3 A;  1FPI A;  1FSA A;  1IMD A;  1NV7 A;  1IME A;  2CZH A;  4GWY A;  4QXD A;  4H45 A;  5T3J A;  5FBP A;  1FPB A;  2VT5 A;  3IFC A;  4HXV A;  5EQ7 A;  1FBH A;  3KC1 A;  4O7I A;  1FBF A;  1FJ6 A;  4AS5 A;  5LDZ A;  4MJO A;  2Y5L A;  4GWS A;  4HE1 A;  1DBZ A;  1QGX A;  2Q74 A;  2Y5K A;  1FBG A;  1EYI A;  5ET8 A;  1FBE A;  1FPK A;  5EQ9 A;  4I3Y A;  4H46 A;  3QMF A;  2P3V A;  5EQA A;  1XI6 A;  4PTK A;  2CZK A;  1KA0 A;  1LEV A;  3B8B A;  2GQ1 A;  1FTA A;  1NUX A;  1FRP A;  4KXP A;  1NUZ A;  4GX3 A;  3FBP A;  1IMF A;  1CNQ A;  2QVR A;  2QFL A;  3ROJ A;  1NUY A;  2OWZ A;  2WBB A;  4IR8 A;  5ET7 A;  1RDZ A;  4I40 A;  5ET5 A;  1DCU A;  1FPJ A;  2QVV A;  4GBW A;  1FPL A;  3A29 A;  1D9Q A;  1IMC A;  1INP A;  2FBP A;  4HE0 A;  4HE2 A;  3BIG A;  5ESY A;  2JJK A;  1LBV A;  1NV5 A;  2R8T A;  5I3S A;  1G0H A;  1FPG A;  3BIH A;  1RDX A;  3KC0 A;  1KA1 A;  1DK4 A;  5F24 A;  3RYD A;  4AS4 A;  1VDW A;  1YZ0 A;  1FPD A;  1LBY A;  2FHY A;  2WEF A;  1FPE A;  5EQ8 A;  1JP4 A;  1LBX A;  1NV3 A;  2CZI A;  1IMA A;  1FBP A;  2DDK A;  3LUZ A;  3D1R A;  5DW8 A;  1NV0 A;  5J16 A;  2F3B A;  4GX4 A;  2WBD A;  2OX3 A;  2QVU A;  1NV2 A;  1NI9 A;  3RPL A;  1Q9D A;  5ET6 A;  1K9Z A;  1FBC A;  5IZ3 B;  1FJ9 A;  4GBV A; 
#chains in the Genus database with same CATH topology
 3OO9 A;  1LB9 A;  2Z8F A;  4XXU A;  5A5L A;  2FIE A;  1LBZ A;  3OEL A;  1FTJ A;  5CMC A;  4NTL A;  1M5E A;  3FVO A;  4YKP A;  3TEL A;  2XXI A;  4PAI A;  3E4R A;  1TXF A;  4NF6 B;  4F3P A;  2GFE A;  3MBP A;  4NF4 B;  2QRY A;  2QJE A;  5T3J A;  4MBP A;  3Q27 A;  1NNK A;  3OD7 A;  1MQI A;  1BTJ A;  4Q0C A;  3WAE A;  2VT5 A;  2Y7I A;  1FTK A;  4LAT A;  4LN5 A;  2ALU A;  1FJ6 A;  4JB7 A;  4MJO A;  1DMB A;  2DOJ A;  4NF6 A;  3K1N A;  3W15 C;  2HAU A;  4I3Y A;  4H46 A;  1H45 A;  1B5J A;  4O7M A;  4M4G A;  3KJ7 A;  1S9T A;  4NF8 B;  2VD3 A;  3C35 A;  2RCB A;  1FRP A;  4OMB A;  1AMF A;  3IB2 A;  4NED A;  4Z7E A;  1S7Y A;  1B3G A;  4ELP A;  5AA4 B;  2WBB A;  2VHA A;  3CIJ A;  1JEV A;  2WYK A;  4K3F A;  4NF5 B;  4HCW A;  1GR2 A;  4POW A;  3HCQ A;  1N3W A;  2PYY A;  3IO4 A;  3RTF B;  4IO7 A;  4X1D A;  1OVT A;  2DWH A;  3GXA A;  1NV3 A;  1IMA A;  4BDO A;  4DI3 D;  4BDM A;  1NV0 A;  1YAE A;  2ZYO A;  2XXU A;  5FTI A;  3IAZ A;  3OO7 A;  4KCD A;  4P1L A;  1Q9D A;  1POT A;  1FBC A;  3H6U A;  3ECR A;  1FCK A;  2D3I A;  1P1O A;  1I69 A;  3LC8 A;  5TU0 A;  3G3J A;  4YZZ A;  2THI A;  1N0T A;  2ZXT A;  3DEL B;  4ZE8 A;  4R6K A;  2H9B A;  5ICT A;  3BFU A;  1II5 A;  3S4U A;  4KYS A;  4QXD A;  1CB6 A;  5IZZ A;  3FXU A;  2GRV A;  4X8R A;  1PDA A;  3TQL A;  2NUV A;  2E0S A;  4DE8 A;  4Z0I A;  3MYU A;  4GL0 A;  4O3A A;  2F97 A;  3PUX E;  4N17 A;  1AIV A;  2MKZ A;  1B0L A;  4ZS9 A;  4R72 A;  1N76 A;  4F18 A;  3FBP A;  3IJO B;  2GH9 A;  1IMF A;  2NWJ A;  2F6P A;  3QSL A;  1TFA A;  3T96 B;  3SES A;  4P0G A;  1NUY A;  3O6I A;  3PUV E;  4TQU Q;  4F1Y A;  4F39 A;  3RT8 A;  4YIC A;  1PEB A;  4MIJ A;  1FQB A;  3ZKK A;  3MP8 A;  5JEI A;  4QF9 A;  4PBH A;  4LON B;  2A5T A;  3O6H A;  1LAF E;  5ISU A;  1YZ0 A;  1LBY A;  2FHY A;  1F9B A;  1BP5 A;  1MM6 A;  1B7H A;  1RYX A;  1IEJ A;  5L9S A;  1UIV A;  2WBD A;  2OX3 A;  4MEV A;  1KWH A;  4U22 A;  3SER A;  3UA8 A;  1GV8 A;  3CG1 A;  4IB2 A;  4F3S A;  1I6A A;  3OEN A;  3FZV A;  3RT6 B;  2V3T A;  3KOT A;  4PQJ A;  4MCO A;  2PT2 A;  1MXV A;  3LSW A;  1NV1 A;  3SEY A;  4BDN A;  2ZZV A;  5F1Q A;  1RKM A;  1KZ8 A;  5H8Q A;  1H76 A;  1YYZ A;  2REJ A;  3M3L A;  4P9K A;  4QFL A;  1LCF A;  4WED A;  4UA8 A;  3PUZ E;  2RCA A;  2WX9 A;  3BFT A;  4TLM B;  4LZ5 A;  4YAH X;  2Q89 A;  5CBR A;  1XOC A;  1IXH A;  2CMO A;  3MP1 A;  4AB5 A;  1SW4 A;  4GXA A;  1QGX A;  4NF0 A;  4QHQ A;  4ELQ A;  3H6W A;  2XWV A;  4QSD A;  3SKP A;  3GBB A;  3S2V A;  1ZMG A;  5TPA A;  1IIW A;  2ZYN A;  4H5F A;  1B4Z A;  2A5T B;  1IXI A;  2O51 A;  1JW5 A;  1BLF A;  1LBV A;  1LAG E;  4FE8 A;  5I84 A;  1FPG A;  1JET A;  1LLS A;  4NHB A;  3FJ7 A;  3TTL A;  1LBX A;  1AH5 A;  5HM4 B;  5JTY A;  4FED A;  4NWD A;  3UOR A;  2HQ0 A;  5ET6 A;  1SBP A;  3IR1 A;  5IGA A;  4FBP A;  1H44 A;  5FTH A;  3KZG A;  4PF8 A;  3IL1 B;  5I2N A;  4HS7 A;  3EHU A;  4Q5T A;  1LCT A;  3RPW A;  4YMA A;  1BIY A;  2DE3 A;  4RK9 A;  4IY5 A;  4EQB A;  3SEW A;  2W7Y A;  2VP1 A;  5H8Q B;  2F7A A;  4KR5 A;  1MM7 A;  2XXT A;  4JWO A;  5EHS A;  2NOO A;  1ZKB A;  3KBR A;  1QUK A;  5FHO A;  3U8Q A;  4JVC A;  3VLU A;  1UTH B;  5KCJ A;  4BDQ A;  2QS4 A;  3PUY E;  5JK4 A;  3SEV A;  5EQ7 A;  1MQG A;  1OVB A;  1A55 A;  4QFP A;  4P0I A;  4PE5 B;  3O28 A;  5AE4 A;  5I2K A;  4QRZ A;  3VXC A;  1MXU A;  5K2Y A;  4EF2 A;  3VDF A;  1US5 A;  3TCF A;  2XXV A;  4DI4 B;  1KA0 A;  3B50 A;  1AOV A;  1O64 A;  1B40 A;  2RIN A;  3F11 A;  3DLN A;  4OES A;  5H8H A;  3E78 A;  4H1X A;  2Y7P A;  3Q28 A;  2RC7 A;  2P0S A;  1NMU A;  