3T0JA

Crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
266
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNLTPNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of inositol monophosphatase - II from Staphylococcus aureus MSSA476
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 83
structure length 266
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3t0jA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t0jA02
1SPIA 1FBHA 1VDWA 2F3BA 4GBWA 1NV6A 1LBWA 5ESYA 5DW8A 1DK4A 2Y5KA 2PCRA 1JP4A 4N81A 4AS5A 1G0IA 5ET8A 1EYIA 3D1RA 1CNQA 5ET7A 4GWUA 2Q8MA 3RPLB 1BK4A 1NI9A 1IMEA 1KA1A 5ET5A 2FIXA 5A5LA 1NUWA 4KXPA 1YZ0A 3QMFA 4HXVA 3ROJA 1FBDA 2JJKA 2WBBA 1RDZA 4GX6A 1YXIA 1NUYA 5J16A 1EYJA 1LBZA 5I3SA 1RDYA 3A29A 1NUXA 1NV3A 1FPKA 1FBCA 3LV0A 4PTKA 1K9YA 1NV5A 3B8BA 1EYKA 1D9QA 5F24A 1IMAA 2WEFA 4I3EA 2QVVA 1FBGA 4FBPA 1Q9DA 1FPGA 3T0JA 1NV4A 1FBPA 4GBVA 4G61A 1FPFA 2BJIA 4O7IA 5EQ8A 2HHMA 3KBZA 5EYGA 4H46A 2DDKA 2CZIA 1LBXA 1XI6A 4GWSA 1FTAA 5EYHA 4AS4A 1DBZA 1FPEA 2FHYA 2R8TA 4GWXA 1FRPA 4GX3A 1FJ9A 1LBYA 2P3VA 1FPIA 2FIEA 1NV1A 1NV7A 4HE1A 4GWWA 1NV0A 2QFLA 4GX4A 4H45A 1FPBA 2CZHA 1AWBA 1KA0A 2QVRA 4HE2A 5EQAA 2FVZA 2Q74A 2F3DA 1KZ8A 3BIGA 1FPJA 3KC0A 5ET6A 1FSAA 1IMDA 1DCUA 3BIHA 3IFAA 4MJOA 4QXDA 5IZ1A 3KC1A 5IZ3B 1FPDA 1NUZA 2OWZA 4IR8A 2OX3A 3FBPA 5LDZA 1G0HA 1IMCA 1IMBA 2FBPA 2CZKA 1FBFA 5EQ9A 1INPA 2WBDA 1NV2A 4I40A 2P3NA 2VT5A 4GWZA 1RDXA 2QVUA 1LBVA 1FBEA 1FPLA 2GQ1A 4HE0A 3RYDA 1FJ6A 1LEVA 5IZ3A 5T3JA 4I3YA 1K9ZA 1YYZA 3IFCA 5FBPA 3RPLA 3LUZA 5EQ7A 2Y5LA 4GWYA 1QGXA 1IMFA
chains in the Genus database with same CATH superfamily
4PFIA 1TWYA 4F3GA 1NV6A 4FEBA 1XC1A 1TFDA 4F3SA 5H8QB 2ONSA 5F1QA 1CNQA 1MXYA 3LSXA 2O6AA 3PPNA 5ITPA 2O69A 5I59B 3S9MC 2HXRA 2VGQA 3MZ9A 2F6PA 1O64A 1VR5A 1A8EA 1N0TA 1QJMA 3OSQA 1DTZA 1MDQA 1NKXA 3VV5A 1RDYA 1SBPA 1FBCA 1Y20A 1BTJA 3N26A 4GIZA 2O51A 5F24A 2B4MA 4OVSA 1P1UA 4OEUA 1B7HA 4NF5A 3SKPA 1LFIA 3U92A 3K00A 1NNKA 3KBZA 4XF5A 2F7CA 4U4SA 1R9LA 5I56B 3QIMA 3EQ1A 2BJJX 2GHBA 3CSGA 3HHFA 4NHBA 1FQFA 4NTLA 2PBWA 4G8MA 3TCGA 3TODA 2DOJA 3VLUA 3BKIB 4N07A 3JV9A 1IZ1A 2E1SA 2UYFA 4R2FA 3CFZA 3LR1A 2REGA 2H5YA 1IMCA 4FIMA 4BLAA 1LB9A 4NF6A 4R6YA 4O94A 3MPLA 4NWDA 2KQZA 1MQGA 3U1OA 5I7IA 1YYZA 1Y9UA 3SDFA 1QUKA 1ZU0A 5I84A 3FD3A 3E4RA 1JW5A 3FASA 4BDNA 3HHGA 2XXTA 1B0HA 3PPOA 3VE1B 3FV1A 4DXUA 1LCTA 2Q9TA 4MCOA 4QRZA 4HXVA 2HZLA 4PGPA 2W7YA 1UIVA 4IO5A 2UVGA 3SZPA 2GRVA 2XXIA 3G3FA 3FUZA 3V8XB 1RYXA 3M8UA 3PD8A 2Y84A 4ZDMA 4LVQA 1K9YA 4G2ZA 4KI0E 2XXUA 3MQ9A 4YKKA 1P1OA 4DXBA 1B3GA 5F7VA 5J1DA 3MWBA 2HFBA 1NV4A 1MG1A 4G61A 4F39A 1MY1A 1XVXA 1FQCA 1QKAA 1MXXA 1Y4CA 1T0KA 5I2NB 5EYHA 3TELA 3KJTA 5EHMA 5K2YA 5I59A 2VHAA 2Y7IA 4EQ9A 3IO4A 2KLFA 5AA4B 2WYPA 4IB2A 3BBRA 2FIEA 4ESWA 2DE4A 5CRYA 4G68C 4HE2A 4H8JA 3FGSA 2I0BA 4RYAA 4R72A 2O1LA 2ZZVA 4TOZA 1F9BA 1I6QA 5DTBA 1LB8A 4G8HA 1SI0A 3MW0A 3C31A 1NV2A 4I40A 3O6GA 3PD9A 3MZBA 4ZE9A 1VFDA 5M2VA 3KOSA 1FJ6A 1UTHB 4I3YA 1N7XA 5FBPA 4PFWA 2XWVA 5I57B 5IAIA 1WDNA 5AA4A 2GH9A 3T1BA 1H3DA 3MC2A 4M1VA 2P1SA 1D9YA 1I69A 1FQEA 1DPEA 5BWJA 3TTKA 5CC2A 2L5VA 3I5OA 2WBBA 4MLVA 4LONB 1PEBA 1J1NA 3THIA 2Q2CA 4OVPA 2F36A 1IXIA 4QFOA 1JEUA 3B8BA 2Q89A 4UACA 1IQ7A 4WEPA 3T0JA 3TQWA 2GFEA 4OENA 1UIUA 2ESNA 3O6IA 1XT8A 1LBXA 3OOAA 3N5LA 2V25A 3C36A 2ZMBA 1PB7A 4PAFA 1A99A 1MY4A 4PC9A 3K6WA 1TFAA 3CR9A 4XFEA 2R71A 3TYHA 1NV7A 4QSDA 2QFLA 4GX4A 3CHGA 1FPBA 1OMPA 3OELA 3BIGA 5ET6A 1ZMGA 3RGYA 4IY5A 4MEVA 1B7UA 4FECA 1IMBA 4AB5A 5L8DA 1EZ9A 5DEXA 1PDAA 4HTGA 3HFUA 1K9ZA 3RPLA 4PDHA 3TMGA 4F3BA 4U21A 1XS5A 2B65A 3VVDA 1FTMA 5K2XA 3FXBA 2P0SA 3RPLB 3CSBA 3Q27A 3TFLA 2I49A 2F78A 3PUXE 4N17A 2I0CA 3GLBA 4GWOA 1HSEA 5A5LA 3SEYA 2WX9A 3LC8A 4OVRA 4H0WA 5FHOA 3R7XA 1Q1KA 3N6TA 4N91A 3U94A 5KDTA 3EHTA 3LV0A 3U65A 3IK6B 1IMAA 4LP2B 5H8HB 3TAJA 4BDQA 2H99A 4FAJA 4OA4A 1JVXA 4KQPA 3HSTA 2RF1A 2DE2A 1M5CA 2BJIA 2Y7PA 3BFTA 1BLFA 2F35A 4KCDA 2DDKA 4JWOA 3C32A 1DOTA 3QAXA 3LSLA 5H8QA 5ELVA 2FHYA 1US4A 1FJ9A 1URSA 1HSJA 1O63A 3DM0A 3K1PA 4N6DA 3T9VA 1QUIA 1B4ZA 4DI3D 2XD3A 3FZVA 1ATGA 4ZECA 2PYYA 2XXYA 2PFZA 1POTA 1MQDA 3IB0A 3RYDA 4I1DA 3IFCA 4F3PA 4BDMA 1US5A 4PGNA 2UVJA 2PT2A 2LAOA 5IGAA 