3IFCA

Human muscle fructose-1,6-bisphosphatase e69q mutant in complex with amp and alpha fructose-6-phosphate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
323
Chain Sequence
DMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
total genus 113
structure length 323
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3ifcA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3ifcA02
4GWUA 1IMAA 4GBWA 1IMEA 1NV7A 5F24A 5LDZA 1FRPA 1FPBA 2P3NA 2P3VA 1G0HA 2Y5LA 1EYJA 5ESYA 1IMBA 2VT5A 4KXPA 1FBDA 2QFLA 2QVUA 3RYDA 1FBCA 2WBDA 1AWBA 1LBVA 2R8TA 3BIHA 5EYGA 2FHYA 3QMFA 3RPLA 5ET5A 3A29A 3LUZA 1FJ6A 1FPJA 2WBBA 1LBZA 1NUWA 3KC1A 1XI6A 1FPLA 5DW8A 1FPFA 1Q9DA 1NV6A 2FVZA 2QVRA 2Y5KA 4GWWA 4GWSA 4G61A 5EYHA 1K9ZA 4N81A 3T0JA 2HHMA 4HE2A 1NV3A 1YXIA 1FPGA 1FSAA 4FBPA 4HE1A 1EYIA 5EQ7A 1LBWA 1FBPA 2GQ1A 1KA0A 1DK4A 1KA1A 1RDYA 4GX4A 3LV0A 4GWXA 5T3JA 5IZ3B 2PCRA 4GWZA 1FBFA 1YZ0A 3FBPA 1DBZA 3B8BA 1FPEA 1G0IA 2Q74A 1K9YA 1JP4A 3IFCA 1SPIA 2QVVA 4MJOA 5FBPA 2JJKA 1BK4A 3RPLB 4O7IA 1YYZA 1FTAA 1FJ9A 5EQAA 2FIXA 5A5LA 2FIEA 4I40A 5IZ3A 2OWZA 4HXVA 4H45A 4IR8A 1KZ8A 2CZKA 5ET7A 2OX3A 3ROJA 1NUYA 5J16A 1D9QA 1QGXA 1NUXA 2F3BA 5IZ1A 3IFAA 1INPA 3BIGA 2DDKA 1VDWA 5ET6A 1RDXA 4I3EA 1NV0A 4PTKA 1NUZA 4AS5A 4I3YA 2CZIA 4HE0A 5I3SA 4GWYA 5EQ8A 1FPKA 1NI9A 2FBPA 5ET8A 1FPIA 1LBXA 1NV1A 3KC0A 3KBZA 1NV4A 2BJIA 4GX6A 4GX3A 2CZHA 1IMDA 1FBHA 1IMCA 5EQ9A 1NV5A 2WEFA 1FBEA 1LBYA 4H46A 2F3DA 1NV2A 1IMFA 4GBVA 1DCUA 2Q8MA 4AS4A 1RDZA 1FPDA 4QXDA 1EYKA 1LEVA 3D1RA 1CNQA 1FBGA
chains in the Genus database with same CATH superfamily
2DE3A 2P3VA 1P1QA 1IMBA 1MQDA 4K3FA 2B4LA 1FBCA 3EN3A 4QF9A 1TT1A 2Q2CA 3T96B 1NL5A 3C9HA 3ILTB 4L17A 5IAIA 1M5CA 2QL3A 3K6VA 2Q89A 2E0SA 2V3QA 3HN0A 1O7TA 3C36A 5CBRA 3G3HA 3TCGA 2WYKA 1Y3PA 1FBFA 3LSXA 1EZPA 1MDP1 1H76A 1H43A 5A5XA 4PFTA 4PFIA 4OHNA 4XTCQ 3KJ7A 4EDPA 5I56A 4C1TA 3ODBA 4M1VA 3U65A 3MPKA 5DVIA 3FXUA 1DPPA 4U1OA 3CSBA 2HEUA 4Q8RA 4YKPA 2XD3A 4GXSB 4IO2A 3IAZA 4OFLA 3FZVA 2P1SA 3B7DA 2X26A 1N7XA 1VE4A 5IKBA 3PMVA 4DLDA 1B6HA 3UORA 1M5EA 2Q8MA 2O1MA 2QPQA 2DWJA 1OQGA 4N8GA 2O68A 3TZAA 1QUKA 1B32A 1FBGA 4GBWA 4O3BA 1UIUA 1G0HA 4GWOA 4H0WA 2RC9A 4MH5A 4OFJA 3K00A 4NHBA 4OWDA 3GYYA 4R6HA 1URSA 3G3JA 3CFXA 5TU0A 1I6QA 1LBZA 1B51A 3N26A 4P47A 4PGNA 4GWWA 4ZS9A 1MY4A 2R9JA 2ZNSA 1UQWA 4P56A 3LBSA 2DWHA 4IGRA 4HCYA 3T1BA 2NVUB 4ISUA 1RYOA 3W9WA 1A55A 2XXIA 2ALUA 3VLWA 1MY2A 4LN5A 3QUFA 4C0RA 5I2KA 1FTMA 2CZLA 1FQDA 3KOTA 4H45A 1SW2A 3H06B 3FIRA 4U23A 3F11A 2BJJX 3IO6A 1VDWA 4MX6A 4PFRA 4IO4A 3ZKKA 1MY0A 4IB2A 4POWA 1T0KA 4P1LA 3V83A 1NI9A 3MBPA 2G29A 4MNCA 2PT1A 3MAMA 3I6VA 5H8FB 2HFBA 1PC3A 1II5A 3GLBA 2I58A 2V25A 2ZYNA 2Z23A 3TODA 1QKBA 1LBYA 3PMWA 4U1ZA 3B6TA 1EYKA 3U72A 2XXXA 3OO7A 4JWYA 3K4UA 2ZZXA 4JSDA 4PAIA 3H6WA 3K6UA 5DVJA 3EHSA 1NMUA 3FV2A 1XT8A 5LOMA 1FJ6A 4ZDMA 5H8HA 1FPFA 1HSLA 2V84A 1QUIA 4O3AA 4RA1A 5AA4A 3EHUA 1FSAA 1DTZA 2ZYKA 2B4MA 5IM2A 1TFDA 5KCJB 3TAJA 3C35A 4GWZA 5DVFA 4PDDA 2F7BA 4O3CA 3MVZA 3C4MA 2P0SA 1BK4A 1SW1A 3G3IA 2RCBA 4R6YA 4OVPA 1MXZA 3PTYA 2F6PA 2A5TB 5KZTA 4WXJA 2B3BA 5L8DA 1US4A 3CG1A 3FASA 3ROJA 2H99A 5A5XB 4EXKA 1GTKA 3W9VA 4LQ2A 2YPNA 4OEUA 1Y3QA 4N6KA 4EQBA 1CB6A 5J1DA 3FXQA 3MWBA 1IXGA 4QFKA 3N6UA 3FD3A 2QMXA 2CZHA 2PFZA 3O29A 1IMFA 2HZLA 5ELVA 4NF4B 3D1RA 1R9LA 5IGAA 2XXHA 1CNQA 1LFIA 5CMCA 1B05A 4XKRA 4ECFA 1FPBA 5ESYA 4P1EA 2ANJA 2HQ0A 3HPIA 4N4UA 2ZNUA 1B3EA 2H9BA 1AIVA 1H44A 3DM0A 4XFEA 3PPNA 3SEVA 4H5GA 5CMBA 3FGSA 1IITA 1PEBA 1FPLA 1ZU0A 2FVZA 1Y1ZA 2O84X 4OETA 1K9ZA 4BDOA 4N6PA 1MQJA 5M2VA 5EQ7A 1KA0A 4F18A 4EXLA 2DWIA 3G7WA 4FJPA 5T3JA 1B40A 1NNKA 2ZYOA 4ZZEA 2Q74A 5AA4B 3N6TA 3SEXA 4NQ8A 3T66A 4DXCA 2F78A 4RK9A 3QYTA 4X48A 1ANFA 1ELJA 3MP8A 2F3BA 1A40A 3RTWB 4G68C 2VHAA 2OBGA 3BFTA 4OVQA 4P9KA 1XVXA 3C33A 1LCTA 4G8NA 2F8DA 3L6GA 2PX1A 1B7HA 4PQJA 3RGYA 3TYHA 4ELOA 2I0CA 2ABHA 1FPDA 1B5IA 3I3VA 2I3WA 1VFEA 4GWUA 1PB9A 3G3GA 4KPTA 3RTFB 4LZ7A 3CFZA 3KN3A 4HCWA 4OYVA 3VVFA 2Z8DA 1I6AA 2Q9TA 3O9PA 1AWBA 1IXHA 3LR1A 1ZLQA 4TQUQ 5ET5A 3TUSA 1JW4A 4NF8A 1WVJA 1UTBA 4G77A 4TLLB 2QVRA 1B58A 2Y5KA 1N04A 5ICQA 1J1NA 4PF8A 5FHMA 1OLCA 5DT6A 1Y4CA 3PU5A 4Z0IA 4GX4A 4I1DA 2X7QA 3FBPA 4GRKA 4OEVA 