3IFCA

Human muscle fructose-1,6-bisphosphatase e69q mutant in complex with amp and alpha fructose-6-phosphate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
329
structure length
323
Chain Sequence
DMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSQVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
total genus 113
structure length 323
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3ifcA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3ifcA02
2GQ1A 1JP4A 3ROJA 1LBWA 1LBYA 3KC1A 2R8TA 4GWWA 4KXPA 1FPIA 1RDZA 1NUXA 2QFLA 4I3EA 5EQ8A 2DDKA 1NUWA 1FBDA 1G0HA 1KA0A 1VDWA 4GX4A 4H46A 4G61A 5DW8A 4GBWA 1DBZA 1NUZA 5A5LA 1LBVA 5ET5A 3LUZA 4I40A 1NV1A 3QMFA 3KC0A 3A29A 1NV5A 5EYHA 5ET6A 1SPIA 4GWSA 2WEFA 2WBBA 2QVVA 3B8BA 1CNQA 4IR8A 2FHYA 1FBPA 1NV2A 3IFAA 1IMBA 3RPLA 2Y5LA 1FBCA 2Y5KA 1D9QA 2HHMA 5ET7A 2F3DA 1FPEA 4H45A 1FBFA 5T3JA 4QXDA 1IMFA 5EQ9A 1EYJA 5IZ3B 1NV0A 1NV6A 4HE0A 1K9YA 5F24A 1FPBA 1NV7A 1FBEA 2BJIA 1QGXA 5J16A 1IMEA 3IFCA 4N81A 2QVRA 3LV0A 1YYZA 1LEVA 1FPFA 2FVZA 2Q74A 3RYDA 1FTAA 4HE2A 1FPLA 1FSAA 2CZHA 1IMCA 1IMDA 5FBPA 4GWUA 1FBHA 1NV3A 2FIXA 2VT5A 1AWBA 4HE1A 1RDXA 2CZIA 1LBXA 4AS5A 4MJOA 2JJKA 2CZKA 1DK4A 4I3YA 5EQ7A 3KBZA 3D1RA 4GX3A 4PTKA 4GWXA 1NV4A 1FJ6A 1FJ9A 1Q9DA 1IMAA 4O7IA 5ESYA 5I3SA 1KZ8A 2QVUA 1FPGA 1FBGA 5EQAA 4GWYA 1FPDA 3BIGA 1FPJA 1YZ0A 3FBPA 5IZ3A 1INPA 5LDZA 4HXVA 1G0IA 1K9ZA 2P3NA 2F3BA 2P3VA 3T0JA 1EYKA 4GX6A 5ET8A 2FIEA 1DCUA 4FBPA 1NI9A 2WBDA 3RPLB 4GBVA 2OWZA 2OX3A 1YXIA 4GWZA 1FRPA 1EYIA 2FBPA 1FPKA 1RDYA 2Q8MA 4AS4A 1BK4A 1XI6A 3BIHA 1KA1A 1NUYA 5EYGA 1LBZA 5IZ1A 2PCRA
chains in the Genus database with same CATH superfamily
3I6VA 3O6HA 1B5IA 1H3DA 4I3EA 3UA8A 5ICQA 1FBDA 1KA0A 3FJ7A 1D9VA 3QMFA 5TP9B 4LZ5A 2WBBA 2PFZA 2V84A 4NF6A 2ZNTA 3WAEA 4NMYA 4FAJA 1B3LA 1D9QA 4H67A 5ITOA 1O64A 1FBFA 2YJPA 1PB7A 3H3GA 4F29A 5EQ9A 3VLUA 2ALUA 2DWHA 2WX9A 4KR5A 5J16A 1TFAA 2HXRA 3LV0A 5KCJA 3B7DA 4TOZA 3PV0E 4IO7A 1TT1A 3UP9A 4U22A 4HE1A 2RCBA 3RPWA 1RDXA 4POXA 1S7YA 2OBGA 1NMUA 3R6UA 4BDRA 2F35A 2OK2A 1MS7A 1Q1KA 4PGNA 5AA4A 2NVUB 4YB7A 4OEVA 5ESYA 2DS9A 2UYFA 4OYVA 3M3FA 1YZ0A 1SVXB 5H8HA 3KZGA 2L5VA 4DLDA 3MVZA 2OX3A 4XF5A 3K01A 3CFLA 1FQAA 1URGA 2V93A 4EQ9A 1LBZA 4RK2A 2XXIA 5F1QA 5FTHA 2QRYA 3FJGA 3K0VA 1SBPA 4TQUQ 2PMSA 3OO9A 4NHBA 4PFIA 4HW8A 4H5GA 2XXUA 1VDWA 3DP6A 3T66A 4H8IA 1DBZA 4P0GA 3VLVA 3H03A 4KCDA 3KOSA 1SW1A 4KYEA 2I3VA 1MXVA 2F36A 1NV2A 2H99A 4OESA 5JTYB 4XFEA 3K02A 1JW1A 4IO5A 4GL8A 1YAEA 1B52A 5FHOA 1IMEA 2REJA 1FPFA 3KBRA 4R6KA 3SEXA 4U1OA 3THIA 1N3WA 4R73A 1JW5A 1AWBA 3CG1A 4YZZA 2F6PA 5EYFA 2JJKA 1SYHA 2CZKA 4PCDA 1M5BA 1LB8A 5AA2B 4P8BA 4R72A 1LAGE 3H6WA 1LAHE 4XIGQ 2DVZA 4XKPA 3FBPA 3OEKA 5JK4A 3I3VA 2OWSA 4I8CA 3OXNA 2E0SA 2QMXA 2X7QA 4Z7EA 4PBQA 5DEXB 4PFTA 3VLWA 1YPNA 5AA2D 2Y7KA 2H5YA 5TP9A 3CIJA 4LUBA 4H0WA 4GL0A 3E3KA 5L9OA 1FW0A 3T9UA 4PFRA 1Y3NA 1OQGA 3TUSA 4PQJA 4N8YA 1LBYA 4ZEIA 2DE3A 2DDKA 3C36A 4MEVA 3S9NC 3PUWE 5DW8A 4JWOA 3TTLA 5I56A 1FTMA 5EYHA 4X1BA 1MPCA 2XXRA 4OVRA 1PC3A 3SEVA 2ZMBA 4R2BA 3TYHA 5H8FA 3RT8A 1J1NA 2XX7A 4QXDA 3KN8A 3CI8A 3SKPA 1FPBA 3T93B 4F3GA 4XKNA 3TTKA 2DE4A 4FJPA 2A5SA 1IMDA 3W15C 4ELRA 4PFWA 1N3XA 1FTKA 2FIXA 2GHBA 1JEUA 3FVGA 5CMKA 4QFNA 2GH9A 1MY2A 1NNKA 4KFQA 4GF8A 3G7WA 5DT6A 2FYIA 4OFLA 1FPGA 2DWAA 4Q5TA 3N26A 1MH4A 4MH5A 1B7ZA 3QK6A 4FIMA 3MZ9A 4M1VA 2RCAA 3S9EA 1MQGA 4MNCA 4NTLA 4ZE9A 3TFLA 2VHAA 2VOZA 5I2NA 4GVOA 1M5EA 3IORA 4PFUA 3ONMA 3C32A 4GQOA 1ZU0A 4Q30B 4DDDA 4NF0A 3FATA 4LONB 1ZLQA 1MY4A 4KD5A 1F9BA 3O6GA 4R6HA 3T96B 5ET6A 2QVVA 2H9BA 2X7PA 4IY5A 3I5OA 5KDTA 3IFAA 2Y5LA 1FQBA 4OENA 4BDLA 4YMAA 2DVCA 3MP1A 3PPOA 5DEXA 3PPPA 5CM6A 4QBAA 3UIFA 5EHMA 4MMPA 1NV6A 4F2OA 1Y20A 1NV7A 3B6TA 4EQBA 1YYZA 2Q74A 2Q8JA 4GFRA 4HE2A 3RT6B 4I1DA 3TMGA 1IMCA 2F8DA 1FBHA 1NV3A 2ZYNA 3N6UA 1ZIUA 4XEQA 3LR1A 4UA8A 5EQ7A 2LAOA 1NH7A 3G3JA 1LCFA 1MXWA 2PT1A 2Z8DA 4OEUA 1FJ9A 3MC2A 3ISPA 4X04A 1JW4A 2ONKE 2QPQA 3H6UA 4G8MA 1QUJA 1ZMGA 4U4SA 4BDOA 1N04A 1HSLA 1UTBB 2F6GA 3OSRA 3A3UA 4QHQA 4HXVA 1EYKA 1OMPA 1SYIA 2OPDA 1N76A 3Q29A 4IO3A 3V8XB 4FBPA 4ZEKA 2QMWA 1GV8A 4YU0A 3TTNA 4ONYA 2I4CA 3TQLA 2O7UA 2V3QA 5AA1A 4O3AA 2O1LA 2PCRA 3PUYE 1US4A 2PFYA 3WAFA 