2NUVA 4X48A 1LBWA 2RC9A 1NFTA 5FTIA 5H8FA 4X1BA 4XXUA 3M3FA 3LUYA 1H76A 4OZ9A 5ET7A 4X1DA 1S9TA 1IMEA 5CBRA 2F7BA 4DCYA 4F18A 3TTLA 3LSWA 4ZZEA 3UORA 4C0RA 3NOHA 1LCFA 1NUYA 1MM7A 4FORA 3S2VA 1EYKA 1VE4A 4I3EA 2Y7RA 4LQ5A 4LUBA 3VVEA 1Y3QA 3FVNA 2HHMA 4KPTA 5EYGA 1EZPA 1SDXA 2XXPA 2ALUA 4KR5A 2V3TA 1DBZA 4QHQA 3PV0E 4TQUQ 4P8BA 4GX3A 2P3VA 4IGRA 5CMCA 2D5WA 4YMAA 4YU0A 4NAPA 2F3DA 1FSAA 1IMDA 3K1MA 4OVJA 2WKYA 5JTYB 1IUDA 5IZ3B 3OSRA 4LZ5A 1GV8A 2OJTA 4BDLA 4C1UA 3GXAA 3T22A 4QSEA 2XA5A 3IB2A 3MVXA 3KN3A 4BDRA 2X7PA 2GQ1A 1B58A 2MKZA 5JTYA 1B46A 3LUZA 2YJPA 3HO7A 4I9DA 4ONYA 1GTKA 1QUJA 3FVOA 4UA8A 2VP1A 2QMWA 4JVCA 3W9VA 2DYXA 2XXWA 3E78A 1B0LA 2B4LA 4AS5A 1NI9A 2XD2A 1A7LA 2DE3A 2JJKA 2RINA 1SW5A 3H03A 4ELPA 1YXIA 4PFUA 1BKAA 4R6KA 1LLSA 1FTOA 1MQHA 3RTWB 4RA1A 2O68A 1Y3NA 3MP1A 4F2OA 1LFGA 2DVCA 4BDOA 2WYKA 1LAHE 1XI6A 3RLFE 2HPGA 3PPPA 3IOWA 5I56A 1FPEA 1WVJA 2X7QA 4PBQA 1FRPA 2AYSA 4EQ7A 1EH3A 3FJMA 4O3BA 1JVYA 3MVWA 3TQLA 2M8CA 4R2BA 4OQOA 1FTLA 1AWBA 5I58B 2UYEA 5I5PA 4KYDA 4QF9A 3G3GA 1OQHA 3HCQA 1NUZA 4POXA 4IR8A 4OVQA 4QFKA 4F31B 1INPA 5ICQA 3KZGA 2QS4A 3K4UA 4XKQA 1R9QA 1LEVA 2ZYOA 4ZEFA 1SPIA 3E79A 2F3BA 4GF8A 5L9OA 3IAZA 2F7AA 4H5GA 1PBQA 1B9JA 3OENA 4RY1A 3K1NA 2XX7A 1BK4A 4ELRA 4G68B 1N84A 3KJ7A 4U1OA 3B6QA 3B7DA 2XWKA 3ZKLA 1MH4A 3VLVA 1L5TA 3ROJA 1B7ZA 3B50A 4NWCA 3B6WA 1I6BA 4XEQA 3O97A 4DE8A 2OK2A 3PPQA 2I3VA 3CFXA 3W9WA 4NGUA 4YZZA 5IKBA 3T96B 2HXWA 1IXGA 5CM6A 4P3LA 4NF6B 3FVGA 3KOTA 5IM2A 4O7IA 4G4PA 3VDFA 4IO4A 2ANJA 2HEUA 3WAEA 5DT6A 2ZNSA 4GWSA 3U8QA 1VSOA 3E13X 4O3CA 1P99A 2F97A 1KWHA 3TTRA 3QUFA 3TZAA 4MNIA 1A8FA 4YAHX 4PFTA 4ND9A 4H45A 4MNPA 4F19A 2Q74A 4FEDA 1FPJA 3KC0A 2G93A 5IZ1A 5B7DA 2OWZA 3C33A 2Z22A 5DYHA 1B4HA 1OIBA 4TLMB 3DP8A 1MXWA 3Q25A 3IB1A 4MX6A 4N8GA 1YAEA 1GGGA 4EXLA 2HZKA 4ESXA 4NF5B 4Q30B 3MVZA 2RCBA 1JNFA 1SQYA 3O28A 5T3JA 4RNSA 3T93B 2RKMA 2I6EA 4QFLA 1FBHA 4PE3A 2FNCA 4FATA 3BFUA 1NNPA 3K2DA 4QBAA 3PUWE 1SI1A 4NF4B 3F11A 2OCUA 4XTCQ 4PE5B 1LBCA 2ONKE 3KN8A 4U2RA 1B05A 4R74A 2UXAA 1OLCA 5AE4A 3DLNA 1D3KA 3PTYA 4RK2A 3SEVA 1NUXA 4IO3A 4GVOA 4N6KA 3ILTB 2XWOA 3IR1A 4XIGQ 2WEFA 1ZIUA 1B3LA 4THIA 1OQGA 2R6GE 1FPGA 2F6GA 1B40A 4ZEKA 3RQTA 3UK4A 3V89B 2Z8EA 4MMPA 3EHSA 1VFEA 3SEUA 4GQOA 4OHNA 1MQIA 1MY2A 4N15A 2QRYA 4ISUA 4EDPA 3QSLA 3I6VA 3K0VA 3M3LA 1A40A 5HPQA 1N3WA 1LBYA 1R6ZA 2XHDA 1A55A 5AA1A 2QSXA 4LA9A 3LSFB 1AL3A 1H44A 4RPOA 2H98A 4K3FA 4R9GA 3C4MA 1D9VA 4H6DA 4UABA 1G0HA 2H4IA 3CVGA 4Q8RA 3PPRA 3KGCA 1EU8A 2QS3A 4YB7A 4YMBA 1UTBB 3G3KA 4N13A 4HCWA 5B70A 4GL0A 3SEXA 3FJGA 1XHYA 4PBHA 3MJNA 2Y5LA 2I4CA 1FBDA 4PETA 3A09A 4PAIA 3D4CA 4P56A 3D4GA 2QJEA 1GVCA 1JP4A 4JDFA 5KCJA 3RUMA 3D1RA 3TCFA 1FQBA 2ZNUA 3QYTA 4NQ8A 1I6AA 2ZYMA 4PFRA 4F1VA 1DTGA 2DS9A 4G8NA 4N4UA 4WXJA 3TUSA 1LBZA 1H45A 4EXKA 3A29A 5H8HA 1NV5A 3P7IA 3O6HA 2F5XA 4GBVA 4DIGA 3A3CA 1OLAA 3S9LC 5CMBA 2DQVA 3N6UA 1D4NA 4F1UA 4ELOA 1S50A 2VPNA 4GOTA 2OBGA 4LN5A 3U72A 5TP9B 3PUZE 2F8DA 3U93A 5HM4B 2QVRA 2FVZA 1LAGE 3IFAA 4QXDA 3H6TA 3MP6A 5DEXB 1MM6A 4QSCA 1EZOA 5LDZA 4NX1A 2G29A 4YKPA 4ELQA 1FTJA 5KZTA 3VVFA 1B51A 1FBEA 3L6HA 3KBRA 5JEIA 3MZ1A 4PF8A 3OO9A 2REJA 1IMFA 3N94A 3FXRA 2FA7A 1B1HA 2A5SA 4OEVA 2HCAA 4PCDA 1N76A 1AH5A 4NE4A 4R73A 1EYIA 3O9PA 2HQ0A 3EPEA 1CB6A 5DVIA 3C9HA 1B1XA 3C34A 2OWTA 4OFLA 1QVSA 4EQBA 1RDZA 4Q5TA 4ZEBA 2THIA 2RCAA 4PTKA 3RY3A 3IOUA 1M5FA 4IY6A 2ZXTA 4NF0A 1Q9DA 5H8NB 1MS7A 4GLIA 2RC8A 1AIVA 2D3IA 3FVKA 3E3KA 3I3VA 4OERA 4QFPA 4DI4B 2ABHA 2QPQA 3EN3A 3SEWA 4GWXA 2V3QA 2CEXA 2HAVA 5KCJB 1Y1MA 5CMMA 4GWWA 3UA8A 3S9NC 5HBCA 3H7MA 3PUYE 1UTHA 3UGWA 2PMSA 3GBAA 4MJOA 1P1WA 2OX3A 1MXZA 1Y4TA 4E0XA 1NNTA 5TPAA 3IO6A 4KCCA 3OEMA 1MY3A 3CFLA 2CZKA 1FBFA 3H6VA 4P11A 2DVZA 2QVUA 4H67A 1Y3PA 5FHMA 3K6UA 3OO6A 1QGXA 3TPAA 3OEKA 2OZZA 3GBBA 2Q2AA 3Q26A 4MF3A 4Z0IA 4AQ4A 3V83A 3IJOB 4GWUA 5I2NA 4GXAA 1KA1A 4KXPA 2O1MA 3KFMA 4NF8B 1NMUA 3QMFA 2B3FA 1FQAA 2NXOA 4O3AA 4MLQA 5H8NA 3H3GA 3JYRA 2E0SA 3OO7A 4JWXA 1B5IA 2H25A 2NVUB 1B52A 2DWIA 1R1NA 2NOOA 2IEEA 3H6WA 1USYE 4OANA 3WAFA 1DPPA 5L9SA 2XXKA 3ECRA 3QUJA 1FPFA 1QULA 2DWJA 4AB6A 2KR0A 3TTNA 2PFYA 1MPDA 3DELB 4RK9A 1B32A 4P9KA 1ZKBA 1MQJA 2R8TA 3R6UA 1IXHA 1FPIA 1TXFA 4MAGA 1NV1A 