4N81A

Another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
253
Chain Sequence
RSAYEDDIRLAHRLADVAADIIRPFFRAPLTIDLKADHSPVTKADRGAEQAMRAILEQERPEDGIFGESRPDARRLWVLDPIDGTRAFIGGRASFGTLIALVEDGRPVLGIINQPIHQERWVGVKDLPTSFNGEVIHTRSCPALDHALLATTSPWLFEKEGEVHFDKIRLKCRDTLLGGDCYNYGLLSLGHCDLVVEQGLKFYDFAALVPIVEGAGGIMRDWQNRPLNKNSVGEVIAAGDHHLIEPALSAMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Crystal structure of cbbF from Zymomonas mobilis and its functional implication
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Hydrolase
total genus 87
structure length 253
sequence length 257
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4n81A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4n81A02
1YYZA 2BJIA 1FBGA 3B8BA 1EYKA 1G0IA 3RPLA 1FPIA 1LBYA 4GBVA 1NUYA 4AS4A 4GWWA 1RDZA 2FVZA 1FPJA 3IFAA 1DBZA 2CZHA 4KXPA 4O7IA 2GQ1A 1G0HA 1FRPA 3BIHA 3T0JA 5EQ7A 5IZ3A 1FJ9A 2WEFA 2Q74A 4GX3A 2OX3A 4AS5A 2P3NA 1K9YA 1NV0A 1NV3A 1FSAA 5EYHA 4H46A 5EQ9A 1FBHA 5I3SA 1YXIA 2F3BA 1CNQA 1FBEA 2WBBA 2DDKA 1LEVA 3A29A 3RYDA 5ET7A 1FTAA 5ESYA 4I40A 1XI6A 1IMEA 2OWZA 4H45A 1IMFA 1FPGA 1NUWA 1BK4A 1EYIA 1RDYA 2HHMA 1KA0A 1NUXA 4GWUA 2VT5A 4GX4A 1FBFA 4HXVA 3KBZA 1IMDA 2WBDA 3D1RA 1NI9A 2FIXA 3QMFA 3IFCA 5LDZA 5DW8A 2Y5LA 2P3VA 4PTKA 3LV0A 5EQ8A 2QVRA 5ET8A 1LBXA 4FBPA 2R8TA 3KC0A 5EQAA 1FPLA 1JP4A 1KA1A 4GWXA 3BIGA 1QGXA 3LUZA 1YZ0A 1NV5A 1FJ6A 1VDWA 2FHYA 4QXDA 2QVUA 1FBPA 2QFLA 2JJKA 5EYGA 3ROJA 2PCRA 1LBZA 1Q9DA 1NV6A 1INPA 4GBWA 1LBVA 1FPKA 2Y5KA 1FPFA 4HE0A 5ET5A 1FBCA 4HE2A 1NV7A 4I3YA 5J16A 2FBPA 4GWZA 3RPLB 1DCUA 1NV4A 2FIEA 2Q8MA 1IMCA 4IR8A 5A5LA 4GX6A 1RDXA 1FPEA 5ET6A 1NV2A 1NUZA 1LBWA 2QVVA 2CZKA 4I3EA 5IZ3B 4GWYA 5IZ1A 4GWSA 1IMAA 3KC1A 1FPDA 1NV1A 1D9QA 1SPIA 3FBPA 1EYJA 1FBDA 5FBPA 1K9ZA 4N81A 1IMBA 2F3DA 2CZIA 4HE1A 4MJOA 5F24A 1KZ8A 4G61A 1AWBA 1FPBA 5T3JA 1DK4A