3TDJA 1I6BA 5DVIA 4NN3A 4H46A 5I7IA 4DXCA 1POY1 5A5LA 3OOAA 5K2YA 1MXYA 4ZEBA 5DTBA 5I57A 4EF2A 1OVBA 2FNCA 5I57B 3RPLA 1MDQA 4ND9A 2F3DA 1AL3A 4ECFA 4YMBA 3K4UA 5IZ3B 3RTFB 4PGPA 2R71A 3G3KA 3PU5A 4DIGA 5TPAB 3RYDA 1IEJA 1B5HA 4RPOA 2UVGA 3VXCA 4F31B 4GWUA 2O1MA 3MW0A 1Y4CA 1A7LA 5L9MA 3KJTA 2XXWA 4EF1A 1QKBA 3CHGA 4KI0E 3S2VA 1B5JA 4GWXA 3O66A 4R2FA 1MH3A 4O7IA 5I3SA 1ATGA 1VSOA 3HSTA 4EXLA 3RN8A 1FPDA 4UACA 1I69A 1INPA 1B6HA 3EKIA 1SI0A 1ELJA 1UTBA 4G2ZA 3OO8A 4QF9A 3U8QA 1IXGA 2GHAA 3RUMA 4ZZEA 4O8MA 1BP5A 4NF6B 4WEDA 1MY0A 4PETA 2B4MA 4N6KA 1PEBA 1GR2A 2ZZXA 1R1NA 1VE4A 1MY1A 1B3EA 4F3PA 3PPNA 3SERA 1Y3QA 1MM6A 2ZYKA 1B4ZA 1FPIA 4HCWA 1RDZA 3B6QA 3MZBA 4JSDA 1G0HA 3IOWA 1JEVA 5K2XA 3LSLA 4G68C 1LBVA 1FQDA 1JNFA 4OTEA 4G4PA 1NKXA 1CNQA 1BTJA 3DM0A 4GXAA 4H8JA 2RINA 3FVOA 2HZKA 3FZVA 4NQ8A 4FORA 1A99A 4F18A 1K9YA 3TZAA 1OVTA 3SETA 3E78A 4OA4A 4ZZAA 1QGXA 3IFCA 2GFEA 5DVJA 4PDHA 3GBAA 1MDP1 1US5A 4G68A 4F1UA 3LBSA 5KZTA 2VT5A 2ZZWA 3QIMA 5IKBA 2I48A 1Z7NE 1DK4A 3K1NA 2PBWA 3MQ9A 5I56B 1NH8A 3OSQA 4G8NA 4N6PA 5I2NB 4L17A 2DSFA 2HQ0A 1DTZA 4KCCA 1LFHA 4RYAA 5CC2A 2F3BA 1ZTYA 3B6WA 5FHNA 4LA9A 2DOJA 4NGUA 1SD3A 4F1YA 2XHDA 1BLFA 3U1OA 4HS7A 2RC9A 3RY3A 2VD2A 1NL5A 2KLFA 4MNIA 2VGQA 4GLIA 4G61A 3IX1A 4HCYA 4ZEDA 3LSWA 1P99A 4FE8A 3HPIA 5EQ8A 2HAUA 1VR5A 3OMBA 3V5AA 3U72A 1MQJA 1N7WA 3H6TA 3IAZA 1FTOA 3TELA 4IGTA 2R9JA 3PGFA 1B2HA 3PUXE 1IMBA 4IO4A 4KYSA 4OFJA 1FBCA 2QS4A 3UORA 3TPAA 1CE2A 4H1XA 4PFYA 2WYPA 3A09A 1MQDA 5ISUA 5A5XB 2ZZVA 1QUIA 1B7UA 1LAXA 1FTAA 4LN5A 1A55A 3KOTA 4OQOA 4F3BA 3LC8A 5AA2A 2CZIA 3FJMA 4I62A 4O94A 3CVGA 2P1SA 1PB9A 1IUDA 4PTKA 2XXXA 1NV4A 2O68A 2IEEA 2ZYOA 1I6AA 5IM2A 4ELOA 2PVUA 3IJXB 2HAVA 5LDZA 3Q25A 5HM4B 3T0JA 1UTHB 2FIEA 2WBDA 1LGBC 2H4IA 2DP8A 2NWJA 2NOOA 2P0SA 2HXWA 1KA1A 1B0LA 3IB1A 3T1BA 3OO7A 1OIBA 3R26A 3ROJA 1LBWA 1EZOA 4FEBA 3A3CA 4PF6A 1Y1ZA 2D3IA 5I59B 3HCQA 5H8HB 1UQWA 4U23A 4PE3A 4ZEFA 1A8EA 1ZKBA 4IGRA 2OLBA 4IY6A 4G68B 2OPEA 4QFPA 3IR1A 1FBPA 2XD3A 5JEIA 4DCYA 2AYSA 1MQIA 1GTKA 1SQYA 4G77A 3EN3A 3S9MC 2B4LA 4FEDA 1MXXA 3H7MA 4LQ5A 4PP0A 3RNNA 1R9QA 2Y84A 1FTLA 1FSAA 3KSXA 4WXJA 3E9XA 3ODBA 1LBXA 4NE4A 4MHFA 2I3WA 2XXVA 1N0TA 3PPRA 4OVTA 1M5FA 4PFBA 4RA1A 3TTMA 4YAHX 1B0HA 4PBHA 4R6YA 2Q89A 4OFOA 1MM7A 4DXUA 3BIGA 5CMMA 3TQWA 3L6HA 4KQPA 1IIWA 4EQ7A 4U2RA 2PYYA 5CMCA 5LOMA 4LP2B 1POTA 3EPEA 4OVQA 4QSDA 5J1DA 3ZKLA 1IXHA 2Z23A 4EXKA 4R9GA 1QJMA 1XI6A 4C0RA 4DXBA 1JP4A 3EHUA 1JQFA 1II5A 3M8UA 4DI4B 1Y4TA 1IZ1A 4LQ2A 1XVYA 1Y9UA 1AH5A 3VDFA 4NF4B 1P1UA 3DP4A 5IAIA 1NUZA 1PDAA 2Q9TA 3S9LC 3A29A 2ZXTA 3RLFE 1MXUA 4IR8A 3FVKA 2HCAA 3FIRA 4QSCA 3CSGA 3O6IA 3KG2A 5ET7A 2H98A 1P1OA 2D5WA 3MVWA 2DXRA 1A40A 1IQ7A 1IMFA 1EYJA 1LAFE 4HE0A 5L9SA 5F7VA 1FBEA 4ZE8A 2AL5A 2YPNA 2FVZA 3TEPA 1UTHA 5BWJA 1L5TA 3K00A 1DMBA 1TFDA 1RKMA 4MNPA 4YKPA 4F39A 5I59A 4O7MA 3MBPA 2RC7A 3C9HA 4H6DA 2QSXA 3EQ1A 2PX1A 3M3KA 3RQTA 4P1LA 1NNFA 3RGYA 4P47A 1K9ZA 2Q88A 1Y3PA 2R6GE 3MP6A 3N94A 4JXIA 2XWIA 5ET8A 4OANA 3ZS6A 2XXQA 4R9FA 3F11A 1QVSA 1FQFA 1ZJLA 2VP1A 1NNPA 4OERA 2CEYA 4IB2A 2DE2A 1BIYA 3TODA 1GGGA 3SDFA 3K1PA 2R8TA 2I58A 1MPBA 4NAPA 2QFLA 4R75A 3MYUA 2QS1A 3KEIA 5FHMA 4MIJA 3IO4A 4XTCQ 5ET5A 3BFTA 4PC9A 2XWKA 4LVQA 4ISUA 3FASA 3U92A 1SDXA 3KJ7A 1JVYA 3FVNA 3O29A 5EHSA 4X9TA 1B1XA 3CSBA 3CG3A 4MAGA 1BKAA 3KFMA 5JTYA 4P1EA 3EHTA 1AOVA 5CBSA 2H25A 3PD9A 3T9VA 1URDA 4PAIA 3QXMA 4IO6A 4Z0IA 1KWHA 2F78A 4N4UA 2XWVA 3C31A 3SEUA 1XHYA 1FQCA 4GWOA 2O69A 4MX6A 4C1TA 3HHFA 1IMAA 1MG1A 5L8DA 4M4GA 3N6TA 4PDDA 4JVCA 4GX6A 3U94A 1B4HA 3QSLA 2G93A 3FV1A 1NI9A 3GBBA 4DZ1A 1YXIA 3VVEA 2XXYA 3LSFB 1D4NA 4E0XA 1LLSA 4NEDA 3PUVE 3D4CA 4ESXA 1BK4A 3KN3A 3L6GA 3PD8A 1A8FA 3GXAA 5EYGA 5ITPA 1EZ9A 2Y7PA 1IXIA 2DYXA 4NF8A 3TAJA 3AXFA 1B3HA 3O97A 1MY3A 3W9VA 3FGSA 1USYE 5I2KB 1FTJA 4LATA 3MPKA 1R9LA 3OD7A 1XVXA 4GBWA 4YKJA 3VV5A 2Z8EA 3LUZA 3UGWA 2XA5A 2WEFA 2HEUA 1ZBMA 5LTCA 2HHMA 2UVIA 1Q35A 4GOTA 2I0BA 3MSTA 3U65A 4JSOA 3PPQA 2O84X 2A5TA 2BJIA 4N81A 2QVRA 3GLBA 4RNSA 1LEVA 3FXUA 2XXKA 3KGCA 4QFKA 1MQHA 1FPLA 2CZHA 2XXPA 4X8RA 5FBPA 1RYOA 4EDPA 3GYYA 2VPNA 3MZ1A 3E4RA 4N07A 4E0WA 3W9WA 1FQEA 3O2AA 5DVFA 2CZLA 3JZJA 1Q9DA 2NXOA 3P7IA 5KDTB 2RKMA 1XOCA 3C34A 