4M4GA 3FJ7A 1PB8A 2CZHA 3PUVE 1KA0A 2P2AA 2CZLA 4OYVA 2GHAA 4R75A 4OMBA 3IORA 3FBPA 1B5JA 5A5XB 3T9HB 2DXRA 2ZZWA 1PB9A 2DWHA 1PC3A 5FTHA 4ZE8A 2ZNTA 1QKBA 2Y7WA 1SW1A 3ZS6A 4RXLA 3UP9A 2XX9A 1MY0A 1DSNA 1FTKA 3C35A 3MUQA 1MRPA 3MP8A 4X04A 1IEJA 1JQFA 2F34A 5EYFA 2PCRA 5ET8A 1NL5A 4OVTA 3KN7A 1LBBA 1NH7A 1NUWA 1URGA 3IOTA 1DMBA 4XKNA 1N7WA 1H43A 3CI8A 2Y7KA 2V93A 2QS2A 1EYJA 1AMFA 2OPEA 4ZEDA 4JVDA 3QXMA 4P0IA 4PFYA 1BIYA 2O84X 5CI5A 5BUUA 4EF1A 4EUOA 1FW0A 5AA2A 4R6HA 2V3UA 4X8RA 1MH3A 3FIRA 1FTAA 4HS7A 2XXHA 5IZZA 1MXUA 2D21A 4GFRA 4H8IA 2OPDA 2XWIA 1Z7NE 3FV2A 1HSLA 4YB6A 4LQ2A 1JEVA 2AIXA 1UTBA 1MPBA 3MSTA 1LSTA 1JETA 3SERA 2I3WA 5AA2B 1NH8A 3HV1A 1M5EA 3KSXA 1B6HA 1JW1A 1YTVA 1MXVA 4R9FA 4F22A 1B5HA 3UN6A 2P3NA 3LBSA 3T9UA 3UIFA 1FCKA 2CEYA 3VFJA 2I48A 5KDTB 5EQ7A 4IO6A 1N3XA 4PDDA 4GWYA 3OD7A 3H4ZA 2O7IA 4MBPA 4GL8A 4ZS9A 4GBWA 1ZBMA 5DW8A 3G3IA 2Y5KA 1B3FA 1LFHA 4KFQA 3GYYA 5DVJA 5I2KA 1IXCA 4KYSA 2Q8MA 4KD5A 4OFOA 3M3KA 1XVYA 3TEPA 1O7TA 2A5TA 4XKPA 2YLNA 5I3SA 4P1EA 1FQDA 1Q35A 1GR2A 1Z7ME 4OFJA 3TCHA 4FBPA 1Y1ZA 5ICTA 3DP4A 4MHFA 3PU5A 1FBPA 4MNCA 5A5XA 4JSOA 5EHSA 3SETA 3CG1A 1BP5A 5LTCA 3RT6B 4NF4A 4YKJA 4AS4A 3IJXB 4GD5A 4YB5A 4JXIA 1RYOA 5LOMA 2VD3A 2IA4A 3W15C 4WEDA 3VXCA 3PMXA 2I4BA 1SVXB 2V84A 1ZJLA 3FATA 4H5FA 3KG2A 1SYIA 1YPNA 1B3EA 3ODBA 3T9XB 1ANFA 2NWJA 3HPIA 4TLLB 4FE8A 2ONRA 3OO8A 3PGFA 3IL1B 5L9MA 1OVTA 4LZ7A 4PQJA 3A3UA 1B2HA 3EKIA 2XX8A 4F29A 1RDXA 1LBVA 4NN3A 5IZ3A 2AL5A 3Q28A 1OVBA 1SW2A 4NG7A 5ESYA 1WODA 4LZ8A 2OLBA 3H6UA 3ZKKA 1G0IA 1N04A 4DLDA 5AA3A 2YPNA 5ET5A 2FIXA 3FXQA 1P1QA 2AL4A 5JK4A 4U4XA 3KSJA 1SD3A 5J16A 1ZTYA 5I57A 1TT1A 1AOVA 3G3JA 4E0WA 3B6TA 1B3HA 4GRKA 1ELJA 4GXSB 4OWDA 2XXRA 2DWAA 5DVFA 4NMYA 2FYIA 3VLWA 4XKRA 5TP9A 4I8CA 2A5TB 4OETA 4DZ1A 4PFBA 4JVIA 3PMVA 2R9JA 2VD2A 1KZ8A 3TTMA 4ECFA 1II5A 1MPCA 3R26A 3O29A 4Q0CA 4QFNA 4ZZAA 1FPDA 2Z8DA 2V4CA 4DXCA 3ZSFA 2XXVA 2UVIA 2I58A 4EF2A 5FHNA 1S7YA 4YKIA 2UVHA 4N6PA 3OMBA 4WKMA 4GWZA 3DP6A 3K02A 5ITOA 5ISUA 4MFIA 4U22A 3MAMA 4MH5A 5I58A 4IO2A 1LAFE 1URDA 3S9EA 4JB7A 3SESA 3T66A 3S4UA 1LGBC 1USYH 3JZJA 4N81A 4U23A 3QK6A 1PBPA 4JSDA 4P1LA 1YZ0A 1UQWA 4RJZA 1IIWA 1M5BA 2DXYA 4Z7EA 3O2AA 3TDJA 4GX6A 1NV3A 1D9QA 4H65A 4LATA 2PT1A 3RN8A 3AXFA 2CMOA 2QVVA 1FBGA 4MIJA 4JBZA 4F2QA 4OESA 5H8SA 3RPWA 3VXBA 2RC7A 4DDDA 2Q8JA 4PAKA 1CE2A 4H46A 1IITA 2CZIA 3H06B 2Z8FA 2XXXA 3V5AA 4RPNA 3ILUB 5TU0A 1NNFA 4FJPA 4ZEIA 4P0GA 2QS1A 3CRBA 1SW4A 3EHUA 1NV0A 4HW8A 3HN0A 1YCJA 5AA2D 2ZYNA 4F1YA 1LAXA 4OTEA 4KHZE 3KC1A 4IGTA 4PF6A 2O7UA 1XOCA 1QW0A 4OXVA 1RKMA 3IOVA 4L17A 1SYHA 5CBSA 3K01A 2WBDA 2HAUA 3FXUA 2VT5A 3E9XA 3GZGA 1FPLA 2QMXA 2ZYKA 2VOZA 4N8YA 3TKDA 4O8MA 4JWYA 1VDWA 1DK4A 3G7WA 2Z23A 4IO7A 3MVYA 4HCYA 3ISPA 4KYEA 2PX1A 1MDP1 2DSFA 2X26A 1ZLQA 4I62A 5CMKA 1FPKA 3O66A 3RT8A 4U1ZA 1M5DA 1JW4A 4G77A 2DP8A 3PMWA 4NEDA 3MYUA 4DCXA 5EQ8A 4H1XA 4YICA 3L6GA 3Q29A 2B3BA 3IX1A 3K6XA 2OWSA 5I2KB 3CG3A 4NF8A 5H8FB 2H9BA 3EF7A 2XXQA 3RNNA 3CIJA 3RTFB 3K6VA 4X9TA 4HE1A 1A54A 2Q88A 4O7MA 5EQAA 2PVUA 4POWA 3ONMA 1DCUA 3BIHA 4PP0A 3G3HA 3MBPA 3MPKA 3OXNA 2QL3A 2FBPA 1P1NA 1POY1 3KEIA 4C1TA 5EQ9A 2VPOA 5TPAB 3USDA 4P47A 4HE0A 4G68A 2ZZXA
chains in the Genus database with same CATH topology
4PETA 1SPIA 4PFIA 3T1BA 1FBHA 1VDWA 3E79A 5IGAA 2F3BA 4GBWA 4PE3A 4NG7A 1NV6A 4PAIA 4M1VA 4X04A 1LBWA 5ESYA 5DW8A 1DK4A 4P56A 4PCDA 4JVCA 3W9VA 2Y5KA 3FXBA 3E78A 2B4LA 3GYYA 4QBAA 2PCRA 1JP4A 4N81A 4AS5A 1G0IA 5ET8A 1EYIA 3D1RA 1CNQA 4OVTA 5ET7A 4GWUA 2Q8MA 3RPLB 4HCYA 1BK4A 4F19A 1NI9A 4N17A 1IMEA 1KA1A 2Q9TA 4P1LA 5ET5A 3ISPA 2FIXA 5A5LA 1NUWA 4MCOA 4KXPA 2HXRA 4F18A 2XWKA 1YZ0A 3QMFA 4HXVA 3ROJA 2DE3A 4NQ8A 5JK4A 4PFRA 2HZLA 2L5VA 4PGPA 1FBDA 2JJKA 2WBBA 3B50A 2WX9A 4F1VA 1RDZA 3NOHA 4OVRA 4GX6A 1YXIA 4XEQA 3SZPA 1NUYA 3PTYA 5J16A 4N4UA 4N91A 1EYJA 1LBZA 5I3SA 4P1EA 1RDYA 4OVPA 3A29A 1NUXA 1NV3A 3W9WA 1FPKA 1FBCA 3LV0A 4PTKA 4YZZA 1K9YA 1NV5A 4N6KA 3B8BA 1EYKA 1D9QA 2XWOA 4NGUA 4PDDA 5F24A 2B4MA 4OVSA 1IMAA 3U65A 2WEFA 4I3EA 4NF0A 4OANA 2QVVA 1FBGA 4FBPA 4JVDA 4MIJA 5CM6A 4OA4A 2F5XA 1Q9DA 1FPGA 3T0JA 2XXKA 4P3LA 5J1DA 1NV4A 4MHFA 2DE2A 1FBPA 3MYUA 4GBVA 4MNCA 4G61A 5IM2A 1FPFA 2BJIA 4O7IA 5EQ8A 2HHMA 4MMPA 