3IFCA

Human muscle fructose-1,6-bisphosphatase e69q mutant in complex with amp and alpha fructose-6-phosphate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
323
Chain Sequence
DMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 323
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3ifcA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3ifcA02
1LBYA 4HXVA 3BIGA 3FBPA 4FBPA 1LBVA 2PCRA 4I3YA 3KBZA 1FBFA 1RDZA 2F3DA 5T3JA 3RPLB 2F3BA 2Q74A 2CZKA 1DBZA 1YXIA 4KXPA 3QMFA 1NUWA 2QFLA 1EYIA 5ET8A 1KA0A 2QVRA 4IR8A 4GBVA 4AS4A 1NUZA 4GX4A 4O7IA 2WBDA 2HHMA 2VT5A 1NV2A 1FTAA 2FBPA 1NV4A 1FSAA 1FRPA 1FPFA 1AWBA 1IMBA 1IMFA 1FBPA 5I3SA 1LBZA 2Y5LA 2FHYA 2P3VA 2CZHA 3T0JA 2WEFA 1FJ9A 5IZ1A 4GX3A 4GBWA 3BIHA 2BJIA 4GWXA 5IZ3A 1FPEA 1IMDA 3LUZA 2JJKA 1FPBA 1K9ZA 4GWZA 1NV5A 5ET6A 4AS5A 3RYDA 1FBEA 1FPIA 1FPJA 1NUYA 2QVUA 4I3EA 1LBWA 1FPLA 1NI9A 2FVZA 4MJOA 5ESYA 4GWUA 1FBDA 3KC0A 1SPIA 2FIEA 4GWWA 1KZ8A 5ET5A 3A29A 4N81A 3KC1A 5DW8A 1FPDA 4GWYA 1EYJA 2OX3A 4HE0A 1DK4A 2QVVA 4GX6A 1VDWA 5LDZA 5IZ3B 4H46A 1FBGA 5F24A 1IMAA 1FBHA 2WBBA 4G61A 1FJ6A 3D1RA 1CNQA 2Y5KA 1XI6A 1YZ0A 1Q9DA 1FBCA 1NUXA 2DDKA 4I40A 1D9QA 5A5LA 2GQ1A 5ET7A 4H45A 1JP4A 2FIXA 1NV7A 3B8BA 1IMCA 1IMEA 4HE1A 5EQ7A 1G0IA 2P3NA 1G0HA 1YYZA 1DCUA 1EYKA 1INPA 5EYHA 2CZIA 3RPLA 3IFAA 1FPGA 1RDXA 1LEVA 1NV1A 2R8TA 3LV0A 1K9YA 2OWZA 5EQ9A 5EQ8A 4HE2A 1LBXA 1NV0A 5EQAA 5J16A 1QGXA 3IFCA 2Q8MA 4QXDA 1KA1A 4GWSA 4PTKA 5EYGA 1FPKA 1BK4A 1NV3A 3ROJA 5FBPA 1NV6A 1RDYA
chains in the Genus database with same CATH superfamily
3FBPA 4I9DA 1YTVA 4KR5A 3H6TA 5H8FB 2UXAA 3VLWA 2RINA 1IXIA 2ZYNA 3SKPA 1B9JA 3ONMA 3ZKLA 5JTYA 1MS7A 3K6XA 3KJTA 2NUVA 4GX3A 4ZZEA 3H4ZA 3BIHA 2XXVA 5IZ3A 2Z8EA 2RCBA 5KCJB 2OWTA 1M5BA 1NV5A 5F7VA 1UIVA 1OQHA 5H8QB 2THIA 5I2KB 1DTZA 3USDA 3SETA 3PUXE 4MNPA 3G3IA 4NG7A 1I6QA 3O6HA 3M3FA 4X1BA 2H99A 1USYE 3IL1B 4IO2A 4ISUA 5ET5A 1JW4A 1B05A 1MQHA 5L9SA 3T9XB 4HE0A 1OIBA 4N17A 5F1QA 1RYOA 3IB1A 3R26A 1IZ1A 3WAFA 1JW1A 1MXUA 4OWDA 3M8UA 1B3FA 1G0HA 2DVCA 2OCUA 2X7PA 4PGNA 1WVJA 3QIMA 4ZEBA 4RXLA 2OWZA 4EQ7A 5CBSA 4F22A 2ZNUA 2HAUA 3S9NC 3K6VA 3PMVA 4QBAA 2NWJA 3PPOA 2PYYA 2Q88A 2HQ0A 4KYEA 4I3YA 1POY1 2F35A 4P3LA 3H7MA 2CEYA 2F3DA 4GOTA 4R2BA 4EXKA 2GRVA 1HSEA 2QMWA 4G4PA 2F7AA 1EYIA 2Z23A 4KD5A 1LAHE 4DCYA 3K0VA 1AL3A 1NKXA 5DEXA 1FRPA 1FPFA 1IMBA 3EN3A 3VDFA 3AXFA 4YICA 2RC8A 1ELJA 1P1WA 3KZGA 2KR0A 1TFAA 1ZMGA 2KLFA 2ZNSA 1B7ZA 1NUYA 3MAMA 2DE4A 3IO6A 3C34A 2NOOA 5I56A 2HFBA 3GBAA 5DW8A 4ZS9A 4H67A 1EZPA 4WXJA 4P9KA 3BFTA 2PT2A 4MHFA 4H0WA 3MP6A 1LSTA 2BJJX 4KI0E 3WAEA 3G3GA 2I3WA 4R9GA 3KFMA 3O66A 1A99A 1JETA 3K02A 4MLQA 4JXIA 4YB7A 1GV8A 3BBRA 4EF1A 4NGUA 4BDRA 5LOMA 5J16A 4U4SA 1Z7ME 4QXDA 5FHMA 4KYDA 5EYGA 1I69A 4ND9A 1UTHA 2O68A 3TTLA 3K1MA 1RKMA 4NX1A 3L6GA 4F2QA 1CB6A 4YB5A 4JWXA 2Q74A 3PGFA 4Q5TA 3KN7A 2G93A 4NMYA 3KJ7A 4AS4A 3MVXA 3N6UA 1AOVA 3U1OA 2ESNA 4QFKA 2Y5LA 1RYXA 1OLAA 2DS9A 3PD9A 1BIYA 2DOJA 3G3FA 3MC2A 3IJOB 4R2FA 1B3HA 3MZBA 4PFIA 5B7DA 1XOCA 1B51A 1Y1ZA 2Y84A 1SPIA 2D21A 2XX7A 1KWHA 3DP4A 1DK4A 4H46A 1FBGA 4LVQA 1JVXA 2VD2A 4OA4A 1LFHA 1SDXA 3TUSA 1QVSA 1T0KA 4PE5B 4H45A 2M8CA 3CSBA 3QUJA 3N26A 2R9JA 1QUIA 2I48A 1SVXB 1IXHA 1N7XA 3FXRA 5DVJA 5L9OA 2O69A 2XD3A 3RN8A 3OENA 2I49A 3LV0A 3B6TA 1EZ9A 4E0XA 4OVJA 4YMAA 5FHOA 3S9MC 2PFZA 4LP2B 3PPRA 1M5EA 3ROJA 3IB0A 2DQVA 4MF3A 1LBYA 1A55A 3VV5A 2ZZWA 5CBRA 5H8HB 1UIUA 1MXXA 1FBFA 1EZOA 4G8MA 5AA4A 3S4UA 3GXAA 2PVUA 3UP9A 4KXPA 2QFLA 3MVWA 4PP0A 4EQBA 1Y4TA 4F29A 1MH4A 3IORA 2AIXA 2HHMA 1Q35A 1B3EA 4NWDA 2RC7A 3FASA 2F7CA 3T0JA 4TLLB 1SBPA 4NQ8A 1H43A 5TPAB 4PF8A 4NF5B 3ZS6A 3DELB 3SEXA 3TAJA 5KDTA 4G68B 5CMKA 1NI9A 3M3LA 2A5TB 4N81A 4C1UA 2ZYOA 1EYJA 3DP8A 1NFTA 2I4CA 3D4GA 1QKBA 3K6WA 1F9BA 5AA2D 4ESWA 5HM4B 3MP1A 1XI6A 3V8XB 1NUXA 1JQFA 4LN5A 2GQ1A 3TTMA 3NOHA 3ILTB 2XXRA 3HN0A 4G68C 1IMCA 4HW8A 1IITA 2ZXTA 2F6PA 2XXXA 5H8FA 3OD7A 3CG3A 4DDDA 1N0TA 2Y7IA 4GQOA 2AL4A 2H25A 5TU0A 1ZTYA 4F1UA 4MEVA 2REGA 3TQWA 2H5YA 2VP1A 1RDZA 5KCJA 4TQUQ 3VXCA 4NF4B 5J1DA 4DXBA 3FXBA 2CZKA 5H8QA 4PE3A 5I2KA 1KA0A 2YJPA 4Z0IA 3T9HB 4GX4A 2D5WA 4X1DA 3PMWA 3T93B 4PFUA 3VXBA 4OFOA 4ELQA 4GXAA 5ISUA 3A3CA 1NNFA 3RTWB 2XXHA 