chains in the Genus database with same CATH superfamily
1QUJA 3B8BA 4LZ8A 3O97A 3T1BA 1FQDA 1I69A 3MPLA 3RY3A 1A99A 3O66A 2Q89A 3FASA 4OESA 3T0JA 4C1UA 1LFGA 4BDNA 4ZZAA 3F11A 3A09A 5AA2B 2NOOA 3EN3A 3FUZA 5I3SA 3FVOA 4Q5TA 2KQZA 4OA4A 2V93A 1FBEA 3CIJA 4PBQA 2O1MA 3E3KA 4LZ7A 1P1NA 3PUVE 4PF6A 2OWZA 1Y4CA 1H44A 2QJEA 3IORA 1NL5A 2ZMBA 1KA0A 2V3TA 4POWA 1LB8A 4MCOA 1NI9A 5KDTB 3PPOA 5I59B 2RCAA 5DW8A 4F1UA 3USDA 4MAGA 1IXCA 1JW1A 1NH7A 2R8TA 4K3FA 1SI0A 2UVHA 2V25A 1FW0A 4IGRA 1BP5A 3O28A 1NV6A 3Q26A 4PE5B 1INPA 1OIBA 3U93A 2VD2A 2RF1A 5CBSA 1ZKBA 2UVIA 4AQ4A 1QVSA 4PAKA 4PQJA 2NXOA 2ZNSA 5AA1A 4XKNA 3PTYA 3FGSA 4I62A 2B3FA 4GD5A 4ZEKA 1NKXA 4XKQA 1B3FA 1MQGA 2F7CA 1FPBA 4N17A 4O3CA 3S4UA 5KDTA 1P1UA 1UIUA 1B5JA 2WYKA 3T9HB 3S9MC 2Z23A 1D3KA 1S9TA 1VE4A 3CRBA 1N76A 3B6TA 3IJOB 4NF6A 4GRKA 4RYAA 2F34A 3RT6B 4BDRA 3C4MA 2B4MA 3N6UA 1EZ9A 3CR9A 4JVIA 4MEVA 1IMEA 1FQBA 4MLQA 3PD9A 4NF4A 2KR0A 4IO5A 4ELRA 2F6GA 1DOTA 1SW4A 4ESXA 2P1SA 3SEYA 2FIXA 4LP2B 4TOZA 2XWKA 1LAFE 1ZBMA 1ZIUA 4MMPA 4PFBA 4XTCQ 3KN3A 2DWIA 4ZEIA 5K2XA 1EU8A 1SW1A 4RPOA 3LSLA 2THIA 1P1WA 4XKRA 4PFWA 3UIFA 1SI1A 2QS1A 2FHYA 1JVYA 4KHZE 3D4GA 3MBPA 1II5A 3PMVA 4GBWA 4JSOA 1ELJA 2DP8A 5ET5A 4MBPA 4GWZA 4IY6A 1FQFA 3VFJA 2B3BA 4G68A 4IO6A 5ET6A 1Q1KA 1A40A 5H8NB 1MXVA 4F39A 3CFLA 1B0HA 2DWHA 4X1DA 3DLNA 1D9QA 3I5OA 4G8HA 3OXNA 1N3WA 1B4ZA 4ZECA 1K9ZA 3IOTA 3OEMA 4G61A 1B9JA 3EQ1A 4OERA 3M8UA 3T96B 3TFLA 3I6VA 4GQOA 1A55A 4YMBA 2UVJA 4IO3A 4XEQA 1B7ZA 3M3KA 1DBZA 2D3IA 3EKIA 2OX3A 5ISUA 5L9MA 5H8FA 2O7UA 1GGGA 4U22A 2P2AA 2F3BA 3SESA 3EHUA 2NVUB 3K2DA 5EHMA 2XXVA 2XWVA 1TFAA 4G8NA 5AA4A 2RKMA 5FHMA 4HXVA 4OYVA 3FXBA 3GBBA 2E1SA 3QUJA 4XXUA 4PC9A 5A5XA 3C33A 2NWJA 