3IFCA

Human muscle fructose-1,6-bisphosphatase e69q mutant in complex with amp and alpha fructose-6-phosphate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
323
Chain Sequence
DMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 113
structure length 323
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3ifcA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3ifcA02
2CZKA 1RDXA 2R8TA 5EQ9A 5F24A 1NUXA 2DDKA 2JJKA 4HXVA 1KA0A 2Y5LA 2OWZA 4I3EA 2F3BA 1INPA 2FHYA 1FBCA 3QMFA 1DCUA 1NV6A 2WEFA 1IMAA 4HE1A 2Q74A 1NV2A 4KXPA 1EYIA 1BK4A 5FBPA 1IMBA 5T3JA 4FBPA 1NUYA 1NV5A 4AS4A 4I40A 1XI6A 5I3SA 1FBGA 1FPIA 1FRPA 1LBVA 1FPEA 1NV3A 4HE2A 5EQAA 1FTAA 1G0IA 2WBBA 3LUZA 1DBZA 1Q9DA 3LV0A 4QXDA 4H45A 3A29A 4MJOA 4PTKA 4GX4A 2FVZA 2Y5KA 2CZIA 1NV0A 5IZ1A 4I3YA 5IZ3B 1QGXA 1KZ8A 5EYGA 4GX3A 2QFLA 4N81A 4AS5A 1D9QA 4IR8A 5DW8A 1KA1A 2F3DA 5EQ7A 5A5LA 4GX6A 4GWZA 4O7IA 1K9YA 1K9ZA 1IMFA 1FBPA 3RPLA 1JP4A 3KBZA 1RDYA 1IMCA 4HE0A 2QVUA 4GBVA 5J16A 1FBFA 2Q8MA 2GQ1A 1DK4A 1LBWA 1YYZA 3KC0A 1IMDA 1LBYA 2WBDA 3T0JA 3IFAA 1CNQA 1NV7A 1EYJA 1FPJA 3BIGA 2P3NA 1FPDA 4GWXA 1YXIA 3B8BA 3D1RA 2PCRA 1FBEA 3ROJA 5ET7A 1FJ6A 5LDZA 1NUZA 2QVRA 1EYKA 5ET6A 1FJ9A 4GBWA 1NV1A 2BJIA 3KC1A 3FBPA 4GWWA 4GWUA 1VDWA 5ET5A 1SPIA 1FPBA 1LBXA 2FBPA 1FBHA 2FIXA 1NV4A 4GWSA 3RYDA 1FSAA 3BIHA 5EQ8A 1FBDA 5EYHA 5ESYA 4GWYA 1FPFA 3RPLB 1FPGA 1AWBA 1RDZA 1IMEA 1FPLA 5IZ3A 1LBZA 1LEVA 4H46A 1YZ0A 2HHMA 2FIEA 4G61A 2QVVA 5ET8A 1G0HA 1NI9A 2P3VA 1FPKA 1NUWA 2CZHA 3IFCA 2OX3A 2VT5A
chains in the Genus database with same CATH superfamily
2YLNA 3Q25A 4O7MA 1AOVA 4U4XA 2DOJA 5I56A 4OVRA 3K02A 2OPEA 4GD5A 4PFBA 3K0VA 1P1UA 2Q9TA 3IX1A 5T3JA 2RCAA 3H6WA 4O3AA 3PD8A 5AA1A 2Z8DA 1ZU0A 1FRPA 4XF5A 2P1SA 4QBAA 3DP6A 2I3WA 1POTA 5EHSA 1IXIA 1D3KA 5CRYA 4P8BA 3FUZA 4ZEDA 4I3YA 1QGXA 3OO7A 1VE4A 5IKBA 1NH7A 4GXAA 1II5A 1SQYA 4PETA 1HSLA 2WKYA 3TAJA 4OVTA 2RKMA 4DXBA 3Q28A 1RDYA 4FEDA 2UXAA 2A5SA 3K00A 2DXYA 2GHAA 3PUZE 4BDOA 1FPJA 4F2OA 1MM7A 2PCRA 3BFTA 1OQHA 4R74A 1HSEA 1YTVA 1OMPA 5L9OA 4OFOA 1SPIA 3FXQA 3DP8A 3EF7A 4OFJA 2QSXA 1F9BA 5H8SA 3RPLB 4NF4B 2ZXTA 1AWBA 3TODA 5K2XA 3I3VA 3RGYA 3T22A 4R6YA 4G61A 1NI9A 4YZZA 2KLFA 1B51A 2F7AA 1DOTA 2ZYKA 1R1NA 2FHYA 1IXHA 3F11A 4PC9A 1LFGA 4RPOA 4FBPA 2DVCA 3VLWA 4DI3D 3BFUA 2F7BA 1S50A 4PCDA 4H45A 3S9NC 4MJOA 4OZ9A 5I84A 3EN3A 4WEDA 3WAEA 2ONSA 4QHQA 3LSLA 4ZDMA 1M5CA 1GTKA 1US5A 3T96B 3HN0A 4LZ8A 2H9BA 2QS1A 5DW8A 1P1QA 3R6UA 1URSA 2DVZA 4AB5A 4EQBA 2AIXA 3R7XA 4GL0A 4MFIA 4TOZA 5I2KA 3CFLA 4N07A 1AIVA 1NNPA 3KSXA 3T0JA 1GR2A 2Z8FA 4MNCA 1DMBA 4KYSA 4GWXA 4JSOA 1USYH 4IO7A 2GRVA 4QFLA 3MZ1A 4DZ1A 4E0XA 2NVUB 2FBPA 2B4LA 3CR9A 3TTKA 3P7IA 2BJJX 3KOSA 5AA2A 3VFJA 1BP5A 4N8GA 5B70A 1MY3A 3C4MA 1B3FA 2CEXA 1LB8A 1FQAA 4JVDA 1IEJA 4LONB 5F24A 4MMPA 1FCKA 2VPNA 4MNPA 3MP6A 3W9WA 4OVSA 2DE3A 1B3GA 4F3PA 3MPKA 3U72A 2QL3A 1NV2A 1RKMA 1B4HA 1GV8A 3GLBA 3VXCA 1N3XA 3USDA 2O84X 2M8CA 3E13X 4G68B 4X8RA 4XTCQ 4AQ4A 4GX4A 4G8HA 3HCQA 4C0RA 1Y3QA 4AS5A 4QSCA 2NXOA 4R72A 2F8DA 2OPDA 3UA8A 3H4ZA 4HCWA 5CM6A 1J1NA 2R6GE 2ZNUA 3D4CA 3KN3A 4LQ5A 1IMCA 3TUSA 1DK4A 3KC0A 2XXUA 5AE4A 5L8DA 1IMDA 4RPNA 4EXKA 3BIGA 1PB7A 2P3NA 3KEIA 3Q27A 3PU5A 1UTHA 5EYFA 4ESWA 2UYFA 3A3UA 3BKIB 1QKAA 2XXPA 3UN6A 3IB0A 3RYDA 4KCDA 4PP0A 5EQ8A 3OSQA 1P1WA 1I69A 5ITOA 2H99A 5IZ3A 4GVOA 3RQTA 2FIEA 4BDQA 3QUFA 3IFCA 1MY2A 4HS7A 3DM0A 3E3KA 1MQIA 3K1NA 4U23A 4EF1A 1SW5A 3G3HA 2V3TA 2HCAA 1Y20A 1IMAA 4HE1A 2O7IA 2XX8A 3JV9A 3QK6A 3JYRA 5I57B 1IZ1A 1JNFA 3E9XA 2I48A 4X9TA 3CI8A 3FIRA 4OERA 2CZIA 4ECFA 1B46A 1JQFA 2D3IA 1KZ8A 2WYKA 1FTMA 3N26A 3H6TA 4FEBA 4R2FA 4OANA 4O94A 1FQFA 2XWVA 3KBZA 3W15C 2E0SA 2Q8MA 5TPAB 2VGQA 3G7WA 4I8CA 2WYPA 3S2VA 3ISPA 3OELA 2RINA 2DE2A 4FIMA 5DEXA 2I49A 4ZZEA 2XXRA 3LR1A 1DPPA 2I0CA 2R71A 1NUZA 3B6QA 4R9GA 3KJTA 3U8QA 4NTLA 2XWIA 5DVFA 4PFYA 2O6AA 4GL8A 2XXTA 1LBXA 4YU0A 2WX9A 2FIXA 4ZE9A 2OK2A 2ZNSA 2PYYA 3W9VA 4MH5A 4U22A 1MXWA 1Q35A 3PUYE 1QUIA 4NMYA 1JW5A 1ANFA 3TFLA 4F39A 4MLQA 1RYXA 1RDXA 5IGAA 1XOCA 2XWOA 3H7MA 4OFLA 1KA0A 4OA4A 1JEVA 3O97A 1Z7ME 3QMFA 1POY1 4WEPA 3U92A 1NV5A 1NNFA 2Q88A 4WXJA 4DXCA 3O6IA 4HE2A 3EHTA 1ZLQA 4JXIA 4YMAA 3FVOA 4P1EA 1MXYA 4N15A 