4YICA 3KBZA 4XF5A 2KR0A 4PAKA 2PFYA 2WYKA 5EYGA 4H46A 2DDKA 4X8RA 2CZIA 1LBXA 1XI6A 4GWSA 4N15A 1FTAA 5EYHA 4F1UA 2HPGA 5LTCA 4AS4A 4P9KA 5IZZA 4DI4B 1DBZA 1FPEA 2QPQA 4PFBA 2FHYA 2R8TA 4PBQA 4PAFA 4GWXA 4P8BA 1FRPA 2V3QA 2VPNA 4GX3A 1FJ9A 2CEXA 1LBYA 2P3VA 4LN5A 4MNIA 4NHBA 4PC9A 2WYPA 4X9TA 4XFEA 1FPIA 2FIEA 4MAGA 4N6DA 2XWIA 1NV1A 2DE4A 4NAPA 1NV7A 4HE1A 4GWWA 1NV0A 2QFLA 4GX4A 4H45A 3CHGA 1FPBA 2CZHA 4JVIA 4MNPA 1AWBA 1KA0A 2QVRA 4HE2A 5EQAA 4O7MA 2FVZA 2Q74A 5I5PA 2F3DA 4DI3D 1KZ8A 3BIGA 1FPJA 3KC0A 5ET6A 1FSAA 1IMDA 1DCUA 3BIHA 3IFAA 4MJOA 4QXDA 5IZ1A 2ZZVA 3KC1A 5IZ3B 1FPDA 3MSTA 1NUZA 2OWZA 5I7IA 4IR8A 2OX3A 4PF6A 2V4CA 4MEVA 4UABA 3FBPA 5LDZA 2XA5A 1G0HA 4OVQA 1IMCA 1IMBA 2PFZA 2FBPA 2CZKA 4MX6A 4N8GA 4NX1A 1FBFA 2ZZWA 5EQ9A 1INPA 3EKIA 2WBDA 1NV2A 4I40A 2P3NA 2VT5A 2VPOA 2DVZA 4GWZA 2HZKA 1RDXA 2QVUA 1LBVA 4P47A 1FBEA 4O94A 4NN3A 4HCWA 1FPLA 2GQ1A 4HE0A 3RYDA 2MKZA 2CEYA 1FJ6A 1LEVA 5IZ3A 5T3JA 4I3YA 1K9ZA 2KQZA 3HFUA 1YYZA 3IFCA 5FBPA 4N8YA 3RPLA 3LUZA 5EQ7A 4PGNA 2Y5LA 4PBHA 2ZZXA 2XWVA 4PF8A 4PDHA 4O8MA 4GWYA 1QGXA 1IMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPI A;  1FBH A;  1VDW A;  2F3B A;  4GBW A;  1NV6 A;  1LBW A;  5ESY A;  5DW8 A;  1DK4 A;  2Y5K A;  2PCR A;  1JP4 A;  4N81 A;  4AS5 A;  1G0I A;  5ET8 A;  1EYI A;  3D1R A;  1CNQ A;  5ET7 A;  4GWU A;  2Q8M A;  3RPL B;  1BK4 A;  1NI9 A;  1IME A;  1KA1 A;  5ET5 A;  2FIX A;  5A5L A;  1NUW A;  4KXP A;  1YZ0 A;  3QMF A;  4HXV A;  3ROJ A;  1FBD A;  2JJK A;  2WBB A;  1RDZ A;  4GX6 A;  1YXI A;  1NUY A;  5J16 A;  1EYJ A;  1LBZ A;  5I3S A;  1RDY A;  3A29 A;  1NUX A;  1NV3 A;  1FPK A;  1FBC A;  3LV0 A;  4PTK A;  1K9Y A;  1NV5 A;  3B8B A;  1EYK A;  1D9Q A;  5F24 A;  1IMA A;  2WEF A;  4I3E A;  2QVV A;  1FBG A;  4FBP A;  1Q9D A;  1FPG A;  3T0J A;  1NV4 A;  1FBP A;  4GBV A;  4G61 A;  1FPF A;  2BJI A;  4O7I A;  5EQ8 A;  2HHM A;  3KBZ A;  5EYG A;  4H46 A;  2DDK A;  2CZI A;  1LBX A;  1XI6 A;  4GWS A;  1FTA A;  5EYH A;  4AS4 A;  1DBZ A;  1FPE A;  2FHY A;  2R8T A;  4GWX A;  1FRP A;  4GX3 A;  1FJ9 A;  1LBY A;  2P3V A;  1FPI A;  2FIE A;  1NV1 A;  1NV7 A;  4HE1 A;  4GWW A;  1NV0 A;  2QFL A;  4GX4 A;  4H45 A;  1FPB A;  2CZH A;  1AWB A;  1KA0 A;  2QVR A;  4HE2 A;  5EQA A;  2FVZ A;  2Q74 A;  2F3D A;  1KZ8 A;  3BIG A;  1FPJ A;  3KC0 A;  5ET6 A;  1FSA A;  1IMD A;  1DCU A;  3BIH A;  3IFA A;  4MJO A;  4QXD A;  5IZ1 A;  3KC1 A;  5IZ3 B;  1FPD A;  1NUZ A;  2OWZ A;  4IR8 A;  2OX3 A;  3FBP A;  5LDZ A;  1G0H A;  1IMC A;  1IMB A;  2FBP A;  2CZK A;  1FBF A;  5EQ9 A;  1INP A;  2WBD A;  1NV2 A;  4I40 A;  2P3N A;  2VT5 A;  4GWZ A;  1RDX A;  2QVU A;  1LBV A;  1FBE A;  1FPL A;  2GQ1 A;  4HE0 A;  3RYD A;  1FJ6 A;  1LEV A;  5IZ3 A;  5T3J A;  4I3Y A;  1K9Z A;  1YYZ A;  3IFC A;  5FBP A;  3RPL A;  3LUZ A;  5EQ7 A;  2Y5L A;  4GWY A;  1QGX A;  1IMF A; 
#chains in the Genus database with same CATH topology
 4PFI A;  1TWY A;  4F3G A;  1NV6 A;  4FEB A;  1XC1 A;  1TFD A;  4F3S A;  5H8Q B;  2ONS A;  5F1Q A;  1CNQ A;  1MXY A;  3LSX A;  2O6A A;  3PPN A;  5ITP A;  2O69 A;  5I59 B;  3S9M C;  2HXR A;  2VGQ A;  3MZ9 A;  2F6P A;  1O64 A;  1VR5 A;  1A8E A;  1N0T A;  1QJM A;  3OSQ A;  1DTZ A;  1MDQ A;  1NKX A;  3VV5 A;  1RDY A;  1SBP A;  1FBC A;  1Y20 A;  1BTJ A;  3N26 A;  4GIZ A;  2O51 A;  5F24 A;  2B4M A;  4OVS A;  1P1U A;  4OEU A;  1B7H A;  4NF5 A;  3SKP A;  1LFI A;  3U92 A;  3K00 A;  1NNK A;  3KBZ A;  4XF5 A;  2F7C A;  4U4S A;  1R9L A;  5I56 B;  3QIM A;  3EQ1 A;  2BJJ X;  2GHB A;  3CSG A;  3HHF A;  4NHB A;  1FQF A;  4NTL A;  2PBW A;  4G8M A;  3TCG A;  3TOD A;  2DOJ A;  3VLU A;  3BKI B;  4N07 A;  3JV9 A;  1IZ1 A;  2E1S A;  2UYF A;  4R2F A;  3CFZ A;  3LR1 A;  2REG A;  2H5Y A;  1IMC A;  4FIM A;  4BLA A;  1LB9 A;  4NF6 A;  4R6Y A;  4O94 A;  3MPL A;  4NWD A;  2KQZ A;  1MQG A;  3U1O A;  5I7I A;  1YYZ A;  1Y9U A;  3SDF A;  1QUK A;  1ZU0 A;  5I84 A;  3FD3 A;  3E4R A;  1JW5 A;  3FAS A;  4BDN A;  3HHG A;  2XXT A;  1B0H A;  3PPO A;  3VE1 B;  3FV1 A;  4DXU A;  1LCT A;  2Q9T A;  4MCO A;  4QRZ A;  4HXV A;  2HZL A;  4PGP A;  2W7Y A;  1UIV A;  4IO5 A;  2UVG A;  3SZP A;  2GRV A;  2XXI A;  3G3F A;  3FUZ A;  3V8X B;  1RYX A;  3M8U A;  3PD8 A;  2Y84 A;  