4I9D A;  1MY2 A;  2DWI A;  1HSL A;  5EYF A;  1RDX A;  2Y7W A;  3H7M A;  4MX6 A;  4DCY A;  4EF1 A;  1MPC A;  4KYD A;  3HPI A;  2ONS A;  4DIG A;  2PFY A;  1LST A;  2ZZW A;  4PFW A;  5J16 A;  2QMX A;  3PPP A;  2Q9T A;  1A8E A;  4G77 A;  4OER A;  2XXH A;  1EZO A;  1NNP A;  4FAJ A;  2Q2A A;  4ONY A;  4P47 A;  1FTM A;  4PGP A;  1VE4 A;  4N07 A;  1VR5 A;  3KN3 A;  2Q8M A;  3L6H A;  1EYK A;  1FBD A;  2DS9 A;  1RDY A;  3IB0 A;  1NUW A;  1SVX B;  5FHM A;  4EUO A;  2HZK A;  4NMY A;  1G0I A;  1Y4C A;  3CR9 A;  3O2A A;  2ESN A;  3KN7 A;  1Y1Z A;  1NH8 A;  5L9M A;  3U1O A;  3ILU B;  1Z7M E;  2HEU A;  4O3C A;  4O7I A;  1B3E A;  3K6X A;  3SET A;  4FOR A;  4F19 A;  1AL3 A;  4PAF A;  4GWO A;  2Y5K A;  1YPN A;  4THI A;  5EQ9 A;  1FQF A;  3RN8 A;  2V4C A;  3FD3 A;  4IGR A;  2DWA A;  3G3G A;  3IO6 A;  4WEP A;  4BDR A;  2GHA A;  3TEP A;  3PD8 A;  5IM2 A;  2QVR A;  4IO2 A;  4XEQ A;  3GLB A;  5H8F A;  5IAI A;  4G2Z A;  4F2Q A;  4U1O A;  5H8H B;  4IR8 A;  1M5C A;  5ET5 A;  3EPE A;  1Y4T A;  3G7W A;  3A3U A;  5DTB A;  3B6T A;  4RNS A;  1NV5 A;  1LB8 A;  2Z23 A;  4G4P A;  3C33 A;  5EQ8 A;  4JDF A;  4ELR A;  2F7C A;  3OOA A;  2CZI A;  1SYH A;  3MVY A;  3TCH A;  4PBQ A;  1MH4 A;  2PBW A;  1OQH A;  1QVS A;  3U93 A;  4C1U A;  1IXC A;  4H65 A;  4OVJ A;  4E0W A;  3N6U A;  1FJ9 A;  3DP6 A;  4GBV A;  2P3N A;  4NF8 A;  3K02 A;  2XHD A;  3MAM A;  1B2H A;  1MS7 A;  2DXY A;  1SDX A;  5DEX A;  3FVG A;  3VV5 A;  4RJZ A;  3RLF E;  4KD5 A;  4RYA A;  3QAX A;  3Q26 A;  5LTC A;  1IUD A;  2FVZ A;  2QS2 A;  1XVX A;  1IMD A;  3FUZ A;  4KYE A;  4NE4 A;  2ZNU A;  4H0W A;  3TTK A;  2Q8J A;  4OVP A;  3G3K A;  2HAV A;  2WKY A;  1FBF A;  4JSD A;  1R1N A;  1XT8 A;  5L8D A;  3FVN A;  2F78 A;  4XIG Q;  4GL8 A;  4ZDM A;  4QFN A;  1OLA A;  3T1B A;  3CG3 A;  4MLV A;  2ZZX A;  3VE1 B;  2I6E A;  3C36 A;  1B5I A;  4OAN A;  1ZLQ A;  3TCG A;  1N7W A;  3VXB A;  4XFE A;  4I40 A;  2QVV A;  4OFO A;  1A54 A;  2Y7K A;  3PV0 E;  3TZA A;  1JW4 A;  4LZ7 A;  2XX9 A;  4P3L A;  4R2B A;  1A99 A;  2ZNT A;  4NGU A;  4AS4 A;  3MUQ A;  2X7P A;  1XHY A;  1PBP A;  1FW0 A;  4YU0 A;  3S9L C;  2O84 X;  1J1N A;  1ZIU A;  3H03 A;  4JWY A;  4KFQ A;  2R71 A;  3B6W A;  3S9N C;  2V25 A;  1QUL A;  1Q1K A;  1NV2 A;  3RPL A;  1MQD A;  4Q30 B;  3Q29 A;  4PFR A;  1RYO A;  4EDP A;  3MZ9 A;  4OVQ A;  3TUS A;  3FV2 A;  5KDT B;  4PP0 A;  5I58 B;  1EZP A;  1MDQ A;  4F22 A;  1UTB B;  4JXI