3CI8A 5ITOA 1IMDA 4ZE9A 2JJKA 1Y3QA 1P1OA 1FPBA 1JEVA 4UA8A 4P56A 4P8BA 1IQ7A 1LBWA 2VGQA 2XX8A 5IZZA 1MM7A 3RY3A 3GZGA 1BTJA 2UVIA 2DSFA 4KFQA 1MDP1 4HCYA 4ZZAA 4I1DA 4L17A 1XS5A 2B4LA 3DLNA 3T1BA 3H6VA 2YLNA 1YAEA 5AE4A 5I58B 3TTNA 1MY2A 4I40A 3OEMA 3FXQA 1S7YA 3KN8A 2HZLA 5M2VA 3OEKA 2FYIA 5K2YA 4MIJA 2QL3A 1YYZA 4R73A 1DCUA 2DWAA 2QS3A 4YKJA 3FUZA 1P1QA 3VVFA 3O2AA 1TXFA 3THIA 2E0SA 1NV0A 1B1HA 3PUVE 2O7IA 3FVNA 3EPEA 1PC3A 3FVOA 2W7YA 4MAGA 4XKRA 4NWCA 4N91A 2OPDA 4OVRA 1LB8A 3CVGA 4RA1A 3BIGA 2HXWA 2XXTA 4R74A 1R6ZA 4H8IA 2DWJA 4ZE8A 5I84A 3DP6A 3K01A 1NH7A 4MFIA 2QVRA 4F18A 2XA5A 2Q2CA 4U1OA 3W15C 2V4CA 1NV4A 3V89B 5I3SA 2XWVA 3ISPA 3K2DA 1FQDA 5TP9B 4GWXA 3E78A 4HTGA 4GWZA 4GF8A 2Y7RA 4NN3A 1WDNA 4WEDA 1II5A 2DYXA 3MVZA 1Y9UA 3RTFB 1FCKA 1QULA 2VPOA 2Z8FA 4O8MA 2F34A 3KC0A 3TODA 1MPBA 4N07A 2OPEA 1MXVA 2VOZA 3BFUA 4OXVA 2QJEA 5LDZA 3OMBA 1MY0A 2XHDA 5F24A 3B7DA 1LCFA 4FEDA 4G61A 4H65A 3T96B 1Q9DA 4LZ5A 2ZZXA 1N84A 4XIGQ 4F1VA 2B4MA 5JEIA 5HBCA 1INPA 3IOWA 3PUZE 5I2NB 1LEVA 4U1ZA 3R7XA 1K9YA 5EQ9A 4NF8B 4O7MA 3IFCA 2WX9A 2XWKA 3IX1A 4O3CA 3G3HA 2PFYA 1AMFA 2I0CA 3KSJA 3V83A 3LSWA 1XHYA 4FJPA 1UTBB 4FBPA 3HSTA 4JSOA 1SI1A 5LTCA 3KBZA 5AA2B 2O7UA 1IXGA 4FIMA 1DPEA 3G7WA 3QMFA 3FVGA 1MQJA 3K1PA 4GL8A 4ZEIA 5I57B 2DP8A 2WBDA 4POXA 1NV2A 1VSOA 3T9VA 1SYHA 1AWBA 5CM6A 4R9FA 5IZ1A 1CE2A 1I6AA 4OVPA 2BJIA 4YAHX 3I6VA 2F7BA 4KPTA 3C35A 4IO6A 1L5TA 5ET6A 4IO3A 3LR1A 1NNKA 4EDPA 2Z8DA 2V84A 1FTLA 1N7WA 3LC8A 1D9VA 1PB9A 4GWUA 4NAPA 2PMSA 1B3LA 3B6QA 3OELA 3ZSFA 4IY5A 3KC1A 2WYKA 3Q26A 2DXRA 4RYAA 1LAFE 1PDAA 3TCFA 1IMAA 2V25A 1FJ6A 3L6HA 4DI3D 4KYSA 4EXLA 3FJMA 4BDQA 1JP4A 1R9LA 1SD3A 1FQFA 2NXOA 3TELA 3KSXA 3OO9A 5H8NB 2ZYKA 4PFRA 2ANJA 5EHSA 4PAIA 3RGYA 2OLBA 1ZJLA 5EQ8A 3VE1B 2XWOA 1LAXA 2CZLA 1FTOA 1NV6A 4H6DA 3PU5A 2XXUA 3UGWA 3UORA 2PT1A 3F11A 5TPAA 4Q30B 3IOUA 4NF5A 4DI4B 4G2ZA 3C4MA 1IIWA 3LSXA 1DBZA 3KEIA 3OO8A 5ICQA 2ALUA 2PX1A 4U21A 3PV0E 1A54A 2LAOA 2R6GE 2F8DA 4ZECA 1H45A 5L8DA 4QFPA 3JV9A 1Y3PA 2REJA 5B70A 5I5PA 4IGTA 2XD2A 4AS5A 3UIFA 3M3KA 3JZJA 2FVZA 3FXUA 4JBZA 2P0SA 4KCCA 4F3SA 2RKMA 3H6UA 4MNIA 2I58A 4QSEA 3S9LC 3E9XA 4N4UA 1FBCA 3ZKKA 2ONRA 3P7IA 4OVSA 4FAJA 3S9EA 3I3VA 3C9HA 4QHQA 2P3NA 3RQTA 2VHAA 1PBQA 3MUQA 3UK4A 3HFUA 2Q2AA 1FTKA 2KQZA 3FATA 4YU0A 3U72A 4NF4A 1GTKA 1RDXA 3C32A 4P1LA 3FZVA 5H8SA 1IUDA 4PC9A 3TEPA 3LSFB 1MY4A 4HE2A 2RF1A 2Q8MA 1H76A 4PTKA 3IAZA 1NH8A 4H1XA 4ELOA 3EF7A 5ITPA 4LQ2A 2PCRA 4I8CA 3FV2A 3MZ1A 4DLDA 2UYFA 1B46A 1B0HA 4BDOA 5CC2A 3OXNA 4QSDA 3RPWA 4NEDA 1D4NA 4O7IA 3CG1A 4UACA 4U22A 3K6UA 3QYTA 2Y7WA 3IJXB 4YZZA 1FW0A 2CZHA 4AQ4A 4GBWA 5AA3A 3TDJA 1NMUA 1OLCA 4EUOA 1K9ZA 1N3WA 1VE4A 5I58A 5IM2A 4F1YA 4OFLA 1B58A 5ELVA 2V3QA 3EHSA 1ATGA 1PB8A 3T22A 2IEEA 1O63A 2DVZA 3GLBA 2QS1A 1GGGA 5K2XA 3MQ9A 1B3GA 1J1NA 4NE4A 3W9WA 3SEVA 1B0LA 3C31A 4KCDA 4XEQA 3SERA 4X48A 2OBGA 1D9QA 4ZEFA 5EYFA 4MLVA 2OWSA 5CMBA 2FNCA 2OJTA 4OVTA 1MDQA 4XKQA 4DIGA 4QFNA 4R6HA 1Y4CA 3O29A 4GL0A 1NV1A 1M5FA 4OEUA 3RUMA 3U8QA 3CIJA 4OETA 4EF2A 1A40A 1S50A 2Q8JA 3FV1A 5L9MA 4RJZA 2RCAA 3UN6A 1S9TA 5TP9A 1TWYA 3SESA 3RPLB 1EH3A 3FJ7A 1HSJA 2L5VA 4R75A 1B5JA 4N15A 3A09A 4JWYA 4P1EA 4YB6A 1JVYA 4AB6A 3HPIA 1ZLQA 4IR8A 1MY1A 2V93A 1URGA 1FTAA 3EHUA 4F39A 2I4BA 2QS2A 2O51A 4OYVA 4OEVA 1Q1KA 4JSDA 2IA4A 3PPQA 2XWIA 4GD5A 1FPJA 4ZEDA 2F78A 4F3PA 1DOTA 2OZZA 3VVEA 2Q89A 3U94A 3E13X 5I2NA 1QKAA 4N6PA 3K4UA 3KBRA 1B4HA 2OX3A 4RPNA 3O97A 4NF8A 1O64A 3HV1A 2WBBA 2Q9TA 1DSNA 2DWIA 2UYEA 1US5A 1NV7A 2NVUB 4PQJA 5EQ7A 1UTBA 3PMXA 4OTEA 2V3TA 4KQPA 5AA2A 1DTGA 2I6EA 4QRZA 2XX9A 3RNNA 4DZ1A 2B3BA 2O6AA 5I57A 4FEBA 3O9PA 1MRPA 1SW5A 2AL5A 1LFGA 3I5OA 3TMGA 3PPNA 2O84X 4OMBA 3A3UA 3CR9A 2DE3A 1NL5A 4X8RA 4IB2A 2F6GA 4NF6B 4N6KA 4GXSB 4FATA 3PPPA 1YXIA 1A7LA 3GYYA 1DMBA 3PUWE 1TT1A 1MH3A 3N6TA 4LZ7A 5I59B 4GVOA 2B65A 1LLSA 3MVYA 3H6WA 4ZEKA 4WKMA 2OK2A 2FHYA 5FHNA 3V5AA 3CRBA 4PGPA 4BDLA 3Q28A 1ZIUA 3LUZA 4QSCA 3G3KA 3C36A 2F97A 3TYHA 1OVBA 3ODBA 2B3FA 1R9QA 2WYPA 2QVUA 1OMPA 4GRKA 1XVXA 4XKPA 1LFIA 5H8NA 4X9TA 2F36A 3A29A 4JDFA 3SEUA 4MCOA 4ELRA 2QVVA 1P99A 4QFOA 3N5LA 1O7TA 4K3FA 2H98A 1FQAA 2FIXA 3B8BA 3E4RA 2Y7PA 1FQEA 3PTYA 4JVCA 4HE1A 4UABA 