3Q29A 5FHNA 3PD9A 1TWYA 4RJZA 1UIVA 2HXRA 5CMBA 1B9JA 1D9QA 4IR8A 4C1UA 2Y7IA 2GH9A 3ZS6A 2HQ0A 2Y7RA 2DS9A 5I2NB 3IJXB 1K9ZA 1R6ZA 4LA9A 4JVCA 4H5FA 3H06B 2QVUA 3JZJA 4GBVA 1VR5A 3GXAA 5H8HA 3TCFA 1LBYA 4PFUA 3PUVE 1CNQA 1Y4TA 4F1VA 4XXUA 2R9JA 2UVIA 3FJGA 1FBEA 3K1MA 4NF5A 5CMMA 4ZEBA 3V5AA 1FJ9A 1UTBA 4JSDA 2REGA 1SVXB 1H43A 3MP1A 2VD3A 3OOAA 3VVEA 4RK2A 3OO9A 4IB2A 4THIA 3VLUA 1SYHA 4IO2A 5L9SA 3N6UA 5AA3A 4H67A 3UORA 3PUWE 4LZ5A 2RC9A 5ET8A 1G0HA 4NG7A 4FE8A 5FHOA 1MS7A 4OQOA 2DDKA 4N13A 4LQ2A 4H5GA 2PX1A 1QUJA 3ZKLA 1YCJA 3FVKA 1UQWA 4AS4A 1VFDA 4NWDA 1DPEA 1FTLA 2YPNA 3PGFA 5EQAA 3PMWA 2DSFA 4NQ8A 2A5TB 2ONRA 4YICA 3KG2A 3K4UA 4O8MA 1XVXA 1B40A 2DWJA 2FA7A 1LBCA 1KA1A 2KR0A 3UIFA 2Q8JA 2D21A 3THIA 3OXNA 4HW8A 3FV2A 5HBCA 2THIA 3CFZA 4MCOA 4LN5A 3KGCA 5J16A 3AXFA 4P11A 3MUQA 1P1NA 4NF8B 1ZJLA 1ZMGA 2ZYMA 4YKIA 3K6UA 4NHBA 3RT6B 1WVJA 1FW0A 5I59A 1B3EA 2P0SA 2QS3A 1A40A 4POXA 4GWWA 3O29A 4OYVA 1IITA 5H8QA 3IL1B 2F35A 3CG3A 2ZMBA 3ECRA 4N4UA 4XEQA 4KQPA 2ZZVA 4BDRA 5CMKA 3C31A 1CB6A 1YZ0A 1M5BA 3OO8A 3FXUA 1LCTA 4R73A 4OEUA 1B52A 1LFHA 1NFTA 3PPOA 4RNSA 4QFKA 4YB5A 1NNKA 4NF6A 3M3LA 1NV6A 1SYIA 4U2RA 3KBRA 5TU0A 4TQUQ 1KWHA 2OCUA 3TDJA 1MQGA 2D5WA 4QXDA 3A29A 2REJA 1PB8A 2HZKA 1O7TA 1I6BA 1CE2A 3KJ7A 3KN7A 5DT6A 4FAJA 5CBSA 2Q2AA 3KSJA 3TEPA 4OVPA 5A5XA 2PVUA 2I6EA 3SEWA 3DLNA 2O1LA 5JTYB 1M5EA 5KDTA 5I58A 1D9YA 2ZNTA 2Q2CA 2ZYNA 1YYZA 3UGWA 3B50A 1QW0A 5F1QA 1NH8A 1NV7A 3UP9A 1H44A 4E0WA 4PQJA 4MIJA 3K01A 5H8FB 5H8NB 2AL4A 4LP2B 5TP9A 1BIYA 4QFNA 3CSBA 4GBWA 1OQGA 2B65A 2HZLA 4H6DA 3GBBA 4U4SA 4XKNA 1VDWA 3EQ1A 1B6HA 3EHUA 3N6TA 3Q26A 4Q8RA 3RY3A 3G3FA 4Z7EA 1SW2A 4I9DA 1NUWA 1JVXA 4GQOA 5CBRA 1B05A 3V8XB 2Y84A 2CZKA 4LZ7A 1JVYA 1NUXA 2OWZA 2OJTA 2F3BA 3MPLA 3TZAA 3VLVA 1FBCA 4GXSB 3RPWA 4JB7A 3H6UA 1JW1A 1LGBC 1PB9A 4GOTA 4TLLB 3TYHA 2Q89A 4F29A 2V84A 4IO5A 2O7UA 3PPRA 4LATA 2FVZA 4OVQA 2OLBA 1M5DA 3V89B 4R6KA 3PPPA 4PAFA 2F6PA 4NGUA 4GRKA 1A8EA 3RTFB 2UVHA 4AB6A 4GX6A 2XX7A 5I56B 4ESXA 4NE4A 4QSEA 3TKDA 2NUVA 4K3FA 5DTBA 2P2AA 1Y9UA 1A99A 3FV1A 5AA4A 3FXRA 1R9QA 2XD2A 5EHMA 2DP8A 1B3HA 5BUUA 4C1TA 4P1LA 1BKAA 4KPTA 5DVJA 1LLSA 4P0GA 3G3IA 1OIBA 3G3JA 2IEEA 1AL3A 3E79A 4F1UA 3K6WA 1FQDA 4DIGA 4EXLA 4KFQA 3BIHA 3HO7A 2B4MA 4OTEA 2DE4A 3CG1A 4O3CA 5J1DA 2XD3A 4KI0E 4MNIA 1B5IA 3IB2A 4EF2A 1FPKA 2VHAA 1MY0A 2JJKA 2PBWA 5K2YA 2I0BA 2X26A 4XKRA 4H65A 1TFAA 3RLFE 1A54A 4KXPA 4F3SA 1PEBA 3MZBA 1MXVA 3QXMA 4G8NA 1YPNA 1NV3A 4JDFA 3OO6A 4Z0IA 3RUMA 4JBZA 1URGA 5IZ1A 2ONKE 1LFIA 1H3DA 3SESA 3QUJA 3O9PA 4G68C 2XA5A 5LTCA 3ZSFA 4RY1A 5AA2D 3FZVA 4L17A 3TMGA 1VSOA 4WKMA 3B6WA 1K9YA 1IMFA 2RCBA 4PDDA 5KCJA 4HE0A 5ISUA 3T9VA 3MVXA 2GQ1A 3K2DA 3IAZA 2F6GA 3IFAA 2F78A 1XS5A 1ZTYA 1H45A 1YXIA 3D1RA 2RC8A 4ONYA 1MXZA 3HV1A 1GGGA 3LSXA 4X04A 3LSWA 2XXVA 1SW1A 2V25A 5CC2A 1XHYA 4IY6A 4LVQA 5I2KB 1SBPA 3O6HA 2E1SA 3FJMA 3QIMA 4DCYA 4ISUA 2RF1A 4H0WA 3LBSA 3IO4A 1AMFA 4IO3A 3PPQA 4M4GA 3MC2A 4HXVA 4I3EA 4F22A 3QSLA 4OMBA 3S9LC 1BK4A 1ZKBA 3HPIA 5IM2A 1LBVA 2DWIA 1FPEA 2OZZA 2XWKA 4QRZA 4YAHX 1Q9DA 2F97A 1N3WA 1PC3A 2DYXA 5AA2B 2OBGA 4BDLA 2GHBA 4DDDA 4DLDA 1EZPA 3IR1A 3QAXA 3SETA 3I6VA 2H5YA 2DWAA 3DP4A 4OVJA 1B5HA 4N8YA 3IB1A 3SEYA 3LSFB 3RPLA 4NF4A 3CHGA 3B6TA 1FQEA 2OWTA 2VP1A 1RYOA 4NWCA 1XT8A 2ZZWA 4GWOA 5CMCA 1N84A 4ZEFA 1O64A 4R6HA 3SZPA 2ALUA 4P0IA 3R26A 3SKPA 4R2BA 3RN8A 4PBQA 1IXGA 1ATGA 3PUXE 2V93A 3MVWA 1Q1KA 2PT1A 3H6VA 4RA1A 3CRBA 3VDFA 2I3VA 3TTLA 3IJOB 4KYEA 4RK9A 1T0KA 1FBHA 1NV4A 4N91A 4IO4A 5ESYA 5FHMA 3MZ9A 4ZECA 5CI5A 3OMBA 3HHGA 1Y3NA 3SDFA 5JEIA 4XIGQ 4N6DA 1UTHB 4KYDA 1MDQA 1INPA 3VE1B 4OHNA 5HPQA 4PBHA 1MXXA 2WEFA 3FXBA 5FBPA 3IK6B 3E78A 4QFPA 4P47A 1XI6A 4OESA 5L9MA 2HFBA 4F2QA 1FTAA 4RYAA 1A55A 3MP8A 2UVJA 1NV0A 3MYUA 3RT8A 5IZ3B 4N81A 2O51A 3M8UA 1O63A 4MAGA 3VXBA 4N6PA 5A5LA 3GYYA 3MQ9A 2H4IA 4KHZE 4BDMA 1NKXA 2XX9A 3S9MC 4DCXA 3O66A 5B7DA 3O28A 4H1XA 3PPNA 4ZEIA 2ABHA 1USYE 3QYTA 2O1MA 1EYJA 2Y7WA 3L6HA 3OEMA 4X1DA 3B8BA 2HPGA 1EYKA 4FORA 4H8JA 1NV1A 4OENA 4XKPA 4POWA 2B3FA 5DYHA 2QJEA 2VOZA 4OEVA 4G68A 4KR5A 4GWYA 1LAGE 4GLIA 2MKZA 1RDZA 5IAIA 4NAPA 4H46A 3C35A 5ICTA 1MY1A 1MQJA 3HHFA 2CZHA 1PDAA 4DI4B 4G2ZA 2F5XA 2XXYA 4JWXA 4O3BA 