1PBQA 1Q1KA 2QJEA 3KZGA 4QSDA 4NF4A 4DE8A 4I40A 1D4NA 3LUYA 4OERA 4P3LA 4KFQA 4RXLA 5CM6A 2I4CA 5B7DA 3UGWA 4H5FA 3QAXA 1YPNA 2XWKA 1N0TA 1Y9UA 2ESNA 4NWDA 3M8UA 1XC1A 4AB6A 3ISPA 4MLQA 1O64A 1MQIA 2PT2A 1N3WA 4GQOA 1FTOA 1AOVA 1JVYA 4N15A 2QS2A 2XXQA 2UYEA 3IOVA 3K02A 3PUVE 4MAGA 1EZ9A 4I8CA 1IMAA 4F1UA 2I3VA 4F3BA 2F35A 4KXPA 1FBDA 2QFLA 2QVUA 1H45A 3Q25A 3SDFA 1Y1MA 3M3FA 2WBDA 4XKQA 4BDNA 1OVTA 1MY3A 2XWOA 3PUZE 1MS7A 3A29A 3IOWA 4NGUA 5HBCA 2WBBA 1MXXA 1F9BA 1LB8A 4OENA 1P1WA 4PFUA 4EUOA 4XF5A 2XXVA 3R6UA 5AA2A 3SEYA 4H8JA 1LBWA 1SW5A 2PMSA 3FV1A 4NN3A 4GWXA 1P1NA 4THIA 4GIZA 3B8BA 4R73A 4ND9A 4NF6B 4PETA 1XS5A 3EQ1A 3IK6B 4QBAA 2XXYA 1B5JA 5LTCA 2KLFA 3GBBA 5J16A 1QKAA 2HAVA 1INPA 2XA5A 4F2QA 1IZ1A 2DS9A 4I62A 1MY1A 4XEQA 2O51A 1NUZA 1ZKBA 2HCAA 4FATA 4LZ8A 4DXUA 2CMOA 1BKAA 4R74A 2FBPA 1B2HA 3DP4A 1B5HA 1NV1A 4YB6A 3K0VA 3Q26A 5HM4B 3KN8A 2BJIA 4GX3A 3MPLA 1DMBA 1B1HA 4F1YA 4IGTA 3FUZA 1IMDA 3T9VA 3E13X 1IMCA 4OFOA 4TOZA 3Q28A 4FORA 3USDA 5ISUA 3RQTA 4GL8A 4Z7EA 3DP8A 4KD5A 5HPQA 1HSEA 3FVOA 3O2AA 1NV7A 1YCJA 1RYXA 5I2NA 2OPEA 4NF5B 4MCOA 1SQYA 3H03A 4MBPA 4P0GA 4YICA 2MKZA 2XWVA 3A3UA 3PPPA 2UXAA 1Q9DA 4GWSA 2DE2A 2O69A 4N8YA 1NV3A 1ZIUA 1EYIA 3PD8A 1DK4A 3FATA 3U1OA 2HZKA 2DWAA 1A99A 3O6HA 3IL1B 2R6GE 4MF3A 1YZ0A 2FNCA 5I57A 4BDRA 2QVVA 3MC2A 1ZJLA 4FAJA 4LQ5A 3ILUB 4DI3D 3TCHA 2RKMA 1MPBA 4N13A 2UVJA 4F19A 4MEVA 3O28A 4JVIA 4KI0E 1SYHA 3H4ZA 4O8MA 4Q30B 2UVGA 4KCDA 3O6IA 1LBBA 2HXWA 3SKPA 5I3SA 4LA9A 1LBXA 4F2OA 4P11A 4NAPA 4DZ1A 2ZXTA 2REJA 3KEIA 1MPDA 5L9OA 5EQ9A 4MLVA 2WEFA 1FBEA 4H46A 2QRYA 1B1XA 1TFAA 4QXDA 4BLAA 4O7MA 4ELRA 5F24A 1FRPA 3N94A 1AL3A 5H8NB 3B6WA 1Y20A 5I57B 2F97A 1TXFA 4YU0A 2OZZA 2FHYA 3K2DA 2H25A 1JEUA 4U4SA 5JTYB 1AMFA 2IA4A 5DW8A 1N3XA 2AYSA 2DSFA 3V8XB 3BFUA 4HE2A 4EQ9A 1B3LA 3QSLA 3RUMA 5H8QA 3VDFA 1FBPA 3PPQA 4R9GA 5DTBA 1RDYA 5I5PA 3H6TA 2PCRA 5H8SA 1H3DA 1DBZA 3A09A 1MXYA 4MJOA 4N07A 1Y4TA 1NNTA 2D3IA 3MP6A 1I6BA 3MZ9A 3HSTA 4HXVA 2B3FA 1KZ8A 2AL5A 2O7IA 1D3KA 3VVDA 2XXRA 1NUYA 4N6DA 3S9MC 3IFAA 5TP9B 1NH7A 2NWJA 2KQZA 2X7PA 1PB7A 3QXMA 1SDXA 4I3YA 1Q35A 5H8FA 3KBRA 1LBCA 4HE0A 3ECRA 5ET8A 3FVKA 1FPIA 1SVXB 1KWHA 3IJXB 3P7IA 4ZEFA 2WX9A 1MM6A 4KQPA 2OPDA 4O94A 3KG2A 2V3UA 3H6UA 5CBSA 3TKDA 1NV2A 4H8IA 2R71A 4AS4A 4LONB 1MH3A 1NKXA 1VFDA 2XX9A 4OXVA 2QS4A 2E1SA 2P3NA 1GR2A 4IO5A 3S9EA 3RYDA 4YB7A 1SI0A 2RC7A 4IO6A 1LFHA 5KDTA 4ESWA 2F7AA 1LAGE 2F34A 2VOZA 1OLAA 3OSQA 1D9VA 1USYH 3JYRA 3N5LA 2ONKE 4AQ4A 4QRZA 4X1BA 4X9TA 4MNIA 2OK2A 5AA1A 5AA2B 1B46A 4YAHX 3S9LC 1G0IA 1L5TA 4R6KA 5CRYA 3S2VA 4QSCA 2VGQA 4DCYA 4HTGA 4LP2B 2XWIA 4TLMB 3OO6A 1OIBA 1B7UA 1DSNA 2O6AA 1POTA 2CZKA 1R9QA 5ET7A 1P99A 2Q88A 2OX3A 1P1UA 3PV0E 3K6XA 5I84A 2DXYA 4G8MA 4FEBA 2HXRA 5I59B 3FXBA 3MUQA 4F3SA 1IUDA 3OD7A 3FJ7A 2ZMBA 5I58A 4NF8B 4GWYA 4PFWA 3VLUA 3PGFA 4PBHA 5AE4A 4FIMA 3OMBA 2Q8JA 3VV5A 1GVCA 2OCUA 4GF8A 1MRPA 2Q2AA 3EF7A 3PUWE 4JVDA 1A54A 4ZEDA 3WAFA 2M8CA 3EKIA 4GFRA 5B70A 3RPLA 5EYGA 4ELPA 5FHNA 2H4IA 3CHGA 5JK4A 2RINA 1USYE 4NTLA 4H65A 5CI5A 2HHMA 3ZS6A 5KDTB 3MJNA 2FA7A 3UN6A 2Z8FA 3KN7A 3HO7A 2O1LA 2RC8A 2JJKA 1RKMA 4U2RA 4FECA 4O7IA 1FTAA 4UA8A 4OVRA 4G68B 3LSLA 5L9SA 1HSJA 1PDAA 3GZGA 3I5OA 4ZEKA 4KR5A 5H8HB 4G2ZA 3LSFB 2XXUA 4YKKA 5IZ1A 2DE4A 5DYHA 2A5TA 4QFLA 1IXCA 1NV0A 5K2XA 3PPRA 5FHOA 4NF5A 1OQHA 1A7LA 5EHMA 4DIGA 3CFLA 5I7IA 4KYEA 1VSOA 3D4CA 3S9NC 4R72A 1SW4A 1NH8A 4FEDA 3K1PA 3W15C 4DI4B 3R7XA 4H6DA 1OVBA 3IB2A 4E0WA 4OA4A 4F3PA 4PGPA 2QS1A 3SEUA 1QUJA 1SI1A 4RK2A 3TCFA 3UP9A 4RJZA 3MVYA 4OMBA 3RN8A 1QW0A 3IOUA 5ICTA 1IEJA 3EPEA 4Q0CA 4ZE8A 4RYAA 1B9JA 3LUZA 1DPEA 4WEDA 2NOOA 4NG7A 5K2YA 1Z7ME 4GXAA 4N81A 3T0JA 4UABA 5F7VA 3TDJA 3T22A 1KA1A 2ZZVA 2NUVA 3FJGA 3FVNA 4C1UA 2F36A 1FPEA 4XKPA 1GGGA 1XHYA 2ZYMA 4GD5A 1SBPA 1FQAA 1FQEA 4GL0A 1XVYA 3FVGA 2Y7RA 4PAKA 5FTIA 4OVTA 4LATA 2OJTA 1ZTYA 2DVZA 3TELA 4AB5A 3C32A 4PP0A 3JZJA 3VVEA 3VE1B 4POXA 3R26A 3OEMA 3U8QA 1QULA 4R2FA 5JTYA 2ZNTA 1LLSA 4ZEBA 3OOAA 5BWJA 1DCUA 1TWYA 3HHFA 3PD9A 3HFUA 1A8FA 3IJOB 3CI8A 3OEKA 1EU8A 3CRBA 3DP6A 5H8QB 4E0XA 4OVJA 1LCFA 5L9MA 3K01A 2Z22A 3EHTA 1NNFA 2XXWA 3O66A 4G4PA 4F22A 3IOTA 4JXIA 3QK6A 2I4BA 3BIHA 1D9YA 2VP1A 2KR0A 1FPJA 2UVHA 