3T0JA

Crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
266
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNLTPNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of inositol monophosphatase - II from Staphylococcus aureus MSSA476
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 83
structure length 266
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3t0jA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t0jA02
1K9ZA 5I3SA 1FBCA 1IMFA 1QGXA 5LDZA 2FVZA 2QVRA 4I3EA 5FBPA 4GWXA 1RDZA 2R8TA 1YYZA 1VDWA 1EYIA 1DBZA 1NV0A 2WBDA 3BIGA 3RPLA 5J16A 4GWZA 3LUZA 3IFCA 1FBFA 4O7IA 5IZ3A 2FIXA 4PTKA 1INPA 1LEVA 2F3BA 2FIEA 4GX6A 1IMEA 5EQ8A 1NV6A 1YZ0A 1NUYA 5IZ1A 1EYKA 2QVVA 4AS5A 1NV7A 1FJ9A 1KA1A 1NV3A 1Q9DA 1FBHA 2Y5KA 4GBWA 1RDYA 1FSAA 3LV0A 1FPDA 3A29A 2HHMA 3FBPA 1DK4A 2P3VA 1K9YA 3KBZA 1IMAA 1RDXA 4HE2A 1BK4A 1FPGA 4N81A 4H46A 2Q8MA 5ET7A 2GQ1A 5ESYA 5A5LA 1AWBA 2CZKA 1FPBA 4GBVA 2CZHA 5EQ7A 1LBVA 3KC0A 4IR8A 3IFAA 1G0HA 2DDKA 2VT5A 4MJOA 1G0IA 1FBPA 1SPIA 2P3NA 1FBEA 1YXIA 1JP4A 1IMBA 3KC1A 1FJ6A 3BIHA 1KZ8A 4QXDA 1XI6A 4AS4A 1IMDA 5DW8A 1FPFA 1NV4A 2BJIA 5T3JA 1FPLA 1NUXA 5ET5A 4GWYA 4I3YA 2WEFA 3T0JA 2JJKA 1FTAA 1CNQA 1NUZA 4GX4A 1NV2A 1LBXA 4HXVA 1NUWA 5EQ9A 4GWSA 2WBBA 1NI9A 2OWZA 5IZ3B 4GWWA 1FBDA 1FPIA 1D9QA 1LBYA 2F3DA 4G61A 5EYHA 5F24A 4HE0A 3QMFA 4KXPA 3ROJA 1EYJA 2QVUA 5ET6A 2Y5LA 1NV5A 2PCRA 4I40A 1LBZA 2Q74A 1IMCA 4GWUA 1NV1A 1DCUA 3B8BA 1FPEA 3RYDA 5EYGA 1FPKA 4H45A 2FBPA 1LBWA 5EQAA 2OX3A 4FBPA 2CZIA 4GX3A 1FRPA 1FPJA 5ET8A 4HE1A 3RPLB 3D1RA 1KA0A 1FBGA 2FHYA 2QFLA
chains in the Genus database with same CATH superfamily
4IGTA 4GWXA 4PFUA 1NV0A 3TQWA 4QFPA 5H8FB 4M4GA 1LAGE 4I62A 4N07A 1MXVA 4FIMA 3UA8A 5AA2D 4R9FA 1LSTA 1FQEA 4NGUA 1NV7A 1B1HA 1ZBMA 2O1LA 4OXVA 1RDYA 4JSOA 5DEXA 4EQ7A 4N6KA 2O51A 2PT1A 4BDQA 3BKIB 4RXLA 2XXYA 4FAJA 1B7ZA 3LUYA 3IX1A 1O64A 5AA4B 1A54A 3UORA 4OHNA 3SZPA 1DSNA 4NHBA 2Z8EA 3KC0A 4OMBA 4MJOA 4DI4B 4NE4A 2Y84A 1POTA 4XEQA 4GXAA 2XWKA 3M3FA 1MXWA 2L5VA 4PAIA 1PDAA 3CSBA 3FVOA 5T3JA 2REJA 3CFZA 3DELB 4U22A 3MZ9A 4GIZA 1CNQA 1Y1MA 3PUXE 5I2NB 4GWSA 2F7AA 1NNTA 3PMXA 1D9QA 2ZZVA 4RNSA 2LAOA 2VPNA 3N26A 5LTCA 3O9PA 5EHMA 4C0RA 1II5A 2W7YA 4BDMA 1JW5A 1NH7A 1A7LA 1USYH 2XD3A 3O66A 1FPEA 2ZYOA 1OLCA 1MH3A 2ALUA 3G7WA 2QRYA 4Z7EA 2HAUA 3ZSFA 3WAFA 4N17A 1M5DA 5I3SA 1QGXA 4I3EA 3K1PA 5CC2A 2XXWA 5K2YA 3TZAA 1YYZA 3V5AA 3PUWE 4POXA 1OLAA 3LBSA 3Q25A 2VPOA 2QMXA 3V89B 4XXUA 4JDFA 1URSA 3H6VA 3BFTA 1NUYA 5IZ1A 4DLDA 4EQBA 3RN8A 3TODA 1KA1A 1HSLA 4LP2B 4JVCA 1LLSA 3I6VA 4P56A 1WODA 4WEDA 4YZZA 2ZXTA 4JWXA 2WYKA 1IMAA 2CEXA 1IITA 1BK4A 2HZLA 4OESA 3TCGA 2B3BA 4F22A 5H8FA 2XXIA 4MF3A 3OELA 2Q2CA 4F2QA 1YXIA 3TTKA 4XKNA 1Y3PA 3H6UA 3KC1A 5B70A 4ZS9A 2A5SA 3RTFB 3S9MC 1H43A 4PF6A 5CBSA 5K2XA 1WDNA 2PT2A 2AL4A 3MQ9A 3IJXB 1MQDA 4PFIA 4F29A 2QS3A 4NTLA 2H5YA 4Q30B 5CBRA 1NI9A 4P8BA 2DWJA 4TLLB 3G3IA 4X1DA 2PCRA 5AA4A 3G3JA 4LATA 4X1BA 3U93A 4GOTA 5EYGA 5EQAA 3OEMA 2DYXA 3IR1A 4NF8B 3RPLB 3IFAA 2QFLA 1P1UA 4KYEA 3SEYA 5CI5A 3OO9A 3PGFA 3Q27A 2XWVA 2FA7A 1RDZA 3Q26A 1VDWA 3CI8A 3MAMA 2CMOA 3CVGA 5I2NA 1PB9A 2PMSA 4GF8A 2RC9A 4KFQA 2XXTA 4P0IA 2QS4A 3JYRA 3K6UA 3VV5A 4FEDA 4YB6A 2ZYNA 3UP9A 3KJTA 2B4LA 1MY1A 2ZNTA 3LV0A 1N7XA 1PB8A 1DK4A 2P3VA 1PB7A 1OQHA 1LB9A 5AA1A 1L5TA 3N5LA 1Y1ZA 1A8FA 1MPDA 1FPBA 2HXWA 2F97A 4IR8A 1G0HA 2VT5A 4F31B 4OEVA 3IB1A 4RPNA 2P2AA 1KZ8A 1B5IA 3EPEA 2UVGA 5L9SA 2XA5A 3G3KA 1FPLA 3FXQA 4OVJA 1QJMA 2JJKA 1AMFA 1OQGA 2XX7A 2OWZA 1B4ZA 5I58B 1FBDA 5DTBA 2HEUA 3LC8A 4MNPA 3NOHA 1D9YA 4FJPA 4ELPA 4QFOA 3RYDA 1MH4A 2FBPA 1FTOA 3O6HA 3CFLA 1K9ZA 1YTVA 1FBCA 3IB0A 1OVTA 4P1LA 5AA2B 1XOCA 3IOWA 2WBDA 3LUZA 4F19A 4O7IA 4L17A 2FIEA 1N04A 4PQJA 4LQ5A 1IIWA 2QVVA 3TFLA 2Z8FA 4Q0CA 3W9WA 2H98A 1D9VA 4N13A 4HCYA 3T96B 4NF8A 3A3CA 1FPGA 1ZMGA 1TFDA 5ET7A 3RUMA 3USDA 4JVDA 3RNNA 2X26A 3OO8A 4G2ZA 4OFJA 1ZTYA 1G0IA 1FBPA 2Y7PA 5IAIA 5LOMA 3BIHA 1XI6A 2ONSA 3DP4A 4XKQA 5L9OA 4EXLA 3VLVA 1QULA 4NAPA 2XX8A 4P47A 4HXVA 1FQCA 3MVWA 3KOSA 3CSGA 4IB2A 4BLAA 5IZ3B 4OQOA 4ZEBA 3C33A 4HE0A 2D5WA 4G68C 2O69A 3U94A 4RYAA 2OCUA 3W15C 3E13X 3TDJA 1LBCA 1YAEA 2I49A 4MEVA 3O6GA 1IXHA 3R26A 5FTHA 3H7MA 4LUBA 2Q8JA 