2XWOA 3N5LA 3Q27A 1PB8A 4XKRA 4BDNA 4KHZE 5FTIA 4GBVA 2OWZA 2M8CA 1P1WA 2WYKA 4POWA 3H6VA 1DTGA 3T22A 4C1UA 1B7HA 1LBBA 1S50A 4OZ9A 3IB2A 3G3FA 2ABHA 2ONSA 5CI5A 3IOUA 3KC1A 4P11A 4NWCA 4N13A 4MLQA 4OVJA 5CBRA 3IO6A 4NF4A 3C35A 4DI3D 2DXYA 2DWIA 5HPQA 4EUOA 2O6AA 4I40A 4KPTA 2CEXA 1NV5A 4YKIA 2OJTA 4U4XA 3B8BA 3K6XA 1SW2A 2Y5KA 1PBPA 3K2DA 4H5FA 4H45A 1JVXA 2XX8A 5I58A 1T0KA 3O28A 1NV0A 5I58B 3U93A 2B3BA 4RPNA 2I0CA 3IK6B 2FA7A 3E13X 1B40A 1PBQA 4Q0CA 2AIXA 3UN6A 4NWDA 4ELQA 3FXQA 4ZECA 3K6VA 3ILTB 1O7TA 1XT8A 2KR0A 2I49A 2QL3A 5H8QB 4MJOA 4F3SA 4ZS9A 2IA4A 4NF5A 2OWTA 1CB6A 2VPOA 3PMVA 1TWYA 3SEWA 2Q2CA 3SZPA 1B46A 2Q2AA 1SW5A 4OXVA 3IOVA 1D9YA 3G3HA 1IITA 3H4ZA 4YB5A 1FCKA 3IJOB 4PAKA 1EYIA 3OELA 4NF8B 1I6QA 3QUFA 3MPLA 4JWXA 1NUYA 3D4GA 4OETA 2GQ1A 1XS5A 2F34A 4XXUA 4KXPA 3HN0A 1P1QA 3ECRA 3MVYA 1NUWA 1EU8A 4NF5B 4QSEA 4GX4A 2OZZA 2YLNA 1EH3A 3HHGA 3SESA 1NV1A 4UABA 4MFIA 2XXHA 3JYRA 2QS3A 4AQ4A 2CMOA 5CMBA 3VFJA 2OCUA 1VFDA 1OLAA 1FPEA 2HFBA 3B50A 4IO2A 3MWBA 3Q26A 3PMXA 3IOTA 4N15A 1UIVA 5F24A 4H65A 1VFEA 1QKAA 1JETA 2ONRA 1QUKA 4RK9A 2UVJA 3IB0A 4GIZA 1USYH 3ILUB 4BDQA 4X48A 4O3CA 4AS5A 2ZNSA 5B70A 2ZNUA 3PMWA 2W7YA 3KBZA 4JBZA 4O3BA 3TCFA 5BUUA 1S9TA 1B05A 1WDNA 4AB5A 2QVUA 1FBGA 5EQAA 4WKMA 1FPJA 1OQHA 2KQZA 2F7AA 1GVCA 5TPAA 1LFIA 2GRVA 1YTVA 4X1DA 5H8NB 4BDMA 3EF7A 2XD2A 4N8GA 2P3VA 4OMBA 3SEYA 5IZZA 1URSA 1HSJA 3DLNA 4YKKA 1DPEA 3R7XA 3E79A 4MBPA 4N91A 2QJEA 3VVFA 2O51A 1SI1A 2FBPA 3BKIB 4AS4A 1AIVA 3BIHA 4OHNA 5I5PA 2F7CA 2B65A 5HBCA 4RJZA 2I4BA 4BLAA 5IGAA 4WEPA 4F22A 5I2KA 4N6DA 4LZ8A 1B58A 3QUJA 3MAMA 5ICTA 4F19A 2QS2A 3KC0A 1YCJA 3VXBA 3DELB 2XX9A 4MCOA 3OEMA 3UK4A 2FHYA 5B7DA 4THIA 4HTGA 1WVJA 3JV9A 1N7XA 3KSJA 4GD5A 3QYTA 2ANJA 4F2QA 3G3GA 2RF1A 2RC8A 5M2VA 2A5TB 1H76A 3KN7A 2P2AA 1UIUA 3TTRA 1DOTA 3T9HB 3OENA 1DSNA 1EZPA 1QULA 5AE4A 1M5CA 1B3FA 3G3IA 4ESWA 1O63A 2Y7WA 2G29A 4TLLB 4I3YA 1XC1A 4LZ7A 4QRZA 1IXCA 4P0IA 3Q28A 3V83A 3CFZA 4NX1A 3PUZE 3FV2A 3K6UA 5ELVA 3V89B 4P3LA 4GRKA 5IZ3A 1G0IA 1HSEA 3TCGA 1LCTA 5CRYA 5H8NA 1DCUA 4P56A 3LUYA 3RPLB 1Y1MA 3HO7A 3HV1A 1MRPA 3LSXA 4OWDA 4AB6A 4ELPA 2UYEA 4OVSA 3K6WA 4JWYA 1FPKA 2Q8MA 2Z22A 4YB6A 2DWJA 4PAFA 3FXBA 4FECA 3T9XB 4QFOA 5H8SA 1NUXA 4QFLA 2X26A 2VD3A 4MF3A 3ZKKA 4GXSB 3M3LA 1D3KA 3TCHA 4U21A 1SPIA 3USDA 4OVPA 2Y7RA 1H45A 4R74A 3MJNA 1LFGA 3BBRA 3ZSFA 5A5XA 1AMFA 4JVIA 4NG7A 3QAXA 3IL1B 3MVXA 4RY1A 1A54A 4K3FA 4XKQA 1OLCA 3S4UA 3DP8A 3FXRA 4DE8A 4DCXA 3BFUA 3TKDA 1NNTA 4U1ZA 2UVHA 4G8HA 2D21A 3C4MA 1FJ6A 3NOHA 3O9PA 2PT2A 1KZ8A 2THIA 4GWYA 4I9DA 2V3TA 5KCJB 1P1NA 4F1VA 2UXAA 1DPPA 2REGA 2Z8FA 5AA3A 1M5DA 2V25A 3EHSA 5H8FB 1TXFA 1B1HA 2DQVA 2ESNA 1FRPA 4N17A 4ZDMA 3K1MA 3MUQA 1B9JA 3FD3A 5I84A 1QW0A 4GWWA 2WKYA 2HZLA 3CFXA 4JVDA 2F97A 4YICA 4TLMB 4JB7A 4GWSA 2XXTA 4FATA 1WODA 2AL4A 4PE5B 3H06B 1NFTA 2V4CA 4MLVA 1N84A 2I6EA 2E1SA 2Y7IA 5AA4B 5T3JA 2BJJX 1MPDA 3OO6A 3HFUA 3FUZA 4PF8A 1LSTA 2O7IA 1B32A 5DYHA 3PTYA 3GZGA 2V3UA 3MP8A 3D1RA 4Q8RA 4GX3A 1H43A 2B3FA 3VE1B 5H8QA 1LB9A 1RYXA 2MKZA 3CR9A 3C33A 1ANFA 1SW4A 2P3NA 1MXZA 4JDFA 1R6ZA 2ZYMA 3RTWB 1Z7ME 2F7BA 5TU0A 1B3GA 1H44A 1B51A 3VVDA 4GWZA 2F5XA 4P9KA 1RDYA 2NUVA 3CRBA 4RXLA 1LBCA 4KYDA 2HPGA 5IZ1A
chains in the Genus database with same CATH topology
4PAFA 3FXBA 2CEYA 4HCYA 2DE2A 2GQ1A 1JP4A 4PFRA 3ROJA 1LBWA 4N8YA 1LBYA 4NF0A 3KC1A 2R8TA 2PFYA 4DI4B 4GWWA 4KXPA 1FPIA 4HCWA 4NHBA 3W9VA 4NAPA 1RDZA 1NUXA 2QFLA 4I3EA 5EQ8A 4PFIA 2HZLA 5IGAA 4JVDA 2DE3A 4N6DA 4DI3D 2DDKA 3MYUA 5IM2A 4PF6A 1NUWA 4MEVA 4NN3A 1FBDA 1G0HA 1KA0A 1VDWA 4GX4A 4H46A 4YICA 4G61A 4MIJA 5I7IA 5DW8A 4GBWA 1DBZA 1NUZA 5A5LA 4F19A 2Q9TA 1LBVA 5ET5A 3LUZA 4PC9A 4PE3A 4I40A 1NV1A 3QMFA 4UABA 3KC0A 3A29A 1NV5A 5EYHA 2CEXA 5ET6A 2XA5A 2XWKA 1SPIA 4GWSA 4OVPA 2WEFA 2WBBA 2QVVA 4MCOA 3B8BA 1CNQA 4IR8A 2PFZA 2FHYA 4OVRA 1FBPA 1NV2A 3IFAA 1IMBA 3RPLA 2Y5LA 1FBCA 2Y5KA 5LTCA 1D9QA 2HHMA 5ET7A 2V4CA 2F3DA 2HZKA 1FPEA 4H45A 4NQ8A 3MSTA 4XFEA 3B50A 4QBAA 1FBFA 5T3JA 2B4LA 4F1UA 4QXDA 5CM6A 1IMFA 5EQ9A 1EYJA 5IZ3B 3HFUA 4JVIA 1NV0A 1NV6A 4HE0A 4MMPA 4N15A 4NG7A 4X9TA 4F18A 1K9YA 5F24A 4MAGA 4PF8A 4PGPA 1FPBA 2WYPA 3U65A 1NV7A 3E78A 2WX9A 4OA4A 1FBEA 2BJIA 1QGXA 5J16A 1IMEA 3IFCA 