1ATGA 5TPAB 1US5A 1PBPA 2Y7IA 3B6QA 2ZZWA 3U92A 1POY1 5I56B 3H3GA 3SEWA 2H98A 4DXBA 4XIGQ 2LAOA 2VD3A 2V93A 4GLIA 3LV0A 1SYIA 2Y84A 1MH4A 3G3FA 4N91A 2FYIA 5EHSA 1JP4A 3IFCA 4R9FA 1YYZA 2XXPA 1MQHA 4F1VA 2XX7A 4P8BA 5DEXB 3T9UA 5CMMA 5I2KB 4JDFA 2CEXA 4BDMA 1SD3A 4OVSA 3SZPA 1N76A 3LSWA 1NNPA 4G8HA 2PYYA 3E79A 1EZOA 3KFMA 1WDNA 5ET6A 4NWCA 1MPCA 4RY1A 2HPGA 2I6EA 3D4GA 1FW0A 2GHBA 2XD2A 4PFYA 2AIXA 3KC0A 2THIA 3OO9A 1NV4A 2P2AA 3RY3A 3V5AA 1MXUA 1N7WA 3OELA 1NV5A 1LAFE 1S7YA 2WYPA 3E78A 4ESXA 1ZBMA 2I48A 4YZZA 3PUXE 4KYDA 1B0HA 1LEVA 4H67A 3Q29A 1MG1A 3UK4A 5I59A 3L6HA 4QFOA 4OTEA 1IMEA 5LDZA 1GV8A 3HHGA 1B7ZA 4RPNA 3TQWA 1LFGA 3CVGA 3CR9A 3AXFA 2GFEA 2R8TA 2XXKA 3IO4A 3KC1A 1XI6A 1WODA 5AA2D 1JW5A 2Z8EA 5H8NA 3M3KA 3TTMA 3JV9A 4IY5A 2Y7WA 2XHDA 3K6WA 3K1MA 3IORA 5BUUA 3THIA 4JBZA 2AL4A 1MQGA 3U93A 3TTRA 1K9YA 4PE5B 1SPIA 4R75A 2B65A 2W7YA 3RPLB 3ONMA 2F7CA 3K1NA 4MHFA 3RT8A 1B52A 1FQBA 3VXBA 3NOHA 2OLBA 3VFJA 2QS3A 4PDHA 2UVIA 4EF1A 4LVQA 1NUXA 3FXRA 3BIGA 2Y7PA 4PAFA 4ELQA 1A8EA 2O7UA 1FQCA 5DEXA 4F3GA 5CMKA 3IB0A 1FPKA 1P1OA 3T93B 3CSGA 4H1XA 4ZECA 2GRVA 4OQOA 3TFLA 4WKMA 3MZ1A 5FTHA 4KCCA 3T9HB 4X8RA 1R1NA 3G3KA 1FQFA 3MSTA 2Y5LA 5TPAA 2RF1A 2V4CA 4KYSA 1B4HA 1LAHE 1MXVA 4I9DA 2V3TA 1BIYA 3PUYE 1B4ZA 4ZZAA 2NXOA 1MDQA 5KCJA 4G68A 3SERA 3OSRA 1NUWA 1B3GA 3SETA 2PBWA 5TP9A 1YAEA 4QSEA 1R6ZA 4OANA 4JVCA 4GVOA 1IXIA 2RCAA 2GQ1A 3FJMA 4OESA 5EYFA 4NMYA 3RNNA 3TTNA 3H6VA 2A5SA 5FBPA 3KSJA 2IEEA 2I49A 3UA8A 3CIJA 4FE8A 1FJ9A 5EQAA 1MM7A 2VD2A 2FIXA 5F1QA 2OWZA 3MP1A 4JWXA 4IO7A 1EH3A 1Y3NA 3E9XA 5IZZA 1D9QA 4XXUA 4R2BA 1URGA 1UIVA 4IY6A 4QHQA 4BDQA 1IIWA 4I3EA 4BDLA 3ZKLA 2DP8A 2YLNA 4AS5A 1VR5A 3TPAA 3TTKA 1M5DA 2CEYA 4PE3A 3C31A 4U22A 4X04A 3KBZA 3OO8A 3TQLA 1S9TA 4PF6A 2GHAA 4PBQA 3OXNA 2DOJA 4NF0A 4F39A 3HV1A 4N17A 4RPOA 1IQ7A 1MXWA 1JNFA 4NE4A 4LZ5A 1EYJA 3MW0A 4NF6A 4YKJA 3V89B 3M3LA 2VT5A 3GBAA 3OENA 1JW1A 1QVSA 3PMXA 4U4XA 1JVXA 3QMFA 2DXRA 3DELB 1B3HA 1OMPA 4MFIA 1JETA 1S50A 2ONRA 1YTVA 2DVCA 4HE1A 2D21A 4DDDA 3TEPA 3C34A 5ITOA 4YKIA 3VLVA 5IZ3B 1BTJA 4KHZE 1NFTA 3RT6B 3TMGA 2VPOA 4GOTA 3MZBA 3H7MA 1BLFA 3E3KA 2ONSA 2L5VA 3IB1A 1QGXA 3KGCA 1M5BA 3T9XB 1AH5A 4WEPA 2DDKA 1UTHA 2QSXA 3DLNA 1RDXA 5I58B 1BP5A 2WKYA 4YB5A 3Q27A 1PB8A 4IO3A 2CZIA 4YMAA 1N84A 5EQ8A 3RLFE 3HCQA 4Q5TA 3ZSFA 4MNPA 4HS7A 4HW8A 3GXAA 2HAUA 2XX8A 2UYFA 3CG3A 3IX1A 1FBHA 2YJPA 4MMPA 1DTGA 3B50A 3O97A 4GBVA 4ONYA 1Z7NE 4DCXA 3SESA 4JB7A 3VXCA 1UTBB 2QMWA 4EQ7A 1QJMA 5AA3A 1XOCA 2PVUA 1LSTA 3PPOA 4YMBA 1M5FA 4X1DA 5CC2A 1B3FA 1LBVA 3LC8A 2G93A 4RNSA 1B0LA 4U21A 3A3CA 3KSXA 2D5WA 1NV6A 3KJTA 4MIJA 3QUJA 4G61A 2F5XA 3S4UA 5EYHA 1FTJA 3BBRA 1YXIA 1FPGA 4FBPA 3O6GA 2OWTA 4ZEIA 1FTLA 2Y7KA 3TTLA 4JSOA 2F6GA 4EF2A 4LUBA 1JEVA 4OZ9A 4PFBA 4QFPA 3RPWA 2DYXA 3E4RA 1LB9A 5JEIA 3U94A 5A5LA 2FIEA 3MVWA 5IZ3A 4IR8A 1LGBC 3QIMA 2H5YA 4JWOA 3IR1A 2PFYA 2XXTA 4PC9A 1O63A 3MQ9A 2REGA 2I0BA 4UACA 1DOTA 4F31B 1CE2A 3WAEA 4PTKA 3MVXA 1LAXA 4F29A 4XKNA 3UIFA 4QFNA 4NX1A 4M4GA 1FTKA 3KOSA 1JQFA 4GX6A 1UTHB 1FCKA 1I69A 1ZMGA 2VPNA 4NEDA 4P0IA 1URDA 3MYUA 2OWSA 2DQVA 5ITPA 2F3DA 3BKIB 1RDZA 2GH9A 4ZE9A 4PCDA 5I2NB
chains in the Genus database with same CATH topology
4GWUA 1IMAA 4GBWA 1IMEA 1NV7A 5F24A 5LDZA 1FRPA 1FPBA 2DE3A 2P3NA 2P3VA 1G0HA 2Y5LA 1EYJA 5ESYA 3B50A 2V4CA 3MSTA 4P1EA 1IMBA 4PAIA 4PGPA 2VT5A 4KXPA 1FBDA 2QFLA 2QVUA 2B4LA 3RYDA 1FBCA 4JVDA 4HCWA 4N4UA 4MCOA 4NHBA 2WBDA 2Q9TA 3EKIA 1AWBA 3GYYA 1LBVA 2XWOA 2ZZXA 2R8TA 3BIHA 5EYGA 2FHYA 3QMFA 3RPLA 5ET5A 4XFEA 3A29A 4NGUA 4YICA 3LUZA 2KR0A 1FJ6A 1FPJA 2WBBA 2MKZA 2XXKA 2XWVA 1LBZA 4NG7A 1NUWA 3KC1A 1XI6A 4P47A 1FPLA 5DW8A 1FPFA 1Q9DA 4PGNA 1NV6A 2FVZA 2QVRA 2Y5KA 4GWWA 4GWSA 3CHGA 4MIJA 4XF5A 5JK4A 4F1UA 2DE2A 4G61A 2F5XA 4N8YA 4PF8A 5EYHA 1K9ZA 4N81A 3T0JA 2HHMA 4HE2A 4OANA 4P56A 1NV3A 2V3QA 2ZZWA 1YXIA 4JVCA 4UABA 1FPGA 1FSAA 4FBPA 4HE1A 1EYIA 5EQ7A 1LBWA 1FBPA 2GQ1A 2B4MA 4X9TA 1KA0A 5IM2A 4F18A 1DK4A 1KA1A 4MNIA 4HCYA 4NN3A 1RDYA 2HZKA 3T1BA 4GX4A 3LV0A 2ZZVA 4GWXA 5T3JA 5IZ3B 5I5PA 2PCRA 4GWZA 2WYKA 4PDDA 1FBFA 1YZ0A 3FBPA 1DBZA 3B8BA 4N91A 1FPEA 3W9WA 1G0IA 2Q74A 1K9YA 1JP4A 3IFCA 1SPIA 2QVVA 4MJOA 5FBPA 4PFBA 2JJKA 4PETA 2VPOA 