5DEXB 3ILTB 3GZGA 5FTHA 2I4BA 2FNCA 3C34A 3GBAA 1US4A 3OEKA 4Q0CA 1B5JA 2ESNA 4F19A 3HFUA 3L6GA 1MPDA 1NUYA 3FASA 4I1DA 3U94A 1FBGA 1DTGA 2ANJA 3LUZA 2B3BA 3LV0A 1M5FA 4PE5B 5M2VA 1Y3PA 5I5PA 1DTZA 3M3KA 2PFZA 3OSRA 4QF9A 1GVCA 4GX3A 4PFRA 5JK4A 4QFOA 1P99A 2G29A 5EQ7A 2G93A 2XHDA 5ICQA 3M3FA 4IGRA 4MBPA 2DWHA 2X7PA 5BWJA 2YJPA 1MH3A 3PMVA 4F3BA 3S4UA 1FQCA 1QULA 3O6GA 2WBDA 2OWSA 4NEDA 3KOTA 3WAFA 4YB7A 3K6VA 2DQVA 4DE8A 1MQHA 4ELRA 1FJ6A 2I58A 4LUBA 2GFEA 4DXUA 2IA4A 4UABA 2XXXA 1FTOA 4FATA 5LOMA 3FJ7A 3BBRA 5HM4B 3H3GA 1FPBA 5I57A 1TXFA 4GWSA 2FYIA 3ZKKA 1S7YA 2XXQA 2H25A 1FPLA 2RC7A 5H8HB 4PDHA 2P3VA 3S9EA 1B7HA 1QVSA 2VT5A 5EQ9A 1OLAA 1B7ZA 2V4CA 1LBBA 4NF5B 3T1BA 1UTBB 1ZIUA 2VPOA 3I5OA 4I40A 1OVTA 2QRYA 4H8IA 5TPAA 4ELPA 4OXVA 1DBZA 4U21A 4U1ZA 4RXLA 4PTKA 3EPEA 4ZEKA 1JW4A 4F31B 4MF3A 2CMOA 4R9FA 1Y4CA 5ITPA 2O68A 2QFLA 1EH3A 1SDXA 3MWBA 4OWDA 4NN3A 4P56A 4F18A 3VV5A 2Z23A 4PE3A 1WDNA 2PMSA 1SI0A 1R9LA 3DELB 4O7IA 3SEUA 2XXKA 4NF0A 1FBPA 1JP4A 1N7WA 3O2AA 4G8MA 1LB9A 4YB6A 2ZYOA 3G3GA 2Z22A 1DSNA 1MRPA 3MVYA 2W7YA 1FPDA 1BLFA 4IO6A 4GF8A 2QVRA 1H76A 1B1XA 4ZZAA 4PAIA 2BJIA 3KC1A 1SD3A 4MHFA 1SI1A 4PFIA 4N6KA 4HCYA 1WODA 3C33A 1FSAA 1MQDA 4G77A 1FBDA 5EYHA 3SEVA 2F34A 1TFDA 1OLCA 3C32A 1FPGA 1MPBA 1LCFA 1QKBA 2AYSA 3KZGA 1B1HA 4MLVA 1LAHE 2OX3A 3NOHA 4BLAA 2R8TA 3ODBA 1EU8A 1N0TA 2Y5LA 5I2NA 1L5TA 5I59B 1MG1A 3TQLA 1MY4A 1IXCA 3MBPA 4PFTA 1DCUA 3KFMA 2Q74A 2XXIA 1EYIA 2I4CA 1IMBA 1MXUA 3MVZA 4ZE8A 2LAOA 5H8QB 1LAFE 5I3SA 3CFXA 1D4NA 1XC1A 1MH4A 1A7LA 4FJPA 2UVGA 1N04A 2Z8EA 5EYGA 3PTYA 3TPAA 4Q5TA 4HTGA 5FTIA 4EDPA 1BTJA 2F7CA 4PF6A 3TCHA 3MW0A 3T66A 3V83A 2QPQA 3CVGA 4EQ9A 3N94A 1QJMA 3VVDA 4NF6B 1OVBA 4UACA 2XXHA 3T93B 3FVGA 3FVNA 1LSTA 1FBFA 3IO6A 2F36A 1LBWA 1Y1MA 3EKIA 1EZ9A 4PGPA 1YAEA 2AL5A 4QSDA 2QMWA 3A3CA 1B7UA 3ROJA 5ET7A 4R75A 5ET6A 3TQWA 4PFWA 1URDA 2QS2A 4U1OA 1TT1A 2HAVA 4GWUA 4F1YA 4YMBA 3OENA 4ELQA 5A5XB 4XKQA 2KQZA 2A5TA 2QS4A 1PBQA 5KDTB 5I58B 3TTMA 2QVVA 5KZTA 3KN8A 1Y1ZA 3T9HB 2VD2A 3MJNA 4BDNA 4ELOA 5TP9B 3ILUB 3U1OA 3SEXA 3FGSA 1Z7NE 2DXRA 1B2HA 5ELVA 1B0HA 1G0IA 4NF8A 3LUYA 2ZZXA 3EHSA 3FD3A 3IOUA 1FTJA 3IOVA 3T9XB 2Y5KA 4EQ7A 4JWOA 3TCGA 4GIZA 3U65A 5DVIA 1UIUA 4EUOA 1NMUA 1FTKA 2V3UA 4P9KA 2F3DA 1N7XA 1SW4A 4IGTA 4F3GA 4GFRA 2NOOA 1JEUA 4YKKA 2H98A 3UK4A 3ONMA 2HXWA 1IQ7A 3G3KA 1VFEA 2UYEA 3IOTA 1N76A 1A8FA 3K6XA 2PFYA 2V3QA 1P1OA 4TLMB 4FECA 5LDZA 1D9VA 3TTRA 1NL5A 1XVYA 4M1VA 1B0LA 4ND9A 5ET5A 4UA8A 3OD7A 1FPFA 4KD5A 1IMEA 4Q30B 5AA4B 1LBZA 2HHMA 1HSJA 3C9HA 1B32A 1B3LA 3MSTA 2HAUA 1IUDA 4X1BA 3LC8A 4OETA 1EZOA 2Y7PA 5JTYA 4YKJA 3RTWB 3B7DA 4MX6A 3MAMA 3CSGA 5F7VA 1FPIA 1LAXA 4N17A 3IORA 5IZZA 2WBBA 1NNTA 4JWYA 3U93A 2NWJA 4NX1A 4JVIA 5H8NA 5H8FA 2Y7KA 4XFEA 2L5VA 3TTNA 1I6QA 1MM6A 2PT2A 3SERA 4KCCA 4PAKA 3T9UA 1ZBMA 2CZLA 4GWZA 3A09A 2O69A 3HSTA 4I62A 3K1PA 3PMXA 3E4RA 1B4ZA 2XXWA 4G4PA 4P3LA 1AH5A 3TELA 3RNNA 2QMXA 4PF8A 3PV0E 1B58A 4YKPA 3FBPA 1S9TA 2HEUA 3CIJA 1I6AA 4MEVA 3N5LA 5I7IA 4IY5A 1MDP1 3D4GA 1MPCA 2CEYA 4PGNA 4ZS9A 5KCJB 3VVFA 1PBPA 1LEVA 3H03A 3C36A 2X7QA 1QUKA 4X48A 1FQBA 1JETA 3IOWA 1IIWA 3FATA 1ELJA
chains in the Genus database with same CATH topology
1RDXA 5EQ9A 5IGAA 4O7MA 2JJKA 2XWOA 2V4CA 1KA0A 4OVRA 4OA4A 3T1BA 3QMFA 4PFBA 4KXPA 2VPOA 2Q9TA 5T3JA 1NV5A 4I40A 1FRPA 4XF5A 1NV3A 4HE2A 4QBAA 1DBZA 4P1EA 4N15A 4PTKA 5IZ1A 4P8BA 4I3YA 1QGXA 2QFLA 2HXRA 4NN3A 4P56A 4F18A 2XA5A 1D9QA 4IR8A 5LTCA 4PE3A 4PETA 4O7IA 1K9YA 1K9ZA 2XXKA 4JVCA 4NF0A 1IMFA 1FBPA 4OVTA 1JP4A 4PDDA 1RDYA 4HE0A 2QVUA 4GBVA 2GQ1A 1LBYA 3IFAA 1CNQA 4F1VA 1FPJA 1FPDA 1YXIA 3D1RA 2PCRA 1FBEA 2QVRA 1FJ9A 4PAIA 4X04A 2BJIA 3KC1A 4MHFA 1SPIA 4PFIA 4N6KA 4HCYA 1FSAA 1FBDA 5EYHA 3RPLB 1FPGA 1AWBA 4G61A 5ET8A 1G0HA 1NI9A 4YZZA 4NG7A 3NOHA 2OX3A 2R8TA 2DDKA 4HXVA 2Y5LA 4I3EA 2FHYA 1DCUA 4PC9A 2Q74A 1EYIA 1BK4A 1IMBA 4FBPA 4AS4A 5I3SA 4DI3D 5IM2A 1LBVA 1FPEA 2XWKA 5EQAA 1Q9DA 4PCDA 4H45A 4MJOA 4NQ8A 4YICA 4O8MA 5EYGA 3PTYA 5DW8A 1KA1A 2KR0A 4PF6A 2DVZA 2QPQA 4N8YA 3RPLA 3CHGA 4MCOA 4LN5A 5J16A 1FBFA 1LBWA 3T0JA 2ZZWA 3EKIA 4MNCA 4PGPA 4GWXA 4NHBA 3SZPA 3ROJA 5ET7A 5ET6A 4PBQA 4GWWA 4GWUA 2FBPA 2B4LA 1FBHA 1NV4A 2KQZA 4N91A 4N4UA 4XEQA 