3TQLA 1ZIUA 1ANFA 3OD7A 5JK4A 1A55A 4GRKA 4PE5B 1TT1A 1S7YA 3U1OA 2ABHA 4FATA 1B0HA 1DBZA 2IA4A 3IFCA 3VXBA 5I58A 3B6WA 1MG1A 3K4UA 5I59B 3TUSA 1XC1A 2ZNUA 4PAFA 5AE4A 5EQ8A 1NKXA 1NNFA 1PC3A 1FJ9A 5ITOA 4NG7A 1VFDA 3TTLA 5H8SA 3H4ZA 1LAXA 4FORA 1NNKA 1M5FA 1UTBB 3KBZA 2R71A 4PFBA 3FVNA 5AA2A 2GQ1A 1MPBA 4QFKA 4F3PA 3SKPA 1LBVA 1US4A 3PMVA 4MH5A 1NMUA 2G93A 3W9VA 3HN0A 3PMWA 1SBPA 3OXNA 2XXVA 2I48A 1JEVA 5FHNA 3FVKA 1NUZA 4GX4A 4K3FA 2GFEA 5H8QB 4YB7A 5F24A 3OOAA 2ZYMA 2OZZA 1FCKA 4O94A 1MQJA 4I40A 4KR5A 1NV1A 4JWOA 4WKMA 3IORA 2F6PA 1B3HA 3BIGA 1FBGA 4DXBA 1IMFA 4PCDA 3EQ1A 1URDA 5AA3A 4PE3A 3IO6A 2DE3A 2D3IA 1SW2A 2I4CA 1MPCA 4LZ8A 5IZ3A 1B3LA 3KBRA 5I56B 5EHSA 1WVJA 1LEVA 2QJEA 4UACA 4GX6A 1IMEA 1DPPA 5M2VA 2I3WA 3ZKKA 3OSRA 1YCJA 5HM4B 1H76A 1CE2A 2UXAA 4P3LA 4O3BA 3UK4A 3OO6A 4ZEFA 2F6GA 4R74A 4N81A 1DMBA 2QPQA 1ZLQA 2GHBA 3CR9A 1NNPA 2F8DA 5H8HB 3L6GA 2V3TA 4EQ9A 5IKBA 5I59A 4OVQA 4XIGQ 2B3FA 3SERA 3O97A 2V93A 2KQZA 2VHAA 3ISPA 4AS4A 4I8CA 3N6TA 2HFBA 3K1MA 1ATGA 2XX9A 3QUJA 4IY6A 1JQFA 1FTAA 4JVIA 4Z0IA 4PETA 1UTBA 1BP5A 3MYUA 1LBYA 3ECRA 2DXYA 4EUOA 3ROJA 3VE1B 1LBZA 4F2OA 1EZPA 4FECA 3KOTA 3GBBA 2YPNA 1N0TA 3FASA 2CZIA 2O6AA 4OEUA 2UVJA 4HCWA 4N6DA 3FV1A 1NFTA 3T93B 1S50A 1PBQA 4ISUA 1LAHE 3VXCA 1LBBA 2DE4A 3QAXA 1MY4A 1VSOA 5H8QA 2DP8A 2RF1A 2QL3A 4DCYA 5HBCA 1FTKA 3G3HA 4E0XA 4WXJA 3KN7A 3U92A 4ZEDA 3S4UA 3MVXA 4WEPA 3TCFA 2DVCA 3WAEA 1FSAA 1MS7A 3A29A 3IL1B 1EZOA 4OFOA 4G68A 3KFMA 4PP0A 1NH8A 1UTHA 4IY5A 4YMAA 5EQ7A 1N3WA 5IM2A 4IO4A 2F78A 1MXUA 4GL8A 3E4RA 1MDQA 5I56A 1SDXA 1N7WA 1A99A 1Y20A 1EU8A 1D4NA 2F34A 3KSJA 4U4SA 5I57B 5JEIA 3FATA 1FPFA 3RGYA 4O3AA 2RKMA 1Z7NE 4MX6A 1Y3QA 3FIRA 3PUYE 2OWTA 4GWWA 4LVQA 3L6HA 4QF9A 4PFRA 2Y5LA 3TMGA 4U1OA 1SD3A 2HPGA 5F7VA 1GR2A 2Y7KA 1FQFA 3MP8A 5H8HA 3RY3A 3DP8A 2OX3A 4LZ7A 3Q29A 1FRPA 2NVUB 4NX1A 4HE1A 4R73A 5TPAA 2FHYA 1QUIA 3LSXA 1I6BA 2OPDA 3MPLA 1TXFA 5CMKA 3A09A 3FZVA 4RJZA 3HPIA 3VVDA 2DXRA 2Z23A 4PTKA 4PFYA 1JVXA 3RLFE 2HCAA 3S2VA 3MBPA 2NXOA 4R6YA 4NF5B 4X04A 3PD9A 1LFGA 3K02A 3IB2A 3UN6A 2OLBA 4ND9A 2R9JA 4IO6A 2G29A 5I5PA 4YKJA 1P1OA 3T1BA 5I84A 5ICTA 4E0WA 2I3VA 1ZJLA 4U4XA 4OVSA 1I6QA 2F5XA 3C9HA 5ESYA 3PPOA 1N84A 5A5LA 2NUVA 1RKMA 2Q88A 1BLFA 1I6AA 4TLMB 1HSEA 1QUKA 3OEKA 4MFIA 4P0GA 4F3BA 5CMBA 1TFAA 3ILUB 5DVFA 1FJ6A 2QS1A 3ZKLA 2FYIA 4MMPA 4BDOA 1NV4A 2OWSA 3IJOB 2RCBA 5ET5A 3E79A 2WEFA 3T0JA 4H6DA 1DTGA 2HXRA 4YICA 1J1NA 5EYHA 5ET6A 1SYHA 4X8RA 4MLQA 2V3UA 1VE4A 1QUJA 5F1QA 2HQ0A 1AOVA 3QUFA 1IEJA 4N8GA 4OENA 5I57A 3HV1A 3ZS6A 3U8QA 2ZMBA 1B6HA 2OK2A 4P1EA 4RPOA 2XXQA 2B65A 4KCCA 5HPQA 1B32A 4PGNA 1LCTA 2VD2A 4QSCA 5J16A 1B3GA 1MY3A 3K1NA 3K00A 2ESNA 3T9HB 4JSDA 4OANA 1LAFE 1OVBA 3PUZE 1POY1 4QSEA 2UVHA 4GBWA 3V83A 5TP9A 4BDRA 2VOZA 1B2HA 1FTJA 1RDXA 3CFXA 1H44A 4MNIA 4H8JA 4BDLA 4KCDA 2THIA 1JP4A 2DE2A 3OO7A 4NF5A 3PPNA 4QXDA 5I7IA 1MXYA 5DYHA 1US5A 4POWA 5ICQA 3SEVA 4UABA 1MXXA 4I3YA 1B52A 2Y7RA 3D4CA 1Y3NA 1LCFA 3FXRA 1AIVA 2O68A 3C31A 4X48A 1SI0A 2Q89A 4QRZA 3MUQA 3GZGA 5IGAA 1QW0A 4ESWA 2Q2AA 3QIMA 4H45A 4AB5A 3N6UA 2XXHA 1OMPA 3H06B 3QXMA 2XXKA 1AH5A 1R9LA 2RINA 4O8MA 2R8TA 1EYIA 3B7DA 4XTCQ 1JETA 3HHGA 1DOTA 4F18A 1INPA 2NOOA 4ONYA 1RYXA 4MIJA 4R6KA 1FQAA 1NV3A 1JEUA 1A8EA 1R9QA 1QKAA 1SI1A 3KZGA 1FPDA 4U23A 2H25A 2UVIA 1MDP1 4F1UA 2PBWA 1Z7ME 2QS2A 2XHDA 2F36A 2Q8MA 1M5CA 2YLNA 1B46A 3VVFA 3M3LA 2CZHA 3FJGA 3LSWA 1R6ZA 2H99A 4QSDA 3MC2A 4EXKA 1VFEA 3IOVA 1N3XA 1FTMA 2I0BA 1B9JA 2IEEA 4XFEA 3V8XB 4MBPA 1YPNA 4ZZAA 3LSLA 3VDFA 4ZEKA 4G8NA 1NV2A 1LBXA 1HSJA 4O7MA 2NWJA 1LFHA 2V3QA 4IO7A 1H3DA 1B7UA 1IQ7A 3ILTB 1MY0A 4GWOA 4ESXA 4PC9A 2WX9A 1PEBA 3GBAA 4YB5A 4G77A 2RC7A 3KG2A 3EHSA 2RCAA 3G3GA 4GX3A 4U2RA 4JXIA 4NMYA 1R1NA 4HW8A 3D1RA 4BDNA 3K6XA 5IZZA 2QSXA 4ZECA 2PFZA 3OMBA 4MNCA 1O63A 2X7PA 2ZYKA 2M8CA 3SEUA 3TTNA 3CG3A 2F7BA 4YKPA 4NWCA 1T0KA 1B58A 1NV6A 1IXGA 5JTYB 4PBHA 2F7CA 5I2KB 4G68B 4QHQA 4XKPA 1UTHB 4NF6A 1B7HA 4NEDA 3THIA 4DZ1A 4OERA 1SQYA 2PFYA 3KJ7A 4HE2A 3C34A 3E78A 3RTWB 4FEBA 4YKKA 2HAVA 3B6TA 3T9VA 2DDKA 3TYHA 5L9MA 2P3NA 3N94A 4F3GA 4XKRA 5A5XB 1P1QA 4N91A 4ZDMA 1GV8A 1NUXA 4GWYA 1XS5A 2KR0A 3EKIA 3H3GA 3H6TA 3PD8A 2XWIA 3JZJA 5EQ9A 2Z22A 3PPRA 4YU0A 1SW5A 