1BK4A 4LN5A 4PFIA 3RPLB 4O7IA 1YYZA 1FTAA 4OVRA 4MHFA 2XWIA 4NQ8A 3NOHA 1FJ9A 5EQAA 4DI3D 4F1VA 4P8BA 4OVPA 2FIXA 5A5LA 4PDHA 2FIEA 3PTYA 4PAKA 4F19A 4I40A 5IZ3A 2OWZA 4HXVA 4H45A 4IR8A 2L5VA 4JVIA 4MEVA 4P3LA 4QBAA 1KZ8A 4M1VA 4OVTA 3U65A 2CZKA 2PFYA 5LTCA 2CEXA 5ET7A 4PC9A 4OVSA 3SZPA 2OX3A 3ROJA 1NUYA 5J16A 2DVZA 4N6DA 1D9QA 1QGXA 1NUXA 2F3BA 5IZ1A 3E79A 4O8MA 3IFAA 1INPA 3BIGA 3W9VA 5CM6A 2XA5A 2DE4A 2DDKA 1VDWA 2KQZA 5ET6A 1RDXA 4MX6A 4PAFA 2HXRA 4PFRA 3FXBA 4I3EA 1NV0A 4XEQA 4PTKA 1NUZA 4P9KA 4OVQA 2HPGA 4N6KA 4AS5A 2XWKA 4I3YA 2CZIA 4NX1A 2CEYA 4P1LA 4HE0A 5J1DA 5I3SA 4GWYA 5EQ8A 1FPKA 1NI9A 2FBPA 5ET8A 1FPIA 1LBXA 4PE3A 1NV1A 3KC0A 3ISPA 4MNCA 4MNPA 4PBHA 3KBZA 4X04A 1NV4A 2WX9A 4NAPA 4PF6A 5I7IA 2BJIA 4GX6A 4GX3A 2CZHA 2VPNA 4PBQA 4O94A 1IMDA 1FBHA 4MMPA 1IMCA 5EQ9A 1NV5A 2WEFA 3MYUA 4NF0A 4OA4A 1FBEA 2WYPA 2PFZA 1LBYA 4H46A 2F3DA 1NV2A 1IMFA 4GBVA 1DCUA 2Q8MA 2HZLA 4N15A 4YZZA 4X8RA 4N17A 4AS4A 1RDZA 1FPDA 2QPQA 4DI4B 4QXDA 3HFUA 1EYKA 1LEVA 4N8GA 3E78A 3D1RA 4O7MA 4MAGA 4PCDA 5IGAA 5IZZA 1CNQA 1FBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWU A;  1IMA A;  4GBW A;  1IME A;  1NV7 A;  5F24 A;  5LDZ A;  1FRP A;  1FPB A;  2P3N A;  2P3V A;  1G0H A;  2Y5L A;  1EYJ A;  5ESY A;  1IMB A;  2VT5 A;  4KXP A;  1FBD A;  2QFL A;  2QVU A;  3RYD A;  1FBC A;  2WBD A;  1AWB A;  1LBV A;  2R8T A;  3BIH A;  5EYG A;  2FHY A;  3QMF A;  3RPL A;  5ET5 A;  3A29 A;  3LUZ A;  1FJ6 A;  1FPJ A;  2WBB A;  1LBZ A;  1NUW A;  3KC1 A;  1XI6 A;  1FPL A;  5DW8 A;  1FPF A;  1Q9D A;  1NV6 A;  2FVZ A;  2QVR A;  2Y5K A;  4GWW A;  4GWS A;  4G61 A;  5EYH A;  1K9Z A;  4N81 A;  3T0J A;  2HHM A;  4HE2 A;  1NV3 A;  1YXI A;  1FPG A;  1FSA A;  4FBP A;  4HE1 A;  1EYI A;  5EQ7 A;  1LBW A;  1FBP A;  2GQ1 A;  1KA0 A;  1DK4 A;  1KA1 A;  1RDY A;  4GX4 A;  3LV0 A;  4GWX A;  5T3J A;  5IZ3 B;  2PCR A;  4GWZ A;  1FBF A;  1YZ0 A;  3FBP A;  1DBZ A;  3B8B A;  1FPE A;  1G0I A;  2Q74 A;  1K9Y A;  1JP4 A;  3IFC A;  1SPI A;  2QVV A;  4MJO A;  5FBP A;  2JJK A;  1BK4 A;  3RPL B;  4O7I A;  1YYZ A;  1FTA A;  1FJ9 A;  5EQA A;  2FIX A;  5A5L A;  2FIE A;  4I40 A;  5IZ3 A;  2OWZ A;  4HXV A;  4H45 A;  4IR8 A;  1KZ8 A;  2CZK A;  5ET7 A;  2OX3 A;  3ROJ A;  1NUY A;  5J16 A;  1D9Q A;  1QGX A;  1NUX A;  2F3B A;  5IZ1 A;  3IFA A;  1INP A;  3BIG A;  2DDK A;  1VDW A;  5ET6 A;  1RDX A;  4I3E A;  1NV0 A;  4PTK A;  1NUZ A;  4AS5 A;  4I3Y A;  2CZI A;  4HE0 A;  5I3S A;  4GWY A;  5EQ8 A;  1FPK A;  1NI9 A;  2FBP A;  5ET8 A;  1FPI A;  1LBX A;  1NV1 A;  3KC0 A;  3KBZ A;  1NV4 A;  2BJI A;  4GX6 A;  4GX3 A;  2CZH A;  1IMD A;  1FBH A;  1IMC A;  5EQ9 A;  1NV5 A;  2WEF A;  1FBE A;  1LBY A;  4H46 A;  2F3D A;  1NV2 A;  1IMF A;  4GBV A;  1DCU A;  2Q8M A;  4AS4 A;  1RDZ A;  1FPD A;  4QXD A;  1EYK A;  1LEV A;  3D1R A;  1CNQ A;  1FBG A; 
#chains in the Genus database with same CATH topology
 2DE3 A;  2P3V A;  1P1Q A;  1IMB A;  1MQD A;  4K3F A;  2B4L A;  1FBC A;  3EN3 A;  4QF9 A;  1TT1 A;  2Q2C A;  3T96 B;  1NL5 A;  3C9H A;  3ILT B;  4L17 A;  5IAI A;  1M5C A;  2QL3 A;  3K6V A;  2Q89 A;  2E0S A;  2V3Q A;  3HN0 A;  1O7T A;  3C36 A;  5CBR A;  3G3H A;  3TCG A;  2WYK A;  1Y3P A;  1FBF A;  3LSX A;  1EZP A;  1MDP 1;  1H76 A;  1H43 A;  5A5X A;  4PFT A;  4PFI A;  4OHN A;  4XTC Q;  3KJ7 A;  4EDP A;  5I56 A;  4C1T A;  3ODB A;  4M1V A;  3U65 A;  3MPK A;  5DVI A;  3FXU A;  1DPP A;  4U1O A;  3CSB A;  2HEU A;  4Q8R A;  4YKP A;  2XD3 A;  4GXS B;  4IO2 A;  3IAZ A;  4OFL A;  3FZV A;  2P1S A;  3B7D A;  2X26 A;  1N7X A;  1VE4 A;  5IKB A;  3PMV A;  4DLD A;  1B6H A;  3UOR A;  1M5E A;  2Q8M A;  2O1M A;  2QPQ A;  2DWJ A;  1OQG A;  4N8G A;  2O68 A;  3TZA A;  1QUK A;  1B32 A;  1FBG A;  4GBW A;  4O3B A;  1UIU A;  1G0H A;  4GWO A;  4H0W A;  2RC9 A;  4MH5 A;  4OFJ A;  3K00 A;  4NHB A;  4OWD A;  3GYY A;  4R6H A;  1URS A;  3G3J A;  3CFX A;  5TU0 A;  1I6Q A;  1LBZ A;  1B51 A;  3N26 A;  4P47 A;  4PGN A;  4GWW A;  4ZS9 A;  1MY4 A;  2R9J A;  2ZNS A;  1UQW A;  4P56 A;  3LBS A;  2DWH A;  4IGR A;  4HCY A;  3T1B A;  2NVU B;  4ISU A;  1RYO A;  3W9W A;  1A55 A;  2XXI A;  2ALU A;  3VLW A;  1MY2 A;  4LN5 A;  3QUF A;  4C0R A;  5I2K A;  1FTM A;  2CZL A;  1FQD A;  3KOT A;  4H45 