4ZDM A;  4LVQ A;  1K9Y A;  4G2Z A;  4KI0 E;  2XXU A;  3MQ9 A;  4YKK A;  1P1O A;  4DXB A;  1B3G A;  5F7V A;  5J1D A;  3MWB A;  2HFB A;  1NV4 A;  1MG1 A;  4G61 A;  4F39 A;  1MY1 A;  1XVX A;  1FQC A;  1QKA A;  1MXX A;  1Y4C A;  1T0K A;  5I2N B;  5EYH A;  3TEL A;  3KJT A;  5EHM A;  5K2Y A;  5I59 A;  2VHA A;  2Y7I A;  4EQ9 A;  3IO4 A;  2KLF A;  5AA4 B;  2WYP A;  4IB2 A;  3BBR A;  2FIE A;  4ESW A;  2DE4 A;  5CRY A;  4G68 C;  4HE2 A;  4H8J A;  3FGS A;  2I0B A;  4RYA A;  4R72 A;  2O1L A;  2ZZV A;  4TOZ A;  1F9B A;  1I6Q A;  5DTB A;  1LB8 A;  4G8H A;  1SI0 A;  3MW0 A;  3C31 A;  1NV2 A;  4I40 A;  3O6G A;  3PD9 A;  3MZB A;  4ZE9 A;  1VFD A;  5M2V A;  3KOS A;  1FJ6 A;  1UTH B;  4I3Y A;  1N7X A;  5FBP A;  4PFW A;  2XWV A;  5I57 B;  5IAI A;  1WDN A;  5AA4 A;  2GH9 A;  3T1B A;  1H3D A;  3MC2 A;  4M1V A;  2P1S A;  1D9Y A;  1I69 A;  1FQE A;  1DPE A;  5BWJ A;  3TTK A;  5CC2 A;  2L5V A;  3I5O A;  2WBB A;  4MLV A;  4LON B;  1PEB A;  1J1N A;  3THI A;  2Q2C A;  4OVP A;  2F36 A;  1IXI A;  4QFO A;  1JEU A;  3B8B A;  2Q89 A;  4UAC A;  1IQ7 A;  4WEP A;  3T0J A;  3TQW A;  2GFE A;  4OEN A;  1UIU A;  2ESN A;  3O6I A;  1XT8 A;  1LBX A;  3OOA A;  3N5L A;  2V25 A;  3C36 A;  2ZMB A;  1PB7 A;  4PAF A;  1A99 A;  1MY4 A;  4PC9 A;  3K6W A;  1TFA A;  3CR9 A;  4XFE A;  2R71 A;  3TYH A;  1NV7 A;  4QSD A;  2QFL A;  4GX4 A;  3CHG A;  1FPB A;  1OMP A;  3OEL A;  3BIG A;  5ET6 A;  1ZMG A;  3RGY A;  4IY5 A;  4MEV A;  1B7U A;  4FEC A;  1IMB A;  4AB5 A;  5L8D A;  1EZ9 A;  5DEX A;  1PDA A;  4HTG A;  3HFU A;  1K9Z A;  3RPL A;  4PDH A;  3TMG A;  4F3B A;  4U21 A;  1XS5 A;  2B65 A;  3VVD A;  1FTM A;  5K2X A;  3FXB A;  2P0S A;  3RPL B;  3CSB A;  3Q27 A;  3TFL A;  2I49 A;  2F78 A;  3PUX E;  4N17 A;  2I0C A;  3GLB A;  4GWO A;  1HSE A;  5A5L A;  3SEY A;  2WX9 A;  3LC8 A;  4OVR A;  4H0W A;  5FHO A;  3R7X A;  1Q1K A;  3N6T A;  4N91 A;  3U94 A;  5KDT A;  3EHT A;  3LV0 A;  3U65 A;  3IK6 B;  1IMA A;  4LP2 B;  5H8H B;  3TAJ A;  4BDQ A;  2H99 A;  4FAJ A;  4OA4 A;  1JVX A;  4KQP A;  3HST A;  2RF1 A;  2DE2 A;  1M5C A;  2BJI A;  2Y7P A;  3BFT A;  1BLF A;  2F35 A;  4KCD A;  2DDK A;  4JWO A;  3C32 A;  1DOT A;  3QAX A;  3LSL A;  5H8Q A;  5ELV A;  2FHY A;  1US4 A;  1FJ9 A;  1URS A;  1HSJ A;  1O63 A;  3DM0 A;  3K1P A;  4N6D A;  3T9V A;  1QUI A;  1B4Z A;  4DI3 D;  2XD3 A;  3FZV A;  1ATG A;  4ZEC A;  2PYY A;  2XXY A;  2PFZ A;  1POT A;  1MQD A;  3IB0 A;  3RYD A;  4I1D A;  3IFC A;  4F3P A;  4BDM A;  1US5 A;  4PGN A;  2UVJ A;  2PT2 A;  2LAO A;  5IGA A;  2NUV A;  4X48 A;  1LBW A;  2RC9 A;  1NFT A;  5FTI A;  5H8F A;  4X1B A;  4XXU A;  3M3F A;  3LUY A;  1H76 A;  4OZ9 A;  5ET7 A;  4X1D A;  1S9T A;  1IME A;  5CBR A;  2F7B A;  4DCY A;  4F18 A;  3TTL A;  3LSW A;  4ZZE A;  3UOR A;  4C0R A;  3NOH A;  1LCF A;  1NUY A;  1MM7 A;  4FOR A;  3S2V A;  1EYK A;  1VE4 A;  4I3E A;  2Y7R A;  4LQ5 A;  4LUB A;  3VVE A;  1Y3Q A;  3FVN A;  2HHM A;  4KPT A;  5EYG A;  1EZP A;  1SDX A;  2XXP A;  2ALU A;  4KR5 A;  2V3T A;  1DBZ A;  4QHQ A;  3PV0 E;  4TQU Q;  4P8B A;  4GX3 A;  2P3V A;  4IGR A;  5CMC A;  2D5W A;  4YMA A;  4YU0 A;  4NAP A;  2F3D A;  1FSA A;  1IMD A;  3K1M A;  4OVJ A;  2WKY A;  5JTY B;  1IUD A;  5IZ3 B;  3OSR A;  4LZ5 A;  1GV8 A;  2OJT A;  4BDL A;  4C1U A;  3GXA A;  3T22 A;  4QSE A;  2XA5 A;  3IB2 A;  3MVX A;  3KN3 A;  4BDR A;  2X7P A;  2GQ1 A;  1B58 A;  2MKZ A;  5JTY A;  1B46 A;  3LUZ A;  2YJP A;  3HO7 A;  4I9D A;  4ONY A;  1GTK A;  1QUJ A;  3FVO A;  4UA8 A;  2VP1 A;  2QMW A;  4JVC A;  3W9V A;  2DYX A;  2XXW A;  3E78 A;  1B0L A;  2B4L A;  4AS5 A;  1NI9 A;  2XD2 A;  1A7L A;  2DE3 A;  2JJK A;  2RIN A;  1SW5 A;  3H03 A;  4ELP A;  1YXI A;  4PFU A;  1BKA A;  4R6K A;  1LLS A;  1FTO A;  1MQH A;  3RTW B;  4RA1 A;  2O68 A;  1Y3N A;  3MP1 A;  4F2O A;  1LFG A;  2DVC A;  4BDO A;  2WYK A;  1LAH E;  1XI6 A;  3RLF E;  2HPG A;  3PPP A;  3IOW A;  5I56 A;  1FPE A;  1WVJ A;  2X7Q A;  4PBQ A;  1FRP A;  2AYS A;  4EQ7 A;  1EH3 A;  3FJM A;  4O3B A;  1JVY A;  3MVW A;  3TQL A;  2M8C A;  4R2B A;  4OQO A;  1FTL A;  1AWB A;  5I58 B;  2UYE A;  5I5P A;  4KYD A;  4QF9 A;  3G3G A;  1OQH A;  3HCQ A;  1NUZ A;  4POX A;  4IR8 A;  4OVQ A;  4QFK A;  4F31 B;  1INP A;  5ICQ A;  3KZG