A;  1NV4 A;  1SW2 A;  1LBC A;  5AA2 D;  2QPQ A;  2ONK E;  4ZEF A;  4GRK A;  5FBP A;  3KFM A;  3MVZ A;  2WYP A;  4LZ8 A;  4BDL A;  2I49 A;  1B3F A;  1NH7 A;  4EQ9 A;  1B9J A;  3HV1 A;  3IFC A;  3OMB A;  1SI0 A;  1JW1 A;  4X04 A;  4M1V A;  1DOT A;  4FEB A;  3KG2 A;  2A5S A;  2PT1 A;  1DPP A;  1FBG A;  4PF6 A;  1FBE A;  2H99 A;  4ESW A;  1VFE A;  1I6B A;  2I0B A;  3EHS A;  4OET A;  3MJN A;  1P1N A;  5BWJ A;  3ROJ A;  1ZJL A;  5ET7 A;  3TTN A;  2OPD A;  4ESX A;  4IO4 A;  5M2V A;  3FAS A;  2REG A;  3IOR A;  1IMC A;  3IJX B;  2I4C A;  2XD3 A;  1A8F A;  1VFD A;  2OK2 A;  3PMX A;  5ELV A;  3IB1 A;  2ZMB A;  4UAB A;  3SEU A;  2XD2 A;  1B7U A;  3K6U A;  1QUI A;  5K2X A;  3V89 B;  5I58 A;  3O6G A;  3JYR A;  4ND9 A;  4FAT A;  1JNF A;  1Y20 A;  4PDH A;  5CRY A;  2XXX A;  4KCC A;  4I62 A;  3PMV A;  1UIU A;  5DVJ A;  4GWU A;  3HHG A;  2QS3 A;  3RPL B;  4RY1 A;  3K01 A;  1MY1 A;  3RNN A;  1K9Y A;  5EYH A;  1SPI A;  1SW5 A;  2FA7 A;  3M8U A;  1CE2 A;  4P8B A;  2VPO A;  1OQG A;  1NV7 A;  5H8F B;  4WKM A;  3BKI B;  3FXQ A;  1SW1 A;  3CSG A;  2I48 A;  2H98 A;  2O6A A;  2O69 A;  1OIB A;  4HW8 A;  5KDT A;  3KN8 A;  2Y84 A;  4G68 B;  4FIM A;  3RQT A;  2ZYK A;  4G68 C;  5HPQ A;  3CFZ A;  1T0K A;  5EQA A;  1USY E;  3B8B A;  1TFD A;  4KXP A;  1NKX A;  1Y3N A;  3OSQ A;  4PAK A;  4L17 A;  3FV1 A;  4GFR A;  2NXO A;  1LAX A;  1SI1 A;  1RDZ A;  3JZJ A;  5TP9 B;  2DWJ A;  3CVG A;  3FGS A;  4DZ1 A;  3O29 A;  1PB7 A;  4EXL A;  3BIG A;  2VGQ A;  4MHF A;  4X9T A;  4R73 A;  1G0H A;  1QUJ A;  4RK2 A;  3CSB A;  4FEC A;  4ZEC A;  5F24 A;  5I2N B;  3OSR A;  5DVF A;  1P1U A;  3CFX A;  4XTC Q;  2DDK A;  3MWB A;  5F7V A;  4JWX A;  1HSJ A;  1S50 A;  5B7D A;  3H6V A;  4R9G A;  2GHB A;  2HXR A;  3IX1 A;  3LSX A;  3H4Z A;  4OTE A;  2BJI A;  5CBS A;  4G61 A;  3FAT A;  3KBZ A;  4NF4 A;  4R9F A;  3HN0 A;  4FJP A;  4TLL B;  2FIX A;  1D9Y A;  2V93 A;  2I3V A;  5IZ3 A;  2DSF A;  5A5X B;  3T9V A;  2PMS A;  2QL3 A;  1MH3 A;  5H8S A;  4P11 A;  1TWY A;  1FPB A;  4ZED A;  2OLB A;  1IQ7 A;  3D4C A;  3O66 A;  3KC1 A;  3QK6 A;  4AS5 A;  5LDZ A;  2PX1 A;  3ZS6 A;  4QFK A;  5I2K B;  3VLW A;  4LVQ A;  4YB5 A;  2QS1 A;  2B3F A;  2GQ1 A;  1BKA A;  1GVC A;  1MXZ A;  4OQO A;  4N6P A;  2VD2 A;  5KZT A;  4G68 A;  2OWZ A;  2F34 A;  4ZEI A;  2B3B A;  5AA4 A;  3G3F A;  4IO5 A;  3A29 A;  2M8C A;  3U65 A;  3CFL A;  1B51 A;  4ZE9 A;  1MXY A;  4NQ8 A;  1B58 A;  