4LUBA 1QJMA 1SW4A 2CZIA 2FA7A 3IFAA 3IR1A 3IB2A 3OSQA 4GWOA 3G3JA 5FTIA 1YPNA 2ONKE 2HZKA 3H3GA 4OFJA 4GWSA 2O1LA 4POWA 3ECRA 3K00A 4P47A 2UVJA 3KGCA 3LBSA 4C0RA 2E1SA 1MXZA 2F5XA 5FTHA 4AB5A 1LCTA 3CHGA 2GH9A 3TPAA 3RT8A 4YMBA 3HHGA 3OOAA 4PCDA 4EQ9A 4RK2A 4P0IA 1NUZA 3FD3A 1ZU0A 2HCAA 2QSXA 5ICTA 2ZNTA 1FJ9A 1PBPA 2UVHA 5IAIA 5A5XB 4OHNA 4F3BA 4HCWA 1IEJA 4M1VA 5KZTA 3PD8A 1FBEA 2WKYA 4IO5A 1XT8A 2G29A 1SW2A 4YKIA 4IGRA 2ZZVA 4GWWA 3H03A 4M4GA 3HHFA 4XKNA 4NHBA 1B7UA 1MY3A 4DXUA 3EKIA 3B6WA 4LQ5A 4PAKA 2XXPA 5EYHA 3TFLA 5DTBA 3LUYA 2Z22A 4N8GA 3IOVA 4I62A 2XXIA 2R71A 3MJNA 3TCHA 4H5GA 3IK6B 3R6UA 5FBPA 1NNTA 4JVIA 1SW1A 1VR5A 5H8HA 1VFDA 1LBVA 3QSLA 1FQBA 2QPQA 3MBPA 4U23A 1NNPA 4BDNA 2XXQA 4RK9A 2VPNA 4MNCA 1ZKBA 3O6IA 4GBVA 4GIZA 2VT5A 5IGAA 2FBPA 2DE2A 3IO4A 1LBZA 2XXKA 3HCQA 1FTJA 4XTCQ 3SEYA 1LB9A 4BLAA 5CRYA 1FPEA 1A8EA 1N04A 2XXWA 4G68A 1FPIA 4LZ8A 4DCXA 2A5TA 1M5CA 4MJOA 2HPGA 4H8JA 5JTYB 3QXMA 1LBCA 3B50A 2YPNA 1M5DA 4GWYA 3O6GA 4GX6A 5IZ3B 4PFBA 2ONSA 1GR2A 4THIA 1ANFA 4XXUA 2XXYA 1OVTA 4ELPA 1A8FA 3OSRA 4LATA 1SQYA 1HSLA 1IMEA 1R1NA 3U92A 1BKAA 4TLMB 1POTA 4NF0A 1USYH 3RPLA 4QF9A 1JNFA 3O28A 4F31B 3N94A 4O94A 1VFEA 3HO7A 1IXCA 3RT6B 1MXWA 4G8NA 1D3KA 4HXVA 4YKKA 1PEBA 2O1MA 1QUKA 3TQLA 3TTKA 2F3BA 1MXYA 4JWOA 4IO4A 1DPPA 3TTRA 2I3VA 3CSGA 4QFLA 4F2OA 1ZBMA 1LAGE 1JEUA 3VLVA 2P3VA 1MM6A 2VD3A 2UVGA 1MQGA 1B7HA 1B1XA 2I0BA 4P11A 4U4XA 5IKBA 1FPLA 2GFEA 2V3UA 4H5FA 1AH5A 4Z7EA 3MSTA 4PBQA 5DEXB 1YCJA 3MYUA 4IY6A 4OQOA 3MW0A 1H44A 2CEXA 4OZ9A 3E79A 2P1SA 1Y3NA 1FBHA 3K1NA 3QAXA 3Q25A 1CNQA 1US4A 3FIRA 5DVFA 1QW0A 4RNSA 2HAVA 3T66A 5ET7A 5BWJA 3VLUA 1LBBA 1MPDA 1FQCA 3FVKA 1P1NA 3W9VA 3OO7A 3H06B 1B5IA 3T9UA 5I56B 3MWBA 4NF6A 3UA8A 1MQIA 3S2VA 4PFYA 3C33A 4TOZA 1B52A 4IO7A 4Q0CA 3Q27A 5I59A 4FECA 5CMCA 2GHBA 1UQWA 4PETA 4XFEA 4X04A 3TCGA 4O3BA 4LA9A 5T3JA 1BP5A 3U65A 1NUWA 1B5HA 3ILUB 4PF6A 4N13A 4Q8RA 2QRYA 2H9BA 3IOTA 1XC1A 5DT6A 1FSAA 3TKDA 2X7QA 1FBPA 2DWHA 5CI5A 1URDA 1UTHB 3JYRA 1H3DA 3MP8A 4FE8A 4OERA 1SI0A 3BKIB 4MX6A 4R72A 5EHMA 4PFWA 1B40A 4PAFA 3QUFA 2HEUA 3KOTA 4PFTA 3PUYE 3VFJA 4HS7A 4RPOA 2ABHA 3OO6A 5ESYA 1TFDA 1FBDA 4O3AA 4R6YA 2QS4A 5JK4A 5BUUA 3QK6A 4GLIA 1WODA 3RLFE 3EQ1A 3Q29A 1AIVA 1VDWA 2HXRA 1I6BA 3SEWA 3D1RA 1YZ0A 2DDKA 2D3IA 3U93A 5A5LA 2A5SA 3KOSA 3SDFA 4KHZE 4F19A 3D4CA 1G0IA 1SYIA 1EYKA 3KG2A 2MKZA 1Z7NE 4OENA 3E3KA 4JB7A 1FPGA 3FJGA 5I7IA 2R8TA 2P2AA 1JW5A 4ZDMA 1BLFA 1LBXA 4G8HA 4MH5A 3MPLA 2RC9A 1MQDA 1XVYA 4G77A 1FPKA 1BK4A 1URSA 2CMOA 5HPQA 2GHAA 4PDDA 2ZMBA 1OQGA 4F3GA 3MZ9A 2H4IA 4OESA 5A5XA 4NTLA 4R6KA 1QUJA 1EU8A 4YKPA 4N6DA 3MPKA 4XF5A 5ET8A 4GFRA 4OVQA 3CFLA 4PBHA 3KN3A 3LSLA 1IMFA 1B32A 3CFZA 2WEFA 1MG1A 3EHTA 4LONB 4WEPA 4E0WA 4RY1A 4MBPA 1B6HA 5AA4B 4OANA 3RYDA 4N8YA 1LGBC 4I3EA 2DXYA 1FTMA 1B4ZA 1N3XA 2Y7KA 2FIEA 1KZ8A 4DE8A 5DVIA 2ZYMA 1FPDA 4ESXA 3FGSA 4PDHA 1P1UA 2X26A 4BDMA 1B2HA 4ONYA 5CMMA 2Y5KA 3CFXA 5AA1A 1PB7A 3SZPA 5KDTB 1GVCA 3VVDA 1N76A 2QMXA 3DM0A 2PBWA 4U2RA 4P0GA 5DYHA 1Y20A 4DXCA 4ECFA 5EQAA 2AYSA 1Y1MA 1QGXA 4C1TA 1KA1A 1MPCA 4FORA 1D9YA 1NV3A 3GBBA 4MMPA 3TZAA 1RDYA 4JVDA
chains in the Genus database with same CATH topology
4MEVA 3FBPA 1LBVA 2PCRA 1RDZA 2QPQA 5J1DA 3FXBA 2CZKA 4PE3A 2VPNA 1KA0A 4MNCA 4GBVA 4GX4A 4O7IA 2VT5A 5IGAA 2FBPA 2DE2A 1LBZA 4YZZA 2XXKA 2CZHA 4GX3A 4GBWA 3BIHA 5IZ3A 1FPEA 1IMDA 2JJKA 1FPBA 1K9ZA 1NV5A 5IM2A 4P56A 4P8BA 1FPIA 2V3QA 1LBWA 4MJOA 2HPGA 4MNPA 5IZZA 4NG7A 2DVZA 3B50A 5ET5A 4HCYA 4GWYA 4HE0A 4N17A 4GX6A 2B4LA 5IZ3B 3W9WA 3T1BA 4PFBA 4XEQA 4I40A 1D9QA 2HZLA 1IMEA 1G0HA 4MIJA 1YYZA 1DCUA 4OVTA 4NF0A 3RPLA 4PGNA 1NV1A 2OWZA 1NV0A 4O94A 4MAGA 4N91A 4OVRA 4QBAA 4HXVA 3BIGA 4I3YA 4P3LA 2CEYA 2F3DA 3RPLB 2L5VA 2F3BA 4N15A 4P1EA 1EYIA 2QVRA 4F18A 2XA5A 4IR8A 2V4CA 1FTAA 1NV4A 1FRPA 1FPFA 1IMBA 5I3SA 2XWVA 2P3VA 3ISPA 4YICA 4GWXA 3E78A 2KR0A 4GWZA 2XWIA 4NN3A 1FPJA 1NUYA 1FPLA 2VPOA 2DE4A 4O8MA 3KC0A 3MSTA 4PBQA 3MYUA 5DW8A 2OX3A 5LDZA 2CEXA 5F24A 4P9KA 3E79A 1FBHA 2WBBA 4G61A 1CNQA 4MHFA 1Q9DA 2Q9TA 5ET7A 2ZZXA 4F1VA 1NV7A 5EQ7A 3W9VA 2B4MA 1INPA 1LEVA 4NGUA 1K9YA 5EQ9A 5J16A 4O7MA 3IFCA 2WX9A 2XWKA 4QXDA 2PFYA 5EYGA 4PETA 4XFEA 4FBPA 4X04A 5LTCA 2DE3A 