5ESYA 2ZZVA 4N8GA 1YZ0A 2QVVA 2CEXA 4JVDA 5F24A 4MMPA 2VPNA 4MNPA 4N6DA 3W9WA 4OVSA 1INPA 2DE3A 4PBHA 1NV6A 2WEFA 1NV2A 3FXBA 5FBPA 3E78A 4P47A 1XI6A 1FTAA 1G0IA 4QXDA 3A29A 2ZZXA 4X8RA 4GX4A 2HZKA 2Y5KA 1NV0A 3MYUA 5IZ3B 3U65A 4N81A 4AS5A 4MAGA 4P9KA 2F3DA 5A5LA 3GYYA 4OVPA 4HCWA 5CM6A 1IMCA 1DK4A 1YYZA 3KC0A 1IMDA 3B50A 1NV7A 1EYJA 3BIGA 4MIJA 2PFYA 2P3NA 2V3QA 3B8BA 2HPGA 5LDZA 1EYKA 4GBWA 1NV1A 2HZLA 1VDWA 4M1VA 5ET5A 3RYDA 5EQ8A 4GWYA 1FPFA 2MKZA 1RDZA 1IMEA 4NAPA 5IZ3A 1LBZA 4H46A 2HHMA 2FIEA 1NUWA 2CZHA 3IFCA 4DI4B 2CZKA 2F5XA 3MSTA 1NUXA 2OWZA 2F3BA 1FBCA 1IMAA 4HE1A 4F19A 3HFUA 1NUYA 4MX6A 1FBGA 1FPIA 4N17A 5IZZA 2WBBA 3LUZA 3LV0A 4X9TA 4NX1A 4JVIA 5I5PA 2FVZA 2PFZA 2CZIA 4OVQA 4XFEA 2L5VA 1KZ8A 2WYKA 4GX3A 4PFRA 4PAFA 4NGUA 5JK4A 4PAKA 5EQ7A 4GX6A 4OANA 4O94A 4GWZA 2XWVA 3KBZA 2Q8MA 2WBDA 2WYPA 4P1LA 3ISPA 4P3LA 2DE2A 1FJ6A 1NUZA 4PF8A 4UABA 2XWIA 3E79A 3FBPA 4F1UA 1FPBA 1LBXA 2WX9A 2FIXA 4GWSA 4MEVA 5I7IA 3BIHA 2B4MA 2DE4A 3W9VA 2CEYA 4PGNA 5J1DA 1FPLA 1LEVA 4MNIA 4PDHA 2P3VA 1FPKA 2VT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZK A;  1RDX A;  2R8T A;  5EQ9 A;  5F24 A;  1NUX A;  2DDK A;  2JJK A;  4HXV A;  1KA0 A;  2Y5L A;  2OWZ A;  4I3E A;  2F3B A;  1INP A;  2FHY A;  1FBC A;  3QMF A;  1DCU A;  1NV6 A;  2WEF A;  1IMA A;  4HE1 A;  2Q74 A;  1NV2 A;  4KXP A;  1EYI A;  1BK4 A;  5FBP A;  1IMB A;  5T3J A;  4FBP A;  1NUY A;  1NV5 A;  4AS4 A;  4I40 A;  1XI6 A;  5I3S A;  1FBG A;  1FPI A;  1FRP A;  1LBV A;  1FPE A;  1NV3 A;  4HE2 A;  5EQA A;  1FTA A;  1G0I A;  2WBB A;  3LUZ A;  1DBZ A;  1Q9D A;  3LV0 A;  4QXD A;  4H45 A;  3A29 A;  4MJO A;  4PTK A;  4GX4 A;  2FVZ A;  2Y5K A;  2CZI A;  1NV0 A;  5IZ1 A;  4I3Y A;  5IZ3 B;  1QGX A;  1KZ8 A;  5EYG A;  4GX3 A;  2QFL A;  4N81 A;  4AS5 A;  1D9Q A;  4IR8 A;  5DW8 A;  1KA1 A;  2F3D A;  5EQ7 A;  5A5L A;  4GX6 A;  4GWZ A;  4O7I A;  1K9Y A;  1K9Z A;  1IMF A;  1FBP A;  3RPL A;  1JP4 A;  3KBZ A;  1RDY A;  1IMC A;  4HE0 A;  2QVU A;  4GBV A;  5J16 A;  1FBF A;  2Q8M A;  2GQ1 A;  1DK4 A;  1LBW A;  1YYZ A;  3KC0 A;  1IMD A;  1LBY A;  2WBD A;  3T0J A;  3IFA A;  1CNQ A;  1NV7 A;  1EYJ A;  1FPJ A;  3BIG A;  2P3N A;  1FPD A;  4GWX A;  1YXI A;  3B8B A;  3D1R A;  2PCR A;  1FBE A;  3ROJ A;  5ET7 A;  1FJ6 A;  5LDZ A;  1NUZ A;  2QVR A;  1EYK A;  5ET6 A;  1FJ9 A;  4GBW A;  1NV1 A;  2BJI A;  3KC1 A;  3FBP A;  4GWW A;  4GWU A;  1VDW A;  5ET5 A;  1SPI A;  1FPB A;  1LBX A;  2FBP A;  1FBH A;  2FIX A;  1NV4 A;  4GWS A;  3RYD A;  1FSA A;  3BIH A;  5EQ8 A;  1FBD A;  5EYH A;  5ESY A;  4GWY A;  1FPF A;  3RPL B;  1FPG A;  1AWB A;  1RDZ A;  1IME A;  1FPL A;  5IZ3 A;  1LBZ A;  1LEV A;  4H46 A;  1YZ0 A;  2HHM A;  2FIE A;  4G61 A;  2QVV A;  5ET8 A;  1G0H A;  1NI9 A;  2P3V A;  1FPK A;  1NUW A;  2CZH A;  3IFC A;  2OX3 A;  2VT5 A; 
#chains in the Genus database with same CATH topology
 2YLN A;  3Q25 A;  4O7M A;  1AOV A;  4U4X A;  2DOJ A;  5I56 A;  4OVR A;  3K02 A;  2OPE A;  4GD5 A;  4PFB A;  3K0V A;  1P1U A;  2Q9T A;  3IX1 A;  5T3J A;  2RCA A;  3H6W A;  4O3A A;  3PD8 A;  5AA1 A;  2Z8D A;  1ZU0 A;  1FRP A;  4XF5 A;  2P1S A;  4QBA A;  3DP6 A;  2I3W A;  1POT A;  5EHS A;  1IXI A;  1D3K A;  5CRY A;  4P8B A;  3FUZ A;  4ZED A;  4I3Y A;  1QGX A;  3OO7 A;  1VE4 A;  5IKB A;  1NH7 A;  4GXA A;  1II5 A;  1SQY A;  4PET A;  1HSL A;  2WKY A;  3TAJ A;  4OVT A;  2RKM A;  4DXB A;  3Q28 A;  1RDY A;  4FED A;  2UXA A;  2A5S A;  3K00 A;  2DXY A;  2GHA A;  3PUZ E;  4BDO A;  1FPJ A;  4F2O A;  1MM7 A;  2PCR A;  3BFT A;  1OQH A;  4R74 A;  1HSE A;  1YTV A;  1OMP A;  5L9O A;  4OFO A;  1SPI A;  3FXQ A;  3DP8 A;  3EF7 A;  4OFJ A;  2QSX A;  1F9B A;  5H8S A;  3RPL B;  4NF4 B;  2ZXT A;  1AWB A;  3TOD A;  5K2X A;  3I3V A;  3RGY A;  3T22 A;  4R6Y A;  4G61 A;  1NI9 A;  4YZZ A;  2KLF A;  1B51 A;  2F7A A;  1DOT A;  2ZYK A;  1R1N A;  2FHY A;  1IXH A;  3F11 A;  4PC9 A;  1LFG A;  4RPO A;  4FBP A;  2DVC A;  3VLW A;  4DI3 D;  3BFU A;  2F7B A;  1S50 A;  4PCD A;  4H45 A;  3S9N C;  4MJO A;  4OZ9 A;  5I84 A;  3EN3 A;  4WED A;  3WAE A;  2ONS A;  4QHQ A;  3LSL A;  4ZDM A;  1M5C A;  1GTK A;  1US5 A;  3T96 B;  3HN0 A;  4LZ8 A;  2H9B A;  2QS1 A;  5DW8 A;  1P1Q A;  3R6U A;  1URS A;  