3B7D A;  3S9M C;  4XKR A;  3RUM A;  3FIR A;  1M5B A;  3CHG A;  1VDW A;  1FQD A;  3AXF A;  1EU8 A;  3K6V A;  1JP4 A;  4NAP A;  2ABH A;  4GF8 A;  1FBP A;  3MC2 A;  1A7L A;  1B05 A;  4GX4 A;  4N13 A;  1FQC A;  3C34 A;  4OWD A;  1NI9 A;  2AYS A;  2HXW A;  3MVW A;  4GX6 A;  1XVY A;  2O1L A;  2VPN A;  4OVR A;  4PFU A;  3IOU A;  3UIF A;  4OVT A;  5I56 A;  5I57 B;  3KGC A;  4H8J A;  4F1V A;  3N94 A;  3V83 A;  3MVX A;  1YTV A;  1DSN A;  4H45 A;  2RC9 A;  4HTG A;  5J1D A;  3K1P A;  2KR0 A;  3TOD A;  3C4M A;  4U4S A;  4PET A;  3ODB A;  1FQA A;  1MPB A;  4DCX A;  4IGT A;  2F36 A;  1PC3 A;  3Q25 A;  3U72 A;  1LEV A;  1ZBM A;  4GX3 A;  3NOH A;  3EN3 A;  2OWT A;  1CNQ A;  3T9U A;  2QFL A;  4OZ9 A;  3R26 A;  1ZTY A;  4RPN A;  3MP6 A;  2QSX A;  4JVD A;  3W9W A;  3TKD A;  1D9Q A;  5IKB A;  3RY3 A;  1R9Q A;  3HO7 A;  3OO6 A;  3GBA A;  4EQ7 A;  4HE2 A;  3HFU A;  4QSC A;  4KPT A;  3SZP A;  3PPQ A;  1MQJ A;  1FQE A;  1OMP A;  3K0V A;  3PUW E;  1DK4 A;  4PDD A;  3THI A;  1Y3P A;  2Q88 A;  4DLD A;  4MNI A;  1UTH A;  3A3C A;  1VSO A;  2XA5 A;  4PFB A;  2OBG A;  5JTY B;  3K4U A;  2NVU B;  2O1M A;  4IO3 A;  2F3B A;  3KEI A;  4Q8R A;  1K9Z A;  4BLA A;  4LP2 B;  2D5W A;  5AA2 A;  2DYX A;  4XKP A;  3PD9 A;  4N6D A;  1JVX A;  5CI5 A;  2ZYM A;  5AA3 A;  2B4L A;  4PFI A;  4IO6 A;  4GOT A;  3T0J A;  4N6K A;  1PBQ A;  4JBZ A;  4U2R A;  4MNP A;  4MFI A;  1LFI A;  4GVO A;  2F3D A;  1UQW A;  3R6U A;  1FSA A;  3TAJ A;  2O7I A;  1IME A;  1MXW A;  3S9E A;  1Q35 A;  3LR1 A;  4OEV A;  3K2D A;  4GWS A;  2KLF A;  2F8D A;  2I3W A;  1URG A;  4XKN A;  2XWO A;  2L5V A;  2ZNS A;  3LSF B;  1LFH A;  3UP9 A;  4AQ4 A;  3I5O A;  4F31 B;  4U23 A;  3VFJ A;  3N5L A;  1L5T A;  4O3B A;  2I4B A;  1FPL A;  3G3I A;  1QJM A;  4I1D A;  3ILT B;  1XS5 A;  5B70 A;  4DXC A;  5I3S A;  4MMP A;  3BIH A;  3U94 A;  3PGF A;  4F1U A;  4EXK A;  1PB8 A;  2G93 A;  4OEN A;  1ATG A;  1M5D A;  2RC8 A;  2AIX A;  4R6Y A;  1DTZ A;  3C9H A;  3V8X B;  5I7I A;  1URS A;  2DVZ A;  1B6H A;  2H25 A;  2QVU A;  3R7X A;  3QUJ A;  2R9J A;  2UYE A;  4DXB A;  2OWS A;  3WAF A;  2XWI A;  1P1W A;  4WXJ A;  1MRP A;  4LQ2 A;  4YMB A;  2E1S A;  5H8N B;  1B46 A;  2OCU A;  3N26 A;  1D3K A;  1IMB A;  5TPA B;  2RKM A;  1FPI A;  2I0C A;  2CZH A;  3RGY A;  4PC9 A;  1JEU A;  4F29 A;  1IZ1 A;  2O68 A;  1EZ9 A;  3H6T A;  4X1B A;  3C31 A;  4ZEK A;  1D9V A;  4XF5 A;  5ITO A;  4P1E A;  4HE1 A;  1DBZ A;  1N84 A;  4AB6 A;  1GGG A;  4HCY A;  2P3V A;  4MLQ A;  5A5X A;  3PTY A;  3MST A;  3DM0 A;  3VVF A;  3UGW A;  4RPO A;  1N04 A;  5DEX B;  1MPD A;  5CMM A;  1O7T A;  4PE3 A;  1INP A;  4N8Y A;  2O7U A;  2Y7R A;  3USD A;  3MZ1 A;  3C32 A;  1SD3 A;  5I59 B;  4OA4 A;  2XXR A;  2IA4 A;  1B0H A;  2YJP A;  1I6Q A;  1ANF A;  3ZSF A;  3ISP A;  3TYH A;  4RXL A;  1WDN A;  2XXK A;  3U92 A;  1QKA A;  3UN6 A;  1B1X A;  1MQH A;  1MY4 A;  4GWW A;  2PCR A;  1FPF A;  1EYJ A;  1EH3 A;  1LBB A;  1PB9 A;  3FVK A;  3KSJ A;  2HHM A;  1IIT A;  4OXV A;  1B7Z A;  2Q2C A;  2XXP A;  4G8M A;  4GWZ A;  2VOZ A;  3VLV A;  2P1S A;  1MY3 A;  3H06 B;  3EF7 A;  1POY 1;  3TDJ A;  1D4N A;  2CZL A;  2X7Q A;  2YPN A;  1LAH E;  4O94 A;  3E9X A;  4OFJ A;  2Y5L A;  4QSE A;  5CMB A;  3W9V A;  5H8N A;  1FPK A;  2H4I A;  2CEY A;  3VVE A;  2H5Y A;  4YKJ A;  4N8G A;  4U4X A;  4F3G A;  1NUX A;  1NUZ A;  3I3V A;  1B3H A;  3K6W A;  4ZZA A;  3T22 A;  4PFY A;  3K1M A;  4H8I A;  4YKK A;  1URD A;  5I5P A;  4GBW A;  2IEE A;  2HFB A;  5ITP A;  1JVY A;  5LOM A;  2OPE A;  5AA1 A;  2F5X A;  4MH5 A;  4POX A;  3KC0 A;  3HHF A;  4PGN A;  2G29 A;  3P7I A;  2HPG A;  3LUY A;  3EHT A;  1ZU0 A;  1R6Z A;  4U1Z A;  3PPN A;  5DVI A;  3DP8 A;  5CMK A;  1Y1M A;  4N91 A;  1A40 A;  4ISU A;  3LV0 A;  1R9L A;  5I59 A;  1NL5 A;  1NNF A;  4N15 A;  4PCD A;  2V3U A;  2V84 A;  3E13 X;  4GD5 A;  2HCA A;  2AL4 A;  2DXR A;  2DE2 A;  5TP9 A;  4XKQ A;  4I3E A;  3E79 A;  4DXU A;  1YXI A;  2D21 A;  3IOT A;  1O63 A;  3O97 A;  4OFL A;  1GTK A;  1IXG A;  3T9H B;  5L9O A;  4H5G A;  2F6G A;  3T93 B;  3MZB A;  1FBH A;  3I6V A;  3SEX A;  1LGB C;  3TTR A;  3MW0 A;  1UTB A;  4JSO A;  2AL5 A;  3K00 A;  2I58 A;  2LAO A;  3SDF A;  3OEM A;  1B1H A;  5FHN A;  4DDD A;  1MDP 1;  2RF1 A;  3O9P A;  2Z8E A;  1SYI A;  2XX7 A;  4KHZ E;  1DPE A;  4GIZ A;  1MY0 A;  4U21 A;  1FPJ A;  2FYI A;  4QBA A;  3TTM A;  1FTO A;  3T66 A;  2FNC A;  2V3Q A;  4YB6 A;  2DVC A;  1B32 A;  1Z7N E;  2DQV A;  1H43 A;  3RYD A;  3H3G A;  3ONM A;  1P99 A;  4O8M A;  3LSL A;  2KQZ A;  1ELJ A;  4KI0 E;  4ZZE A;  2XXQ A;  1Y9U A;  2B4M A;  4LQ5 A;  4C1T A;  4YKI A;  1B4H A;  2DP8 A;  1XC1 A;  3E3K A;  3GYY A;  4G8H A;  1AWB A;  1LBW A;  3TFL A;  2UVG A;  4F3B A;  3PPR A;  4P56 A;  5EYG A;  3FXR A;  4OHN A;  4GXS B;  4ZEB A;  4GWY A;  1QW0 A;  5KCJ B;  1NNT A;  4QFO A;  2XXY A;  4IY6 A;  3DP4 A;  4UAC A;  1WVJ A;  3VVD A;  