3KBZA 4NX1A 5T3JA 4X8RA 4N6KA 3U65A 2Q74A 1YXIA 3QMFA 1NUWA 3GYYA 4PF6A 4AS4A 2WBDA 1NV2A 1FSAA 1AWBA 1FBPA 2Y5LA 5CM6A 2FHYA 5IZ1A 4OVPA 4PGPA 2BJIA 3LUZA 4MX6A 5ET6A 2WYPA 4PAFA 2QVUA 4PFIA 5ESYA 4GWUA 1FBDA 4NAPA 4X9TA 1SPIA 5JK4A 3A29A 3KC1A 2WYKA 4MCOA 1DK4A 2QVVA 1VDWA 2HXRA 4H46A 1FBGA 1IMAA 4OA4A 1FJ6A 3D1RA 1YZ0A 2DDKA 4DI3D 5A5LA 4H45A 1JP4A 2FIXA 3B8BA 3PTYA 4JVCA 4F19A 4HE1A 1G0IA 4UABA 1EYKA 2MKZA 2CZIA 3IFAA 4PFRA 1FPGA 4PAIA 5I7IA 2R8TA 3LV0A 5EQ8A 2HZKA 2XWOA 1LBXA 2PFZA 4GWSA 1FPKA 1BK4A 3ROJA 1NV6A 4PDDA 1LBYA 2ZZWA 4P47A 1FBFA 4DI4B 2F5XA 1DBZA 4KXPA 2QFLA 3CHGA 4N6DA 4XF5A 5ET8A 4PCDA 1NUZA 4OVQA 2HHMA 4PBHA 1IMFA 3T0JA 2WEFA 1FJ9A 4NQ8A 5I5PA 4PF8A 4AS5A 4OANA 4HCWA 4M1VA 3RYDA 1FBEA 4N8YA 4I3EA 1NI9A 2FVZA 2ZZVA 2FIEA 4GWWA 1KZ8A 4N81A 1FPDA 1EYJA 4MNIA 4PDHA 4NHBA 2Y5KA 1XI6A 4N4UA 1FBCA 1NUXA 3SZPA 4LN5A 4OVSA 2GQ1A 3NOHA 1IMCA 3EKIA 2P3NA 4PAKA 3HFUA 5EYHA 2KQZA 1RDXA 4P1LA 4N8GA 4PC9A 4HE2A 5EQAA 1QGXA 2Q8MA 1KA1A 4PTKA 5FBPA 1NV3A 4MMPA 4F1UA 1RDYA 4JVIA 4JVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBY A;  4HXV A;  3BIG A;  3FBP A;  4FBP A;  1LBV A;  2PCR A;  4I3Y A;  3KBZ A;  1FBF A;  1RDZ A;  2F3D A;  5T3J A;  3RPL B;  2F3B A;  2Q74 A;  2CZK A;  1DBZ A;  1YXI A;  4KXP A;  3QMF A;  1NUW A;  2QFL A;  1EYI A;  5ET8 A;  1KA0 A;  2QVR A;  4IR8 A;  4GBV A;  4AS4 A;  1NUZ A;  4GX4 A;  4O7I A;  2WBD A;  2HHM A;  2VT5 A;  1NV2 A;  1FTA A;  2FBP A;  1NV4 A;  1FSA A;  1FRP A;  1FPF A;  1AWB A;  1IMB A;  1IMF A;  1FBP A;  5I3S A;  1LBZ A;  2Y5L A;  2FHY A;  2P3V A;  2CZH A;  3T0J A;  2WEF A;  1FJ9 A;  5IZ1 A;  4GX3 A;  4GBW A;  3BIH A;  2BJI A;  4GWX A;  5IZ3 A;  1FPE A;  1IMD A;  3LUZ A;  2JJK A;  1FPB A;  1K9Z A;  4GWZ A;  1NV5 A;  5ET6 A;  4AS5 A;  3RYD A;  1FBE A;  1FPI A;  1FPJ A;  1NUY A;  2QVU A;  4I3E A;  1LBW A;  1FPL A;  1NI9 A;  2FVZ A;  4MJO A;  5ESY A;  4GWU A;  1FBD A;  3KC0 A;  1SPI A;  2FIE A;  4GWW A;  1KZ8 A;  5ET5 A;  3A29 A;  4N81 A;  3KC1 A;  5DW8 A;  1FPD A;  4GWY A;  1EYJ A;  2OX3 A;  4HE0 A;  1DK4 A;  2QVV A;  4GX6 A;  1VDW A;  5LDZ A;  5IZ3 B;  4H46 A;  1FBG A;  5F24 A;  1IMA A;  1FBH A;  2WBB A;  4G61 A;  1FJ6 A;  3D1R A;  1CNQ A;  2Y5K A;  1XI6 A;  1YZ0 A;  1Q9D A;  1FBC A;  1NUX A;  2DDK A;  4I40 A;  1D9Q A;  5A5L A;  2GQ1 A;  5ET7 A;  4H45 A;  1JP4 A;  2FIX A;  1NV7 A;  3B8B A;  1IMC A;  1IME A;  4HE1 A;  5EQ7 A;  1G0I A;  2P3N A;  1G0H A;  1YYZ A;  1DCU A;  1EYK A;  1INP A;  5EYH A;  2CZI A;  3RPL A;  3IFA A;  1FPG A;  1RDX A;  1LEV A;  1NV1 A;  2R8T A;  3LV0 A;  1K9Y A;  2OWZ A;  5EQ9 A;  5EQ8 A;  4HE2 A;  1LBX A;  1NV0 A;  5EQA A;  5J16 A;  1QGX A;  3IFC A;  2Q8M A;  4QXD A;  1KA1 A;  4GWS A;  4PTK A;  5EYG A;  1FPK A;  1BK4 A;  1NV3 A;  3ROJ A;  5FBP A;  1NV6 A;  1RDY A; 
#chains in the Genus database with same CATH topology
 3FBP A;  4I9D A;  1YTV A;  4KR5 A;  3H6T A;  5H8F B;  2UXA A;  3VLW A;  2RIN A;  1IXI A;  2ZYN A;  3SKP A;  1B9J A;  3ONM A;  3ZKL A;  5JTY A;  1MS7 A;  3K6X A;  3KJT A;  2NUV A;  4GX3 A;  4ZZE A;  3H4Z A;  3BIH A;  2XXV A;  5IZ3 A;  2Z8E A;  2RCB A;  5KCJ B;  2OWT A;  1M5B A;  1NV5 A;  5F7V A;  1UIV A;  1OQH A;  5H8Q B;  2THI A;  5I2K B;  1DTZ A;  3USD A;  3SET A;  3PUX E;  4MNP A;  3G3I A;  4NG7 A;  1I6Q A;  3O6H A;  3M3F A;  4X1B A;  2H99 A;  1USY E;  3IL1 B;  4IO2 A;  4ISU A;  5ET5 A;  1JW4 A;  1B05 A;  1MQH A;  5L9S A;  3T9X B;  4HE0 A;  1OIB A;  4N17 A;  5F1Q A;  1RYO A;  3IB1 A;  3R26 A;  1IZ1 A;  3WAF A;  1JW1 A;  1MXU A;  4OWD A;  3M8U A;  1B3F A;  1G0H A;  2DVC A;  2OCU A;  2X7P A;  4PGN A;  1WVJ A;  3QIM A;  4ZEB A;  4RXL A;  2OWZ A;  4EQ7 A;  5CBS A;  4F22 A;  2ZNU A;  2HAU A;  3S9N C;  3K6V A;  3PMV A;  4QBA A;  2NWJ A;  3PPO A;  2PYY A;  2Q88 A;  2HQ0 A;  4KYE A;  4I3Y A;  1POY 1;  2F35 A;  4P3L A;  3H7M A;  2CEY A;  2F3D A;  4GOT A;  4R2B A;  4EXK A;  2GRV A;  1HSE A;  2QMW A;  4G4P A;  2F7A A;  1EYI A;  2Z23 A;  4KD5 A;  1LAH E;  4DCY A;  3K0V A;  1AL3 A;  1NKX A;  5DEX A;  1FRP A;  1FPF A;  1IMB A;  3EN3 A;  3VDF A;  3AXF A;  4YIC A;  2RC8 A;  1ELJ A;  1P1W A;  3KZG A;  2KR0 A;  1TFA A;  1ZMG A;  2KLF A;  2ZNS A;  1B7Z A;  1NUY A;  3MAM A;  2DE4 