2DVZ A;  4AB5 A;  4EQB A;  2AIX A;  3R7X A;  4GL0 A;  4MFI A;  4TOZ A;  5I2K A;  3CFL A;  4N07 A;  1AIV A;  1NNP A;  3KSX A;  3T0J A;  1GR2 A;  2Z8F A;  4MNC A;  1DMB A;  4KYS A;  4GWX A;  4JSO A;  1USY H;  4IO7 A;  2GRV A;  4QFL A;  3MZ1 A;  4DZ1 A;  4E0X A;  2NVU B;  2FBP A;  2B4L A;  3CR9 A;  3TTK A;  3P7I A;  2BJJ X;  3KOS A;  5AA2 A;  3VFJ A;  1BP5 A;  4N8G A;  5B70 A;  1MY3 A;  3C4M A;  1B3F A;  2CEX A;  1LB8 A;  1FQA A;  4JVD A;  1IEJ A;  4LON B;  5F24 A;  4MMP A;  1FCK A;  2VPN A;  4MNP A;  3MP6 A;  3W9W A;  4OVS A;  2DE3 A;  1B3G A;  4F3P A;  3MPK A;  3U72 A;  2QL3 A;  1NV2 A;  1RKM A;  1B4H A;  1GV8 A;  3GLB A;  3VXC A;  1N3X A;  3USD A;  2O84 X;  2M8C A;  3E13 X;  4G68 B;  4X8R A;  4XTC Q;  4AQ4 A;  4GX4 A;  4G8H A;  3HCQ A;  4C0R A;  1Y3Q A;  4AS5 A;  4QSC A;  2NXO A;  4R72 A;  2F8D A;  2OPD A;  3UA8 A;  3H4Z A;  4HCW A;  5CM6 A;  1J1N A;  2R6G E;  2ZNU A;  3D4C A;  3KN3 A;  4LQ5 A;  1IMC A;  3TUS A;  1DK4 A;  3KC0 A;  2XXU A;  5AE4 A;  5L8D A;  1IMD A;  4RPN A;  4EXK A;  3BIG A;  1PB7 A;  2P3N A;  3KEI A;  3Q27 A;  3PU5 A;  1UTH A;  5EYF A;  4ESW A;  2UYF A;  3A3U A;  3BKI B;  1QKA A;  2XXP A;  3UN6 A;  3IB0 A;  3RYD A;  4KCD A;  4PP0 A;  5EQ8 A;  3OSQ A;  1P1W A;  1I69 A;  5ITO A;  2H99 A;  5IZ3 A;  4GVO A;  3RQT A;  2FIE A;  4BDQ A;  3QUF A;  3IFC A;  1MY2 A;  4HS7 A;  3DM0 A;  3E3K A;  1MQI A;  3K1N A;  4U23 A;  4EF1 A;  1SW5 A;  3G3H A;  2V3T A;  2HCA A;  1Y20 A;  1IMA A;  4HE1 A;  2O7I A;  2XX8 A;  3JV9 A;  3QK6 A;  3JYR A;  5I57 B;  1IZ1 A;  1JNF A;  3E9X A;  2I48 A;  4X9T A;  3CI8 A;  3FIR A;  4OER A;  2CZI A;  4ECF A;  1B46 A;  1JQF A;  2D3I A;  1KZ8 A;  2WYK A;  1FTM A;  3N26 A;  3H6T A;  4FEB A;  4R2F A;  4OAN A;  4O94 A;  1FQF A;  2XWV A;  3KBZ A;  3W15 C;  2E0S A;  2Q8M A;  5TPA B;  2VGQ A;  3G7W A;  4I8C A;  2WYP A;  3S2V A;  3ISP A;  3OEL A;  2RIN A;  2DE2 A;  4FIM A;  5DEX A;  2I49 A;  4ZZE A;  2XXR A;  3LR1 A;  1DPP A;  2I0C A;  2R71 A;  1NUZ A;  3B6Q A;  4R9G A;  3KJT A;  3U8Q A;  4NTL A;  2XWI A;  5DVF A;  4PFY A;  2O6A A;  4GL8 A;  2XXT A;  1LBX A;  4YU0 A;  2WX9 A;  2FIX A;  4ZE9 A;  2OK2 A;  2ZNS A;  2PYY A;  3W9V A;  4MH5 A;  4U22 A;  1MXW A;  1Q35 A;  3PUY E;  1QUI A;  4NMY A;  1JW5 A;  1ANF A;  3TFL A;  4F39 A;  4MLQ A;  1RYX A;  1RDX A;  5IGA A;  1XOC A;  2XWO A;  3H7M A;  4OFL A;  1KA0 A;  4OA4 A;  1JEV A;  3O97 A;  1Z7M E;  3QMF A;  1POY 1;  4WEP A;  3U92 A;  1NV5 A;  1NNF A;  2Q88 A;  4WXJ A;  4DXC A;  3O6I A;  4HE2 A;  3EHT A;  1ZLQ A;  4JXI A;  4YMA A;  3FVO A;  4P1E A;  1MXY A;  4N15 A;  3Q29 A;  5FHN A;  3PD9 A;  1TWY A;  4RJZ A;  1UIV A;  2HXR A;  5CMB A;  1B9J A;  1D9Q A;  4IR8 A;  4C1U A;  2Y7I A;  2GH9 A;  3ZS6 A;  2HQ0 A;  2Y7R A;  2DS9 A;  5I2N B;  3IJX B;  1K9Z A;  1R6Z A;  4LA9 A;  4JVC A;  4H5F A;  3H06 B;  2QVU A;  3JZJ A;  4GBV A;  1VR5 A;  3GXA A;  5H8H A;  3TCF A;  1LBY A;  4PFU A;  3PUV E;  1CNQ A;  1Y4T A;  4F1V A;  4XXU A;  2R9J A;  2UVI A;  3FJG A;  1FBE A;  3K1M A;  4NF5 A;  5CMM A;  4ZEB A;  3V5A A;  1FJ9 A;  1UTB A;  4JSD A;  2REG A;  1SVX B;  1H43 A;  3MP1 A;  2VD3 A;  3OOA A;  3VVE A;  4RK2 A;  3OO9 A;  4IB2 A;  4THI A;  3VLU A;  1SYH A;  4IO2 A;  5L9S A;  3N6U A;  5AA3 A;  4H67 A;  3UOR A;  3PUW E;  4LZ5 A;  2RC9 A;  5ET8 A;  1G0H A;  4NG7 A;  4FE8 A;  5FHO A;  1MS7 A;  4OQO A;  2DDK A;  4N13 A;  4LQ2 A;  4H5G A;  2PX1 A;  1QUJ A;  3ZKL A;  1YCJ A;  3FVK A;  1UQW A;  4AS4 A;  1VFD A;  4NWD A;  1DPE A;  1FTL A;  2YPN A;  3PGF A;  5EQA A;  3PMW A;  2DSF A;  4NQ8 A;  2A5T B;  2ONR A;  4YIC A;  3KG2 A;  3K4U A;  4O8M A;  1XVX A;  1B40 A;  2DWJ A;  2FA7 A;  1LBC A;  1KA1 A;  2KR0 A;  3UIF A;  2Q8J A;  2D21 A;  3THI A;  3OXN A;  4HW8 A;  3FV2 A;  5HBC A;  2THI A;  3CFZ A;  4MCO A;  4LN5 A;  3KGC A;  5J16 A;  3AXF A;  4P11 A;  3MUQ A;  1P1N A;  4NF8 B;  1ZJL A;  1ZMG A;  2ZYM A;  4YKI A;  3K6U A;  4NHB A;  3RT6 B;  1WVJ A;  1FW0 A;  5I59 A;  1B3E A;  2P0S A;  2QS3 A;  1A40 A;  4POX A;  4GWW A;  3O29 A;  4OYV A;  1IIT A;  5H8Q A;  3IL1 B;  2F35 A;  3CG3 A;  2ZMB A;  3ECR A;  4N4U A;  4XEQ A;  4KQP A;  2ZZV A;  4BDR A;  5CMK A;  3C31 A;  1CB6 A;  1YZ0 A;  1M5B A;  3OO8 A;  3FXU A;  1LCT A;  