A;  1SW2 A;  3H06 B;  3FIR A;  4U23 A;  3F11 A;  2BJJ X;  3IO6 A;  1VDW A;  4MX6 A;  4PFR A;  4IO4 A;  3ZKK A;  1MY0 A;  4IB2 A;  4POW A;  1T0K A;  4P1L A;  3V83 A;  1NI9 A;  3MBP A;  2G29 A;  4MNC A;  2PT1 A;  3MAM A;  3I6V A;  5H8F B;  2HFB A;  1PC3 A;  1II5 A;  3GLB A;  2I58 A;  2V25 A;  2ZYN A;  2Z23 A;  3TOD A;  1QKB A;  1LBY A;  3PMW A;  4U1Z A;  3B6T A;  1EYK A;  3U72 A;  2XXX A;  3OO7 A;  4JWY A;  3K4U A;  2ZZX A;  4JSD A;  4PAI A;  3H6W A;  3K6U A;  5DVJ A;  3EHS A;  1NMU A;  3FV2 A;  1XT8 A;  5LOM A;  1FJ6 A;  4ZDM A;  5H8H A;  1FPF A;  1HSL A;  2V84 A;  1QUI A;  4O3A A;  4RA1 A;  5AA4 A;  3EHU A;  1FSA A;  1DTZ A;  2ZYK A;  2B4M A;  5IM2 A;  1TFD A;  5KCJ B;  3TAJ A;  3C35 A;  4GWZ A;  5DVF A;  4PDD A;  2F7B A;  4O3C A;  3MVZ A;  3C4M A;  2P0S A;  1BK4 A;  1SW1 A;  3G3I A;  2RCB A;  4R6Y A;  4OVP A;  1MXZ A;  3PTY A;  2F6P A;  2A5T B;  5KZT A;  4WXJ A;  2B3B A;  5L8D A;  1US4 A;  3CG1 A;  3FAS A;  3ROJ A;  2H99 A;  5A5X B;  4EXK A;  1GTK A;  3W9V A;  4LQ2 A;  2YPN A;  4OEU A;  1Y3Q A;  4N6K A;  4EQB A;  1CB6 A;  5J1D A;  3FXQ A;  3MWB A;  1IXG A;  4QFK A;  3N6U A;  3FD3 A;  2QMX A;  2CZH A;  2PFZ A;  3O29 A;  1IMF A;  2HZL A;  5ELV A;  4NF4 B;  3D1R A;  1R9L A;  5IGA A;  2XXH A;  1CNQ A;  1LFI A;  5CMC A;  1B05 A;  4XKR A;  4ECF A;  1FPB A;  5ESY A;  4P1E A;  2ANJ A;  2HQ0 A;  3HPI A;  4N4U A;  2ZNU A;  1B3E A;  2H9B A;  1AIV A;  1H44 A;  3DM0 A;  4XFE A;  3PPN A;  3SEV A;  4H5G A;  5CMB A;  3FGS A;  1IIT A;  1PEB A;  1FPL A;  1ZU0 A;  2FVZ A;  1Y1Z A;  2O84 X;  4OET A;  1K9Z A;  4BDO A;  4N6P A;  1MQJ A;  5M2V A;  5EQ7 A;  1KA0 A;  4F18 A;  4EXL A;  2DWI A;  3G7W A;  4FJP A;  5T3J A;  1B40 A;  1NNK A;  2ZYO A;  4ZZE A;  2Q74 A;  5AA4 B;  3N6T A;  3SEX A;  4NQ8 A;  3T66 A;  4DXC A;  2F78 A;  4RK9 A;  3QYT A;  4X48 A;  1ANF A;  1ELJ A;  3MP8 A;  2F3B A;  1A40 A;  3RTW B;  4G68 C;  2VHA A;  2OBG A;  3BFT A;  4OVQ A;  4P9K A;  1XVX A;  3C33 A;  1LCT A;  4G8N A;  2F8D A;  3L6G A;  2PX1 A;  1B7H A;  4PQJ A;  3RGY A;  3TYH A;  4ELO A;  2I0C A;  2ABH A;  1FPD A;  1B5I A;  3I3V A;  2I3W A;  1VFE A;  4GWU A;  1PB9 A;  3G3G A;  4KPT A;  3RTF B;  4LZ7 A;  3CFZ A;  3KN3 A;  4HCW A;  4OYV A;  3VVF A;  2Z8D A;  1I6A A;  2Q9T A;  3O9P A;  1AWB A;  1IXH A;  3LR1 A;  1ZLQ A;  4TQU Q;  5ET5 A;  3TUS A;  1JW4 A;  4NF8 A;  1WVJ A;  1UTB A;  4G77 A;  4TLL B;  2QVR A;  1B58 A;  2Y5K A;  1N04 A;  5ICQ A;  1J1N A;  4PF8 A;  5FHM A;  1OLC A;  5DT6 A;  1Y4C A;  3PU5 A;  4Z0I A;  4GX4 A;  4I1D A;  2X7Q A;  3FBP A;  4GRK A;  4OEV A;  1PBQ A;  1Q1K A;  2QJE A;  3KZG A;  4QSD A;  4NF4 A;  4DE8 A;  4I40 A;  1D4N A;  3LUY A;  4OER A;  4P3L A;  4KFQ A;  4RXL A;  5CM6 A;  2I4C A;  5B7D A;  3UGW A;  4H5F A;  3QAX A;  1YPN A;  2XWK A;  1N0T A;  1Y9U A;  2ESN A;  4NWD A;  3M8U A;  1XC1 A;  4AB6 A;  3ISP A;  4MLQ A;  1O64 A;  1MQI A;  2PT2 A;  1N3W A;  4GQO A;  1FTO A;  1AOV A;  1JVY A;  4N15 A;  2QS2 A;  2XXQ A;  2UYE A;  3IOV A;  3K02 A;  3PUV E;  4MAG A;  1EZ9 A;  4I8C A;  1IMA A;  4F1U A;  2I3V A;  4F3B A;  2F35 A;  4KXP A;  1FBD A;  2QFL A;  2QVU A;  1H45 A;  3Q25 A;  3SDF A;  1Y1M A;  3M3F A;  2WBD A;  4XKQ A;  4BDN A;  1OVT A;  1MY3 A;  2XWO A;  3PUZ E;  1MS7 A;  3A29 A;  3IOW A;  4NGU A;  5HBC A;  2WBB A;  1MXX A;  1F9B A;  1LB8 A;  4OEN A;  1P1W A;  4PFU A;  4EUO A;  4XF5 A;  2XXV A;  3R6U A;  5AA2 A;  3SEY A;  4H8J A;  1LBW A;  1SW5 A;  2PMS A;  3FV1 A;  4NN3 A;  4GWX A;  1P1N A;  4THI A;  4GIZ A;  3B8B A;  4R73 A;  4ND9 A;  4NF6 B;  4PET A;  1XS5 A;  3EQ1 A;  3IK6 B;  4QBA A;  2XXY A;  1B5J A;  5LTC A;  2KLF A;  3GBB A;  5J16 A;  1QKA A;  2HAV A;  1INP A;  2XA5 A;  4F2Q A;  1IZ1 A;  2DS9 A;  4I62 A;  1MY1 A;  4XEQ A;  2O51 A;  1NUZ A;  1ZKB A;  2HCA A;  4FAT A;  4LZ8 A;  4DXU A;  2CMO A;  1BKA A;  4R74 A;  2FBP A;  1B2H A;  3DP4 A;  1B5H A;  1NV1 A;  4YB6 A;  3K0V A;  3Q26 A;  5HM4 B;  3KN8 A;  2BJI A;  4GX3 A;  3MPL A;  1DMB A;  1B1H A;  4F1Y A;  4IGT A;  3FUZ A;  1IMD A;  3T9V A;  3E13 X;  1IMC A;  4OFO A;  4TOZ A;  3Q28 A;  4FOR A;  3USD A;  5ISU A;  3RQT A;  4GL8 A;  4Z7E A;  3DP8 A;  4KD5 A;  5HPQ A;  1HSE A;  3FVO A;  3O2A A;  1NV7 A;  1YCJ A;  1RYX A;  5I2N