3TTRA 2P0SA 4RK9A 4PDHA 3HO7A 4H5FA 4PBQA 4R75A 2Y7WA 4OETA 5TPAB 3PPQA 3TELA 3O2AA 3B8BA 1Y4TA 2XXUA 3SEXA 3M3KA 4GXSB 3IK6B 3FD3A 3GXAA 3JV9A 3PPPA 1MRPA 4DDDA 5ITPA 4GFRA 2O7UA 2VD3A 3CG1A 3EN3A 4GL0A 1IXIA 5EYFA 1Q35A 3T66A 2PYYA 1JW4A 4N8YA 1Q9DA 3SETA 1B4HA 4KPTA 1AL3A 1B3FA 2MKZA 1SVXB 3FBPA 1N76A 2DWHA 5CMMA 1MXZA 3S9LC 4G4PA 3HHFA 2CZKA 3MP1A 3K2DA 1SYIA 3DLNA 1Q1KA 5ISUA 3IAZA 4DXUA 1SW4A 3I5OA 3FV2A 5JTYA 2H9BA 3OSQA 3T9XB 2AIXA 2XWOA 5I2KA 4N15A 3EHTA 4RK2A 5J1DA 2UYFA 2V4CA 3M8UA 3KGCA 2RC8A 3HSTA 3H6WA 1P1NA 4G61A 3E9XA 3FXBA 3FXUA 3FUZA 3MPKA 2XXPA 1NV5A 2A5TB 4R2BA 3B6QA 4DCXA 3T22A 3R7XA 5CMCA 1FPKA 1LBWA 4F3SA 3Q28A 2AL5A 1XVYA 1XT8A 1D3KA 2X7QA 5A5XA 4OWDA 1O7TA 2OPEA 5FBPA 3FJ7A 2XXRA 1B51A 4LQ2A 4ELQA 4AQ4A 3C36A 4MCOA 1FW0A 2DWIA 4PGPA 1FBFA 3K6WA 3QYTA 5FHMA 2F3BA 4KYDA 5TP9B 3IOUA 3G3FA 1BTJA 1S9TA 2KLFA 3KSXA 4TOZA 3TEPA 4HS7A 1UIVA 5KDTB 3QSLA 2XXXA 4F1VA 3O6IA 2XD2A 5CRYA 1IZ1A 4GBVA 2HZKA 3O28A 2O7IA 3P7IA 3EF7A 4GLIA 3TKDA 4XF5A 4HTGA 4TQUQ 2UYEA 4U1ZA 4LZ5A 1IMBA 5TU0A 1B40A 1NL5A 5DW8A 3LR1A 3S9NC 1DPEA 4JWYA 2Y7IA 4P9KA 4NWDA 2ONKE 3RPWA 4F1YA 3QK6A 1EZ9A 3FGSA 1FPIA 4H8IA 4N6PA 4ZZEA 3QMFA 1EYJA 2R6GE 1SW1A 3MSTA 1IMCA 1XVXA 2P1SA 3AXFA 4PF8A 1DCUA 1FQDA 1USYE 3UGWA 2OJTA 4DXCA 5DVJA 2I4BA 3MP6A 1ZKBA 4RY1A 3TCHA 4YKIA 4GWUA 4EF2A 2GRVA 5LDZA 2ZNSA 3VLWA 4U21A 4NF0A 1B05A 3TTMA 3ODBA 3T9UA 2B4MA 3U65A 1LGBC 4OTEA 4GQOA 1CB6A 2DS9A 3TPAA 4UA8A 3TAJA 2CZLA 4O3CA 3CIJA 3MJNA 2WKYA 2A5TA 4OZ9A 5KCJB 1EYKA 4AS5A 3K6VA 4X9TA 4N4UA 1DTZA 4F39A 3KEIA 4KYSA 1FBHA 4GD5A 1GVCA 1H45A 3ONMA 1B3EA 1I69A 5DT6A 5KZTA 2PVUA 4I9DA 2V84A 3CHGA 3HCQA 4IO5A 3MZBA 5CM6A 1EH3A 3S9EA 2QMWA 2BJJX 1P99A 4OA4A 1B5HA 4QBAA 3U72A 3PUVE 2BJIA 2I58A 3KN8A 2DSFA 2ANJA 3A3UA 5KDTA 1NUWA 4G8MA 4G8HA 1BIYA 2DVZA 4NF4B 1MQGA 2QVUA 4MLVA 2O1MA 1Y9UA 2Q74A 5B7DA 2OBGA 3VLUA 4THIA 1FPJA 4LONB 5DVIA 4IGRA 1A40A 2YJPA 4RA1A 2E1SA 3C35A 1IUDA 3RPLA 1UIUA 4OVTA 3GLBA 2FIXA 4NN3A 2F35A 3SEWA 4QFNA 1PBPA 2GH9A 4NQ8A 3H03A 4JBZA 4NF6B 4JB7A 4PFTA 3B50A 1LFIA 4DE8A 2VGQA 4H65A 1MQIA 5H8NB 2Y5KA 2FNCA 1GGGA 2Q9TA 3PV0E 4OFLA 2HHMA 3GYYA 3DM0A 2E0SA 4ZE9A 4OVPA 3OENA 2O84X 3E3KA 1B1XA 4H46A 2CEYA 4ELOA 5FTIA 4MAGA 4Q5TA 4R2FA 4PAKA 4MHFA 4AB6A 3MVYA 4IO2A 3KN3A 1SPIA 1QKBA 3O29A 5BUUA 3VVEA 4LA9A 5KCJA 1XHYA 1IMDA 2DOJA 4H67A 4C1TA 2VP1A 4R6HA 3K0VA 4FE8A 1FQBA 2I6EA 1IXCA 5BWJA 4OVRA 2ZZXA 2WBBA 1MM7A 3K01A 2F3DA 3C32A 3D4GA 3I3VA 1M5BA 3DP6A 1B0LA 5L8DA 3F11A 4ZE8A 3VFJA 1UQWA 4LN5A 4ZEIA 3FVGA 1VR5A 5DEXB 3MZ1A 5ET8A 2ZZWA 3SESA 1KA0A 4H1XA 2FVZA 2QVRA 1MQHA 3PTYA 3C4MA 3MVZA 2DQVA 1KWHA 1Y4CA 4DIGA 4PDDA 2AYSA 3IO4A 1P1WA 3RQTA 4GWZA 1JW1A 1JNFA 4NF4A 5FHOA 1ELJA 1OIBA 4R72A 1YZ0A 1RYOA 3MW0A 4EDPA 3FJMA 4PFWA 1MY2A 2DWAA 4KI0E 1F9BA 2D21A 1M5EA 3BFUA 1K9YA 4H5GA 4M1VA 4Q8RA 3HFUA 3LSFB 1AWBA 2I0CA 1B5JA 2ONRA 1MM6A 3BBRA 3EHUA 3SDFA 2REGA 1GTKA 1LB8A 4QFLA 4EF1A 1FBEA 4YMBA 2WYPA 3RT6B 4P11A 1URGA 1TWYA 2PX1A 2H4IA 1QVSA 4KHZE 2V25A 5H8NA 4IO3A 4R9GA 4KQPA 3RT8A 4YAHX 4KD5A 4DI3D 3CRBA 1FTLA 2GHAA 4I1DA 4KXPA 4ECFA 3PU5A 1ZU0A 4GVOA 5ELVA 2Z8DA 1BKAA 4FBPA 1JVYA 3R6UA 3UIFA 4C1UA 4H0WA 3IOTA 3MWBA 4ELRA 4OYVA
chains in the Genus database with same CATH topology
5FBPA 4P1EA 4GWXA 1DBZA 4MCOA 1NV0A 4PGNA 4PGPA 5J16A 3IFCA 1FBFA 2F3BA 4PAFA 5EQ8A 4NGUA 4OANA 1NV7A 1FJ9A 4NG7A 4GBWA 1RDYA 4N6KA 3KBZA 1RDXA 4F1VA 4PFBA 2GQ1A 3SZPA 4GBVA 4NHBA 4MNIA 2HZKA 1LBVA 3KC0A 4MJOA 4XF5A 4DI4B 4XEQA 1JP4A 1IMBA 2XWKA 2DE2A 2L5VA 4QXDA 4PAIA 5I7IA 5DW8A 3W9VA 5T3JA 4UABA 4I3YA 4P9KA 1CNQA 1NUZA 4GX4A 4GWSA 1FPIA 1D9QA 2ZZVA 5F24A 2VPNA 3QMFA 4O94A 1EYJA 3MSTA 4I40A 5LTCA 1IMCA 1NV1A 4PF8A 1DCUA 1FPEA 5IGAA 4H45A 2XXKA 3BIGA 4GWUA 1FBGA 4N17A 5I3SA 1QGXA 1IMFA 5LDZA 4PCDA 4I3EA 4O8MA 2R8TA 1YYZA 1EYIA 4NF0A 4PE3A 2DE3A 2VPOA 2B4MA 3U65A 5IZ3A 4F18A 1INPA 1LEVA 4GX6A 1IMEA 4MIJA 1NUYA 5IZ1A 1EYKA 4AS5A 4X9TA 4N4UA 1KA1A 1NV3A 1FBHA 4JVCA 1FPDA 4P3LA 4P56A 4YZZA 2WYKA 1IMAA 4F1UA 2CEXA 1BK4A 2HZLA 3CHGA 4N81A 2Q8MA 2QPQA 2CZHA 5CM6A 1YXIA 4OA4A 4OVQA 4QBAA 3KC1A 2KQZA 3ISPA 4AS4A 4XFEA 2BJIA 4PF6A 1FTAA 4PFIA 1NV2A 1LBXA 4O7MA 4JVIA 1NUWA 4PETA 2DVZA 1NI9A 3MYUA 2V3QA 1LBYA 4P8BA 3ROJA 