4R73 A;  4OEU A;  1B52 A;  1LFH A;  1NFT A;  3PPO A;  4RNS A;  4QFK A;  4YB5 A;  1NNK A;  4NF6 A;  3M3L A;  1NV6 A;  1SYI A;  4U2R A;  3KBR A;  5TU0 A;  4TQU Q;  1KWH A;  2OCU A;  3TDJ A;  1MQG A;  2D5W A;  4QXD A;  3A29 A;  2REJ A;  1PB8 A;  2HZK A;  1O7T A;  1I6B A;  1CE2 A;  3KJ7 A;  3KN7 A;  5DT6 A;  4FAJ A;  5CBS A;  2Q2A A;  3KSJ A;  3TEP A;  4OVP A;  5A5X A;  2PVU A;  2I6E A;  3SEW A;  3DLN A;  2O1L A;  5JTY B;  1M5E A;  5KDT A;  5I58 A;  1D9Y A;  2ZNT A;  2Q2C A;  2ZYN A;  1YYZ A;  3UGW A;  3B50 A;  1QW0 A;  5F1Q A;  1NH8 A;  1NV7 A;  3UP9 A;  1H44 A;  4E0W A;  4PQJ A;  4MIJ A;  3K01 A;  5H8F B;  5H8N B;  2AL4 A;  4LP2 B;  5TP9 A;  1BIY A;  4QFN A;  3CSB A;  4GBW A;  1OQG A;  2B65 A;  2HZL A;  4H6D A;  3GBB A;  4U4S A;  4XKN A;  1VDW A;  3EQ1 A;  1B6H A;  3EHU A;  3N6T A;  3Q26 A;  4Q8R A;  3RY3 A;  3G3F A;  4Z7E A;  1SW2 A;  4I9D A;  1NUW A;  1JVX A;  4GQO A;  5CBR A;  1B05 A;  3V8X B;  2Y84 A;  2CZK A;  4LZ7 A;  1JVY A;  1NUX A;  2OWZ A;  2OJT A;  2F3B A;  3MPL A;  3TZA A;  3VLV A;  1FBC A;  4GXS B;  3RPW A;  4JB7 A;  3H6U A;  1JW1 A;  1LGB C;  1PB9 A;  4GOT A;  4TLL B;  3TYH A;  2Q89 A;  4F29 A;  2V84 A;  4IO5 A;  2O7U A;  3PPR A;  4LAT A;  2FVZ A;  4OVQ A;  2OLB A;  1M5D A;  3V89 B;  4R6K A;  3PPP A;  4PAF A;  2F6P A;  4NGU A;  4GRK A;  1A8E A;  3RTF B;  2UVH A;  4AB6 A;  4GX6 A;  2XX7 A;  5I56 B;  4ESX A;  4NE4 A;  4QSE A;  3TKD A;  2NUV A;  4K3F A;  5DTB A;  2P2A A;  1Y9U A;  1A99 A;  3FV1 A;  5AA4 A;  3FXR A;  1R9Q A;  2XD2 A;  5EHM A;  2DP8 A;  1B3H A;  5BUU A;  4C1T A;  4P1L A;  1BKA A;  4KPT A;  5DVJ A;  1LLS A;  4P0G A;  3G3I A;  1OIB A;  3G3J A;  2IEE A;  1AL3 A;  3E79 A;  4F1U A;  3K6W A;  1FQD A;  4DIG A;  4EXL A;  4KFQ A;  3BIH A;  3HO7 A;  2B4M A;  4OTE A;  2DE4 A;  3CG1 A;  4O3C A;  5J1D A;  2XD3 A;  4KI0 E;  4MNI A;  1B5I A;  3IB2 A;  4EF2 A;  1FPK A;  2VHA A;  1MY0 A;  2JJK A;  2PBW A;  5K2Y A;  2I0B A;  2X26 A;  4XKR A;  4H65 A;  1TFA A;  3RLF E;  1A54 A;  4KXP A;  4F3S A;  1PEB A;  3MZB A;  1MXV A;  3QXM A;  4G8N A;  1YPN A;  1NV3 A;  4JDF A;  3OO6 A;  4Z0I A;  3RUM A;  4JBZ A;  1URG A;  5IZ1 A;  2ONK E;  1LFI A;  1H3D A;  3SES A;  3QUJ A;  3O9P A;  4G68 C;  2XA5 A;  5LTC A;  3ZSF A;  4RY1 A;  5AA2 D;  3FZV A;  4L17 A;  3TMG A;  1VSO A;  4WKM A;  3B6W A;  1K9Y A;  1IMF A;  2RCB A;  4PDD A;  5KCJ A;  4HE0 A;  5ISU A;  3T9V A;  3MVX A;  2GQ1 A;  3K2D A;  3IAZ A;  2F6G A;  3IFA A;  2F78 A;  1XS5 A;  1ZTY A;  1H45 A;  1YXI A;  3D1R A;  2RC8 A;  4ONY A;  1MXZ A;  3HV1 A;  1GGG A;  3LSX A;  4X04 A;  3LSW A;  2XXV A;  1SW1 A;  2V25 A;  5CC2 A;  1XHY A;  4IY6 A;  4LVQ A;  5I2K B;  1SBP A;  3O6H A;  2E1S A;  3FJM A;  3QIM A;  4DCY A;  4ISU A;  2RF1 A;  4H0W A;  3LBS A;  3IO4 A;  1AMF A;  4IO3 A;  3PPQ A;  4M4G A;  3MC2 A;  4HXV A;  4I3E A;  4F22 A;  3QSL A;  4OMB A;  3S9L C;  1BK4 A;  1ZKB A;  3HPI A;  5IM2 A;  1LBV A;  2DWI A;  1FPE A;  2OZZ A;  2XWK A;  4QRZ A;  4YAH X;  1Q9D A;  2F97 A;  1N3W A;  1PC3 A;  2DYX A;  5AA2 B;  2OBG A;  4BDL A;  2GHB A;  4DDD A;  4DLD A;  1EZP A;  3IR1 A;  3QAX A;  3SET A;  3I6V A;  2H5Y A;  2DWA A;  3DP4 A;  4OVJ A;  1B5H A;  4N8Y A;  3IB1 A;  3SEY A;  3LSF B;  3RPL A;  4NF4 A;  3CHG A;  3B6T A;  1FQE A;  2OWT A;  2VP1 A;  1RYO A;  4NWC A;  1XT8 A;  2ZZW A;  4GWO A;  5CMC A;  1N84 A;  4ZEF A;  1O64 A;  4R6H A;  3SZP A;  2ALU A;  4P0I A;  3R26 A;  3SKP A;  4R2B A;  3RN8 A;  4PBQ A;  1IXG A;  1ATG A;  3PUX E;  2V93 A;  3MVW A;  1Q1K A;  2PT1 A;  3H6V A;  4RA1 A;  3CRB A;  3VDF A;  2I3V A;  3TTL A;  3IJO B;  4KYE A;  4RK9 A;  1T0K A;  1FBH A;  1NV4 A;  4N91 A;  4IO4 A;  5ESY A;  5FHM A;  3MZ9 A;  4ZEC A;  5CI5 A;  3OMB A;  3HHG A;  1Y3N A;  3SDF A;  5JEI A;  4XIG Q;  4N6D A;  1UTH B;  4KYD A;  1MDQ A;  1INP A;  3VE1 B;  4OHN A;  5HPQ A;  4PBH A;  1MXX A;  2WEF A;  3FXB A;  5FBP A;  3IK6 B;  3E78 A;  4QFP A;  4P47 A;  1XI6 A;  4OES A;  5L9M A;  2HFB A;  4F2Q A;  1FTA A;  4RYA A;  1A55 A;  3MP8 A;  2UVJ A;  1NV0 A;  3MYU A;  3RT8 A;  5IZ3 B;  4N81 A;  2O51 A;  3M8U A;  1O63 A;  4MAG A;  3VXB A;  4N6P A;  5A5L A;  3GYY A;  3MQ9 A;  2H4I A;  4KHZ E;  4BDM A;  1NKX A;  2XX9 A;  3S9M C;  4DCX A;  3O66 