4N81A 2QVRA 2DE4A 3LV0A 1YYZA 2HXRA 2ZZVA 4P1EA 1LEVA 1FPFA 2FVZA 2Q74A 3RYDA 2XXKA 1FTAA 4LN5A 4HE2A 1FPLA 4PDHA 1FSAA 2CZHA 3PTYA 4PAIA 1IMCA 1IMDA 4X8RA 5FBPA 4GWUA 1FBHA 1NV3A 2FIXA 2VT5A 1AWBA 4HE1A 1RDXA 2KR0A 2ZZWA 3GYYA 4XEQA 2CZIA 4YZZA 1LBXA 4AS5A 4MJOA 2JJKA 2VPNA 2CZKA 4O94A 4MHFA 1DK4A 4I3YA 5EQ7A 4N4UA 4PCDA 3CHGA 3KBZA 3D1RA 4MNPA 4P8BA 3W9WA 4OVTA 2XWVA 4GX3A 4PGNA 4PTKA 4GWXA 4PFBA 1NV4A 1FJ6A 1FJ9A 3ISPA 4O7MA 4MX6A 4NX1A 1Q9DA 1IMAA 4O7IA 5ESYA 5I3SA 3NOHA 4PBHA 4X04A 2QPQA 1KZ8A 2QVUA 1FPGA 4P47A 1FBGA 5EQAA 4GWYA 2MKZA 1FPDA 2DVZA 3T1BA 3BIGA 2VPOA 1FPJA 4P1LA 2KQZA 4P3LA 1YZ0A 3FBPA 5IZ3A 1INPA 4F1VA 5LDZA 5JK4A 4PDDA 4HXVA 1G0IA 1K9ZA 2P3NA 2XWOA 2F3BA 2P3VA 3EKIA 4JVCA 3T0JA 1EYKA 4M1VA 4GX6A 2L5VA 4N8GA 5IZZA 2XWIA 5ET8A 4PBQA 4MNCA 4OANA 2FIEA 3SZPA 1DCUA 4NGUA 4FBPA 1NI9A 2WBDA 4P56A 3RPLB 4GBVA 2OWZA 2OX3A 1YXIA 2WYKA 4OVQA 4GWZA 3E79A 1FRPA 4XF5A 4PAKA 5J1DA 4N91A 2F5XA 4OVSA 2V3QA 4P9KA 1EYIA 4MNIA 2FBPA 1FPKA 1RDYA 4O8MA 2Q8MA 4AS4A 1BK4A 1XI6A 4N17A 4PETA 3BIHA 2B4MA 4N6KA 5I5PA 1KA1A 2ZZXA 2HPGA 1NUYA 5EYGA 1LBZA 5IZ1A 2PCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQ1 A;  1JP4 A;  3ROJ A;  1LBW A;  1LBY A;  3KC1 A;  2R8T A;  4GWW A;  4KXP A;  1FPI A;  1RDZ A;  1NUX A;  2QFL A;  4I3E A;  5EQ8 A;  2DDK A;  1NUW A;  1FBD A;  1G0H A;  1KA0 A;  1VDW A;  4GX4 A;  4H46 A;  4G61 A;  5DW8 A;  4GBW A;  1DBZ A;  1NUZ A;  5A5L A;  1LBV A;  5ET5 A;  3LUZ A;  4I40 A;  1NV1 A;  3QMF A;  3KC0 A;  3A29 A;  1NV5 A;  5EYH A;  5ET6 A;  1SPI A;  4GWS A;  2WEF A;  2WBB A;  2QVV A;  3B8B A;  1CNQ A;  4IR8 A;  2FHY A;  1FBP A;  1NV2 A;  3IFA A;  1IMB A;  3RPL A;  2Y5L A;  1FBC A;  2Y5K A;  1D9Q A;  2HHM A;  5ET7 A;  2F3D A;  1FPE A;  4H45 A;  1FBF A;  5T3J A;  4QXD A;  1IMF A;  5EQ9 A;  1EYJ A;  5IZ3 B;  1NV0 A;  1NV6 A;  4HE0 A;  1K9Y A;  5F24 A;  1FPB A;  1NV7 A;  1FBE A;  2BJI A;  1QGX A;  5J16 A;  1IME A;  3IFC A;  4N81 A;  2QVR A;  3LV0 A;  1YYZ A;  1LEV A;  1FPF A;  2FVZ A;  2Q74 A;  3RYD A;  1FTA A;  4HE2 A;  1FPL A;  1FSA A;  2CZH A;  1IMC A;  1IMD A;  5FBP A;  4GWU A;  1FBH A;  1NV3 A;  2FIX A;  2VT5 A;  1AWB A;  4HE1 A;  1RDX A;  2CZI A;  1LBX A;  4AS5 A;  4MJO A;  2JJK A;  2CZK A;  1DK4 A;  4I3Y A;  5EQ7 A;  3KBZ A;  3D1R A;  4GX3 A;  4PTK A;  4GWX A;  1NV4 A;  1FJ6 A;  1FJ9 A;  1Q9D A;  1IMA A;  4O7I A;  5ESY A;  5I3S A;  1KZ8 A;  2QVU A;  1FPG A;  1FBG A;  5EQA A;  4GWY A;  1FPD A;  3BIG A;  1FPJ A;  1YZ0 A;  3FBP A;  5IZ3 A;  1INP A;  5LDZ A;  4HXV A;  1G0I A;  1K9Z A;  2P3N A;  2F3B A;  2P3V A;  3T0J A;  1EYK A;  4GX6 A;  5ET8 A;  2FIE A;  1DCU A;  4FBP A;  1NI9 A;  2WBD A;  3RPL B;  4GBV A;  2OWZ A;  2OX3 A;  1YXI A;  4GWZ A;  1FRP A;  1EYI A;  2FBP A;  1FPK A;  1RDY A;  2Q8M A;  4AS4 A;  1BK4 A;  1XI6 A;  3BIH A;  1KA1 A;  1NUY A;  5EYG A;  1LBZ A;  5IZ1 A;  2PCR A; 
#chains in the Genus database with same CATH topology
 3I6V A;  3O6H A;  1B5I A;  1H3D A;  4I3E A;  3UA8 A;  5ICQ A;  1FBD A;  1KA0 A;  3FJ7 A;  1D9V A;  3QMF A;  5TP9 B;  4LZ5 A;  2WBB A;  2PFZ A;  2V84 A;  4NF6 A;  2ZNT A;  3WAE A;  4NMY A;  4FAJ A;  1B3L A;  1D9Q A;  4H67 A;  5ITO A;  1O64 A;  1FBF A;  2YJP A;  1PB7 A;  3H3G A;  4F29 A;  5EQ9 A;  3VLU A;  2ALU A;  2DWH A;  2WX9 A;  4KR5 A;  5J16 A;  1TFA A;  2HXR A;  3LV0 A;  5KCJ A;  3B7D A;  4TOZ A;  3PV0 E;  4IO7 A;  1TT1 A;  3UP9 A;  4U22 A;  4HE1 A;  2RCB A;  3RPW A;  1RDX A;  4POX A;  1S7Y A;  2OBG A;  1NMU A;  3R6U A;  4BDR A;  2F35 A;  2OK2 A;  1MS7 A;  1Q1K A;  4PGN A;  5AA4 A;  2NVU B;  4YB7 A;  4OEV A;  5ESY A;  2DS9 A;  2UYF A;  4OYV A;  3M3F A;  1YZ0 A;  1SVX B;  5H8H A;  3KZG A;  2L5V A;  4DLD A;  3MVZ A;  2OX3 A;  4XF5 A;  3K01 A;  3CFL A;  1FQA A;  1URG A;  2V93 A;  4EQ9 A;  1LBZ A;  4RK2 A;  2XXI A;  5F1Q A;  5FTH A;  2QRY A;  3FJG A;  3K0V A;  1SBP A;  4TQU Q;  2PMS A;  3OO9 A;  4NHB A;  4PFI A;  4HW8 A;  4H5G A;  2XXU A;  1VDW A;  3DP6 A;  3T66 A;  4H8I A;  1DBZ A;  4P0G A;  3VLV A;  3H03 A;  4KCD A;  3KOS A;  1SW1 A;  4KYE A;  2I3V A;  1MXV A;  2F36 A;  1NV2 A;  2H99 A;  4OES A;  5JTY B;  4XFE A;  3K02 A;  1JW1 A;  4IO5 A;  4GL8 A;  1YAE A;  1B52 A;  5FHO A;  1IME A;  2REJ A;  1FPF A;  3KBR