2QVUA 2PCRA 1LBZA 2Q74A 4PC9A 2WX9A 5EYGA 5EQAA 2CZIA 4GX3A 1FPJA 3RPLB 3D1RA 3IFAA 2QFLA 4HCWA 5IZZA 4N6DA 2XWVA 1RDZA 2PFZA 1VDWA 4MNCA 2DE4A 3RPLA 4OVTA 2FIXA 4NN3A 4NQ8A 1NV6A 3B50A 4PBHA 2Y5KA 2B4LA 2Q9TA 1FSAA 3LV0A 3A29A 2HHMA 3GYYA 1DK4A 2P3VA 4OVPA 2PFYA 4HE2A 3E78A 4H46A 2CEYA 4MAGA 1FPBA 4PAKA 4MHFA 5EQ7A 5IM2A 4IR8A 1G0HA 2DDKA 2VT5A 1SPIA 2P3NA 4N91A 1KZ8A 1IMDA 1FPFA 2XA5A 1FPLA 1NUXA 4GWYA 2KR0A 3EKIA 2JJKA 4MX6A 4OVRA 2XWIA 5EQ9A 2ZZXA 2WBBA 2OWZA 4GWWA 1FBDA 2F3DA 4PDHA 4PBQA 4PFRA 2Y5LA 4MNPA 3NOHA 2HPGA 3B8BA 3RYDA 4LN5A 2FBPA 2OX3A 1FRPA 4NX1A 5ET8A 2ZZWA 4HE1A 1KA0A 2FHYA 1K9ZA 1FBCA 4P1LA 2FVZA 2QVRA 3PTYA 4PDDA 2WBDA 4GWZA 3LUZA 4F19A 4O7IA 4PTKA 2FIEA 4X04A 1YZ0A 2QVVA 4N8YA 3W9WA 1Q9DA 5I5PA 3T1BA 2MKZA 4HCYA 3FBPA 1K9YA 4OVSA 1FPGA 4M1VA 2F5XA 3HFUA 5ET7A 5ESYA 5A5LA 1AWBA 2CZKA 4JVDA 1G0IA 1FBPA 1FBEA 2WYPA 1FJ6A 3BIHA 1XI6A 4MMPA 1NV4A 5ET5A 3E79A 2XWOA 4N15A 2WEFA 3T0JA 4NAPA 5J1DA 4P47A 4HXVA 2HXRA 2V4CA 4YICA 5IZ3B 4G61A 5EYHA 3FXBA 4DI3D 4HE0A 4KXPA 5ET6A 1NV5A 4X8RA 4MEVA 1FPKA 1LBWA 4FBPA 4N8GA 5JK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9Z A;  5I3S A;  1FBC A;  1IMF A;  1QGX A;  5LDZ A;  2FVZ A;  2QVR A;  4I3E A;  5FBP A;  4GWX A;  1RDZ A;  2R8T A;  1YYZ A;  1VDW A;  1EYI A;  1DBZ A;  1NV0 A;  2WBD A;  3BIG A;  3RPL A;  5J16 A;  4GWZ A;  3LUZ A;  3IFC A;  1FBF A;  4O7I A;  5IZ3 A;  2FIX A;  4PTK A;  1INP A;  1LEV A;  2F3B A;  2FIE A;  4GX6 A;  1IME A;  5EQ8 A;  1NV6 A;  1YZ0 A;  1NUY A;  5IZ1 A;  1EYK A;  2QVV A;  4AS5 A;  1NV7 A;  1FJ9 A;  1KA1 A;  1NV3 A;  1Q9D A;  1FBH A;  2Y5K A;  4GBW A;  1RDY A;  1FSA A;  3LV0 A;  1FPD A;  3A29 A;  2HHM A;  3FBP A;  1DK4 A;  2P3V A;  1K9Y A;  3KBZ A;  1IMA A;  1RDX A;  4HE2 A;  1BK4 A;  1FPG A;  4N81 A;  4H46 A;  2Q8M A;  5ET7 A;  2GQ1 A;  5ESY A;  5A5L A;  1AWB A;  2CZK A;  1FPB A;  4GBV A;  2CZH A;  5EQ7 A;  1LBV A;  3KC0 A;  4IR8 A;  3IFA A;  1G0H A;  2DDK A;  2VT5 A;  4MJO A;  1G0I A;  1FBP A;  1SPI A;  2P3N A;  1FBE A;  1YXI A;  1JP4 A;  1IMB A;  3KC1 A;  1FJ6 A;  3BIH A;  1KZ8 A;  4QXD A;  1XI6 A;  4AS4 A;  1IMD A;  5DW8 A;  1FPF A;  1NV4 A;  2BJI A;  5T3J A;  1FPL A;  1NUX A;  5ET5 A;  4GWY A;  4I3Y A;  2WEF A;  3T0J A;  2JJK A;  1FTA A;  1CNQ A;  1NUZ A;  4GX4 A;  1NV2 A;  1LBX A;  4HXV A;  1NUW A;  5EQ9 A;  4GWS A;  2WBB A;  1NI9 A;  2OWZ A;  5IZ3 B;  4GWW A;  1FBD A;  1FPI A;  1D9Q A;  1LBY A;  2F3D A;  4G61 A;  5EYH A;  5F24 A;  4HE0 A;  3QMF A;  4KXP A;  3ROJ A;  1EYJ A;  2QVU A;  5ET6 A;  2Y5L A;  1NV5 A;  2PCR A;  4I40 A;  1LBZ A;  2Q74 A;  1IMC A;  4GWU A;  1NV1 A;  1DCU A;  3B8B A;  1FPE A;  3RYD A;  5EYG A;  1FPK A;  4H45 A;  2FBP A;  1LBW A;  5EQA A;  2OX3 A;  4FBP A;  2CZI A;  4GX3 A;  1FRP A;  1FPJ A;  5ET8 A;  4HE1 A;  3RPL B;  3D1R A;  1KA0 A;  1FBG A;  2FHY A;  2QFL A; 
#chains in the Genus database with same CATH topology
 4IGT A;  4GWX A;  4PFU A;  1NV0 A;  3TQW A;  4QFP A;  5H8F B;  4M4G A;  1LAG E;  4I62 A;  4N07 A;  1MXV A;  4FIM A;  3UA8 A;  5AA2 D;  4R9F A;  1LST A;  1FQE A;  4NGU A;  1NV7 A;  1B1H A;  1ZBM A;  2O1L A;  4OXV A;  1RDY A;  4JSO A;  5DEX A;  4EQ7 A;  4N6K A;  2O51 A;  2PT1 A;  4BDQ A;  3BKI B;  4RXL A;  2XXY A;  4FAJ A;  1B7Z A;  3LUY A;  3IX1 A;  1O64 A;  5AA4 B;  1A54 A;  3UOR A;  4OHN A;  3SZP A;  1DSN A;  4NHB A;  2Z8E A;  3KC0 A;  4OMB A;  4MJO A;  4DI4 B;  4NE4 A;  2Y84 A;  1POT A;  4XEQ A;  4GXA A;  2XWK A;  3M3F A;  1MXW A;  2L5V A;  4PAI A;  1PDA A;  3CSB A;  3FVO A;  5T3J A;  2REJ A;  3CFZ A;  3DEL B;  4U22 A;  3MZ9 A;  4GIZ A;  1CNQ A;  1Y1M A;  3PUX E;  5I2N B;  4GWS A;  2F7A A;  1NNT A;  3PMX A;  1D9Q A;  2ZZV A;  4RNS A;  2LAO A;  2VPN A;  3N26 A;  5LTC A;  3O9P A;  5EHM A;  4C0R A;  1II5 A;  2W7Y A;  4BDM A;  1JW5 A;  1NH7 A;  1A7L A;  1USY H;  2XD3 A;  3O66 A;  1FPE A;  2ZYO A;  1OLC A;  1MH3 A;  2ALU A;  3G7W A;  2QRY A;  4Z7E A;  2HAU A;  3ZSF A;  3WAF A;  4N17 A;  1M5D A;  5I3S A;  1QGX A;  4I3E A;  3K1P A;  5CC2 A;  2XXW A;  5K2Y A;  3TZA A;  1YYZ A;  3V5A A;  3PUW E;  4POX A;  1OLA A;  3LBS A;  3Q25 A;  2VPO A;  2QMX A;  3V89 B;  4XXU A;  4JDF A;  1URS A;  3H6V A;  3BFT A;  1NUY A;  5IZ1 A;  4DLD A;  