A;  2OPE A;  4NF5 B;  4MCO A;  1SQY A;  3H03 A;  4MBP A;  4P0G A;  4YIC A;  2MKZ A;  2XWV A;  3A3U A;  3PPP A;  2UXA A;  1Q9D A;  4GWS A;  2DE2 A;  2O69 A;  4N8Y A;  1NV3 A;  1ZIU A;  1EYI A;  3PD8 A;  1DK4 A;  3FAT A;  3U1O A;  2HZK A;  2DWA A;  1A99 A;  3O6H A;  3IL1 B;  2R6G E;  4MF3 A;  1YZ0 A;  2FNC A;  5I57 A;  4BDR A;  2QVV A;  3MC2 A;  1ZJL A;  4FAJ A;  4LQ5 A;  3ILU B;  4DI3 D;  3TCH A;  2RKM A;  1MPB A;  4N13 A;  2UVJ A;  4F19 A;  4MEV A;  3O28 A;  4JVI A;  4KI0 E;  1SYH A;  3H4Z A;  4O8M A;  4Q30 B;  2UVG A;  4KCD A;  3O6I A;  1LBB A;  2HXW A;  3SKP A;  5I3S A;  4LA9 A;  1LBX A;  4F2O A;  4P11 A;  4NAP A;  4DZ1 A;  2ZXT A;  2REJ A;  3KEI A;  1MPD A;  5L9O A;  5EQ9 A;  4MLV A;  2WEF A;  1FBE A;  4H46 A;  2QRY A;  1B1X A;  1TFA A;  4QXD A;  4BLA A;  4O7M A;  4ELR A;  5F24 A;  1FRP A;  3N94 A;  1AL3 A;  5H8N B;  3B6W A;  1Y20 A;  5I57 B;  2F97 A;  1TXF A;  4YU0 A;  2OZZ A;  2FHY A;  3K2D A;  2H25 A;  1JEU A;  4U4S A;  5JTY B;  1AMF A;  2IA4 A;  5DW8 A;  1N3X A;  2AYS A;  2DSF A;  3V8X B;  3BFU A;  4HE2 A;  4EQ9 A;  1B3L A;  3QSL A;  3RUM A;  5H8Q A;  3VDF A;  1FBP A;  3PPQ A;  4R9G A;  5DTB A;  1RDY A;  5I5P A;  3H6T A;  2PCR A;  5H8S A;  1H3D A;  1DBZ A;  3A09 A;  1MXY A;  4MJO A;  4N07 A;  1Y4T A;  1NNT A;  2D3I A;  3MP6 A;  1I6B A;  3MZ9 A;  3HST A;  4HXV A;  2B3F A;  1KZ8 A;  2AL5 A;  2O7I A;  1D3K A;  3VVD A;  2XXR A;  1NUY A;  4N6D A;  3S9M C;  3IFA A;  5TP9 B;  1NH7 A;  2NWJ A;  2KQZ A;  2X7P A;  1PB7 A;  3QXM A;  1SDX A;  4I3Y A;  1Q35 A;  5H8F A;  3KBR A;  1LBC A;  4HE0 A;  3ECR A;  5ET8 A;  3FVK A;  1FPI A;  1SVX B;  1KWH A;  3IJX B;  3P7I A;  4ZEF A;  2WX9 A;  1MM6 A;  4KQP A;  2OPD A;  4O94 A;  3KG2 A;  2V3U A;  3H6U A;  5CBS A;  3TKD A;  1NV2 A;  4H8I A;  2R71 A;  4AS4 A;  4LON B;  1MH3 A;  1NKX A;  1VFD A;  2XX9 A;  4OXV A;  2QS4 A;  2E1S A;  2P3N A;  1GR2 A;  4IO5 A;  3S9E A;  3RYD A;  4YB7 A;  1SI0 A;  2RC7 A;  4IO6 A;  1LFH A;  5KDT A;  4ESW A;  2F7A A;  1LAG E;  2F34 A;  2VOZ A;  1OLA A;  3OSQ A;  1D9V A;  1USY H;  3JYR A;  3N5L A;  2ONK E;  4AQ4 A;  4QRZ A;  4X1B A;  4X9T A;  4MNI A;  2OK2 A;  5AA1 A;  5AA2 B;  1B46 A;  4YAH X;  3S9L C;  1G0I A;  1L5T A;  4R6K A;  5CRY A;  3S2V A;  4QSC A;  2VGQ A;  4DCY A;  4HTG A;  4LP2 B;  2XWI A;  4TLM B;  3OO6 A;  1OIB A;  1B7U A;  1DSN A;  2O6A A;  1POT A;  2CZK A;  1R9Q A;  5ET7 A;  1P99 A;  2Q88 A;  2OX3 A;  1P1U A;  3PV0 E;  3K6X A;  5I84 A;  2DXY A;  4G8M A;  4FEB A;  2HXR A;  5I59 B;  3FXB A;  3MUQ A;  4F3S A;  1IUD A;  3OD7 A;  3FJ7 A;  2ZMB A;  5I58 A;  4NF8 B;  4GWY A;  4PFW A;  3VLU A;  3PGF A;  4PBH A;  5AE4 A;  4FIM A;  3OMB A;  2Q8J A;  3VV5 A;  1GVC A;  2OCU A;  4GF8 A;  1MRP A;  2Q2A A;  3EF7 A;  3PUW E;  4JVD A;  1A54 A;  4ZED A;  3WAF A;  2M8C A;  3EKI A;  4GFR A;  5B70 A;  3RPL A;  5EYG A;  4ELP A;  5FHN A;  2H4I A;  3CHG A;  5JK4 A;  2RIN A;  1USY E;  4NTL A;  4H65 A;  5CI5 A;  2HHM A;  3ZS6 A;  5KDT B;  3MJN A;  2FA7 A;  3UN6 A;  2Z8F A;  3KN7 A;  3HO7 A;  2O1L A;  2RC8 A;  2JJK A;  1RKM A;  4U2R A;  4FEC A;  4O7I A;  1FTA A;  4UA8 A;  4OVR A;  4G68 B;  3LSL A;  5L9S A;  1HSJ A;  1PDA A;  3GZG A;  3I5O A;  4ZEK A;  4KR5 A;  5H8H B;  4G2Z A;  3LSF B;  2XXU A;  4YKK A;  5IZ1 A;  2DE4 A;  5DYH A;  2A5T A;  4QFL A;  1IXC A;  1NV0 A;  5K2X A;  3PPR A;  5FHO A;  4NF5 A;  1OQH A;  1A7L A;  5EHM A;  4DIG A;  3CFL A;  5I7I A;  4KYE A;  1VSO A;  3D4C A;  3S9N C;  4R72 A;  1SW4 A;  1NH8 A;  4FED A;  3K1P A;  3W15 C;  4DI4 B;  3R7X A;  4H6D A;  1OVB A;  3IB2 A;  4E0W A;  4OA4 A;  4F3P A;  4PGP A;  2QS1 A;  3SEU A;  1QUJ A;  1SI1 A;  4RK2 A;  3TCF A;  3UP9 A;  4RJZ A;  3MVY A;  4OMB A;  3RN8 A;  1QW0 A;  3IOU A;  5ICT A;  1IEJ A;  3EPE A;  4Q0C A;  4ZE8 A;  4RYA A;  1B9J A;  3LUZ A;  1DPE A;  4WED A;  2NOO A;  4NG7 A;  5K2Y A;  1Z7M E;  4GXA A;  4N81 A;  3T0J A;  4UAB A;  5F7V A;  3TDJ A;  3T22 A;  1KA1 A;  2ZZV A;  2NUV A;  3FJG A;  3FVN A;  4C1U A;  2F36 A;  1FPE A;  4XKP A;  1GGG A;  1XHY A;  2ZYM A;  4GD5 A;  1SBP A;  1FQA A;  1FQE A;  4GL0 A;  1XVY A;  3FVG A;  2Y7R A;  4PAK A;  5FTI A;  4OVT A;  4LAT A;  2OJT A;  1ZTY A;  2DVZ A;  3TEL A;  4AB5 A;  3C32 A;  4PP0 A;  