A;  4R6K A;  3SEX A;  4U1O A;  3THI A;  1N3W A;  4R73 A;  1JW5 A;  1AWB A;  3CG1 A;  4YZZ A;  2F6P A;  5EYF A;  2JJK A;  1SYH A;  2CZK A;  4PCD A;  1M5B A;  1LB8 A;  5AA2 B;  4P8B A;  4R72 A;  1LAG E;  3H6W A;  1LAH E;  4XIG Q;  2DVZ A;  4XKP A;  3FBP A;  3OEK A;  5JK4 A;  3I3V A;  2OWS A;  4I8C A;  3OXN A;  2E0S A;  2QMX A;  2X7Q A;  4Z7E A;  4PBQ A;  5DEX B;  4PFT A;  3VLW A;  1YPN A;  5AA2 D;  2Y7K A;  2H5Y A;  5TP9 A;  3CIJ A;  4LUB A;  4H0W A;  4GL0 A;  3E3K A;  5L9O A;  1FW0 A;  3T9U A;  4PFR A;  1Y3N A;  1OQG A;  3TUS A;  4PQJ A;  4N8Y A;  1LBY A;  4ZEI A;  2DE3 A;  2DDK A;  3C36 A;  4MEV A;  3S9N C;  3PUW E;  5DW8 A;  4JWO A;  3TTL A;  5I56 A;  1FTM A;  5EYH A;  4X1B A;  1MPC A;  2XXR A;  4OVR A;  1PC3 A;  3SEV A;  2ZMB A;  4R2B A;  3TYH A;  5H8F A;  3RT8 A;  1J1N A;  2XX7 A;  4QXD A;  3KN8 A;  3CI8 A;  3SKP A;  1FPB A;  3T93 B;  4F3G A;  4XKN A;  3TTK A;  2DE4 A;  4FJP A;  2A5S A;  1IMD A;  3W15 C;  4ELR A;  4PFW A;  1N3X A;  1FTK A;  2FIX A;  2GHB A;  1JEU A;  3FVG A;  5CMK A;  4QFN A;  2GH9 A;  1MY2 A;  1NNK A;  4KFQ A;  4GF8 A;  3G7W A;  5DT6 A;  2FYI A;  4OFL A;  1FPG A;  2DWA A;  4Q5T A;  3N26 A;  1MH4 A;  4MH5 A;  1B7Z A;  3QK6 A;  4FIM A;  3MZ9 A;  4M1V A;  2RCA A;  3S9E A;  1MQG A;  4MNC A;  4NTL A;  4ZE9 A;  3TFL A;  2VHA A;  2VOZ A;  5I2N A;  4GVO A;  1M5E A;  3IOR A;  4PFU A;  3ONM A;  3C32 A;  4GQO A;  1ZU0 A;  4Q30 B;  4DDD A;  4NF0 A;  3FAT A;  4LON B;  1ZLQ A;  1MY4 A;  4KD5 A;  1F9B A;  3O6G A;  4R6H A;  3T96 B;  5ET6 A;  2QVV A;  2H9B A;  2X7P A;  4IY5 A;  3I5O A;  5KDT A;  3IFA A;  2Y5L A;  1FQB A;  4OEN A;  4BDL A;  4YMA A;  2DVC A;  3MP1 A;  3PPO A;  5DEX A;  3PPP A;  5CM6 A;  4QBA A;  3UIF A;  5EHM A;  4MMP A;  1NV6 A;  4F2O A;  1Y20 A;  1NV7 A;  3B6T A;  4EQB A;  1YYZ A;  2Q74 A;  2Q8J A;  4GFR A;  4HE2 A;  3RT6 B;  4I1D A;  3TMG A;  1IMC A;  2F8D A;  1FBH A;  1NV3 A;  2ZYN A;  3N6U A;  1ZIU A;  4XEQ A;  3LR1 A;  4UA8 A;  5EQ7 A;  2LAO A;  1NH7 A;  3G3J A;  1LCF A;  1MXW A;  2PT1 A;  2Z8D A;  4OEU A;  1FJ9 A;  3MC2 A;  3ISP A;  4X04 A;  1JW4 A;  2ONK E;  2QPQ A;  3H6U A;  4G8M A;  1QUJ A;  1ZMG A;  4U4S A;  4BDO A;  1N04 A;  1HSL A;  1UTB B;  2F6G A;  3OSR A;  3A3U A;  4QHQ A;  4HXV A;  1EYK A;  1OMP A;  1SYI A;  2OPD A;  1N76 A;  3Q29 A;  4IO3 A;  3V8X B;  4FBP A;  4ZEK A;  2QMW A;  1GV8 A;  4YU0 A;  3TTN A;  4ONY A;  2I4C A;  3TQL A;  2O7U A;  2V3Q A;  5AA1 A;  4O3A A;  2O1L A;  2PCR A;  3PUY E;  1US4 A;  2PFY A;  3WAF A;  3TDJ A;  1I6B A;  5DVI A;  4NN3 A;  4H46 A;  5I7I A;  4DXC A;  1POY 1;  5A5L A;  3OOA A;  5K2Y A;  1MXY A;  4ZEB A;  5DTB A;  5I57 A;  4EF2 A;  1OVB A;  2FNC A;  5I57 B;  3RPL A;  1MDQ A;  4ND9 A;  2F3D A;  1AL3 A;  4ECF A;  4YMB A;  3K4U A;  5IZ3 B;  3RTF B;  4PGP A;  2R71 A;  3G3K A;  3PU5 A;  4DIG A;  5TPA B;  3RYD A;  1IEJ A;  1B5H A;  4RPO A;  2UVG A;  3VXC A;  4F31 B;  4GWU A;  2O1M A;  3MW0 A;  1Y4C A;  1A7L A;  5L9M A;  3KJT A;  2XXW A;  4EF1 A;  1QKB A;  3CHG A;  4KI0 E;  3S2V A;  1B5J A;  4GWX A;  3O66 A;  4R2F A;  1MH3 A;  4O7I A;  5I3S A;  1ATG A;  1VSO A;  3HST A;  4EXL A;  3RN8 A;  1FPD A;  4UAC A;  1I69 A;  1INP A;  1B6H A;  3EKI A;  1SI0 A;  1ELJ A;  1UTB A;  4G2Z A;  3OO8 A;  4QF9 A;  3U8Q A;  1IXG A;  2GHA A;  3RUM A;  4ZZE A;  4O8M A;  1BP5 A;  4NF6 B;  4WED A;  1MY0 A;  4PET A;  2B4M A;  4N6K A;  1PEB A;  1GR2 A;  2ZZX A;  1R1N A;  1VE4 A;  1MY1 A;  1B3E A;  4F3P A;  3PPN A;  3SER A;  1Y3Q A;  1MM6 A;  2ZYK A;  1B4Z A;  1FPI A;  4HCW A;  1RDZ A;  3B6Q A;  3MZB A;  4JSD A;  1G0H A;  3IOW A;  1JEV A;  5K2X A;  3LSL A;  4G68 C;  1LBV A;  1FQD A;  1JNF A;  4OTE A;  4G4P A;  1NKX A;  1CNQ A;  1BTJ A;  3DM0 A;  4GXA A;  4H8J A;  2RIN A;  3FVO A;  2HZK A;  3FZV A;  4NQ8 A;  4FOR A;  1A99 A;  4F18 A;  1K9Y A;  3TZA A;  1OVT A;  3SET A;  3E78 A;  4OA4 A;  4ZZA A;  1QGX A;  3IFC A;  2GFE A;  5DVJ A;  4PDH A;  3GBA A;  1MDP 1;  1US5 A;  4G68 A;  4F1U A;  3LBS A;  5KZT A;  2VT5 A;  2ZZW A;  3QIM A;  5IKB A;  2I48 A;  1Z7N E;  1DK4 A;  3K1N A;  2PBW A;  3MQ9 A;  5I56 B;  1NH8 A;  3OSQ A;  4G8N A;  4N6P A;  5I2N B;  4L17 A;  2DSF A;  2HQ0 A;  1DTZ A;  4KCC A;  1LFH A;  4RYA A;  5CC2 A;  2F3B A;  