2WKYA 1FPLA 4N13A 5ICTA 3H6UA 1NV5A 2QFLA 4C1TA 5L8DA 4GXAA 3S9LC 1B40A 1FPKA 1JVXA 4X9TA 3ILTB 1NV7A 4BDOA 1B46A 1IXIA 4DI4B 3HSTA 2FIEA 3ISPA 2IEEA 4NHBA 4RK2A 2OCUA 4ECFA 2Y7WA 1TFDA 2AYSA 3N26A 1POTA 2B65A 1FTOA 3LSFB 3TUSA 3G3IA 1FBDA 1D9YA 1HSJA 3O6IA 4O3AA 4ZEDA 4YKIA 2GRVA 5I56B 3ECRA 3FV2A 4KPTA 1N04A 2A5SA 2B4LA 3KJ7A 3RT8A 4U2RA 2O51A 2HQ0A 3HV1A 3LUYA 5I84A 1R1NA 1ZTYA 4PAFA 4DLDA 3BKIB 4YZZA 1USYH 3TCFA 2DQVA 1QULA 4H0WA 3A29A 3E4RA 3K6UA 4ESWA 4R75A 4OFOA 1AL3A 4DI3D 3KOTA 1B51A 4NAPA 2REGA 2DS9A 2BJJX 3C35A 1IMDA 4XFEA 3B7DA 3TMGA 3ONMA 1BLFA 2P3VA 2QS2A 4F22A 5CMBA 2CZLA 5JK4A 3U92A 4GWXA 4H5GA 1FJ6A 3MWBA 2Y7KA 3ROJA 2Z8FA 4PFUA 4P1EA 3EHSA 2Y5KA 3OSQA 3FATA 1ANFA 5I7IA 3MJNA 4GLIA 4GX6A 4N6PA 5H8QB 2I6EA 1MQJA 3KGCA 4LZ5A 2FNCA 2OBGA 4GWSA 4NWDA 5TPAA 3NOHA 4BDQA 4QRZA 4G68C 5IAIA 2UYEA 1IMBA 4YB6A 2BJIA 3OSRA 2H5YA 4NG7A 4U1OA 3RPLA 4OVPA 1PB8A 1MXXA 2VHAA 3C34A 2FVZA 1Z7ME 2HXWA 4O7IA 3CSGA 3JYRA 3HFUA 3MQ9A 5IKBA 3PU5A 4YKPA 3H6WA 2DWJA 1JNFA 1I6QA 2ZYNA 1NNTA 4PDDA 1BTJA 1JETA 2HCAA 5EQ9A 2V84A 4F2OA 4P0GA 2YJPA 4JWYA 4R2BA 5KCJA 2Z8EA 3PMXA 5HM4B 1IMFA 4I1DA 4E0XA 5H8QA 4IGTA 5H8HA 4R6YA 1IXGA 2DE2A 4F3GA 3TYHA 2UYFA 4F31B 4PP0A 1SW5A 2I58A 4POXA 3LC8A 4GIZA 4EF1A 2DWAA 1LFHA 3P7IA 3U65A 4H5FA 4OZ9A 2PT2A 4NX1A 4ONYA 2PVUA 3N6TA 2Y7IA 1YTVA 1EZOA 2H25A 1FTJA 1OVBA 3WAFA 2MKZA 3TQWA 3PD8A 2UVGA 2QVVA 2CZKA 1MY4A 2R6GE 4IY5A 4OFLA 2ABHA 4WEDA 1B3LA 1NV1A 1IUDA 4FATA 4DZ1A 4MLVA 5F24A 1M5CA 1R9LA 3IR1A 4U21A 4GL0A 1S50A 2ZNTA 3A3CA 3V89B 1B7HA 4GWWA 1FPJA 3E79A 1G0HA 5EQ7A 2OPDA 1LAXA 1FJ9A 1Y3QA 2Q74A 4GX3A 3UN6A 1K9YA 2VGQA 4OMBA 4G77A 4I8CA 3BFTA 3RUMA 2PYYA 3FJGA 5AA3A 4PDHA 4JDFA 2F8DA 3D4CA 3DP4A 5JEIA 1JEVA 3DP8A 4QFKA 3FJ7A 3FV1A 3IOUA 1JW5A 2XXPA 2Y7PA 2V3UA 1QUIA 