4EQB A;  3RN8 A;  3TOD A;  1KA1 A;  1HSL A;  4LP2 B;  4JVC A;  1LLS A;  3I6V A;  4P56 A;  1WOD A;  4WED A;  4YZZ A;  2ZXT A;  4JWX A;  2WYK A;  1IMA A;  2CEX A;  1IIT A;  1BK4 A;  2HZL A;  4OES A;  3TCG A;  2B3B A;  4F22 A;  5H8F A;  2XXI A;  4MF3 A;  3OEL A;  2Q2C A;  4F2Q A;  1YXI A;  3TTK A;  4XKN A;  1Y3P A;  3H6U A;  3KC1 A;  5B70 A;  4ZS9 A;  2A5S A;  3RTF B;  3S9M C;  1H43 A;  4PF6 A;  5CBS A;  5K2X A;  1WDN A;  2PT2 A;  2AL4 A;  3MQ9 A;  3IJX B;  1MQD A;  4PFI A;  4F29 A;  2QS3 A;  4NTL A;  2H5Y A;  4Q30 B;  5CBR A;  1NI9 A;  4P8B A;  2DWJ A;  4TLL B;  3G3I A;  4X1D A;  2PCR A;  5AA4 A;  3G3J A;  4LAT A;  4X1B A;  3U93 A;  4GOT A;  5EYG A;  5EQA A;  3OEM A;  2DYX A;  3IR1 A;  4NF8 B;  3RPL B;  3IFA A;  2QFL A;  1P1U A;  4KYE A;  3SEY A;  5CI5 A;  3OO9 A;  3PGF A;  3Q27 A;  2XWV A;  2FA7 A;  1RDZ A;  3Q26 A;  1VDW A;  3CI8 A;  3MAM A;  2CMO A;  3CVG A;  5I2N A;  1PB9 A;  2PMS A;  4GF8 A;  2RC9 A;  4KFQ A;  2XXT A;  4P0I A;  2QS4 A;  3JYR A;  3K6U A;  3VV5 A;  4FED A;  4YB6 A;  2ZYN A;  3UP9 A;  3KJT A;  2B4L A;  1MY1 A;  2ZNT A;  3LV0 A;  1N7X A;  1PB8 A;  1DK4 A;  2P3V A;  1PB7 A;  1OQH A;  1LB9 A;  5AA1 A;  1L5T A;  3N5L A;  1Y1Z A;  1A8F A;  1MPD A;  1FPB A;  2HXW A;  2F97 A;  4IR8 A;  1G0H A;  2VT5 A;  4F31 B;  4OEV A;  3IB1 A;  4RPN A;  2P2A A;  1KZ8 A;  1B5I A;  3EPE A;  2UVG A;  5L9S A;  2XA5 A;  3G3K A;  1FPL A;  3FXQ A;  4OVJ A;  1QJM A;  2JJK A;  1AMF A;  1OQG A;  2XX7 A;  2OWZ A;  1B4Z A;  5I58 B;  1FBD A;  5DTB A;  2HEU A;  3LC8 A;  4MNP A;  3NOH A;  1D9Y A;  4FJP A;  4ELP A;  4QFO A;  3RYD A;  1MH4 A;  2FBP A;  1FTO A;  3O6H A;  3CFL A;  1K9Z A;  1YTV A;  1FBC A;  3IB0 A;  1OVT A;  4P1L A;  5AA2 B;  1XOC A;  3IOW A;  2WBD A;  3LUZ A;  4F19 A;  4O7I A;  4L17 A;  2FIE A;  1N04 A;  4PQJ A;  4LQ5 A;  1IIW A;  2QVV A;  3TFL A;  2Z8F A;  4Q0C A;  3W9W A;  2H98 A;  1D9V A;  4N13 A;  4HCY A;  3T96 B;  4NF8 A;  3A3C A;  1FPG A;  1ZMG A;  1TFD A;  5ET7 A;  3RUM A;  3USD A;  4JVD A;  3RNN A;  2X26 A;  3OO8 A;  4G2Z A;  4OFJ A;  1ZTY A;  1G0I A;  1FBP A;  2Y7P A;  5IAI A;  5LOM A;  3BIH A;  1XI6 A;  2ONS A;  3DP4 A;  4XKQ A;  5L9O A;  4EXL A;  3VLV A;  1QUL A;  4NAP A;  2XX8 A;  4P47 A;  4HXV A;  1FQC A;  3MVW A;  3KOS A;  3CSG A;  4IB2 A;  4BLA A;  5IZ3 B;  4OQO A;  4ZEB A;  3C33 A;  4HE0 A;  2D5W A;  4G68 C;  2O69 A;  3U94 A;  4RYA A;  2OCU A;  3W15 C;  3E13 X;  3TDJ A;  1LBC A;  1YAE A;  2I49 A;  4MEV A;  3O6G A;  1IXH A;  3R26 A;  5FTH A;  3H7M A;  4LUB A;  2Q8J A;  3TQL A;  1ZIU A;  1ANF A;  3OD7 A;  5JK4 A;  1A55 A;  4GRK A;  4PE5 B;  1TT1 A;  1S7Y A;  3U1O A;  2ABH A;  4FAT A;  1B0H A;  1DBZ A;  2IA4 A;  3IFC A;  3VXB A;  5I58 A;  3B6W A;  1MG1 A;  3K4U A;  5I59 B;  3TUS A;  1XC1 A;  2ZNU A;  4PAF A;  5AE4 A;  5EQ8 A;  1NKX A;  1NNF A;  1PC3 A;  1FJ9 A;  5ITO A;  4NG7 A;  1VFD A;  3TTL A;  5H8S A;  3H4Z A;  1LAX A;  4FOR A;  1NNK A;  1M5F A;  1UTB B;  3KBZ A;  2R71 A;  4PFB A;  3FVN A;  5AA2 A;  2GQ1 A;  1MPB A;  4QFK A;  4F3P A;  3SKP A;  1LBV A;  1US4 A;  3PMV A;  4MH5 A;  1NMU A;  2G93 A;  3W9V A;  3HN0 A;  3PMW A;  1SBP A;  3OXN A;  2XXV A;  2I48 A;  1JEV A;  5FHN A;  3FVK A;  1NUZ A;  4GX4 A;  4K3F A;  2GFE A;  5H8Q B;  4YB7 A;  5F24 A;  3OOA A;  2ZYM A;  2OZZ A;  1FCK A;  4O94 A;  1MQJ A;  4I40 A;  4KR5 A;  1NV1 A;  4JWO A;  4WKM A;  3IOR A;  2F6P A;  1B3H A;  3BIG A;  1FBG A;  4DXB A;  1IMF A;  4PCD A;  3EQ1 A;  1URD A;  5AA3 A;  4PE3 A;  3IO6 A;  2DE3 A;  2D3I A;  1SW2 A;  2I4C A;  1MPC A;  4LZ8 A;  5IZ3 A;  1B3L A;  3KBR A;  5I56 B;  5EHS A;  1WVJ A;  1LEV A;  2QJE A;  4UAC A;  4GX6 A;  1IME A;  1DPP A;  5M2V A;  2I3W A;  3ZKK A;  3OSR A;  1YCJ A;  5HM4 B;  1H76 A;  1CE2 A;  2UXA A;  4P3L A;  4O3B A;  3UK4 A;  3OO6 A;  4ZEF A;  2F6G A;  4R74 A;  4N81 A;  1DMB A;  2QPQ A;  1ZLQ A;  2GHB A;  3CR9 A;  1NNP A;  2F8D A;  5H8H B;  3L6G A;  2V3T A;  4EQ9 A;  5IKB A;  5I59 A;  4OVQ A;  4XIG Q;  2B3F A;  3SER A;  3O97 A;  2V93 A;  2KQZ A;  2VHA A;  3ISP A;  4AS4 A;  4I8C A;  3N6T A;  2HFB A;  3K1M A;  1ATG A;  2XX9 A;  3QUJ A;  4IY6 A;  1JQF A;  1FTA A;  4JVI A;  4Z0I A;  4PET A;  1UTB A;  1BP5 A;  3MYU A;  1LBY A;  3ECR A;  2DXY A;  4EUO