3JZJ A;  3VVE A;  3VE1 B;  4POX A;  3R26 A;  3OEM A;  3U8Q A;  1QUL A;  4R2F A;  5JTY A;  2ZNT A;  1LLS A;  4ZEB A;  3OOA A;  5BWJ A;  1DCU A;  1TWY A;  3HHF A;  3PD9 A;  3HFU A;  1A8F A;  3IJO B;  3CI8 A;  3OEK A;  1EU8 A;  3CRB A;  3DP6 A;  5H8Q B;  4E0X A;  4OVJ A;  1LCF A;  5L9M A;  3K01 A;  2Z22 A;  3EHT A;  1NNF A;  2XXW A;  3O66 A;  4G4P A;  4F22 A;  3IOT A;  4JXI A;  3QK6 A;  2I4B A;  3BIH A;  1D9Y A;  2VP1 A;  2KR0 A;  1FPJ A;  2UVH A;  1ATG A;  5TPA B;  1US5 A;  1PBP A;  2Y7I A;  3B6Q A;  2ZZW A;  3U92 A;  1POY 1;  5I56 B;  3H3G A;  3SEW A;  2H98 A;  4DXB A;  4XIG Q;  2LAO A;  2VD3 A;  2V93 A;  4GLI A;  3LV0 A;  1SYI A;  2Y84 A;  1MH4 A;  3G3F A;  4N91 A;  2FYI A;  5EHS A;  1JP4 A;  3IFC A;  4R9F A;  1YYZ A;  2XXP A;  1MQH A;  4F1V A;  2XX7 A;  4P8B A;  5DEX B;  3T9U A;  5CMM A;  5I2K B;  4JDF A;  2CEX A;  4BDM A;  1SD3 A;  4OVS A;  3SZP A;  1N76 A;  3LSW A;  1NNP A;  4G8H A;  2PYY A;  3E79 A;  1EZO A;  3KFM A;  1WDN A;  5ET6 A;  4NWC A;  1MPC A;  4RY1 A;  2HPG A;  2I6E A;  3D4G A;  1FW0 A;  2GHB A;  2XD2 A;  4PFY A;  2AIX A;  3KC0 A;  2THI A;  3OO9 A;  1NV4 A;  2P2A A;  3RY3 A;  3V5A A;  1MXU A;  1N7W A;  3OEL A;  1NV5 A;  1LAF E;  1S7Y A;  2WYP A;  3E78 A;  4ESX A;  1ZBM A;  2I48 A;  4YZZ A;  3PUX E;  4KYD A;  1B0H A;  1LEV A;  4H67 A;  3Q29 A;  1MG1 A;  3UK4 A;  5I59 A;  3L6H A;  4QFO A;  4OTE A;  1IME A;  5LDZ A;  1GV8 A;  3HHG A;  1B7Z A;  4RPN A;  3TQW A;  1LFG A;  3CVG A;  3CR9 A;  3AXF A;  2GFE A;  2R8T A;  2XXK A;  3IO4 A;  3KC1 A;  1XI6 A;  1WOD A;  5AA2 D;  1JW5 A;  2Z8E A;  5H8N A;  3M3K A;  3TTM A;  3JV9 A;  4IY5 A;  2Y7W A;  2XHD A;  3K6W A;  3K1M A;  3IOR A;  5BUU A;  3THI A;  4JBZ A;  2AL4 A;  1MQG A;  3U93 A;  3TTR A;  1K9Y A;  4PE5 B;  1SPI A;  4R75 A;  2B65 A;  2W7Y A;  3RPL B;  3ONM A;  2F7C A;  3K1N A;  4MHF A;  3RT8 A;  1B52 A;  1FQB A;  3VXB A;  3NOH A;  2OLB A;  3VFJ A;  2QS3 A;  4PDH A;  2UVI A;  4EF1 A;  4LVQ A;  1NUX A;  3FXR A;  3BIG A;  2Y7P A;  4PAF A;  4ELQ A;  1A8E A;  2O7U A;  1FQC A;  5DEX A;  4F3G A;  5CMK A;  3IB0 A;  1FPK A;  1P1O A;  3T93 B;  3CSG A;  4H1X A;  4ZEC A;  2GRV A;  4OQO A;  3TFL A;  4WKM A;  3MZ1 A;  5FTH A;  4KCC A;  3T9H B;  4X8R A;  1R1N A;  3G3K A;  1FQF A;  3MST A;  2Y5L A;  5TPA A;  2RF1 A;  2V4C A;  4KYS A;  1B4H A;  1LAH E;  1MXV A;  4I9D A;  2V3T A;  1BIY A;  3PUY E;  1B4Z A;  4ZZA A;  2NXO A;  1MDQ A;  5KCJ A;  4G68 A;  3SER A;  3OSR A;  1NUW A;  1B3G A;  3SET A;  2PBW A;  5TP9 A;  1YAE A;  4QSE A;  1R6Z A;  4OAN A;  4JVC A;  4GVO A;  1IXI A;  2RCA A;  2GQ1 A;  3FJM A;  4OES A;  5EYF A;  4NMY A;  3RNN A;  3TTN A;  3H6V A;  2A5S A;  5FBP A;  3KSJ A;  2IEE A;  2I49 A;  3UA8 A;  3CIJ A;  4FE8 A;  1FJ9 A;  5EQA A;  1MM7 A;  2VD2 A;  2FIX A;  5F1Q A;  2OWZ A;  3MP1 A;  4JWX A;  4IO7 A;  1EH3 A;  1Y3N A;  3E9X A;  5IZZ A;  1D9Q A;  4XXU A;  4R2B A;  1URG A;  1UIV A;  4IY6 A;  4QHQ A;  4BDQ A;  1IIW A;  4I3E A;  4BDL A;  3ZKL A;  2DP8 A;  2YLN A;  4AS5 A;  1VR5 A;  3TPA A;  3TTK A;  1M5D A;  2CEY A;  4PE3 A;  3C31 A;  4U22 A;  4X04 A;  3KBZ A;  3OO8 A;  3TQL A;  1S9T A;  4PF6 A;  2GHA A;  4PBQ A;  3OXN A;  2DOJ A;  4NF0 A;  4F39 A;  3HV1 A;  4N17 A;  4RPO A;  1IQ7 A;  1MXW A;  1JNF A;  4NE4 A;  4LZ5 A;  1EYJ A;  3MW0 A;  4NF6 A;  4YKJ A;  3V89 B;  3M3L A;  2VT5 A;  3GBA A;  3OEN A;  1JW1 A;  1QVS A;  3PMX A;  4U4X A;  1JVX A;  3QMF A;  2DXR A;  3DEL B;  1B3H A;  1OMP A;  4MFI A;  1JET A;  1S50 A;  2ONR A;  1YTV A;  2DVC A;  4HE1 A;  2D21 A;  4DDD A;  3TEP A;  3C34 A;  5ITO A;  4YKI A;  3VLV A;  5IZ3 B;  1BTJ A;  4KHZ E;  1NFT A;  3RT6 B;  3TMG A;  2VPO A;  4GOT A;  3MZB A;  3H7M A;  1BLF A;  3E3K A;  2ONS A;  2L5V A;  3IB1 A;  1QGX A;  3KGC A;  1M5B A;  3T9X B;  1AH5 A;  4WEP A;  2DDK A;  1UTH A;  2QSX A;  3DLN A;  1RDX A;  5I58 B;  1BP5 A;  2WKY A;  4YB5 A;  3Q27 A;  1PB8 A;  4IO3 A;  2CZI A;  4YMA A;  1N84 A;  5EQ8 A;  3RLF E;  3HCQ A;  4Q5T A;  3ZSF A;  4MNP A;  4HS7 A;  4HW8 A;  3GXA A;  2HAU A;  2XX8 A;  2UYF A;  3CG3 A;  3IX1 A;  1FBH A;  2YJP A;  4MMP A;  1DTG A;  3B50 A;  3O97 A;  4GBV A;  4ONY A;  1Z7N E;  4DCX A;  3SES A;  4JB7 A;  3VXC A;  1UTB B;  2QMW A;  4EQ7 A;  1QJM A;  