3O9PA 3D1RA 1MH3A 1LAHE 4MIJA 2I0BA 4FBPA 1GTKA 3VLUA 5DVFA 3V8XB 2V4CA 2F7AA 4WXJA 4X04A 2H9BA 4JWOA 1NFTA 2REJA 1H43A 1Q9DA 2XXQA 1F9BA 4PFIA 3S9EA 3MYUA 4R2FA 1MQDA 1CE2A 4OTEA 1JW4A 2ZYMA 2DVZA 2XXTA 4KCDA 4PFRA 4ZZEA 2XXIA 5CMMA 1ZMGA 4NF6B 5IZ1A 2XXHA 1FPDA 2Q88A 4ZS9A 2WYPA 4PBHA 5AE4A 1LBBA 4LQ2A 4EUOA 2DE3A 2G93A 4QFLA 3K0VA 1DK4A 1YYZA 2O68A 2L5VA 3TQLA 1IITA 4O8MA 4PGPA 3RN8A 2O69A 1LBYA 1IIWA 4FIMA 4NF4B 3TTRA 5J1DA 4R6KA 2GQ1A 4GFRA 2XXUA 3TAJA 3H06B 3CI8A 2X7PA 4H46A 3V83A 4HCWA 1QKAA 5B70A 4OEVA 2PFYA 4DIGA 1MM6A 1I6BA 3RNNA 3HPIA 2HHMA 1FQEA 2HZKA 2OK2A 4QFPA 1UTHB 3QSLA 3TPAA 4LQ5A 1PEBA 1MH4A 4PTKA 4G68B 3CHGA 4FEDA 3TKDA 2CEXA 3KC0A 1QUKA 4I9DA 1MY0A 1USYE 3LUZA 1SDXA 3O29A 4U1ZA 1DSNA 3E78A 3SEUA 3FXQA 1B1XA 5J16A 2I4BA 4N15A 3I3VA 2Q9TA 1ZJLA 3RPWA 2DXYA 3S9NC 2H4IA 2OWTA 3M3LA 2Z22A 3K1PA 1N7XA 1WDNA 3B50A 4DXUA 3UK4A 1MPBA 5H8FB 3RTWB 2F3DA 4HE1A 4O7MA 2RINA 1UTHA 4X8RA 3LSWA 4F18A 1NUYA 4Q8RA 3L6GA 5AA4B 4KI0E 4FEBA 5ICQA 1TWYA 3B6QA 2QL3A 3RGYA 1T0KA 4H8JA 4AS5A 5CRYA 1B3HA 4JBZA 3VV5A 1SYHA 5A5XB 4F3PA 1FBHA 2QS3A 3CVGA 5HBCA 1CNQA 3OEKA 4P0IA 4I40A 1XI6A 1YPNA 3G3KA 1FPGA 5K2YA 3QXMA 5I5PA 4NWCA 3W9WA 3N5LA 3QAXA 1XC1A 2OPEA 4F3BA 3OELA 1I6AA 3MAMA 3IFCA 3H03A 4QFNA 4XIGQ 1QKBA 1LAGE 1JP4A 3U8QA 5JTYA 1N7WA 2XXYA 3E9XA 4TLLB 4EXKA 2AL5A 1NMUA 3GZGA 4EDPA 2F5XA 4ISUA 4RXLA 3ZKLA 4OANA 4KR5A 4N8YA 4OVQA 4N91A 4DE8A 4HTGA 2OWSA 2YPNA 4AB6A 4I3EA 2D5WA 4NF8B 1B05A 4WEPA 3IO4A 5FBPA 5CC2A 1B52A 2ZZXA 3FVGA 1B1HA 4C0RA 2UXAA 2IA4A 2FA7A 2HFBA 3R7XA 1N84A 2PFZA 3VVEA 1PB7A 2XX9A 5EYFA 2HAVA 1FPIA 3UORA 4N6KA 4IO2A 3TDJA 4AS4A 4KFQA 3L6HA 1SQYA 4F2QA 3IB2A 4PE3A 5I2NA 1B32A 4ZEFA 2O7IA 3TELA 1FRPA 5AA2D 3UGWA 3VLVA 5CI5A 3TCHA 3IL1B 4OHNA 2P3NA 5F1QA 5BWJA 4G4PA 3HN0A 4O94A 