A;  3ROJ A;  3VE1 B;  1LBZ A;  4F2O A;  1EZP A;  4FEC A;  3KOT A;  3GBB A;  2YPN A;  1N0T A;  3FAS A;  2CZI A;  2O6A A;  4OEU A;  2UVJ A;  4HCW A;  4N6D A;  3FV1 A;  1NFT A;  3T93 B;  1S50 A;  1PBQ A;  4ISU A;  1LAH E;  3VXC A;  1LBB A;  2DE4 A;  3QAX A;  1MY4 A;  1VSO A;  5H8Q A;  2DP8 A;  2RF1 A;  2QL3 A;  4DCY A;  5HBC A;  1FTK A;  3G3H A;  4E0X A;  4WXJ A;  3KN7 A;  3U92 A;  4ZED A;  3S4U A;  3MVX A;  4WEP A;  3TCF A;  2DVC A;  3WAE A;  1FSA A;  1MS7 A;  3A29 A;  3IL1 B;  1EZO A;  4OFO A;  4G68 A;  3KFM A;  4PP0 A;  1NH8 A;  1UTH A;  4IY5 A;  4YMA A;  5EQ7 A;  1N3W A;  5IM2 A;  4IO4 A;  2F78 A;  1MXU A;  4GL8 A;  3E4R A;  1MDQ A;  5I56 A;  1SDX A;  1N7W A;  1A99 A;  1Y20 A;  1EU8 A;  1D4N A;  2F34 A;  3KSJ A;  4U4S A;  5I57 B;  5JEI A;  3FAT A;  1FPF A;  3RGY A;  4O3A A;  2RKM A;  1Z7N E;  4MX6 A;  1Y3Q A;  3FIR A;  3PUY E;  2OWT A;  4GWW A;  4LVQ A;  3L6H A;  4QF9 A;  4PFR A;  2Y5L A;  3TMG A;  4U1O A;  1SD3 A;  2HPG A;  5F7V A;  1GR2 A;  2Y7K A;  1FQF A;  3MP8 A;  5H8H A;  3RY3 A;  3DP8 A;  2OX3 A;  4LZ7 A;  3Q29 A;  1FRP A;  2NVU B;  4NX1 A;  4HE1 A;  4R73 A;  5TPA A;  2FHY A;  1QUI A;  3LSX A;  1I6B A;  2OPD A;  3MPL A;  1TXF A;  5CMK A;  3A09 A;  3FZV A;  4RJZ A;  3HPI A;  3VVD A;  2DXR A;  2Z23 A;  4PTK A;  4PFY A;  1JVX A;  3RLF E;  2HCA A;  3S2V A;  3MBP A;  2NXO A;  4R6Y A;  4NF5 B;  4X04 A;  3PD9 A;  1LFG A;  3K02 A;  3IB2 A;  3UN6 A;  2OLB A;  4ND9 A;  2R9J A;  4IO6 A;  2G29 A;  5I5P A;  4YKJ A;  1P1O A;  3T1B A;  5I84 A;  5ICT A;  4E0W A;  2I3V A;  1ZJL A;  4U4X A;  4OVS A;  1I6Q A;  2F5X A;  3C9H A;  5ESY A;  3PPO A;  1N84 A;  5A5L A;  2NUV A;  1RKM A;  2Q88 A;  1BLF A;  1I6A A;  4TLM B;  1HSE A;  1QUK A;  3OEK A;  4MFI A;  4P0G A;  4F3B A;  5CMB A;  1TFA A;  3ILU B;  5DVF A;  1FJ6 A;  2QS1 A;  3ZKL A;  2FYI A;  4MMP A;  4BDO A;  1NV4 A;  2OWS A;  3IJO B;  2RCB A;  5ET5 A;  3E79 A;  2WEF A;  3T0J A;  4H6D A;  1DTG A;  2HXR A;  4YIC A;  1J1N A;  5EYH A;  5ET6 A;  1SYH A;  4X8R A;  4MLQ A;  2V3U A;  1VE4 A;  1QUJ A;  5F1Q A;  2HQ0 A;  1AOV A;  3QUF A;  1IEJ A;  4N8G A;  4OEN A;  5I57 A;  3HV1 A;  3ZS6 A;  3U8Q A;  2ZMB A;  1B6H A;  2OK2 A;  4P1E A;  4RPO A;  2XXQ A;  2B65 A;  4KCC A;  5HPQ A;  1B32 A;  4PGN A;  1LCT A;  2VD2 A;  4QSC A;  5J16 A;  1B3G A;  1MY3 A;  3K1N A;  3K00 A;  2ESN A;  3T9H B;  4JSD A;  4OAN A;  1LAF E;  1OVB A;  3PUZ E;  1POY 1;  4QSE A;  2UVH A;  4GBW A;  3V83 A;  5TP9 A;  4BDR A;  2VOZ A;  1B2H A;  1FTJ A;  1RDX A;  3CFX A;  1H44 A;  4MNI A;  4H8J A;  4BDL A;  4KCD A;  2THI A;  1JP4 A;  2DE2 A;  3OO7 A;  4NF5 A;  3PPN A;  4QXD A;  5I7I A;  1MXY A;  5DYH A;  1US5 A;  4POW A;  5ICQ A;  3SEV A;  4UAB A;  1MXX A;  4I3Y A;  1B52 A;  2Y7R A;  3D4C A;  1Y3N A;  1LCF A;  3FXR A;  1AIV A;  2O68 A;  3C31 A;  4X48 A;  1SI0 A;  2Q89 A;  4QRZ A;  3MUQ A;  3GZG A;  5IGA A;  1QW0 A;  4ESW A;  2Q2A A;  3QIM A;  4H45 A;  4AB5 A;  3N6U A;  2XXH A;  1OMP A;  3H06 B;  3QXM A;  2XXK A;  1AH5 A;  1R9L A;  2RIN A;  4O8M A;  2R8T A;  1EYI A;  3B7D A;  4XTC Q;  1JET A;  3HHG A;  1DOT A;  4F18 A;  1INP A;  2NOO A;  4ONY A;  1RYX A;  4MIJ A;  4R6K A;  1FQA A;  1NV3 A;  1JEU A;  1A8E A;  1R9Q A;  1QKA A;  1SI1 A;  3KZG A;  1FPD A;  4U23 A;  2H25 A;  2UVI A;  1MDP 1;  4F1U A;  2PBW A;  1Z7M E;  2QS2 A;  2XHD A;  2F36 A;  2Q8M A;  1M5C A;  2YLN A;  1B46 A;  3VVF A;  3M3L A;  2CZH A;  3FJG A;  3LSW A;  1R6Z A;  2H99 A;  4QSD A;  3MC2 A;  4EXK A;  1VFE A;  3IOV A;  1N3X A;  1FTM A;  2I0B A;  1B9J A;  2IEE A;  4XFE A;  3V8X B;  4MBP A;  1YPN A;  4ZZA A;  3LSL A;  3VDF A;  4ZEK A;  4G8N A;  1NV2 A;  1LBX A;  1HSJ A;  4O7M A;  2NWJ A;  1LFH A;  2V3Q A;  4IO7 A;  1H3D A;  1B7U A;  1IQ7 A;  3ILT B;  1MY0 A;  4GWO A;  4ESX A;  4PC9 A;  2WX9 A;  1PEB A;  3GBA A;  4YB5 A;  4G77 A;  2RC7 A;  3KG2 A;  3EHS A;  2RCA A;  3G3G A;  4GX3 A;  4U2R A;  4JXI A;  4NMY A;  1R1N A;  4HW8 A;  3D1R A;  4BDN A;  3K6X A;  5IZZ A;  2QSX A;  4ZEC A;  2PFZ A;  3OMB A;  4MNC A;  1O63 A;  2X7P A;  2ZYK A;  2M8C A;  3SEU A;  3TTN A;  3CG3 A;  2F7B A;  4YKP A;  4NWC A;  1T0K A;  1B58 A;  1NV6 A;  1IXG A;  5JTY B;  4PBH A;  2F7C A;  5I2K B;  4G68 B;  4QHQ A;  4XKP A;  1UTH B;  