5AA3 A;  1XOC A;  2PVU A;  1LST A;  3PPO A;  4YMB A;  1M5F A;  4X1D A;  5CC2 A;  1B3F A;  1LBV A;  3LC8 A;  2G93 A;  4RNS A;  1B0L A;  4U21 A;  3A3C A;  3KSX A;  2D5W A;  1NV6 A;  3KJT A;  4MIJ A;  3QUJ A;  4G61 A;  2F5X A;  3S4U A;  5EYH A;  1FTJ A;  3BBR A;  1YXI A;  1FPG A;  4FBP A;  3O6G A;  2OWT A;  4ZEI A;  1FTL A;  2Y7K A;  3TTL A;  4JSO A;  2F6G A;  4EF2 A;  4LUB A;  1JEV A;  4OZ9 A;  4PFB A;  4QFP A;  3RPW A;  2DYX A;  3E4R A;  1LB9 A;  5JEI A;  3U94 A;  5A5L A;  2FIE A;  3MVW A;  5IZ3 A;  4IR8 A;  1LGB C;  3QIM A;  2H5Y A;  4JWO A;  3IR1 A;  2PFY A;  2XXT A;  4PC9 A;  1O63 A;  3MQ9 A;  2REG A;  2I0B A;  4UAC A;  1DOT A;  4F31 B;  1CE2 A;  3WAE A;  4PTK A;  3MVX A;  1LAX A;  4F29 A;  4XKN A;  3UIF A;  4QFN A;  4NX1 A;  4M4G A;  1FTK A;  3KOS A;  1JQF A;  4GX6 A;  1UTH B;  1FCK A;  1I69 A;  1ZMG A;  2VPN A;  4NED A;  4P0I A;  1URD A;  3MYU A;  2OWS A;  2DQV A;  5ITP A;  2F3D A;  3BKI B;  1RDZ A;  2GH9 A;  4ZE9 A;  4PCD A;  5I2N B; 
#chains in the Genus database with same CATH homology
 4GWU A;  1IMA A;  4GBW A;  1IME A;  1NV7 A;  5F24 A;  5LDZ A;  1FRP A;  1FPB A;  2DE3 A;  2P3N A;  2P3V A;  1G0H A;  2Y5L A;  1EYJ A;  5ESY A;  3B50 A;  2V4C A;  3MST A;  4P1E A;  1IMB A;  4PAI A;  4PGP A;  2VT5 A;  4KXP A;  1FBD A;  2QFL A;  2QVU A;  2B4L A;  3RYD A;  1FBC A;  4JVD A;  4HCW A;  4N4U A;  4MCO A;  4NHB A;  2WBD A;  2Q9T A;  3EKI A;  1AWB A;  3GYY A;  1LBV A;  2XWO A;  2ZZX A;  2R8T A;  3BIH A;  5EYG A;  2FHY A;  3QMF A;  3RPL A;  5ET5 A;  4XFE A;  3A29 A;  4NGU A;  4YIC A;  3LUZ A;  2KR0 A;  1FJ6 A;  1FPJ A;  2WBB A;  2MKZ A;  2XXK A;  2XWV A;  1LBZ A;  4NG7 A;  1NUW A;  3KC1 A;  1XI6 A;  4P47 A;  1FPL A;  5DW8 A;  1FPF A;  1Q9D A;  4PGN A;  1NV6 A;  2FVZ A;  2QVR A;  2Y5K A;  4GWW A;  4GWS A;  3CHG A;  4MIJ A;  4XF5 A;  5JK4 A;  4F1U A;  2DE2 A;  4G61 A;  2F5X A;  4N8Y A;  4PF8 A;  5EYH A;  1K9Z A;  4N81 A;  3T0J A;  2HHM A;  4HE2 A;  4OAN A;  4P56 A;  1NV3 A;  2V3Q A;  2ZZW A;  1YXI A;  4JVC A;  4UAB A;  1FPG A;  1FSA A;  4FBP A;  4HE1 A;  1EYI A;  5EQ7 A;  1LBW A;  1FBP A;  2GQ1 A;  2B4M A;  4X9T A;  1KA0 A;  5IM2 A;  4F18 A;  1DK4 A;  1KA1 A;  4MNI A;  4HCY A;  4NN3 A;  1RDY A;  2HZK A;  3T1B A;  4GX4 A;  3LV0 A;  2ZZV A;  4GWX A;  5T3J A;  5IZ3 B;  5I5P A;  2PCR A;  4GWZ A;  2WYK A;  4PDD A;  1FBF A;  1YZ0 A;  3FBP A;  1DBZ A;  3B8B A;  4N91 A;  1FPE A;  3W9W A;  1G0I A;  2Q74 A;  1K9Y A;  1JP4 A;  3IFC A;  1SPI A;  2QVV A;  4MJO A;  5FBP A;  4PFB A;  2JJK A;  4PET A;  2VPO A;  1BK4 A;  4LN5 A;  4PFI A;  3RPL B;  4O7I A;  1YYZ A;  1FTA A;  4OVR A;  4MHF A;  2XWI A;  4NQ8 A;  3NOH A;  1FJ9 A;  5EQA A;  4DI3 D;  4F1V A;  4P8B A;  4OVP A;  2FIX A;  5A5L A;  4PDH A;  2FIE A;  3PTY A;  4PAK A;  4F19 A;  4I40 A;  5IZ3 A;  2OWZ A;  4HXV A;  4H45 A;  4IR8 A;  2L5V A;  4JVI A;  4MEV A;  4P3L A;  4QBA A;  1KZ8 A;  4M1V A;  4OVT A;  3U65 A;  2CZK A;  2PFY A;  5LTC A;  2CEX A;  5ET7 A;  4PC9 A;  4OVS A;  3SZP A;  2OX3 A;  3ROJ A;  1NUY A;  5J16 A;  2DVZ A;  4N6D A;  1D9Q A;  1QGX A;  1NUX A;  2F3B A;  5IZ1 A;  3E79 A;  4O8M A;  3IFA A;  1INP A;  3BIG A;  3W9V A;  5CM6 A;  2XA5 A;  2DE4 A;  2DDK A;  1VDW A;  2KQZ A;  5ET6 A;  1RDX A;  4MX6 A;  4PAF A;  2HXR A;  4PFR A;  3FXB A;  4I3E A;  1NV0 A;  4XEQ A;  4PTK A;  1NUZ A;  4P9K A;  4OVQ A;  2HPG A;  4N6K A;  4AS5 A;  2XWK A;  4I3Y A;  2CZI A;  4NX1 A;  2CEY A;  4P1L A;  4HE0 A;  5J1D A;  5I3S A;  4GWY A;  5EQ8 A;  1FPK A;  1NI9 A;  2FBP A;  5ET8 A;  1FPI A;  1LBX A;  4PE3 A;  1NV1 A;  3KC0 A;  3ISP A;  4MNC A;  4MNP A;  4PBH A;  3KBZ A;  4X04 A;  1NV4 A;  2WX9 A;  4NAP A;  4PF6 A;  5I7I A;  2BJI A;  4GX6 A;  4GX3 A;  2CZH A;  2VPN A;  4PBQ A;  4O94 A;  1IMD A;  1FBH A;  4MMP A;  1IMC A;  5EQ9 A;  1NV5 A;  2WEF A;  3MYU A;  4NF0 A;  4OA4 A;  1FBE A;  2WYP A;  2PFZ A;  1LBY A;  4H46 A;  2F3D A;  1NV2 A;  1IMF A;  4GBV A;  1DCU A;  2Q8M A;  2HZL A;  4N15 A;  4YZZ A;  4X8R A;  4N17 A;  4AS4 A;  1RDZ A;  1FPD A;  2QPQ A;  4DI4 B;  4QXD A;  3HFU A;  1EYK A;  1LEV A;  4N8G A;  3E78 A;  3D1R A;  4O7M A;  4MAG A;  4PCD A;  5IGA A;  5IZZ A;  1CNQ A;  1FBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...