3S2VA 5ET7A 2P0SA 1LB9A 1HSEA 4N6DA 3BFUA 4R72A 4R73A 4HS7A 3OO8A 3K02A 1NUXA 4ZEBA 4PFYA 5LOMA 3ODBA 3KBZA 2WBDA 3TTLA 4NF8A 2Y84A 1EZPA 5B7DA 2Y5LA 1B5HA 2H98A 4YB5A 2M8CA 2Q2CA 1S7YA 1SD3A 2NUVA 4PETA 5L9OA 1EH3A 3PPQA 1IXHA 1KA1A 2A5TB 3BIGA 3K00A 2F36A 3TTKA 3JV9A 5TPAB 1VDWA 3G7WA 2JJKA 2PCRA 1LBZA 4MHFA 3OO6A 3KSXA 1LBVA 5IM2A 1N0TA 2X7QA 4QSDA 2FBPA 4GWOA 3RPLB 3O2AA 4DCYA 1IQ7A 1N3XA 1UQWA 2R9JA 1URDA 4P1LA 2I4CA 3BBRA 4ELOA 1H3DA 1L5TA 2ALUA 1XS5A 3KZGA 1TT1A 2ZZWA 5TU0A 3QYTA 1D9VA 1LSTA 2DOJA 4Z7EA 1FQCA 1MS7A 5KCJB 4MNIA 3O6GA 3C9HA 5H8HB 2CZHA 1P1QA 2A5TA 4OETA 4XF5A 3RTFB 3WAEA 5TP9A 1OQHA 1MY3A 3FXUA 5IZ3A 3O6HA 3PUYE 1NV0A 1NV3A 3KN7A 4GVOA 3ZS6A 4NMYA 5IZZA 4ZDMA 3VXBA 1LLSA 1MM7A 1XVXA 4OENA 1LBCA 1Y3PA 1VSOA 1YCJA 3K1MA 3KN8A 1PDAA 1JQFA 4OWDA 4GWUA 2VT5A 4BDMA 3MVXA 5H8SA 1QJMA 2VD3A 4P8BA 5LDZA 4LN5A 3MVWA 4QFOA 3PPRA 3LV0A 4R9FA 1A7LA 5EQAA 5FTHA 1Y4TA 2VPOA 1QGXA 3C32A 1UIVA 4UACA 1VFDA 2ZZVA 3E13X 4QXDA 2DXRA 3LBSA 1JEUA 2DYXA 4IO4A 2DE4A 4N4UA 4N8GA 4RPNA 2F97A 4YKKA 3PUXE 3DM0A 2Q8MA 4IR8A 1HSLA 4FJPA 1RDXA 2I48A 1NV2A 3CSBA 1Y1ZA 4Q30B 1P1OA 1SW2A 4U4XA 5DEXB 3FBPA 1EYJA 2XXKA 1B3GA 2ZNUA 5DVIA 5CM6A 1M5BA 1QW0A 3ZSFA 1G0IA 3IO6A 1KWHA 2D21A 1VR5A 3T93B 3R26A 3OENA 4PAIA 1WODA 3EF7A 3KEIA 3QIMA 3U1OA 4JSDA 2PT1A 2CEYA 1A8FA 3VVFA 5EYHA 3PPPA 3G3HA 1MXYA 1FTAA 5BUUA 4NF5A 3G3GA 4RJZA 4YAHX 1A54A 2WX9A 4KYEA 4M4GA 1RYOA 4ELPA 5DEXA 1H76A 3T66A 1ZU0A 3H6TA 3TTNA 5EQ8A 3FIRA 4E0WA 4MF3A 3PGFA 4DXCA 3G3FA 4KQPA 4UABA 1P99A 1MQHA 1Y1MA 2F78A 2XX7A 4NEDA 2ONSA 3OO9A 1ATGA 1IEJA 3CFZA 1FPFA 4MH5A 1DPPA 4OVRA 4XKPA 5LTCA 1AIVA 1AOVA 3T9XB 3MP8A 2XA5A 5FHOA 2AL4A 4BDLA 3IAZA 5I2KB 3GXAA 3SKPA 1PBQA 4ND9A 1AH5A 3HHFA 4N81A 4MJOA 3MSTA 3VE1B 1KZ8A 4QHQA 1AWBA 4IB2A 2HPGA 4BLAA 4LUBA 