4NF6 A;  1B7H A;  4NED A;  3THI A;  4DZ1 A;  4OER A;  1SQY A;  2PFY A;  3KJ7 A;  4HE2 A;  3C34 A;  3E78 A;  3RTW B;  4FEB A;  4YKK A;  2HAV A;  3B6T A;  3T9V A;  2DDK A;  3TYH A;  5L9M A;  2P3N A;  3N94 A;  4F3G A;  4XKR A;  5A5X B;  1P1Q A;  4N91 A;  4ZDM A;  1GV8 A;  1NUX A;  4GWY A;  1XS5 A;  2KR0 A;  3EKI A;  3H3G A;  3H6T A;  3PD8 A;  2XWI A;  3JZJ A;  5EQ9 A;  2Z22 A;  3PPR A;  4YU0 A;  1SW5 A;  3TTR A;  2P0S A;  4RK9 A;  4PDH A;  3HO7 A;  4H5F A;  4PBQ A;  4R75 A;  2Y7W A;  4OET A;  5TPA B;  3PPQ A;  3TEL A;  3O2A A;  3B8B A;  1Y4T A;  2XXU A;  3SEX A;  3M3K A;  4GXS B;  3IK6 B;  3FD3 A;  3GXA A;  3JV9 A;  3PPP A;  1MRP A;  4DDD A;  5ITP A;  4GFR A;  2O7U A;  2VD3 A;  3CG1 A;  3EN3 A;  4GL0 A;  1IXI A;  5EYF A;  1Q35 A;  3T66 A;  2PYY A;  1JW4 A;  4N8Y A;  1Q9D A;  3SET A;  1B4H A;  4KPT A;  1AL3 A;  1B3F A;  2MKZ A;  1SVX B;  3FBP A;  1N76 A;  2DWH A;  5CMM A;  1MXZ A;  3S9L C;  4G4P A;  3HHF A;  2CZK A;  3MP1 A;  3K2D A;  1SYI A;  3DLN A;  1Q1K A;  5ISU A;  3IAZ A;  4DXU A;  1SW4 A;  3I5O A;  3FV2 A;  5JTY A;  2H9B A;  3OSQ A;  3T9X B;  2AIX A;  2XWO A;  5I2K A;  4N15 A;  3EHT A;  4RK2 A;  5J1D A;  2UYF A;  2V4C A;  3M8U A;  3KGC A;  2RC8 A;  3HST A;  3H6W A;  1P1N A;  4G61 A;  3E9X A;  3FXB A;  3FXU A;  3FUZ A;  3MPK A;  2XXP A;  1NV5 A;  2A5T B;  4R2B A;  3B6Q A;  4DCX A;  3T22 A;  3R7X A;  5CMC A;  1FPK A;  1LBW A;  4F3S A;  3Q28 A;  2AL5 A;  1XVY A;  1XT8 A;  1D3K A;  2X7Q A;  5A5X A;  4OWD A;  1O7T A;  2OPE A;  5FBP A;  3FJ7 A;  2XXR A;  1B51 A;  4LQ2 A;  4ELQ A;  4AQ4 A;  3C36 A;  4MCO A;  1FW0 A;  2DWI A;  4PGP A;  1FBF A;  3K6W A;  3QYT A;  5FHM A;  2F3B A;  4KYD A;  5TP9 B;  3IOU A;  3G3F A;  1BTJ A;  1S9T A;  2KLF A;  3KSX A;  4TOZ A;  3TEP A;  4HS7 A;  1UIV A;  5KDT B;  3QSL A;  2XXX A;  4F1V A;  3O6I A;  2XD2 A;  5CRY A;  1IZ1 A;  4GBV A;  2HZK A;  3O28 A;  2O7I A;  3P7I A;  3EF7 A;  4GLI A;  3TKD A;  4XF5 A;  4HTG A;  4TQU Q;  2UYE A;  4U1Z A;  4LZ5 A;  1IMB A;  5TU0 A;  1B40 A;  1NL5 A;  5DW8 A;  3LR1 A;  3S9N C;  1DPE A;  4JWY A;  2Y7I A;  4P9K A;  4NWD A;  2ONK E;  3RPW A;  4F1Y A;  3QK6 A;  1EZ9 A;  3FGS A;  1FPI A;  4H8I A;  4N6P A;  4ZZE A;  3QMF A;  1EYJ A;  2R6G E;  1SW1 A;  3MST A;  1IMC A;  1XVX A;  2P1S A;  3AXF A;  4PF8 A;  1DCU A;  1FQD A;  1USY E;  3UGW A;  2OJT A;  4DXC A;  5DVJ A;  2I4B A;  3MP6 A;  1ZKB A;  4RY1 A;  3TCH A;  4YKI A;  4GWU A;  4EF2 A;  2GRV A;  5LDZ A;  2ZNS A;  3VLW A;  4U21 A;  4NF0 A;  1B05 A;  3TTM A;  3ODB A;  3T9U A;  2B4M A;  3U65 A;  1LGB C;  4OTE A;  4GQO A;  1CB6 A;  2DS9 A;  3TPA A;  4UA8 A;  3TAJ A;  2CZL A;  4O3C A;  3CIJ A;  3MJN A;  2WKY A;  2A5T A;  4OZ9 A;  5KCJ B;  1EYK A;  4AS5 A;  3K6V A;  4X9T A;  4N4U A;  1DTZ A;  4F39 A;  3KEI A;  4KYS A;  1FBH A;  4GD5 A;  1GVC A;  1H45 A;  3ONM A;  1B3E A;  1I69 A;  5DT6 A;  5KZT A;  2PVU A;  4I9D A;  2V84 A;  3CHG A;  3HCQ A;  4IO5 A;  3MZB A;  5CM6 A;  1EH3 A;  3S9E A;  2QMW A;  2BJJ X;  1P99 A;  4OA4 A;  1B5H A;  4QBA A;  3U72 A;  3PUV E;  2BJI A;  2I58 A;  3KN8 A;  2DSF A;  2ANJ A;  3A3U A;  5KDT A;  1NUW A;  4G8M A;  4G8H A;  1BIY A;  2DVZ A;  4NF4 B;  1MQG A;  2QVU A;  4MLV A;  2O1M A;  1Y9U A;  2Q74 A;  5B7D A;  2OBG A;  3VLU A;  4THI A;  1FPJ A;  4LON B;  5DVI A;  4IGR A;  1A40 A;  2YJP A;  4RA1 A;  2E1S A;  3C35 A;  1IUD A;  3RPL A;  1UIU A;  4OVT A;  3GLB A;  2FIX A;  4NN3 A;  2F35 A;  3SEW A;  4QFN A;  1PBP A;  2GH9 A;  4NQ8 A;  3H03 A;  4JBZ A;  4NF6 B;  4JB7 A;  4PFT A;  3B50 A;  1LFI A;  4DE8 A;  2VGQ A;  4H65 A;  1MQI A;  5H8N B;  2Y5K A;  2FNC A;  1GGG A;  2Q9T A;  3PV0 E;  4OFL A;  2HHM A;  3GYY A;  3DM0 A;  2E0S A;  4ZE9 A;  4OVP A;  3OEN A;  2O84 X;  3E3K A;  1B1X A;  4H46 A;  2CEY A;  4ELO A;  5FTI A;  4MAG A;  4Q5T A;  4R2F A;  4PAK A;  4MHF A;  4AB6 A;  3MVY A;  4IO2 A;  3KN3 A;  1SPI A;  1QKB A;  3O29 A;  5BUU A;  3VVE A;  4LA9 A;  5KCJ A;  1XHY A;  1IMD A;  2DOJ A;  4H67 A;  4C1T A;  2VP1 A;  4R6H A;  3K0V A;  4FE8 A;  1FQB A;  2I6E A;  1IXC A;  5BWJ A;  4OVR A;  2ZZX A;  2WBB A;  1MM7 A;  3K01 A;  2F3D A;  3C32 A;  3D4G A;  3I3V A;  1M5B A;  3DP6 A;  1B0L A;  5L8D A;  3F11 A;  4ZE8 A;  3VFJ A;  1UQW A;  4LN5 A;  