1ZTY A;  3B6W A;  5FHN A;  4LA9 A;  2DOJ A;  4NGU A;  1SD3 A;  4F1Y A;  2XHD A;  1BLF A;  3U1O A;  4HS7 A;  2RC9 A;  3RY3 A;  2VD2 A;  1NL5 A;  2KLF A;  4MNI A;  2VGQ A;  4GLI A;  4G61 A;  3IX1 A;  4HCY A;  4ZED A;  3LSW A;  1P99 A;  4FE8 A;  3HPI A;  5EQ8 A;  2HAU A;  1VR5 A;  3OMB A;  3V5A A;  3U72 A;  1MQJ A;  1N7W A;  3H6T A;  3IAZ A;  1FTO A;  3TEL A;  4IGT A;  2R9J A;  3PGF A;  1B2H A;  3PUX E;  1IMB A;  4IO4 A;  4KYS A;  4OFJ A;  1FBC A;  2QS4 A;  3UOR A;  3TPA A;  1CE2 A;  4H1X A;  4PFY A;  2WYP A;  3A09 A;  1MQD A;  5ISU A;  5A5X B;  2ZZV A;  1QUI A;  1B7U A;  1LAX A;  1FTA A;  4LN5 A;  1A55 A;  3KOT A;  4OQO A;  4F3B A;  3LC8 A;  5AA2 A;  2CZI A;  3FJM A;  4I62 A;  4O94 A;  3CVG A;  2P1S A;  1PB9 A;  1IUD A;  4PTK A;  2XXX A;  1NV4 A;  2O68 A;  2IEE A;  2ZYO A;  1I6A A;  5IM2 A;  4ELO A;  2PVU A;  3IJX B;  2HAV A;  5LDZ A;  3Q25 A;  5HM4 B;  3T0J A;  1UTH B;  2FIE A;  2WBD A;  1LGB C;  2H4I A;  2DP8 A;  2NWJ A;  2NOO A;  2P0S A;  2HXW A;  1KA1 A;  1B0L A;  3IB1 A;  3T1B A;  3OO7 A;  1OIB A;  3R26 A;  3ROJ A;  1LBW A;  1EZO A;  4FEB A;  3A3C A;  4PF6 A;  1Y1Z A;  2D3I A;  5I59 B;  3HCQ A;  5H8H B;  1UQW A;  4U23 A;  4PE3 A;  4ZEF A;  1A8E A;  1ZKB A;  4IGR A;  2OLB A;  4IY6 A;  4G68 B;  2OPE A;  4QFP A;  3IR1 A;  1FBP A;  2XD3 A;  5JEI A;  4DCY A;  2AYS A;  1MQI A;  1GTK A;  1SQY A;  4G77 A;  3EN3 A;  3S9M C;  2B4L A;  4FED A;  1MXX A;  3H7M A;  4LQ5 A;  4PP0 A;  3RNN A;  1R9Q A;  2Y84 A;  1FTL A;  1FSA A;  3KSX A;  4WXJ A;  3E9X A;  3ODB A;  1LBX A;  4NE4 A;  4MHF A;  2I3W A;  2XXV A;  1N0T A;  3PPR A;  4OVT A;  1M5F A;  4PFB A;  4RA1 A;  3TTM A;  4YAH X;  1B0H A;  4PBH A;  4R6Y A;  2Q89 A;  4OFO A;  1MM7 A;  4DXU A;  3BIG A;  5CMM A;  3TQW A;  3L6H A;  4KQP A;  1IIW A;  4EQ7 A;  4U2R A;  2PYY A;  5CMC A;  5LOM A;  4LP2 B;  1POT A;  3EPE A;  4OVQ A;  4QSD A;  5J1D A;  3ZKL A;  1IXH A;  2Z23 A;  4EXK A;  4R9G A;  1QJM A;  1XI6 A;  4C0R A;  4DXB A;  1JP4 A;  3EHU A;  1JQF A;  1II5 A;  3M8U A;  4DI4 B;  1Y4T A;  1IZ1 A;  4LQ2 A;  1XVY A;  1Y9U A;  1AH5 A;  3VDF A;  4NF4 B;  1P1U A;  3DP4 A;  5IAI A;  1NUZ A;  1PDA A;  2Q9T A;  3S9L C;  3A29 A;  2ZXT A;  3RLF E;  1MXU A;  4IR8 A;  3FVK A;  2HCA A;  3FIR A;  4QSC A;  3CSG A;  3O6I A;  3KG2 A;  5ET7 A;  2H98 A;  1P1O A;  2D5W A;  3MVW A;  2DXR A;  1A40 A;  1IQ7 A;  1IMF A;  1EYJ A;  1LAF E;  4HE0 A;  5L9S A;  5F7V A;  1FBE A;  4ZE8 A;  2AL5 A;  2YPN A;  2FVZ A;  3TEP A;  1UTH A;  5BWJ A;  1L5T A;  3K00 A;  1DMB A;  1TFD A;  1RKM A;  4MNP A;  4YKP A;  4F39 A;  5I59 A;  4O7M A;  3MBP A;  2RC7 A;  3C9H A;  4H6D A;  2QSX A;  3EQ1 A;  2PX1 A;  3M3K A;  3RQT A;  4P1L A;  1NNF A;  3RGY A;  4P47 A;  1K9Z A;  2Q88 A;  1Y3P A;  2R6G E;  3MP6 A;  3N94 A;  4JXI A;  2XWI A;  5ET8 A;  4OAN A;  3ZS6 A;  2XXQ A;  4R9F A;  3F11 A;  1QVS A;  1FQF A;  1ZJL A;  2VP1 A;  1NNP A;  4OER A;  2CEY A;  4IB2 A;  2DE2 A;  1BIY A;  3TOD A;  1GGG A;  3SDF A;  3K1P A;  2R8T A;  2I58 A;  1MPB A;  4NAP A;  2QFL A;  4R75 A;  3MYU A;  2QS1 A;  3KEI A;  5FHM A;  4MIJ A;  3IO4 A;  4XTC Q;  5ET5 A;  3BFT A;  4PC9 A;  2XWK A;  4LVQ A;  4ISU A;  3FAS A;  3U92 A;  1SDX A;  3KJ7 A;  1JVY A;  3FVN A;  3O29 A;  5EHS A;  4X9T A;  1B1X A;  3CSB A;  3CG3 A;  4MAG A;  1BKA A;  3KFM A;  5JTY A;  4P1E A;  3EHT A;  1AOV A;  5CBS A;  2H25 A;  3PD9 A;  3T9V A;  1URD A;  4PAI A;  3QXM A;  4IO6 A;  4Z0I A;  1KWH A;  2F78 A;  4N4U A;  2XWV A;  3C31 A;  3SEU A;  1XHY A;  1FQC A;  4GWO A;  2O69 A;  4MX6 A;  4C1T A;  3HHF A;  1IMA A;  1MG1 A;  5L8D A;  4M4G A;  3N6T A;  4PDD A;  4JVC A;  4GX6 A;  3U94 A;  1B4H A;  3QSL A;  2G93 A;  3FV1 A;  1NI9 A;  3GBB A;  4DZ1 A;  1YXI A;  3VVE A;  2XXY A;  3LSF B;  1D4N A;  4E0X A;  1LLS A;  4NED A;  3PUV E;  3D4C A;  4ESX A;  1BK4 A;  3KN3 A;  3L6G A;  3PD8 A;  1A8F A;  3GXA A;  5EYG A;  5ITP A;  1EZ9 A;  2Y7P A;  1IXI A;  2DYX A;  4NF8 A;  3TAJ A;  3AXF A;  1B3H A;  3O97 A;  1MY3 A;  3W9V A;  3FGS A;  1USY E;  5I2K B;  1FTJ A;  4LAT A;  3MPK A;  1R9L A;  3OD7 A;  1XVX A;  4GBW A;  4YKJ A;  3VV5 A;  2Z8E A;  3LUZ A;  3UGW A;  2XA5 A;  2WEF A;  2HEU A;  1ZBM A;  5LTC A;  2HHM A;  2UVI A;  1Q35 A;  4GOT A;  2I0B A;  3MST A;  