A;  3IO6 A;  3C34 A;  2NOO A;  5I56 A;  2HFB A;  3GBA A;  5DW8 A;  4ZS9 A;  4H67 A;  1EZP A;  4WXJ A;  4P9K A;  3BFT A;  2PT2 A;  4MHF A;  4H0W A;  3MP6 A;  1LST A;  2BJJ X;  4KI0 E;  3WAE A;  3G3G A;  2I3W A;  4R9G A;  3KFM A;  3O66 A;  1A99 A;  1JET A;  3K02 A;  4MLQ A;  4JXI A;  4YB7 A;  1GV8 A;  3BBR A;  4EF1 A;  4NGU A;  4BDR A;  5LOM A;  5J16 A;  4U4S A;  1Z7M E;  4QXD A;  5FHM A;  4KYD A;  5EYG A;  1I69 A;  4ND9 A;  1UTH A;  2O68 A;  3TTL A;  3K1M A;  1RKM A;  4NX1 A;  3L6G A;  4F2Q A;  1CB6 A;  4YB5 A;  4JWX A;  2Q74 A;  3PGF A;  4Q5T A;  3KN7 A;  2G93 A;  4NMY A;  3KJ7 A;  4AS4 A;  3MVX A;  3N6U A;  1AOV A;  3U1O A;  2ESN A;  4QFK A;  2Y5L A;  1RYX A;  1OLA A;  2DS9 A;  3PD9 A;  1BIY A;  2DOJ A;  3G3F A;  3MC2 A;  3IJO B;  4R2F A;  1B3H A;  3MZB A;  4PFI A;  5B7D A;  1XOC A;  1B51 A;  1Y1Z A;  2Y84 A;  1SPI A;  2D21 A;  2XX7 A;  1KWH A;  3DP4 A;  1DK4 A;  4H46 A;  1FBG A;  4LVQ A;  1JVX A;  2VD2 A;  4OA4 A;  1LFH A;  1SDX A;  3TUS A;  1QVS A;  1T0K A;  4PE5 B;  4H45 A;  2M8C A;  3CSB A;  3QUJ A;  3N26 A;  2R9J A;  1QUI A;  2I48 A;  1SVX B;  1IXH A;  1N7X A;  3FXR A;  5DVJ A;  5L9O A;  2O69 A;  2XD3 A;  3RN8 A;  3OEN A;  2I49 A;  3LV0 A;  3B6T A;  1EZ9 A;  4E0X A;  4OVJ A;  4YMA A;  5FHO A;  3S9M C;  2PFZ A;  4LP2 B;  3PPR A;  1M5E A;  3ROJ A;  3IB0 A;  2DQV A;  4MF3 A;  1LBY A;  1A55 A;  3VV5 A;  2ZZW A;  5CBR A;  5H8H B;  1UIU A;  1MXX A;  1FBF A;  1EZO A;  4G8M A;  5AA4 A;  3S4U A;  3GXA A;  2PVU A;  3UP9 A;  4KXP A;  2QFL A;  3MVW A;  4PP0 A;  4EQB A;  1Y4T A;  4F29 A;  1MH4 A;  3IOR A;  2AIX A;  2HHM A;  1Q35 A;  1B3E A;  4NWD A;  2RC7 A;  3FAS A;  2F7C A;  3T0J A;  4TLL B;  1SBP A;  4NQ8 A;  1H43 A;  5TPA B;  4PF8 A;  4NF5 B;  3ZS6 A;  3DEL B;  3SEX A;  3TAJ A;  5KDT A;  4G68 B;  5CMK A;  1NI9 A;  3M3L A;  2A5T B;  4N81 A;  4C1U A;  2ZYO A;  1EYJ A;  3DP8 A;  1NFT A;  2I4C A;  3D4G A;  1QKB A;  3K6W A;  1F9B A;  5AA2 D;  4ESW A;  5HM4 B;  3MP1 A;  1XI6 A;  3V8X B;  1NUX A;  1JQF A;  4LN5 A;  2GQ1 A;  3TTM A;  3NOH A;  3ILT B;  2XXR A;  3HN0 A;  4G68 C;  1IMC A;  4HW8 A;  1IIT A;  2ZXT A;  2F6P A;  2XXX A;  5H8F A;  3OD7 A;  3CG3 A;  4DDD A;  1N0T A;  2Y7I A;  4GQO A;  2AL4 A;  2H25 A;  5TU0 A;  1ZTY A;  4F1U A;  4MEV A;  2REG A;  3TQW A;  2H5Y A;  2VP1 A;  1RDZ A;  5KCJ A;  4TQU Q;  3VXC A;  4NF4 B;  5J1D A;  4DXB A;  3FXB A;  2CZK A;  5H8Q A;  4PE3 A;  5I2K A;  1KA0 A;  2YJP A;  4Z0I A;  3T9H B;  4GX4 A;  2D5W A;  4X1D A;  3PMW A;  3T93 B;  4PFU A;  3VXB A;  4OFO A;  4ELQ A;  4GXA A;  5ISU A;  3A3C A;  1NNF A;  3RTW B;  2XXH A;  3CI8 A;  5ITO A;  1IMD A;  4ZE9 A;  2JJK A;  1Y3Q A;  1P1O A;  1FPB A;  1JEV A;  4UA8 A;  4P56 A;  4P8B A;  1IQ7 A;  1LBW A;  2VGQ A;  2XX8 A;  5IZZ A;  1MM7 A;  3RY3 A;  3GZG A;  1BTJ A;  2UVI A;  2DSF A;  4KFQ A;  1MDP 1;  4HCY A;  4ZZA A;  4I1D A;  4L17 A;  1XS5 A;  2B4L A;  3DLN A;  3T1B A;  3H6V A;  2YLN A;  1YAE A;  5AE4 A;  5I58 B;  3TTN A;  1MY2 A;  4I40 A;  3OEM A;  3FXQ A;  1S7Y A;  3KN8 A;  2HZL A;  5M2V A;  3OEK A;  2FYI A;  5K2Y A;  4MIJ A;  2QL3 A;  1YYZ A;  4R73 A;  1DCU A;  2DWA A;  2QS3 A;  4YKJ A;  3FUZ A;  1P1Q A;  3VVF A;  3O2A A;  1TXF A;  3THI A;  2E0S A;  1NV0 A;  1B1H A;  3PUV E;  2O7I A;  3FVN A;  3EPE A;  1PC3 A;  3FVO A;  2W7Y A;  4MAG A;  4XKR A;  4NWC A;  4N91 A;  2OPD A;  4OVR A;  1LB8 A;  3CVG A;  4RA1 A;  3BIG A;  2HXW A;  2XXT A;  4R74 A;  1R6Z A;  4H8I A;  2DWJ A;  4ZE8 A;  5I84 A;  3DP6 A;  3K01 A;  1NH7 A;  4MFI A;  2QVR A;  4F18 A;  2XA5 A;  2Q2C A;  4U1O A;  3W15 C;  2V4C A;  1NV4 A;  3V89 B;  5I3S A;  2XWV A;  3ISP A;  3K2D A;  1FQD A;  5TP9 B;  4GWX A;  3E78 A;  4HTG A;  4GWZ A;  4GF8 A;  2Y7R A;  4NN3 A;  1WDN A;  4WED A;  1II5 A;  2DYX A;  3MVZ A;  1Y9U A;  3RTF B;  1FCK A;  1QUL A;  2VPO A;  2Z8F A;  4O8M A;  2F34 A;  3KC0 A;  3TOD A;  1MPB A;  4N07 A;  2OPE A;  1MXV A;  2VOZ A;  3BFU A;  4OXV A;  2QJE A;  5LDZ A;  3OMB A;  1MY0 A;  2XHD A;  5F24 A;  3B7D A;  1LCF A;  4FED A;  4G61 A;  4H65 A;  3T96 B;  1Q9D A;  4LZ5 A;  2ZZX A;  1N84 A;  4XIG Q;  4F1V A;  2B4M A;  5JEI A;  5HBC A;  1INP A;  3IOW A;  3PUZ E;  5I2N B;  1LEV A;  4U1Z A;  3R7X A;  1K9Y A;  5EQ9 