4ZEI A;  3FVG A;  1VR5 A;  5DEX B;  3MZ1 A;  5ET8 A;  2ZZW A;  3SES A;  1KA0 A;  4H1X A;  2FVZ A;  2QVR A;  1MQH A;  3PTY A;  3C4M A;  3MVZ A;  2DQV A;  1KWH A;  1Y4C A;  4DIG A;  4PDD A;  2AYS A;  3IO4 A;  1P1W A;  3RQT A;  4GWZ A;  1JW1 A;  1JNF A;  4NF4 A;  5FHO A;  1ELJ A;  1OIB A;  4R72 A;  1YZ0 A;  1RYO A;  3MW0 A;  4EDP A;  3FJM A;  4PFW A;  1MY2 A;  2DWA A;  4KI0 E;  1F9B A;  2D21 A;  1M5E A;  3BFU A;  1K9Y A;  4H5G A;  4M1V A;  4Q8R A;  3HFU A;  3LSF B;  1AWB A;  2I0C A;  1B5J A;  2ONR A;  1MM6 A;  3BBR A;  3EHU A;  3SDF A;  2REG A;  1GTK A;  1LB8 A;  4QFL A;  4EF1 A;  1FBE A;  4YMB A;  2WYP A;  3RT6 B;  4P11 A;  1URG A;  1TWY A;  2PX1 A;  2H4I A;  1QVS A;  4KHZ E;  2V25 A;  5H8N A;  4IO3 A;  4R9G A;  4KQP A;  3RT8 A;  4YAH X;  4KD5 A;  4DI3 D;  3CRB A;  1FTL A;  2GHA A;  4I1D A;  4KXP A;  4ECF A;  3PU5 A;  1ZU0 A;  4GVO A;  5ELV A;  2Z8D A;  1BKA A;  4FBP A;  1JVY A;  3R6U A;  3UIF A;  4C1U A;  4H0W A;  3IOT A;  3MWB A;  4ELR A;  4OYV A; 
#chains in the Genus database with same CATH homology
 5FBP A;  4P1E A;  4GWX A;  1DBZ A;  4MCO A;  1NV0 A;  4PGN A;  4PGP A;  5J16 A;  3IFC A;  1FBF A;  2F3B A;  4PAF A;  5EQ8 A;  4NGU A;  4OAN A;  1NV7 A;  1FJ9 A;  4NG7 A;  4GBW A;  1RDY A;  4N6K A;  3KBZ A;  1RDX A;  4F1V A;  4PFB A;  2GQ1 A;  3SZP A;  4GBV A;  4NHB A;  4MNI A;  2HZK A;  1LBV A;  3KC0 A;  4MJO A;  4XF5 A;  4DI4 B;  4XEQ A;  1JP4 A;  1IMB A;  2XWK A;  2DE2 A;  2L5V A;  4QXD A;  4PAI A;  5I7I A;  5DW8 A;  3W9V A;  5T3J A;  4UAB A;  4I3Y A;  4P9K A;  1CNQ A;  1NUZ A;  4GX4 A;  4GWS A;  1FPI A;  1D9Q A;  2ZZV A;  5F24 A;  2VPN A;  3QMF A;  4O94 A;  1EYJ A;  3MST A;  4I40 A;  5LTC A;  1IMC A;  1NV1 A;  4PF8 A;  1DCU A;  1FPE A;  5IGA A;  4H45 A;  2XXK A;  3BIG A;  4GWU A;  1FBG A;  4N17 A;  5I3S A;  1QGX A;  1IMF A;  5LDZ A;  4PCD A;  4I3E A;  4O8M A;  2R8T A;  1YYZ A;  1EYI A;  4NF0 A;  4PE3 A;  2DE3 A;  2VPO A;  2B4M A;  3U65 A;  5IZ3 A;  4F18 A;  1INP A;  1LEV A;  4GX6 A;  1IME A;  4MIJ A;  1NUY A;  5IZ1 A;  1EYK A;  4AS5 A;  4X9T A;  4N4U A;  1KA1 A;  1NV3 A;  1FBH A;  4JVC A;  1FPD A;  4P3L A;  4P56 A;  4YZZ A;  2WYK A;  1IMA A;  4F1U A;  2CEX A;  1BK4 A;  2HZL A;  3CHG A;  4N81 A;  2Q8M A;  2QPQ A;  2CZH A;  5CM6 A;  1YXI A;  4OA4 A;  4OVQ A;  4QBA A;  3KC1 A;  2KQZ A;  3ISP A;  4AS4 A;  4XFE A;  2BJI A;  4PF6 A;  1FTA A;  4PFI A;  1NV2 A;  1LBX A;  4O7M A;  4JVI A;  1NUW A;  4PET A;  2DVZ A;  1NI9 A;  3MYU A;  2V3Q A;  1LBY A;  4P8B A;  3ROJ A;  2QVU A;  2PCR A;  1LBZ A;  2Q74 A;  4PC9 A;  2WX9 A;  5EYG A;  5EQA A;  2CZI A;  4GX3 A;  1FPJ A;  3RPL B;  3D1R A;  3IFA A;  2QFL A;  4HCW A;  5IZZ A;  4N6D A;  2XWV A;  1RDZ A;  2PFZ A;  1VDW A;  4MNC A;  2DE4 A;  3RPL A;  4OVT A;  2FIX A;  4NN3 A;  4NQ8 A;  1NV6 A;  3B50 A;  4PBH A;  2Y5K A;  2B4L A;  2Q9T A;  1FSA A;  3LV0 A;  3A29 A;  2HHM A;  3GYY A;  1DK4 A;  2P3V A;  4OVP A;  2PFY A;  4HE2 A;  3E78 A;  4H46 A;  2CEY A;  4MAG A;  1FPB A;  4PAK A;  4MHF A;  5EQ7 A;  5IM2 A;  4IR8 A;  1G0H A;  2DDK A;  2VT5 A;  1SPI A;  2P3N A;  4N91 A;  1KZ8 A;  1IMD A;  1FPF A;  2XA5 A;  1FPL A;  1NUX A;  4GWY A;  2KR0 A;  3EKI A;  2JJK A;  4MX6 A;  4OVR A;  2XWI A;  5EQ9 A;  2ZZX A;  2WBB A;  2OWZ A;  4GWW A;  1FBD A;  2F3D A;  4PDH A;  4PBQ A;  4PFR A;  2Y5L A;  4MNP A;  3NOH A;  2HPG A;  3B8B A;  3RYD A;  4LN5 A;  2FBP A;  2OX3 A;  1FRP A;  4NX1 A;  5ET8 A;  2ZZW A;  4HE1 A;  1KA0 A;  2FHY A;  1K9Z A;  1FBC A;  4P1L A;  2FVZ A;  2QVR A;  3PTY A;  4PDD A;  2WBD A;  4GWZ A;  3LUZ A;  4F19 A;  4O7I A;  4PTK A;  2FIE A;  4X04 A;  1YZ0 A;  2QVV A;  4N8Y A;  3W9W A;  1Q9D A;  5I5P A;  3T1B A;  2MKZ A;  4HCY A;  3FBP A;  1K9Y A;  4OVS A;  1FPG A;  4M1V A;  2F5X A;  3HFU A;  5ET7 A;  5ESY A;  5A5L A;  1AWB A;  2CZK A;  4JVD A;  1G0I A;  1FBP A;  1FBE A;  2WYP A;  1FJ6 A;  3BIH A;  1XI6 A;  4MMP A;  1NV4 A;  5ET5 A;  3E79 A;  2XWO A;  4N15 A;  2WEF A;  3T0J A;  4NAP A;  5J1D A;  4P47 A;  4HXV A;  2HXR A;  2V4C A;  4YIC A;  5IZ3 B;  4G61 A;  5EYH A;  3FXB A;  4DI3 D;  4HE0 A;  4KXP A;  5ET6 A;  1NV5 A;  4X8R A;  4MEV A;  1FPK A;  1LBW A;  4FBP A;  4N8G A;  5JK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...