A;  2QS4 A;  3K4U A;  4XKQ A;  1R9Q A;  1LEV A;  2ZYO A;  4ZEF A;  1SPI A;  3E79 A;  2F3B A;  4GF8 A;  5L9O A;  3IAZ A;  2F7A A;  4H5G A;  1PBQ A;  1B9J A;  3OEN A;  4RY1 A;  3K1N A;  2XX7 A;  1BK4 A;  4ELR A;  4G68 B;  1N84 A;  3KJ7 A;  4U1O A;  3B6Q A;  3B7D A;  2XWK A;  3ZKL A;  1MH4 A;  3VLV A;  1L5T A;  3ROJ A;  1B7Z A;  3B50 A;  4NWC A;  3B6W A;  1I6B A;  4XEQ A;  3O97 A;  4DE8 A;  2OK2 A;  3PPQ A;  2I3V A;  3CFX A;  3W9W A;  4NGU A;  4YZZ A;  5IKB A;  3T96 B;  2HXW A;  1IXG A;  5CM6 A;  4P3L A;  4NF6 B;  3FVG A;  3KOT A;  5IM2 A;  4O7I A;  4G4P A;  3VDF A;  4IO4 A;  2ANJ A;  2HEU A;  3WAE A;  5DT6 A;  2ZNS A;  4GWS A;  3U8Q A;  1VSO A;  3E13 X;  4O3C A;  1P99 A;  2F97 A;  1KWH A;  3TTR A;  3QUF A;  3TZA A;  4MNI A;  1A8F A;  4YAH X;  4PFT A;  4ND9 A;  4H45 A;  4MNP A;  4F19 A;  2Q74 A;  4FED A;  1FPJ A;  3KC0 A;  2G93 A;  5IZ1 A;  5B7D A;  2OWZ A;  3C33 A;  2Z22 A;  5DYH A;  1B4H A;  1OIB A;  4TLM B;  3DP8 A;  1MXW A;  3Q25 A;  3IB1 A;  4MX6 A;  4N8G A;  1YAE A;  1GGG A;  4EXL A;  2HZK A;  4ESX A;  4NF5 B;  4Q30 B;  3MVZ A;  2RCB A;  1JNF A;  1SQY A;  3O28 A;  5T3J A;  4RNS A;  3T93 B;  2RKM A;  2I6E A;  4QFL A;  1FBH A;  4PE3 A;  2FNC A;  4FAT A;  3BFU A;  1NNP A;  3K2D A;  4QBA A;  3PUW E;  1SI1 A;  4NF4 B;  3F11 A;  2OCU A;  4XTC Q;  4PE5 B;  1LBC A;  2ONK E;  3KN8 A;  4U2R A;  1B05 A;  4R74 A;  2UXA A;  1OLC A;  5AE4 A;  3DLN A;  1D3K A;  3PTY A;  4RK2 A;  3SEV A;  1NUX A;  4IO3 A;  4GVO A;  4N6K A;  3ILT B;  2XWO A;  3IR1 A;  4XIG Q;  2WEF A;  1ZIU A;  1B3L A;  4THI A;  1OQG A;  2R6G E;  1FPG A;  2F6G A;  1B40 A;  4ZEK A;  3RQT A;  3UK4 A;  3V89 B;  2Z8E A;  4MMP A;  3EHS A;  1VFE A;  3SEU A;  4GQO A;  4OHN A;  1MQI A;  1MY2 A;  4N15 A;  2QRY A;  4ISU A;  4EDP A;  3QSL A;  3I6V A;  3K0V A;  3M3L A;  1A40 A;  5HPQ A;  1N3W A;  1LBY A;  1R6Z A;  2XHD A;  1A55 A;  5AA1 A;  2QSX A;  4LA9 A;  3LSF B;  1AL3 A;  1H44 A;  4RPO A;  2H98 A;  4K3F A;  4R9G A;  3C4M A;  1D9V A;  4H6D A;  4UAB A;  1G0H A;  2H4I A;  3CVG A;  4Q8R A;  3PPR A;  3KGC A;  1EU8 A;  2QS3 A;  4YB7 A;  4YMB A;  1UTB B;  3G3K A;  4N13 A;  4HCW A;  5B70 A;  4GL0 A;  3SEX A;  3FJG A;  1XHY A;  4PBH A;  3MJN A;  2Y5L A;  2I4C A;  1FBD A;  4PET A;  3A09 A;  4PAI A;  3D4C A;  4P56 A;  3D4G A;  2QJE A;  1GVC A;  1JP4 A;  4JDF A;  5KCJ A;  3RUM A;  3D1R A;  3TCF A;  1FQB A;  2ZNU A;  3QYT A;  4NQ8 A;  1I6A A;  2ZYM A;  4PFR A;  4F1V A;  1DTG A;  2DS9 A;  4G8N A;  4N4U A;  4WXJ A;  3TUS A;  1LBZ A;  1H45 A;  4EXK A;  3A29 A;  5H8H A;  1NV5 A;  3P7I A;  3O6H A;  2F5X A;  4GBV A;  4DIG A;  3A3C A;  1OLA A;  3S9L C;  5CMB A;  2DQV A;  3N6U A;  1D4N A;  4F1U A;  4ELO A;  1S50 A;  2VPN A;  4GOT A;  2OBG A;  4LN5 A;  3U72 A;  5TP9 B;  3PUZ E;  2F8D A;  3U93 A;  5HM4 B;  2QVR A;  2FVZ A;  1LAG E;  3IFA A;  4QXD A;  3H6T A;  3MP6 A;  5DEX B;  1MM6 A;  4QSC A;  1EZO A;  5LDZ A;  4NX1 A;  2G29 A;  4YKP A;  4ELQ A;  1FTJ A;  5KZT A;  3VVF A;  1B51 A;  1FBE A;  3L6H A;  3KBR A;  5JEI A;  3MZ1 A;  4PF8 A;  3OO9 A;  2REJ A;  1IMF A;  3N94 A;  3FXR A;  2FA7 A;  1B1H A;  2A5S A;  4OEV A;  2HCA A;  4PCD A;  1N76 A;  1AH5 A;  4NE4 A;  4R73 A;  1EYI A;  3O9P A;  2HQ0 A;  3EPE A;  1CB6 A;  5DVI A;  3C9H A;  1B1X A;  3C34 A;  2OWT A;  4OFL A;  1QVS A;  4EQB A;  1RDZ A;  4Q5T A;  4ZEB A;  2THI A;  2RCA A;  4PTK A;  3RY3 A;  3IOU A;  1M5F A;  4IY6 A;  2ZXT A;  4NF0 A;  1Q9D A;  5H8N B;  1MS7 A;  4GLI A;  2RC8 A;  1AIV A;  2D3I A;  3FVK A;  3E3K A;  3I3V A;  4OER A;  4QFP A;  4DI4 B;  2ABH A;  2QPQ A;  3EN3 A;  3SEW A;  4GWX A;  2V3Q A;  2CEX A;  2HAV A;  5KCJ B;  1Y1M A;  5CMM A;  4GWW A;  3UA8 A;  3S9N C;  5HBC A;  3H7M A;  3PUY E;  1UTH A;  3UGW A;  2PMS A;  3GBA A;  4MJO A;  1P1W A;  2OX3 A;  1MXZ A;  1Y4T A;  4E0X A;  1NNT A;  5TPA A;  3IO6 A;  4KCC A;  3OEM A;  1MY3 A;  3CFL A;  2CZK A;  1FBF A;  3H6V A;  4P11 A;  2DVZ A;  2QVU A;  4H67 A;  1Y3P A;  5FHM A;  3K6U A;  3OO6 A;  1QGX A;  3TPA A;  3OEK A;  2OZZ A;  3GBB A;  2Q2A A;  3Q26 A;  4MF3 A;  4Z0I A;  4AQ4 A;  3V83 A;  3IJO B;  4GWU A;  5I2N A;  4GXA A;  1KA1 A;  4KXP A;  2O1M A;  3KFM A;  4NF8 B;  1NMU A;  3QMF A;  2B3F A;  1FQA A;  2NXO A;  4O3A A;  