A;  4NF8 B;  4O7M A;  3IFC A;  2WX9 A;  2XWK A;  3IX1 A;  4O3C A;  3G3H A;  2PFY A;  1AMF A;  2I0C A;  3KSJ A;  3V83 A;  3LSW A;  1XHY A;  4FJP A;  1UTB B;  4FBP A;  3HST A;  4JSO A;  1SI1 A;  5LTC A;  3KBZ A;  5AA2 B;  2O7U A;  1IXG A;  4FIM A;  1DPE A;  3G7W A;  3QMF A;  3FVG A;  1MQJ A;  3K1P A;  4GL8 A;  4ZEI A;  5I57 B;  2DP8 A;  2WBD A;  4POX A;  1NV2 A;  1VSO A;  3T9V A;  1SYH A;  1AWB A;  5CM6 A;  4R9F A;  5IZ1 A;  1CE2 A;  1I6A A;  4OVP A;  2BJI A;  4YAH X;  3I6V A;  2F7B A;  4KPT A;  3C35 A;  4IO6 A;  1L5T A;  5ET6 A;  4IO3 A;  3LR1 A;  1NNK A;  4EDP A;  2Z8D A;  2V84 A;  1FTL A;  1N7W A;  3LC8 A;  1D9V A;  1PB9 A;  4GWU A;  4NAP A;  2PMS A;  1B3L A;  3B6Q A;  3OEL A;  3ZSF A;  4IY5 A;  3KC1 A;  2WYK A;  3Q26 A;  2DXR A;  4RYA A;  1LAF E;  1PDA A;  3TCF A;  1IMA A;  2V25 A;  1FJ6 A;  3L6H A;  4DI3 D;  4KYS A;  4EXL A;  3FJM A;  4BDQ A;  1JP4 A;  1R9L A;  1SD3 A;  1FQF A;  2NXO A;  3TEL A;  3KSX A;  3OO9 A;  5H8N B;  2ZYK A;  4PFR A;  2ANJ A;  5EHS A;  4PAI A;  3RGY A;  2OLB A;  1ZJL A;  5EQ8 A;  3VE1 B;  2XWO A;  1LAX A;  2CZL A;  1FTO A;  1NV6 A;  4H6D A;  3PU5 A;  2XXU A;  3UGW A;  3UOR A;  2PT1 A;  3F11 A;  5TPA A;  4Q30 B;  3IOU A;  4NF5 A;  4DI4 B;  4G2Z A;  3C4M A;  1IIW A;  3LSX A;  1DBZ A;  3KEI A;  3OO8 A;  5ICQ A;  2ALU A;  2PX1 A;  4U21 A;  3PV0 E;  1A54 A;  2LAO A;  2R6G E;  2F8D A;  4ZEC A;  1H45 A;  5L8D A;  4QFP A;  3JV9 A;  1Y3P A;  2REJ A;  5B70 A;  5I5P A;  4IGT A;  2XD2 A;  4AS5 A;  3UIF A;  3M3K A;  3JZJ A;  2FVZ A;  3FXU A;  4JBZ A;  2P0S A;  4KCC A;  4F3S A;  2RKM A;  3H6U A;  4MNI A;  2I58 A;  4QSE A;  3S9L C;  3E9X A;  4N4U A;  1FBC A;  3ZKK A;  2ONR A;  3P7I A;  4OVS A;  4FAJ A;  3S9E A;  3I3V A;  3C9H A;  4QHQ A;  2P3N A;  3RQT A;  2VHA A;  1PBQ A;  3MUQ A;  3UK4 A;  3HFU A;  2Q2A A;  1FTK A;  2KQZ A;  3FAT A;  4YU0 A;  3U72 A;  4NF4 A;  1GTK A;  1RDX A;  3C32 A;  4P1L A;  3FZV A;  5H8S A;  1IUD A;  4PC9 A;  3TEP A;  3LSF B;  1MY4 A;  4HE2 A;  2RF1 A;  2Q8M A;  1H76 A;  4PTK A;  3IAZ A;  1NH8 A;  4H1X A;  4ELO A;  3EF7 A;  5ITP A;  4LQ2 A;  2PCR A;  4I8C A;  3FV2 A;  3MZ1 A;  4DLD A;  2UYF A;  1B46 A;  1B0H A;  4BDO A;  5CC2 A;  3OXN A;  4QSD A;  3RPW A;  4NED A;  1D4N A;  4O7I A;  3CG1 A;  4UAC A;  4U22 A;  3K6U A;  3QYT A;  2Y7W A;  3IJX B;  4YZZ A;  1FW0 A;  2CZH A;  4AQ4 A;  4GBW A;  5AA3 A;  3TDJ A;  1NMU A;  1OLC A;  4EUO A;  1K9Z A;  1N3W A;  1VE4 A;  5I58 A;  5IM2 A;  4F1Y A;  4OFL A;  1B58 A;  5ELV A;  2V3Q A;  3EHS A;  1ATG A;  1PB8 A;  3T22 A;  2IEE A;  1O63 A;  2DVZ A;  3GLB A;  2QS1 A;  1GGG A;  5K2X A;  3MQ9 A;  1B3G A;  1J1N A;  4NE4 A;  3W9W A;  3SEV A;  1B0L A;  3C31 A;  4KCD A;  4XEQ A;  3SER A;  4X48 A;  2OBG A;  1D9Q A;  4ZEF A;  5EYF A;  4MLV A;  2OWS A;  5CMB A;  2FNC A;  2OJT A;  4OVT A;  1MDQ A;  4XKQ A;  4DIG A;  4QFN A;  4R6H A;  1Y4C A;  3O29 A;  4GL0 A;  1NV1 A;  1M5F A;  4OEU A;  3RUM A;  3U8Q A;  3CIJ A;  4OET A;  4EF2 A;  1A40 A;  1S50 A;  2Q8J A;  3FV1 A;  5L9M A;  4RJZ A;  2RCA A;  3UN6 A;  1S9T A;  5TP9 A;  1TWY A;  3SES A;  3RPL B;  1EH3 A;  3FJ7 A;  1HSJ A;  2L5V A;  4R75 A;  1B5J A;  4N15 A;  3A09 A;  4JWY A;  4P1E A;  4YB6 A;  1JVY A;  4AB6 A;  3HPI A;  1ZLQ A;  4IR8 A;  1MY1 A;  2V93 A;  1URG A;  1FTA A;  3EHU A;  4F39 A;  2I4B A;  2QS2 A;  2O51 A;  4OYV A;  4OEV A;  1Q1K A;  4JSD A;  2IA4 A;  3PPQ A;  2XWI A;  4GD5 A;  1FPJ A;  4ZED A;  2F78 A;  4F3P A;  1DOT A;  2OZZ A;  3VVE A;  2Q89 A;  3U94 A;  3E13 X;  5I2N A;  1QKA A;  4N6P A;  3K4U A;  3KBR A;  1B4H A;  2OX3 A;  4RPN A;  3O97 A;  4NF8 A;  1O64 A;  3HV1 A;  2WBB A;  2Q9T A;  1DSN A;  2DWI A;  2UYE A;  1US5 A;  1NV7 A;  2NVU B;  4PQJ A;  5EQ7 A;  1UTB A;  3PMX A;  4OTE A;  2V3T A;  4KQP A;  5AA2 A;  1DTG A;  2I6E A;  4QRZ A;  2XX9 A;  3RNN A;  4DZ1 A;  2B3B A;  2O6A A;  5I57 A;  4FEB A;  3O9P A;  1MRP A;  1SW5 A;  2AL5 A;  1LFG A;  3I5O A;  3TMG A;  3PPN A;  2O84 X;  4OMB A;  3A3U A;  3CR9 A;  2DE3 A;  1NL5 A;  4X8R A;  4IB2 A;  2F6G A;  4NF6 B;  4N6K A;  4GXS B;  4FAT A;  3PPP A;  1YXI A;  1A7L A;  3GYY A;  1DMB A;  3PUW E;  1TT1 A;  1MH3 A;  3N6T A;  4LZ7 A;  5I59 B;  4GVO A;  2B65 A;  1LLS A;  3MVY A;  3H6W A;  