A;  5B7D A;  3O28 A;  4H1X A;  3PPN A;  4ZEI A;  2ABH A;  1USY E;  3QYT A;  2O1M A;  1EYJ A;  2Y7W A;  3L6H A;  3OEM A;  4X1D A;  3B8B A;  2HPG A;  1EYK A;  4FOR A;  4H8J A;  1NV1 A;  4OEN A;  4XKP A;  4POW A;  2B3F A;  5DYH A;  2QJE A;  2VOZ A;  4OEV A;  4G68 A;  4KR5 A;  4GWY A;  1LAG E;  4GLI A;  2MKZ A;  1RDZ A;  5IAI A;  4NAP A;  4H46 A;  3C35 A;  5ICT A;  1MY1 A;  1MQJ A;  3HHF A;  2CZH A;  1PDA A;  4DI4 B;  4G2Z A;  2F5X A;  2XXY A;  4JWX A;  4O3B A;  5DEX B;  3ILT B;  3GZG A;  5FTH A;  2I4B A;  2FNC A;  3C34 A;  3GBA A;  1US4 A;  3OEK A;  4Q0C A;  1B5J A;  2ESN A;  4F19 A;  3HFU A;  3L6G A;  1MPD A;  1NUY A;  3FAS A;  4I1D A;  3U94 A;  1FBG A;  1DTG A;  2ANJ A;  3LUZ A;  2B3B A;  3LV0 A;  1M5F A;  4PE5 B;  5M2V A;  1Y3P A;  5I5P A;  1DTZ A;  3M3K A;  2PFZ A;  3OSR A;  4QF9 A;  1GVC A;  4GX3 A;  4PFR A;  5JK4 A;  4QFO A;  1P99 A;  2G29 A;  5EQ7 A;  2G93 A;  2XHD A;  5ICQ A;  3M3F A;  4IGR A;  4MBP A;  2DWH A;  2X7P A;  5BWJ A;  2YJP A;  1MH3 A;  3PMV A;  4F3B A;  3S4U A;  1FQC A;  1QUL A;  3O6G A;  2WBD A;  2OWS A;  4NED A;  3KOT A;  3WAF A;  4YB7 A;  3K6V A;  2DQV A;  4DE8 A;  1MQH A;  4ELR A;  1FJ6 A;  2I58 A;  4LUB A;  2GFE A;  4DXU A;  2IA4 A;  4UAB A;  2XXX A;  1FTO A;  4FAT A;  5LOM A;  3FJ7 A;  3BBR A;  5HM4 B;  3H3G A;  1FPB A;  5I57 A;  1TXF A;  4GWS A;  2FYI A;  3ZKK A;  1S7Y A;  2XXQ A;  2H25 A;  1FPL A;  2RC7 A;  5H8H B;  4PDH A;  2P3V A;  3S9E A;  1B7H A;  1QVS A;  2VT5 A;  5EQ9 A;  1OLA A;  1B7Z A;  2V4C A;  1LBB A;  4NF5 B;  3T1B A;  1UTB B;  1ZIU A;  2VPO A;  3I5O A;  4I40 A;  1OVT A;  2QRY A;  4H8I A;  5TPA A;  4ELP A;  4OXV A;  1DBZ A;  4U21 A;  4U1Z A;  4RXL A;  4PTK A;  3EPE A;  4ZEK A;  1JW4 A;  4F31 B;  4MF3 A;  2CMO A;  4R9F A;  1Y4C A;  5ITP A;  2O68 A;  2QFL A;  1EH3 A;  1SDX A;  3MWB A;  4OWD A;  4NN3 A;  4P56 A;  4F18 A;  3VV5 A;  2Z23 A;  4PE3 A;  1WDN A;  2PMS A;  1SI0 A;  1R9L A;  3DEL B;  4O7I A;  3SEU A;  2XXK A;  4NF0 A;  1FBP A;  1JP4 A;  1N7W A;  3O2A A;  4G8M A;  1LB9 A;  4YB6 A;  2ZYO A;  3G3G A;  2Z22 A;  1DSN A;  1MRP A;  3MVY A;  2W7Y A;  1FPD A;  1BLF A;  4IO6 A;  4GF8 A;  2QVR A;  1H76 A;  1B1X A;  4ZZA A;  4PAI A;  2BJI A;  3KC1 A;  1SD3 A;  4MHF A;  1SI1 A;  4PFI A;  4N6K A;  4HCY A;  1WOD A;  3C33 A;  1FSA A;  1MQD A;  4G77 A;  1FBD A;  5EYH A;  3SEV A;  2F34 A;  1TFD A;  1OLC A;  3C32 A;  1FPG A;  1MPB A;  1LCF A;  1QKB A;  2AYS A;  3KZG A;  1B1H A;  4MLV A;  1LAH E;  2OX3 A;  3NOH A;  4BLA A;  2R8T A;  3ODB A;  1EU8 A;  1N0T A;  2Y5L A;  5I2N A;  1L5T A;  5I59 B;  1MG1 A;  3TQL A;  1MY4 A;  1IXC A;  3MBP A;  4PFT A;  1DCU A;  3KFM A;  2Q74 A;  2XXI A;  1EYI A;  2I4C A;  1IMB A;  1MXU A;  3MVZ A;  4ZE8 A;  2LAO A;  5H8Q B;  1LAF E;  5I3S A;  3CFX A;  1D4N A;  1XC1 A;  1MH4 A;  1A7L A;  4FJP A;  2UVG A;  1N04 A;  2Z8E A;  5EYG A;  3PTY A;  3TPA A;  4Q5T A;  4HTG A;  5FTI A;  4EDP A;  1BTJ A;  2F7C A;  4PF6 A;  3TCH A;  3MW0 A;  3T66 A;  3V83 A;  2QPQ A;  3CVG A;  4EQ9 A;  3N94 A;  1QJM A;  3VVD A;  4NF6 B;  1OVB A;  4UAC A;  2XXH A;  3T93 B;  3FVG A;  3FVN A;  1LST A;  1FBF A;  3IO6 A;  2F36 A;  1LBW A;  1Y1M A;  3EKI A;  1EZ9 A;  4PGP A;  1YAE A;  2AL5 A;  4QSD A;  2QMW A;  3A3C A;  1B7U A;  3ROJ A;  5ET7 A;  4R75 A;  5ET6 A;  3TQW A;  4PFW A;  1URD A;  2QS2 A;  4U1O A;  1TT1 A;  2HAV A;  4GWU A;  4F1Y A;  4YMB A;  3OEN A;  4ELQ A;  5A5X B;  4XKQ A;  2KQZ A;  2A5T A;  2QS4 A;  1PBQ A;  5KDT B;  5I58 B;  3TTM A;  2QVV A;  5KZT A;  3KN8 A;  1Y1Z A;  3T9H B;  2VD2 A;  3MJN A;  4BDN A;  4ELO A;  5TP9 B;  3ILU B;  3U1O A;  3SEX A;  3FGS A;  1Z7N E;  2DXR A;  1B2H A;  5ELV A;  1B0H A;  1G0I A;  4NF8 A;  3LUY A;  2ZZX A;  3EHS A;  3FD3 A;  3IOU A;  1FTJ A;  3IOV A;  3T9X B;  2Y5K A;  4EQ7 A;  4JWO A;  3TCG A;  4GIZ A;  3U65 A;  5DVI A;  1UIU A;  4EUO A;  1NMU A;  1FTK A;  2V3U A;  4P9K A;  2F3D A;  1N7X A;  1SW4 A;  4IGT A;  4F3G A;  4GFR A;  2NOO A;  1JEU A;  4YKK A;  2H98 A;  3UK4 A;  3ONM A;  2HXW A;  1IQ7 A;  3G3K A;  1VFE A;  2UYE A;  3IOT A;  1N76 A;  1A8F A;  3K6X A;  2PFY A;  2V3Q A;  1P1O A;  4TLM B;  4FEC A;  5LDZ A;  1D9V A;  3TTR A;  1NL5 A;  1XVY A;  4M1V A;  1B0L A;  4ND9 A;  5ET5 A;  