4MLQ A;  5H8N A;  3H3G A;  3JYR A;  2E0S A;  3OO7 A;  4JWX A;  1B5I A;  2H25 A;  2NVU B;  1B52 A;  2DWI A;  1R1N A;  2NOO A;  2IEE A;  3H6W A;  1USY E;  4OAN A;  3WAF A;  1DPP A;  5L9S A;  2XXK A;  3ECR A;  3QUJ A;  1FPF A;  1QUL A;  2DWJ A;  4AB6 A;  2KR0 A;  3TTN A;  2PFY A;  1MPD A;  3DEL B;  4RK9 A;  1B32 A;  4P9K A;  1ZKB A;  1MQJ A;  2R8T A;  3R6U A;  1IXH A;  1FPI A;  1TXF A;  4MAG A;  1NV1 A;  4M4G A;  3FJ7 A;  1PB8 A;  2CZH A;  3PUV E;  1KA0 A;  2P2A A;  2CZL A;  4OYV A;  2GHA A;  4R75 A;  4OMB A;  3IOR A;  3FBP A;  1B5J A;  5A5X B;  3T9H B;  2DXR A;  2ZZW A;  1PB9 A;  2DWH A;  1PC3 A;  5FTH A;  4ZE8 A;  2ZNT A;  1QKB A;  2Y7W A;  1SW1 A;  3ZS6 A;  4RXL A;  3UP9 A;  2XX9 A;  1MY0 A;  1DSN A;  1FTK A;  3C35 A;  3MUQ A;  1MRP A;  3MP8 A;  4X04 A;  1IEJ A;  1JQF A;  2F34 A;  5EYF A;  2PCR A;  5ET8 A;  1NL5 A;  4OVT A;  3KN7 A;  1LBB A;  1NH7 A;  1NUW A;  1URG A;  3IOT A;  1DMB A;  4XKN A;  1N7W A;  1H43 A;  3CI8 A;  2Y7K A;  2V93 A;  2QS2 A;  1EYJ A;  1AMF A;  2OPE A;  4ZED A;  4JVD A;  3QXM A;  4P0I A;  4PFY A;  1BIY A;  2O84 X;  5CI5 A;  5BUU A;  4EF1 A;  4EUO A;  1FW0 A;  5AA2 A;  4R6H A;  2V3U A;  4X8R A;  1MH3 A;  3FIR A;  1FTA A;  4HS7 A;  2XXH A;  5IZZ A;  1MXU A;  2D21 A;  4GFR A;  4H8I A;  2OPD A;  2XWI A;  1Z7N E;  3FV2 A;  1HSL A;  4YB6 A;  4LQ2 A;  1JEV A;  2AIX A;  1UTB A;  1MPB A;  3MST A;  1LST A;  1JET A;  3SER A;  2I3W A;  5AA2 B;  1NH8 A;  3HV1 A;  1M5E A;  3KSX A;  1B6H A;  1JW1 A;  1YTV A;  1MXV A;  4R9F A;  4F22 A;  1B5H A;  3UN6 A;  2P3N A;  3LBS A;  3T9U A;  3UIF A;  1FCK A;  2CEY A;  3VFJ A;  2I48 A;  5KDT B;  5EQ7 A;  4IO6 A;  1N3X A;  4PDD A;  4GWY A;  3OD7 A;  3H4Z A;  2O7I A;  4MBP A;  4GL8 A;  4ZS9 A;  4GBW A;  1ZBM A;  5DW8 A;  3G3I A;  2Y5K A;  1B3F A;  1LFH A;  4KFQ A;  3GYY A;  5DVJ A;  5I2K A;  1IXC A;  4KYS A;  2Q8M A;  4KD5 A;  4OFO A;  3M3K A;  1XVY A;  3TEP A;  1O7T A;  2A5T A;  4XKP A;  2YLN A;  5I3S A;  4P1E A;  1FQD A;  1Q35 A;  1GR2 A;  1Z7M E;  4OFJ A;  3TCH A;  4FBP A;  1Y1Z A;  5ICT A;  3DP4 A;  4MHF A;  3PU5 A;  1FBP A;  4MNC A;  5A5X A;  4JSO A;  5EHS A;  3SET A;  3CG1 A;  1BP5 A;  5LTC A;  3RT6 B;  4NF4 A;  4YKJ A;  4AS4 A;  3IJX B;  4GD5 A;  4YB5 A;  4JXI A;  1RYO A;  5LOM A;  2VD3 A;  2IA4 A;  3W15 C;  4WED A;  3VXC A;  3PMX A;  2I4B A;  1SVX B;  2V84 A;  1ZJL A;  3FAT A;  4H5F A;  3KG2 A;  1SYI A;  1YPN A;  1B3E A;  3ODB A;  3T9X B;  1ANF A;  2NWJ A;  3HPI A;  4TLL B;  4FE8 A;  2ONR A;  3OO8 A;  3PGF A;  3IL1 B;  5L9M A;  1OVT A;  4LZ7 A;  4PQJ A;  3A3U A;  1B2H A;  3EKI A;  2XX8 A;  4F29 A;  1RDX A;  1LBV A;  4NN3 A;  5IZ3 A;  2AL5 A;  3Q28 A;  1OVB A;  1SW2 A;  4NG7 A;  5ESY A;  1WOD A;  4LZ8 A;  2OLB A;  3H6U A;  3ZKK A;  1G0I A;  1N04 A;  4DLD A;  5AA3 A;  2YPN A;  5ET5 A;  2FIX A;  3FXQ A;  1P1Q A;  2AL4 A;  5JK4 A;  4U4X A;  3KSJ A;  1SD3 A;  5J16 A;  1ZTY A;  5I57 A;  1TT1 A;  1AOV A;  3G3J A;  4E0W A;  3B6T A;  1B3H A;  4GRK A;  1ELJ A;  4GXS B;  4OWD A;  2XXR A;  2DWA A;  5DVF A;  4NMY A;  2FYI A;  3VLW A;  4XKR A;  5TP9 A;  4I8C A;  2A5T B;  4OET A;  4DZ1 A;  4PFB A;  4JVI A;  3PMV A;  2R9J A;  2VD2 A;  1KZ8 A;  3TTM A;  4ECF A;  1II5 A;  1MPC A;  3R26 A;  3O29 A;  4Q0C A;  4QFN A;  4ZZA A;  1FPD A;  2Z8D A;  2V4C A;  4DXC A;  3ZSF A;  2XXV A;  2UVI A;  2I58 A;  4EF2 A;  5FHN A;  1S7Y A;  4YKI A;  2UVH A;  4N6P A;  3OMB A;  4WKM A;  4GWZ A;  3DP6 A;  3K02 A;  5ITO A;  5ISU A;  4MFI A;  4U22 A;  3MAM A;  4MH5 A;  5I58 A;  4IO2 A;  1LAF E;  1URD A;  3S9E A;  4JB7 A;  3SES A;  3T66 A;  3S4U A;  1LGB C;  1USY H;  3JZJ A;  4N81 A;  4U23 A;  3QK6 A;  1PBP A;  4JSD A;  4P1L A;  1YZ0 A;  1UQW A;  4RJZ A;  1IIW A;  1M5B A;  2DXY A;  4Z7E A;  3O2A A;  3TDJ A;  4GX6 A;  1NV3 A;  1D9Q A;  4H65 A;  4LAT A;  2PT1 A;  3RN8 A;  3AXF A;  2CMO A;  2QVV A;  1FBG A;  4MIJ A;  4JBZ A;  4F2Q A;  4OES A;  5H8S A;  3RPW A;  3VXB A;  2RC7 A;  4DDD A;  2Q8J A;  4PAK A;  1CE2 A;  4H46 A;  1IIT A;  2CZI A;  3H06 B;  2Z8F A;  2XXX A;  3V5A A;  4RPN A;  3ILU B;  5TU0 A;  1NNF A;  4FJP A;  4ZEI A;  4P0G A;  2QS1 A;  3CRB A;  1SW4 A;  3EHU A;  1NV0 A;  4HW8 A;  3HN0 A;  1YCJ A;  5AA2 D;  2ZYN A;  4F1Y A;  1LAX A;  