3EQ1 A;  4OVS A;  4ELO A;  2YLN A;  3QXM A;  3D4G A;  3PPO A;  1EYI A;  3KJT A;  3QMF A;  1XI6 A;  2QMW A;  2UXA A;  2HZL A;  2ONR A;  3UK4 A;  5EHM A;  1FTA A;  2DE4 A;  1B3L A;  2UYF A;  1N3X A;  1H3D A;  4MAG A;  3OXN A;  4LA9 A;  2CEX A;  1DCU A;  1USY H;  1B52 A;  4I8C A;  4H6D A;  3G3H A;  4KQP A;  1NFT A;  1WOD A;  4TOZ A;  5ESY A;  2JJK A;  1P1Q A;  2R8T A;  2ANJ A;  1B5H A;  4ECF A;  3KOS A;  1DTG A;  1FPD A;  2WEF A;  3LUZ A;  2XXW A;  3FJG A;  2B65 A;  4MF3 A;  2PVU A;  1QKB A;  3QIM A;  3BBR A;  1JQF A;  2Z22 A;  3A09 A;  4RA1 A;  2OZZ A;  1Y3Q A;  1TT1 A;  3IK6 B;  4NWC A;  3V5A A;  3IFA A;  4E0X A;  4R74 A;  3T9X B;  5IZ1 A;  4N81 A;  2Z8D A;  3TQW A;  4GWX A;  1BK4 A;  3IOV A;  2UVH A;  1NV6 A;  1M5F A;  3M3F A;  3ZKL A;  5DYH A;  3TMG A;  3MPK A;  2R6G E;  2OJT A;  4R75 A;  4NX1 A;  4R6H A;  2F35 A;  1HSE A;  3PU5 A;  4R2F A;  5DT6 A;  4HXV A;  4N4U A;  2XX8 A;  3KSX A;  5I56 B;  2F7B A;  3EKI A;  4X48 A;  5BUU A;  1US4 A;  4LUB A;  2Q74 A;  5ET8 A;  1N7X A;  2X26 A;  2XWK A;  4YB7 A;  4NF5 A;  4GQO A;  4OEU A;  2CZK A;  5AA2 B;  4JVI A;  5CC2 A;  3RTW B;  1MG1 A;  4OYV A;  1OLC A;  3CI8 A;  1LFG A;  3MQ9 A;  3LBS A;  3IOW A;  3JV9 A;  4NG7 A;  3QUF A;  4GLI A;  3OEK A;  3QYT A;  3FXB A;  2PFZ A;  3PMW A;  2P2A A;  3M3K A;  2FBP A;  4HE0 A;  3TPA A;  4PFT A;  3MPL A;  2UVI A;  3FJM A;  3N6T A;  1KA1 A;  1MXX A;  2BJJ X;  3GZG A;  4C0R A;  4G8N A;  1FPE A;  4MNC A;  4H67 A;  5HBC A;  3B6Q A;  3L6G A;  1FTL A;  3D1R A;  5DW8 A;  1YCJ A;  3HST A;  3OO8 A;  5CM6 A;  1SQY A;  2UVJ A;  4NN3 A;  4F2O A;  5ICQ A;  5I57 A;  3CRB A;  4PTK A;  5IZ3 B; 
#chains in the Genus database with same CATH homology
 2P3N A;  3LV0 A;  5IGA A;  4FBP A;  4PFR A;  4PDH A;  3IFA A;  5A5L A;  4GX6 A;  5IZ1 A;  2HXR A;  4P47 A;  2FIE A;  4N6D A;  4PF8 A;  4PGP A;  1LBZ A;  2VPN A;  4N15 A;  4N81 A;  4OVR A;  2XWI A;  4PCD A;  4MCO A;  4GWW A;  2PCR A;  1FPF A;  3GYY A;  4OVQ A;  4GWU A;  4YZZ A;  4GWX A;  1NV1 A;  1BK4 A;  2B4L A;  1AWB A;  2Q8M A;  2DE2 A;  1EYJ A;  2DE3 A;  1LBW A;  4OVT A;  2BJI A;  2ZZV A;  4PAI A;  4PFI A;  1EYK A;  4G61 A;  2HHM A;  3KBZ A;  1NV6 A;  4I3E A;  3RPL B;  3T0J A;  1FBD A;  1KZ8 A;  1RDY A;  3E79 A;  4N6K A;  1NUW A;  4P56 A;  5EYG A;  4F1V A;  1YXI A;  4MNP A;  1K9Y A;  5LTC A;  4GWZ A;  2FIX A;  1IMB A;  1G0I A;  1SPI A;  1NV4 A;  1YYZ A;  5EYH A;  2HZK A;  