4UA8 A;  3OD7 A;  1FPF A;  4KD5 A;  1IME A;  4Q30 B;  5AA4 B;  1LBZ A;  2HHM A;  1HSJ A;  3C9H A;  1B32 A;  1B3L A;  3MST A;  2HAU A;  1IUD A;  4X1B A;  3LC8 A;  4OET A;  1EZO A;  2Y7P A;  5JTY A;  4YKJ A;  3RTW B;  3B7D A;  4MX6 A;  3MAM A;  3CSG A;  5F7V A;  1FPI A;  1LAX A;  4N17 A;  3IOR A;  5IZZ A;  2WBB A;  1NNT A;  4JWY A;  3U93 A;  2NWJ A;  4NX1 A;  4JVI A;  5H8N A;  5H8F A;  2Y7K A;  4XFE A;  2L5V A;  3TTN A;  1I6Q A;  1MM6 A;  2PT2 A;  3SER A;  4KCC A;  4PAK A;  3T9U A;  1ZBM A;  2CZL A;  4GWZ A;  3A09 A;  2O69 A;  3HST A;  4I62 A;  3K1P A;  3PMX A;  3E4R A;  1B4Z A;  2XXW A;  4G4P A;  4P3L A;  1AH5 A;  3TEL A;  3RNN A;  2QMX A;  4PF8 A;  3PV0 E;  1B58 A;  4YKP A;  3FBP A;  1S9T A;  2HEU A;  3CIJ A;  1I6A A;  4MEV A;  3N5L A;  5I7I A;  4IY5 A;  1MDP 1;  3D4G A;  1MPC A;  2CEY A;  4PGN A;  4ZS9 A;  5KCJ B;  3VVF A;  1PBP A;  1LEV A;  3H03 A;  3C36 A;  2X7Q A;  1QUK A;  4X48 A;  1FQB A;  1JET A;  3IOW A;  1IIW A;  3FAT A;  1ELJ A; 
#chains in the Genus database with same CATH homology
 1RDX A;  5EQ9 A;  5IGA A;  4O7M A;  2JJK A;  2XWO A;  2V4C A;  1KA0 A;  4OVR A;  4OA4 A;  3T1B A;  3QMF A;  4PFB A;  4KXP A;  2VPO A;  2Q9T A;  5T3J A;  1NV5 A;  4I40 A;  1FRP A;  4XF5 A;  1NV3 A;  4HE2 A;  4QBA A;  1DBZ A;  4P1E A;  4N15 A;  4PTK A;  5IZ1 A;  4P8B A;  4I3Y A;  1QGX A;  2QFL A;  2HXR A;  4NN3 A;  4P56 A;  4F18 A;  2XA5 A;  1D9Q A;  4IR8 A;  5LTC A;  4PE3 A;  4PET A;  4O7I A;  1K9Y A;  1K9Z A;  2XXK A;  4JVC A;  4NF0 A;  1IMF A;  1FBP A;  4OVT A;  1JP4 A;  4PDD A;  1RDY A;  4HE0 A;  2QVU A;  4GBV A;  2GQ1 A;  1LBY A;  3IFA A;  1CNQ A;  4F1V A;  1FPJ A;  1FPD A;  1YXI A;  3D1R A;  2PCR A;  1FBE A;  2QVR A;  1FJ9 A;  4PAI A;  4X04 A;  2BJI A;  3KC1 A;  4MHF A;  1SPI A;  4PFI A;  4N6K A;  4HCY A;  1FSA A;  1FBD A;  5EYH A;  3RPL B;  1FPG A;  1AWB A;  4G61 A;  5ET8 A;  1G0H A;  1NI9 A;  4YZZ A;  4NG7 A;  3NOH A;  2OX3 A;  2R8T A;  2DDK A;  4HXV A;  2Y5L A;  4I3E A;  2FHY A;  1DCU A;  4PC9 A;  2Q74 A;  1EYI A;  1BK4 A;  1IMB A;  4FBP A;  4AS4 A;  5I3S A;  4DI3 D;  5IM2 A;  1LBV A;  1FPE A;  2XWK A;  5EQA A;  1Q9D A;  4PCD A;  4H45 A;  4MJO A;  4NQ8 A;  4YIC A;  4O8M A;  5EYG A;  3PTY A;  5DW8 A;  1KA1 A;  2KR0 A;  4PF6 A;  2DVZ A;  2QPQ A;  4N8Y A;  3RPL A;  3CHG A;  4MCO A;  4LN5 A;  5J16 A;  1FBF A;  1LBW A;  3T0J A;  2ZZW A;  3EKI A;  4MNC A;  4PGP A;  4GWX A;  4NHB A;  3SZP A;  3ROJ A;  5ET7 A;  5ET6 A;  4PBQ A;  4GWW A;  4GWU A;  2FBP A;  2B4L A;  1FBH A;  1NV4 A;  2KQZ A;  4N91 A;  4N4U A;  4XEQ A;  5ESY A;  2ZZV A;  4N8G A;  1YZ0 A;  2QVV A;  2CEX A;  4JVD A;  5F24 A;  4MMP A;  2VPN A;  4MNP A;  4N6D A;  3W9W A;  4OVS A;  1INP A;  2DE3 A;  4PBH A;  1NV6 A;  2WEF A;  1NV2 A;  3FXB A;  5FBP A;  3E78 A;  4P47 A;  1XI6 A;  1FTA A;  1G0I A;  4QXD A;  3A29 A;  2ZZX A;  4X8R A;  4GX4 A;  2HZK A;  2Y5K A;  1NV0 A;  3MYU A;  5IZ3 B;  3U65 A;  4N81 A;  4AS5 A;  4MAG A;  4P9K A;  2F3D A;  5A5L A;  3GYY A;  4OVP A;  4HCW A;  5CM6 A;  1IMC A;  1DK4 A;  1YYZ A;  3KC0 A;  1IMD A;  3B50 A;  1NV7 A;  1EYJ A;  3BIG A;  4MIJ A;  2PFY A;  2P3N A;  2V3Q A;  3B8B A;  2HPG A;  5LDZ A;  1EYK A;  4GBW A;  1NV1 A;  2HZL A;  1VDW A;  4M1V A;  5ET5 A;  3RYD A;  5EQ8 A;  4GWY A;  1FPF A;  2MKZ A;  1RDZ A;  1IME A;  4NAP A;  5IZ3 A;  1LBZ A;  4H46 A;  2HHM A;  2FIE A;  1NUW A;  2CZH A;  3IFC A;  4DI4 B;  2CZK A;  2F5X A;  3MST A;  1NUX A;  2OWZ A;  2F3B A;  1FBC A;  1IMA A;  4HE1 A;  4F19 A;  3HFU A;  1NUY A;  4MX6 A;  1FBG A;  1FPI A;  4N17 A;  5IZZ A;  2WBB A;  3LUZ A;  3LV0 A;  4X9T A;  4NX1 A;  4JVI A;  5I5P A;  2FVZ A;  2PFZ A;  2CZI A;  4OVQ A;  4XFE A;  2L5V A;  1KZ8 A;  2WYK A;  4GX3 A;  4PFR A;  4PAF A;  4NGU A;  5JK4 A;  4PAK A;  5EQ7 A;  4GX6 A;  4OAN A;  4O94 A;  4GWZ A;  2XWV A;  3KBZ A;  2Q8M A;  2WBD A;  2WYP A;  4P1L A;  3ISP A;  4P3L A;  2DE2 A;  1FJ6 A;  1NUZ A;  4PF8 A;  4UAB A;  2XWI A;  3E79 A;  3FBP A;  4F1U A;  1FPB A;  1LBX A;  2WX9 A;  2FIX A;  4GWS A;  4MEV A;  5I7I A;  3BIH A;  2B4M A;  2DE4 A;  3W9V A;  2CEY A;  4PGN A;  5J1D A;  1FPL A;  1LEV A;  4MNI A;  4PDH A;  2P3V A;  1FPK A;  2VT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...