4OTE A;  4KHZ E;  3KC1 A;  4IGT A;  4PF6 A;  2O7U A;  1XOC A;  1QW0 A;  4OXV A;  1RKM A;  3IOV A;  4L17 A;  1SYH A;  5CBS A;  3K01 A;  2WBD A;  2HAU A;  3FXU A;  2VT5 A;  3E9X A;  3GZG A;  1FPL A;  2QMX A;  2ZYK A;  2VOZ A;  4N8Y A;  3TKD A;  4O8M A;  4JWY A;  1VDW A;  1DK4 A;  3G7W A;  2Z23 A;  4IO7 A;  3MVY A;  4HCY A;  3ISP A;  4KYE A;  2PX1 A;  1MDP 1;  2DSF A;  2X26 A;  1ZLQ A;  4I62 A;  5CMK A;  1FPK A;  3O66 A;  3RT8 A;  4U1Z A;  1M5D A;  1JW4 A;  4G77 A;  2DP8 A;  3PMW A;  4NED A;  3MYU A;  4DCX A;  5EQ8 A;  4H1X A;  4YIC A;  3L6G A;  3Q29 A;  2B3B A;  3IX1 A;  3K6X A;  2OWS A;  5I2K B;  3CG3 A;  4NF8 A;  5H8F B;  2H9B A;  3EF7 A;  2XXQ A;  3RNN A;  3CIJ A;  3RTF B;  3K6V A;  4X9T A;  4HE1 A;  1A54 A;  2Q88 A;  4O7M A;  5EQA A;  2PVU A;  4POW A;  3ONM A;  1DCU A;  3BIH A;  4PP0 A;  3G3H A;  3MBP A;  3MPK A;  3OXN A;  2QL3 A;  2FBP A;  1P1N A;  1POY 1;  3KEI A;  4C1T A;  5EQ9 A;  2VPO A;  5TPA B;  3USD A;  4P47 A;  4HE0 A;  4G68 A;  2ZZX A; 
#chains in the Genus database with same CATH homology
 4PET A;  1SPI A;  4PFI A;  3T1B A;  1FBH A;  1VDW A;  3E79 A;  5IGA A;  2F3B A;  4GBW A;  4PE3 A;  4NG7 A;  1NV6 A;  4PAI A;  4M1V A;  4X04 A;  1LBW A;  5ESY A;  5DW8 A;  1DK4 A;  4P56 A;  4PCD A;  4JVC A;  3W9V A;  2Y5K A;  3FXB A;  3E78 A;  2B4L A;  3GYY A;  4QBA A;  2PCR A;  1JP4 A;  4N81 A;  4AS5 A;  1G0I A;  5ET8 A;  1EYI A;  3D1R A;  1CNQ A;  4OVT A;  5ET7 A;  4GWU A;  2Q8M A;  3RPL B;  4HCY A;  1BK4 A;  4F19 A;  1NI9 A;  4N17 A;  1IME A;  1KA1 A;  2Q9T A;  4P1L A;  5ET5 A;  3ISP A;  2FIX A;  5A5L A;  1NUW A;  4MCO A;  4KXP A;  2HXR A;  4F18 A;  2XWK A;  1YZ0 A;  3QMF A;  4HXV A;  3ROJ A;  2DE3 A;  4NQ8 A;  5JK4 A;  4PFR A;  2HZL A;  2L5V A;  4PGP A;  1FBD A;  2JJK A;  2WBB A;  3B50 A;  2WX9 A;  4F1V A;  1RDZ A;  3NOH A;  4OVR A;  4GX6 A;  1YXI A;  4XEQ A;  3SZP A;  1NUY A;  3PTY A;  5J16 A;  4N4U A;  4N91 A;  1EYJ A;  1LBZ A;  5I3S A;  4P1E A;  1RDY A;  4OVP A;  3A29 A;  1NUX A;  1NV3 A;  3W9W A;  1FPK A;  1FBC A;  3LV0 A;  4PTK A;  4YZZ A;  1K9Y A;  1NV5 A;  4N6K A;  3B8B A;  1EYK A;  1D9Q A;  2XWO A;  4NGU A;  4PDD A;  5F24 A;  2B4M A;  4OVS A;  1IMA A;  3U65 A;  2WEF A;  4I3E A;  4NF0 A;  4OAN A;  2QVV A;  1FBG A;  4FBP A;  4JVD A;  4MIJ A;  5CM6 A;  4OA4 A;  2F5X A;  1Q9D A;  1FPG A;  3T0J A;  2XXK A;  4P3L A;  5J1D A;  1NV4 A;  4MHF A;  2DE2 A;  1FBP A;  3MYU A;  4GBV A;  4MNC A;  4G61 A;  5IM2 A;  1FPF A;  2BJI A;  4O7I A;  5EQ8 A;  2HHM A;  4MMP A;  4YIC A;  3KBZ A;  4XF5 A;  2KR0 A;  4PAK A;  2PFY A;  2WYK A;  5EYG A;  4H46 A;  2DDK A;  4X8R A;  2CZI A;  1LBX A;  1XI6 A;  4GWS A;  4N15 A;  1FTA A;  5EYH A;  4F1U A;  2HPG A;  5LTC A;  4AS4 A;  4P9K A;  5IZZ A;  4DI4 B;  1DBZ A;  1FPE A;  2QPQ A;  4PFB A;  2FHY A;  2R8T A;  4PBQ A;  4PAF A;  4GWX A;  4P8B A;  1FRP A;  2V3Q A;  2VPN A;  4GX3 A;  1FJ9 A;  2CEX A;  1LBY A;  2P3V A;  4LN5 A;  4MNI A;  4NHB A;  4PC9 A;  2WYP A;  4X9T A;  4XFE A;  1FPI A;  2FIE A;  4MAG A;  4N6D A;  2XWI A;  1NV1 A;  2DE4 A;  4NAP A;  1NV7 A;  4HE1 A;  4GWW A;  1NV0 A;  2QFL A;  4GX4 A;  4H45 A;  3CHG A;  1FPB A;  2CZH A;  4JVI A;  4MNP A;  1AWB A;  1KA0 A;  2QVR A;  4HE2 A;  5EQA A;  4O7M A;  2FVZ A;  2Q74 A;  5I5P A;  2F3D A;  4DI3 D;  1KZ8 A;  3BIG A;  1FPJ A;  3KC0 A;  5ET6 A;  1FSA A;  1IMD A;  1DCU A;  3BIH A;  3IFA A;  4MJO A;  4QXD A;  5IZ1 A;  2ZZV A;  3KC1 A;  5IZ3 B;  1FPD A;  3MST A;  1NUZ A;  2OWZ A;  5I7I A;  4IR8 A;  2OX3 A;  4PF6 A;  2V4C A;  4MEV A;  4UAB A;  3FBP A;  5LDZ A;  2XA5 A;  1G0H A;  4OVQ A;  1IMC A;  1IMB A;  2PFZ A;  2FBP A;  2CZK A;  4MX6 A;  4N8G A;  4NX1 A;  1FBF A;  2ZZW A;  5EQ9 A;  1INP A;  3EKI A;  2WBD A;  1NV2 A;  4I40 A;  2P3N A;  2VT5 A;  2VPO A;  2DVZ A;  4GWZ A;  2HZK A;  1RDX A;  2QVU A;  1LBV A;  4P47 A;  1FBE A;  4O94 A;  4NN3 A;  4HCW A;  1FPL A;  2GQ1 A;  4HE0 A;  3RYD A;  2MKZ A;  2CEY A;  1FJ6 A;  1LEV A;  5IZ3 A;  5T3J A;  4I3Y A;  1K9Z A;  2KQZ A;  3HFU A;  1YYZ A;  3IFC A;  5FBP A;  4N8Y A;  3RPL A;  3LUZ A;  5EQ7 A;  4PGN A;  2Y5L A;  4PBH A;  2ZZX A;  2XWV A;  4PF8 A;  4PDH A;  4O8M A;  4GWY A;  1QGX A;  1IMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...