2F3D A;  2FVZ A;  5IZ3 A;  4P9K A;  1FPI A;  1FSA A;  4P8B A;  2QPQ A;  2VPO A;  1IMD A;  1NV7 A;  1IME A;  2CZH A;  4GWY A;  4QXD A;  4H45 A;  5T3J A;  5FBP A;  2WX9 A;  2WYP A;  4JVC A;  4NX1 A;  4PC9 A;  5IZZ A;  5J1D A;  2KR0 A;  1FPB A;  4OVP A;  2VT5 A;  3IFC A;  5JK4 A;  4X04 A;  4HXV A;  5EQ7 A;  1FBH A;  4LN5 A;  4N4U A;  3KC1 A;  4PET A;  4O7I A;  4M1V A;  4X8R A;  1FBF A;  1FJ6 A;  4AS5 A;  5LDZ A;  4MJO A;  4O94 A;  3EKI A;  4OVS A;  4XF5 A;  4F19 A;  2Y5L A;  4P1E A;  4GWS A;  3W9V A;  4HE1 A;  1DBZ A;  3MYU A;  4PAF A;  1QGX A;  2Q74 A;  2Y5K A;  1FBG A;  1EYI A;  5ET8 A;  1FBE A;  1FPK A;  4PF6 A;  2CEY A;  5EQ9 A;  4NF0 A;  4I3Y A;  4H46 A;  4N17 A;  3QMF A;  2P3V A;  5EQA A;  1XI6 A;  4PTK A;  2XWK A;  2V4C A;  2L5V A;  2HZL A;  2XWO A;  4O7M A;  2CZK A;  1KA0 A;  1LEV A;  3B8B A;  4N8G A;  2GQ1 A;  2MKZ A;  3T1B A;  1FTA A;  4JVI A;  2XWV A;  3B50 A;  1NUX A;  2DE4 A;  1FRP A;  2ZZX A;  4KXP A;  4PAK A;  1NUZ A;  4GX3 A;  3FBP A;  3NOH A;  3PTY A;  1IMF A;  5IM2 A;  4F18 A;  1CNQ A;  2QVR A;  3MST A;  2QFL A;  4XEQ A;  4OAN A;  3ROJ A;  1NUY A;  4MAG A;  2OWZ A;  2WBB A;  4IR8 A;  5ET7 A;  3E78 A;  1RDZ A;  2CEX A;  4XFE A;  4NG7 A;  4I40 A;  4JVD A;  5ET5 A;  1DCU A;  1FPJ A;  2QVV A;  4QBA A;  3W9W A;  4YIC A;  2WYK A;  5I5P A;  4GBW A;  3FXB A;  1FPL A;  4HCW A;  3A29 A;  1D9Q A;  1IMC A;  2PFZ A;  4HCY A;  4MIJ A;  4PE3 A;  1INP A;  2FBP A;  4HE0 A;  2V3Q A;  3U65 A;  4HE2 A;  4N8Y A;  3BIG A;  5ESY A;  3HFU A;  2JJK A;  4MHF A;  2F5X A;  4NQ8 A;  4X9T A;  1LBV A;  3SZP A;  1NV5 A;  2R8T A;  5I3S A;  4MMP A;  1G0H A;  4PBH A;  1FPG A;  3BIH A;  1RDX A;  3KC0 A;  4MX6 A;  1KA1 A;  4PGN A;  4P3L A;  3CHG A;  1DK4 A;  5F24 A;  3RYD A;  4NHB A;  4AS4 A;  4NGU A;  4OA4 A;  4PDD A;  1VDW A;  1YZ0 A;  1FPD A;  1LBY A;  4F1U A;  2FHY A;  2WEF A;  1FPE A;  5EQ8 A;  2KQZ A;  2HPG A;  4MNC A;  4MNI A;  4O8M A;  4UAB A;  1JP4 A;  1LBX A;  4NAP A;  2XA5 A;  1NV3 A;  2CZI A;  1IMA A;  1FBP A;  2DDK A;  4PFB A;  3LUZ A;  3ISP A;  3D1R A;  2PFY A;  4PBQ A;  5DW8 A;  1NV0 A;  2ZZW A;  4DI3 D;  5J16 A;  5CM6 A;  5I7I A;  4NN3 A;  2F3B A;  4GX4 A;  2XXK A;  2DVZ A;  2Q9T A;  2WBD A;  2OX3 A;  4MEV A;  4DI4 B;  2QVU A;  2B4M A;  1NV2 A;  1NI9 A;  3RPL A;  1Q9D A;  5ET6 A;  4N91 A;  1K9Z A;  4P1L A;  1FBC A;  5IZ3 B;  1FJ9 A;  4GBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...