4ZEK A;  4WKM A;  2OK2 A;  2FHY A;  5FHN A;  3V5A A;  3CRB A;  4PGP A;  4BDL A;  3Q28 A;  1ZIU A;  3LUZ A;  4QSC A;  3G3K A;  3C36 A;  2F97 A;  3TYH A;  1OVB A;  3ODB A;  2B3F A;  1R9Q A;  2WYP A;  2QVU A;  1OMP A;  4GRK A;  1XVX A;  4XKP A;  1LFI A;  5H8N A;  4X9T A;  2F36 A;  3A29 A;  4JDF A;  3SEU A;  4MCO A;  4ELR A;  2QVV A;  1P99 A;  4QFO A;  3N5L A;  1O7T A;  4K3F A;  2H98 A;  1FQA A;  2FIX A;  3B8B A;  3E4R A;  2Y7P A;  1FQE A;  3PTY A;  4JVC A;  4HE1 A;  4UAB A;  4LUB A;  1QJM A;  1SW4 A;  2CZI A;  2FA7 A;  3IFA A;  3IR1 A;  3IB2 A;  3OSQ A;  4GWO A;  3G3J A;  5FTI A;  1YPN A;  2ONK E;  2HZK A;  3H3G A;  4OFJ A;  4GWS A;  2O1L A;  4POW A;  3ECR A;  3K00 A;  4P47 A;  2UVJ A;  3KGC A;  3LBS A;  4C0R A;  2E1S A;  1MXZ A;  2F5X A;  5FTH A;  4AB5 A;  1LCT A;  3CHG A;  2GH9 A;  3TPA A;  3RT8 A;  4YMB A;  3HHG A;  3OOA A;  4PCD A;  4EQ9 A;  4RK2 A;  4P0I A;  1NUZ A;  3FD3 A;  1ZU0 A;  2HCA A;  2QSX A;  5ICT A;  2ZNT A;  1FJ9 A;  1PBP A;  2UVH A;  5IAI A;  5A5X B;  4OHN A;  4F3B A;  4HCW A;  1IEJ A;  4M1V A;  5KZT A;  3PD8 A;  1FBE A;  2WKY A;  4IO5 A;  1XT8 A;  2G29 A;  1SW2 A;  4YKI A;  4IGR A;  2ZZV A;  4GWW A;  3H03 A;  4M4G A;  3HHF A;  4XKN A;  4NHB A;  1B7U A;  1MY3 A;  4DXU A;  3EKI A;  3B6W A;  4LQ5 A;  4PAK A;  2XXP A;  5EYH A;  3TFL A;  5DTB A;  3LUY A;  2Z22 A;  4N8G A;  3IOV A;  4I62 A;  2XXI A;  2R71 A;  3MJN A;  3TCH A;  4H5G A;  3IK6 B;  3R6U A;  5FBP A;  1NNT A;  4JVI A;  1SW1 A;  1VR5 A;  5H8H A;  1VFD A;  1LBV A;  3QSL A;  1FQB A;  2QPQ A;  3MBP A;  4U23 A;  1NNP A;  4BDN A;  2XXQ A;  4RK9 A;  2VPN A;  4MNC A;  1ZKB A;  3O6I A;  4GBV A;  4GIZ A;  2VT5 A;  5IGA A;  2FBP A;  2DE2 A;  3IO4 A;  1LBZ A;  2XXK A;  3HCQ A;  1FTJ A;  4XTC Q;  3SEY A;  1LB9 A;  4BLA A;  5CRY A;  1FPE A;  1A8E A;  1N04 A;  2XXW A;  4G68 A;  1FPI A;  4LZ8 A;  4DCX A;  2A5T A;  1M5C A;  4MJO A;  2HPG A;  4H8J A;  5JTY B;  3QXM A;  1LBC A;  3B50 A;  2YPN A;  1M5D A;  4GWY A;  3O6G A;  4GX6 A;  5IZ3 B;  4PFB A;  2ONS A;  1GR2 A;  4THI A;  1ANF A;  4XXU A;  2XXY A;  1OVT A;  4ELP A;  1A8F A;  3OSR A;  4LAT A;  1SQY A;  1HSL A;  1IME A;  1R1N A;  3U92 A;  1BKA A;  4TLM B;  1POT A;  4NF0 A;  1USY H;  3RPL A;  4QF9 A;  1JNF A;  3O28 A;  4F31 B;  3N94 A;  4O94 A;  1VFE A;  3HO7 A;  1IXC A;  3RT6 B;  1MXW A;  4G8N A;  1D3K A;  4HXV A;  4YKK A;  1PEB A;  2O1M A;  1QUK A;  3TQL A;  3TTK A;  2F3B A;  1MXY A;  4JWO A;  4IO4 A;  1DPP A;  3TTR A;  2I3V A;  3CSG A;  4QFL A;  4F2O A;  1ZBM A;  1LAG E;  1JEU A;  3VLV A;  2P3V A;  1MM6 A;  2VD3 A;  2UVG A;  1MQG A;  1B7H A;  1B1X A;  2I0B A;  4P11 A;  4U4X A;  5IKB A;  1FPL A;  2GFE A;  2V3U A;  4H5F A;  1AH5 A;  4Z7E A;  3MST A;  4PBQ A;  5DEX B;  1YCJ A;  3MYU A;  4IY6 A;  4OQO A;  3MW0 A;  1H44 A;  2CEX A;  4OZ9 A;  3E79 A;  2P1S A;  1Y3N A;  1FBH A;  3K1N A;  3QAX A;  3Q25 A;  1CNQ A;  1US4 A;  3FIR A;  5DVF A;  1QW0 A;  4RNS A;  2HAV A;  3T66 A;  5ET7 A;  5BWJ A;  3VLU A;  1LBB A;  1MPD A;  1FQC A;  3FVK A;  1P1N A;  3W9V A;  3OO7 A;  3H06 B;  1B5I A;  3T9U A;  5I56 B;  3MWB A;  4NF6 A;  3UA8 A;  1MQI A;  3S2V A;  4PFY A;  3C33 A;  4TOZ A;  1B52 A;  4IO7 A;  4Q0C A;  3Q27 A;  5I59 A;  4FEC A;  5CMC A;  2GHB A;  1UQW A;  4PET A;  4XFE A;  4X04 A;  3TCG A;  4O3B A;  4LA9 A;  5T3J A;  1BP5 A;  3U65 A;  1NUW A;  1B5H A;  3ILU B;  4PF6 A;  4N13 A;  4Q8R A;  2QRY A;  2H9B A;  3IOT A;  1XC1 A;  5DT6 A;  1FSA A;  3TKD A;  2X7Q A;  1FBP A;  2DWH A;  5CI5 A;  1URD A;  1UTH B;  3JYR A;  1H3D A;  3MP8 A;  4FE8 A;  4OER A;  1SI0 A;  3BKI B;  4MX6 A;  4R72 A;  5EHM A;  4PFW A;  1B40 A;  4PAF A;  3QUF A;  2HEU A;  3KOT A;  4PFT A;  3PUY E;  3VFJ A;  4HS7 A;  4RPO A;  2ABH A;  3OO6 A;  5ESY A;  1TFD A;  1FBD A;  4O3A A;  4R6Y A;  2QS4 A;  5JK4 A;  5BUU A;  3QK6 A;  4GLI A;  1WOD A;  3RLF E;  3EQ1 A;  3Q29 A;  1AIV A;  1VDW A;  2HXR A;  1I6B A;  3SEW A;  3D1R A;  1YZ0 A;  2DDK A;  2D3I A;  3U93 A;  5A5L A;  2A5S A;  3KOS A;  3SDF A;  4KHZ E;  4F19 A;  3D4C A;  1G0I A;  1SYI A;  1EYK A;  3KG2 A;  2MKZ A;  1Z7N E;  4OEN A;  3E3K A;  4JB7 A;  1FPG A;  3FJG A;  5I7I A;  2R8T A;  2P2A A;  1JW5 A;  4ZDM A;  1BLF A;  1LBX A;  4G8H A;  4MH5 