3U65 A;  4JSO A;  3PPQ A;  2O84 X;  2A5T A;  2BJI A;  4N81 A;  2QVR A;  3GLB A;  4RNS A;  1LEV A;  3FXU A;  2XXK A;  3KGC A;  4QFK A;  1MQH A;  1FPL A;  2CZH A;  2XXP A;  4X8R A;  5FBP A;  1RYO A;  4EDP A;  3GYY A;  2VPN A;  3MZ1 A;  3E4R A;  4N07 A;  4E0W A;  3W9W A;  1FQE A;  3O2A A;  5DVF A;  2CZL A;  3JZJ A;  1Q9D A;  2NXO A;  3P7I A;  5KDT B;  2RKM A;  1XOC A;  3C34 A;  2XWO A;  3N5L A;  3Q27 A;  1PB8 A;  4XKR A;  4BDN A;  4KHZ E;  5FTI A;  4GBV A;  2OWZ A;  2M8C A;  1P1W A;  2WYK A;  4POW A;  3H6V A;  1DTG A;  3T22 A;  4C1U A;  1B7H A;  1LBB A;  1S50 A;  4OZ9 A;  3IB2 A;  3G3F A;  2ABH A;  2ONS A;  5CI5 A;  3IOU A;  3KC1 A;  4P11 A;  4NWC A;  4N13 A;  4MLQ A;  4OVJ A;  5CBR A;  3IO6 A;  4NF4 A;  3C35 A;  4DI3 D;  2DXY A;  2DWI A;  5HPQ A;  4EUO A;  2O6A A;  4I40 A;  4KPT A;  2CEX A;  1NV5 A;  4YKI A;  2OJT A;  4U4X A;  3B8B A;  3K6X A;  1SW2 A;  2Y5K A;  1PBP A;  3K2D A;  4H5F A;  4H45 A;  1JVX A;  2XX8 A;  5I58 A;  1T0K A;  3O28 A;  1NV0 A;  5I58 B;  3U93 A;  2B3B A;  4RPN A;  2I0C A;  3IK6 B;  2FA7 A;  3E13 X;  1B40 A;  1PBQ A;  4Q0C A;  2AIX A;  3UN6 A;  4NWD A;  4ELQ A;  3FXQ A;  4ZEC A;  3K6V A;  3ILT B;  1O7T A;  1XT8 A;  2KR0 A;  2I49 A;  2QL3 A;  5H8Q B;  4MJO A;  4F3S A;  4ZS9 A;  2IA4 A;  4NF5 A;  2OWT A;  1CB6 A;  2VPO A;  3PMV A;  1TWY A;  3SEW A;  2Q2C A;  3SZP A;  1B46 A;  2Q2A A;  1SW5 A;  4OXV A;  3IOV A;  1D9Y A;  3G3H A;  1IIT A;  3H4Z A;  4YB5 A;  1FCK A;  3IJO B;  4PAK A;  1EYI A;  3OEL A;  4NF8 B;  1I6Q A;  3QUF A;  3MPL A;  4JWX A;  1NUY A;  3D4G A;  4OET A;  2GQ1 A;  1XS5 A;  2F34 A;  4XXU A;  4KXP A;  3HN0 A;  1P1Q A;  3ECR A;  3MVY A;  1NUW A;  1EU8 A;  4NF5 B;  4QSE A;  4GX4 A;  2OZZ A;  2YLN A;  1EH3 A;  3HHG A;  3SES A;  1NV1 A;  4UAB A;  4MFI A;  2XXH A;  3JYR A;  2QS3 A;  4AQ4 A;  2CMO A;  5CMB A;  3VFJ A;  2OCU A;  1VFD A;  1OLA A;  1FPE A;  2HFB A;  3B50 A;  4IO2 A;  3MWB A;  3Q26 A;  3PMX A;  3IOT A;  4N15 A;  1UIV A;  5F24 A;  4H65 A;  1VFE A;  1QKA A;  1JET A;  2ONR A;  1QUK A;  4RK9 A;  2UVJ A;  3IB0 A;  4GIZ A;  1USY H;  3ILU B;  4BDQ A;  4X48 A;  4O3C A;  4AS5 A;  2ZNS A;  5B70 A;  2ZNU A;  3PMW A;  2W7Y A;  3KBZ A;  4JBZ A;  4O3B A;  3TCF A;  5BUU A;  1S9T A;  1B05 A;  1WDN A;  4AB5 A;  2QVU A;  1FBG A;  5EQA A;  4WKM A;  1FPJ A;  1OQH A;  2KQZ A;  2F7A A;  1GVC A;  5TPA A;  1LFI A;  2GRV A;  1YTV A;  4X1D A;  5H8N B;  4BDM A;  3EF7 A;  2XD2 A;  4N8G A;  2P3V A;  4OMB A;  3SEY A;  5IZZ A;  1URS A;  1HSJ A;  3DLN A;  4YKK A;  1DPE A;  3R7X A;  3E79 A;  4MBP A;  4N91 A;  2QJE A;  3VVF A;  2O51 A;  1SI1 A;  2FBP A;  3BKI B;  4AS4 A;  1AIV A;  3BIH A;  4OHN A;  5I5P A;  2F7C A;  2B65 A;  5HBC A;  4RJZ A;  2I4B A;  4BLA A;  5IGA A;  4WEP A;  4F22 A;  5I2K A;  4N6D A;  4LZ8 A;  1B58 A;  3QUJ A;  3MAM A;  5ICT A;  4F19 A;  2QS2 A;  3KC0 A;  1YCJ A;  3VXB A;  3DEL B;  2XX9 A;  4MCO A;  3OEM A;  3UK4 A;  2FHY A;  5B7D A;  4THI A;  4HTG A;  1WVJ A;  3JV9 A;  1N7X A;  3KSJ A;  4GD5 A;  3QYT A;  2ANJ A;  4F2Q A;  3G3G A;  2RF1 A;  2RC8 A;  5M2V A;  2A5T B;  1H76 A;  3KN7 A;  2P2A A;  1UIU A;  3TTR A;  1DOT A;  3T9H B;  3OEN A;  1DSN A;  1EZP A;  1QUL A;  5AE4 A;  1M5C A;  1B3F A;  3G3I A;  4ESW A;  1O63 A;  2Y7W A;  2G29 A;  4TLL B;  4I3Y A;  1XC1 A;  4LZ7 A;  4QRZ A;  1IXC A;  4P0I A;  3Q28 A;  3V83 A;  3CFZ A;  4NX1 A;  3PUZ E;  3FV2 A;  3K6U A;  5ELV A;  3V89 B;  4P3L A;  4GRK A;  5IZ3 A;  1G0I A;  1HSE A;  3TCG A;  1LCT A;  5CRY A;  5H8N A;  1DCU A;  4P56 A;  3LUY A;  3RPL B;  1Y1M A;  3HO7 A;  3HV1 A;  1MRP A;  3LSX A;  4OWD A;  4AB6 A;  4ELP A;  2UYE A;  4OVS A;  3K6W A;  4JWY A;  1FPK A;  2Q8M A;  2Z22 A;  4YB6 A;  2DWJ A;  4PAF A;  3FXB A;  4FEC A;  3T9X B;  4QFO A;  5H8S A;  1NUX A;  4QFL A;  2X26 A;  2VD3 A;  4MF3 A;  3ZKK A;  4GXS B;  3M3L A;  1D3K A;  3TCH A;  4U21 A;  1SPI A;  3USD A;  4OVP A;  2Y7R A;  1H45 A;  4R74 A;  3MJN A;  1LFG A;  3BBR A;  3ZSF A;  5A5X A;  1AMF A;  4JVI A;  4NG7 A;  3QAX A;  3IL1 B;  3MVX A;  4RY1 A;  1A54 A;  4K3F A;  4XKQ A;  1OLC A;  3S4U A;  3DP8 A;  3FXR A;  4DE8 A;  4DCX A;  3BFU A;  3TKD A;  1NNT A;  4U1Z A;  2UVH A;  4G8H A;  2D21 A;  3C4M A;  1FJ6 A;  3NOH A;  3O9P A;  2PT2 A;  1KZ8 A;  2THI A;  4GWY A;  4I9D A;  2V3T A;  5KCJ B;  1P1N A;  4F1V A;  2UXA A;  1DPP A;  2REG A;  2Z8F A;  5AA3 A;  1M5D A;  2V25 A;  3EHS A;  5H8F B;  1TXF A;  1B1H A;  2DQV A;  2ESN A;  1FRP A;  4N17 A;  4ZDM A;  3K1M A;  3MUQ A;  1B9J A;  3FD3 A;  5I84 A;  1QW0 A;  4GWW A;  2WKY A;  2HZL A;  3CFX A;  4JVD A;  2F97 A;  4YIC A;  4TLM B;  4JB7 A;  4GWS A;  2XXT A;  4FAT A;  1WOD A;  2AL4 A;  4PE5 B;  3H06 B;  1NFT A;  2V4C A;  4MLV A;  1N84 A;  2I6E A;  2E1S A;  2Y7I A;  5AA4 B;  5T3J A;  2BJJ X;  1MPD A;  3OO6 A;  3HFU A;  3FUZ A;  4PF8 A;  1LST A;  2O7I A;  1B32 A;  5DYH A;  3PTY A;  3GZG A;  2V3U A;  3MP8 A;  3D1R A;  4Q8R A;  4GX3 A;  1H43 A;  2B3F A;  3VE1 B;  5H8Q A;  1LB9 A;  1RYX A;  2MKZ A;  3CR9 A;  3C33 A;  1ANF A;  1SW4 A;  2P3N A;  1MXZ A;  4JDF A;  1R6Z A;  2ZYM A;  3RTW B;  1Z7M E;  2F7B A;  5TU0 A;  1B3G A;  1H44 A;  1B51 A;  3VVD A;  4GWZ A;  2F5X A;  4P9K A;  1RDY A;  2NUV A;  3CRB A;  4RXL A;  1LBC A;  4KYD A;  2HPG A;  5IZ1 A; 
#chains in the Genus database with same CATH homology
 4PAF A;  3FXB A;  2CEY A;  4HCY A;  2DE2 A;  2GQ1 A;  1JP4 A;  4PFR A;  3ROJ A;  1LBW A;  4N8Y A;  1LBY A;  4NF0 A;  3KC1 A;  2R8T A;  2PFY A;  4DI4 B;  4GWW A;  4KXP A;  1FPI A;  4HCW A;  4NHB A;  3W9V A;  4NAP A;  1RDZ A;  1NUX A;  2QFL A;  4I3E A;  5EQ8 A;  4PFI A;  2HZL A;  5IGA A;  4JVD A;  2DE3 A;  4N6D A;  4DI3 D;  2DDK A;  3MYU A;  5IM2 A;  4PF6 A;  1NUW A;  4MEV A;  4NN3 A;  1FBD A;  1G0H A;  1KA0 A;  1VDW A;  4GX4 A;  4H46 A;  4YIC A;  4G61 A;  4MIJ A;  5I7I A;  5DW8 A;  4GBW A;  1DBZ A;  1NUZ A;  5A5L A;  4F19 A;  2Q9T A;  1LBV A;  5ET5 A;  3LUZ A;  4PC9 A;  4PE3 A;  4I40 A;  1NV1 A;  3QMF A;  4UAB A;  3KC0 A;  3A29 A;  1NV5 A;  5EYH A;  2CEX A;  5ET6 A;  2XA5 A;  2XWK A;  1SPI A;  4GWS A;  4OVP A;  2WEF A;  2WBB A;  2QVV A;  4MCO A;  3B8B A;  1CNQ A;  4IR8 A;  2PFZ A;  2FHY A;  4OVR A;  1FBP A;  1NV2 A;  3IFA A;  1IMB A;  3RPL A;  2Y5L A;  1FBC A;  2Y5K A;  5LTC A;  1D9Q A;  2HHM A;  5ET7 A;  2V4C A;  2F3D A;  2HZK A;  1FPE A;  4H45 A;  4NQ8 A;  3MST A;  4XFE A;  3B50 A;  4QBA A;  1FBF A;  5T3J A;  2B4L A;  4F1U A;  4QXD A;  5CM6 A;  1IMF A;  5EQ9 A;  1EYJ A;  5IZ3 B;  3HFU A;  4JVI A;  1NV0 A;  1NV6 A;  4HE0 A;  4MMP A;  4N15 A;  4NG7 A;  4X9T A;  4F18 A;  1K9Y A;  5F24 A;  4MAG A;  4PF8 A;  4PGP A;  1FPB A;  2WYP A;  3U65 A;  1NV7 A;  3E78 A;  2WX9 A;  4OA4 A;  1FBE A;  2BJI A;  1QGX A;  5J16 A;  1IME A;  3IFC A;  4N81 A;  2QVR A;  2DE4 A;  3LV0 A;  1YYZ A;  2HXR A;  2ZZV A;  4P1E A;  1LEV A;  1FPF A;  2FVZ A;  2Q74 A;  3RYD A;  2XXK A;  1FTA A;  4LN5 A;  4HE2 A;  1FPL A;  4PDH A;  1FSA A;  2CZH A;  3PTY A;  4PAI A;  1IMC A;  1IMD A;  4X8R A;  5FBP A;  4GWU A;  1FBH A;  1NV3 A;  2FIX A;  2VT5 A;  1AWB A;  4HE1 A;  1RDX A;  2KR0 A;  2ZZW A;  3GYY A;  4XEQ A;  2CZI A;  4YZZ A;  1LBX A;  4AS5 A;  4MJO A;  2JJK A;  2VPN A;  2CZK A;  4O94 A;  4MHF A;  1DK4 A;  4I3Y A;  5EQ7 A;  4N4U A;  4PCD A;  3CHG A;  3KBZ A;  3D1R A;  4MNP A;  4P8B A;  3W9W A;  4OVT A;  2XWV A;  4GX3 A;  4PGN A;  4PTK A;  4GWX A;  4PFB A;  1NV4 A;  1FJ6 A;  1FJ9 A;  3ISP A;  4O7M A;  4MX6 A;  4NX1 A;  1Q9D A;  1IMA A;  4O7I A;  5ESY A;  5I3S A;  3NOH A;  4PBH A;  4X04 A;  2QPQ A;  1KZ8 A;  2QVU A;  1FPG A;  4P47 A;  1FBG A;  5EQA A;  4GWY A;  2MKZ A;  1FPD A;  2DVZ A;  3T1B A;  3BIG A;  2VPO A;  1FPJ A;  4P1L A;  2KQZ A;  4P3L A;  1YZ0 A;  3FBP A;  5IZ3 A;  1INP A;  4F1V A;  5LDZ A;  5JK4 A;  4PDD A;  4HXV A;  1G0I A;  1K9Z A;  2P3N A;  2XWO A;  2F3B A;  2P3V A;  3EKI A;  4JVC A;  3T0J A;  1EYK A;  4M1V A;  4GX6 A;  2L5V A;  4N8G A;  5IZZ A;  2XWI A;  5ET8 A;  4PBQ A;  4MNC A;  4OAN A;  2FIE A;  3SZP A;  1DCU A;  4NGU A;  4FBP A;  1NI9 A;  2WBD A;  4P56 A;  3RPL B;  4GBV A;  2OWZ A;  2OX3 A;  1YXI A;  2WYK A;  4OVQ A;  4GWZ A;  3E79 A;  1FRP A;  4XF5 A;  4PAK A;  5J1D A;  4N91 A;  2F5X A;  4OVS A;  2V3Q A;  4P9K A;  1EYI A;  4MNI A;  2FBP A;  1FPK A;  1RDY A;  4O8M A;  2Q8M A;  4AS4 A;  1BK4 A;  1XI6 A;  4N17 A;  4PET A;  3BIH A;  2B4M A;  4N6K A;  5I5P A;  1KA1 A;  2ZZX A;  2HPG A;  1NUY A;  5EYG A;  1LBZ A;  5IZ1 A;  2PCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...