A;  3MPL A;  2RC9 A;  1MQD A;  1XVY A;  4G77 A;  1FPK A;  1BK4 A;  1URS A;  2CMO A;  5HPQ A;  2GHA A;  4PDD A;  2ZMB A;  1OQG A;  4F3G A;  3MZ9 A;  2H4I A;  4OES A;  5A5X A;  4NTL A;  4R6K A;  1QUJ A;  1EU8 A;  4YKP A;  4N6D A;  3MPK A;  4XF5 A;  5ET8 A;  4GFR A;  4OVQ A;  3CFL A;  4PBH A;  3KN3 A;  3LSL A;  1IMF A;  1B32 A;  3CFZ A;  2WEF A;  1MG1 A;  3EHT A;  4LON B;  4WEP A;  4E0W A;  4RY1 A;  4MBP A;  1B6H A;  5AA4 B;  4OAN A;  3RYD A;  4N8Y A;  1LGB C;  4I3E A;  2DXY A;  1FTM A;  1B4Z A;  1N3X A;  2Y7K A;  2FIE A;  1KZ8 A;  4DE8 A;  5DVI A;  2ZYM A;  1FPD A;  4ESX A;  3FGS A;  4PDH A;  1P1U A;  2X26 A;  4BDM A;  1B2H A;  4ONY A;  5CMM A;  2Y5K A;  3CFX A;  5AA1 A;  1PB7 A;  3SZP A;  5KDT B;  1GVC A;  3VVD A;  1N76 A;  2QMX A;  3DM0 A;  2PBW A;  4U2R A;  4P0G A;  5DYH A;  1Y20 A;  4DXC A;  4ECF A;  5EQA A;  2AYS A;  1Y1M A;  1QGX A;  4C1T A;  1KA1 A;  1MPC A;  4FOR A;  1D9Y A;  1NV3 A;  3GBB A;  4MMP A;  3TZA A;  1RDY A;  4JVD A; 
#chains in the Genus database with same CATH homology
 4MEV A;  3FBP A;  1LBV A;  2PCR A;  1RDZ A;  2QPQ A;  5J1D A;  3FXB A;  2CZK A;  4PE3 A;  2VPN A;  1KA0 A;  4MNC A;  4GBV A;  4GX4 A;  4O7I A;  2VT5 A;  5IGA A;  2FBP A;  2DE2 A;  1LBZ A;  4YZZ A;  2XXK A;  2CZH A;  4GX3 A;  4GBW A;  3BIH A;  5IZ3 A;  1FPE A;  1IMD A;  2JJK A;  1FPB A;  1K9Z A;  1NV5 A;  5IM2 A;  4P56 A;  4P8B A;  1FPI A;  2V3Q A;  1LBW A;  4MJO A;  2HPG A;  4MNP A;  5IZZ A;  4NG7 A;  2DVZ A;  3B50 A;  5ET5 A;  4HCY A;  4GWY A;  4HE0 A;  4N17 A;  4GX6 A;  2B4L A;  5IZ3 B;  3W9W A;  3T1B A;  4PFB A;  4XEQ A;  4I40 A;  1D9Q A;  2HZL A;  1IME A;  1G0H A;  4MIJ A;  1YYZ A;  1DCU A;  4OVT A;  4NF0 A;  3RPL A;  4PGN A;  1NV1 A;  2OWZ A;  1NV0 A;  4O94 A;  4MAG A;  4N91 A;  4OVR A;  4QBA A;  4HXV A;  3BIG A;  4I3Y A;  4P3L A;  2CEY A;  2F3D A;  3RPL B;  2L5V A;  2F3B A;  4N15 A;  4P1E A;  1EYI A;  2QVR A;  4F18 A;  2XA5 A;  4IR8 A;  2V4C A;  1FTA A;  1NV4 A;  1FRP A;  1FPF A;  1IMB A;  5I3S A;  2XWV A;  2P3V A;  3ISP A;  4YIC A;  4GWX A;  3E78 A;  2KR0 A;  4GWZ A;  2XWI A;  4NN3 A;  1FPJ A;  1NUY A;  1FPL A;  2VPO A;  2DE4 A;  4O8M A;  3KC0 A;  3MST A;  4PBQ A;  3MYU A;  5DW8 A;  2OX3 A;  5LDZ A;  2CEX A;  5F24 A;  4P9K A;  3E79 A;  1FBH A;  2WBB A;  4G61 A;  1CNQ A;  4MHF A;  1Q9D A;  2Q9T A;  5ET7 A;  2ZZX A;  4F1V A;  1NV7 A;  5EQ7 A;  3W9V A;  2B4M A;  1INP A;  1LEV A;  4NGU A;  1K9Y A;  5EQ9 A;  5J16 A;  4O7M A;  3IFC A;  2WX9 A;  2XWK A;  4QXD A;  2PFY A;  5EYG A;  4PET A;  4XFE A;  4FBP A;  4X04 A;  5LTC A;  2DE3 A;  3KBZ A;  4NX1 A;  5T3J A;  4X8R A;  4N6K A;  3U65 A;  2Q74 A;  1YXI A;  3QMF A;  1NUW A;  3GYY A;  4PF6 A;  4AS4 A;  2WBD A;  1NV2 A;  1FSA A;  1AWB A;  1FBP A;  2Y5L A;  5CM6 A;  2FHY A;  5IZ1 A;  4OVP A;  4PGP A;  2BJI A;  3LUZ A;  4MX6 A;  5ET6 A;  2WYP A;  4PAF A;  2QVU A;  4PFI A;  5ESY A;  4GWU A;  1FBD A;  4NAP A;  4X9T A;  1SPI A;  5JK4 A;  3A29 A;  3KC1 A;  2WYK A;  4MCO A;  1DK4 A;  2QVV A;  1VDW A;  2HXR A;  4H46 A;  1FBG A;  1IMA A;  4OA4 A;  1FJ6 A;  3D1R A;  1YZ0 A;  2DDK A;  4DI3 D;  5A5L A;  4H45 A;  1JP4 A;  2FIX A;  3B8B A;  3PTY A;  4JVC A;  4F19 A;  4HE1 A;  1G0I A;  4UAB A;  1EYK A;  2MKZ A;  2CZI A;  3IFA A;  4PFR A;  1FPG A;  4PAI A;  5I7I A;  2R8T A;  3LV0 A;  5EQ8 A;  2HZK A;  2XWO A;  1LBX A;  2PFZ A;  4GWS A;  1FPK A;  1BK4 A;  3ROJ A;  1NV6 A;  4PDD A;  1LBY A;  2ZZW A;  4P47 A;  1FBF A;  4DI4 B;  2F5X A;  1DBZ A;  4KXP A;  2QFL A;  3CHG A;  4N6D A;  4XF5 A;  5ET8 A;  4PCD A;  1NUZ A;  4OVQ A;  2HHM A;  4PBH A;  1IMF A;  3T0J A;  2WEF A;  1FJ9 A;  4NQ8 A;  5I5P A;  4PF8 A;  4AS5 A;  4OAN A;  4HCW A;  4M1V A;  3RYD A;  1FBE A;  4N8Y A;  4I3E A;  1NI9 A;  2FVZ A;  2ZZV A;  2FIE A;  4GWW A;  1KZ8 A;  4N81 A;  1FPD A;  1EYJ A;  4MNI A;  4PDH A;  4NHB A;  2Y5K A;  1XI6 A;  4N4U A;  1FBC A;  1NUX A;  3SZP A;  4LN5 A;  4OVS A;  2GQ1 A;  3NOH A;  1IMC A;  3EKI A;  2P3N A;  4PAK A;  3HFU A;  5EYH A;  2KQZ A;  1RDX A;  4P1L A;  4N8G A;  4PC9 A;  4HE2 A;  5EQA A;  1QGX A;  2Q8M A;  1KA1 A;  4PTK A;  5FBP A;  1NV3 A;  4MMP A;  4F1U A;  1RDY A;  4JVI A;  4JVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...