3T9UA 1EYKA 1FTLA 2G29A 3HCQA 2HAUA 4YICA 1RDZA 3A3UA 4KXPA 3KJTA 3KBRA 1UTBA 4M1VA 4N07A 3TTMA 4P11A 1DPEA 3DELB 2FYIA 3R6UA 4WKMA 5DYHA 5ESYA 3CFXA 4QSCA 1NNKA 3CG1A 1NUWA 1BK4A 1R9QA 2ZYOA 5I2KA 4H1XA 3QK6A 3THIA 1MPCA 4LONB 1J1NA 2F7BA 3GLBA 2QVRA 4DXBA 3EPEA 5AA2A 4HW8A 3IOVA 4GL8A 1R6ZA 3RLFE 5F7VA 3SDFA 4RNSA 4R74A 2OJTA 5M2VA 3FVKA 1CB6A 4PGNA 2XWIA 1LCTA 3FVNA 4JWXA 3RQTA 5I59A 1IMCA 5A5LA 3ILUB 2LAOA 3KOSA 4RA1A 2HEUA 1US4A 1NNPA 1B7UA 3DP6A 4F29A 4F1YA 4JXIA 1OLCA 3H7MA 3K4UA 3U94A 3T22A 3H6VA 3UA8A 4EQBA 4YMAA 1OMPA 1FBGA 4OEUA 4OVJA 3Q29A 2VP1A 1B3EA 2GHBA 2GHAA 2Q8JA 3VLWA 2RCBA 3MVYA 3T9VA 4RK9A 1FSAA 2XD3A 2XHDA 4MNPA 2H99A 2VOZA 4NE4A 5JTYB 1LEVA 5FHNA 1GV8A 1GVCA 5I57B 3EHTA 3MVZA 5FTIA 3SERA 3H3GA 3QUFA 4OVTA 1B6HA 5KZTA 1FBFA 4QSEA 2F6PA 2DVCA 3GBAA 3MP6A 2RC9A 1LBXA 1WVJA 3C31A 3OMBA 3TCGA 4FORA 4MFIA 3VDFA 1DTGA 2QVUA 3PMWA 1US5A 4EQ9A 4P3LA 4I3YA 4TLMB 1FCKA 2QMWA 1DCUA 4OXVA 4P9KA 1OVTA 3MPKA 4R6HA 1MDQA 5I2NB 4EXLA 3PV0E 3IB1A 2E0SA 4PFTA 4KD5A 5I57A 1IMAA 2AIXA 3ZKKA 3PPNA 2QSXA 5DTBA 3M3FA 3IJXB 5I58B 4H65A 4AB5A 5EHSA 2HZLA 3FZVA 3LR1A 2F35A 5L9SA 4GBVA 4L17A 4LATA 2XXXA 3HO7A 1H45A 4IO7A 1Z7NE 5H8NA 4NF0A 3BIHA 3TEPA 4Q0CA 4H6DA 2PMSA 3UP9A 2R71A 4G2ZA 3U72A 1A8EA 5ELVA 3TZAA 3N94A 1AMFA 2XXRA 1Y3NA 3W9VA 4F19A 3VXCA 3K6WA 4H45A 1M5FA 2PX1A 4RY1A 1EYIA 1RDYA 2XXWA 5DT6A 4GOTA 2V3QA 4GX4A 3AXFA 1FTMA 4NGUA 1RYXA 4TQUQ 5CMKA 3QMFA 2CMOA 4LA9A 2I3VA 5I58A 3MW0A 3B6WA 1B5IA 2O6AA 1MDP1 1O7TA 1URSA 3PUWE 2QMXA 1YZ0A 2X26A 4ELQA 4YB7A 4U23A 2Z8DA 2PBWA 1XT8A 2Q2AA 1M5EA 4HE0A 5HPQA 4MNCA 1O64A 4GF8A 4YKJA 1B2HA 1NH8A 1LGBC 3K6XA 5CBRA 5TP9B 4OQOA 2XWOA 5IZ3B 5CMCA 4F3SA 3IOWA 1OLAA 4H8IA 4P56A 2I49A 4MX6A 4EQ7A 5T3JA 2YLNA 3SEXA 4ZE8A 4EF2A 4JB7A 3OD7A 2O1LA 4X1BA 2ONKE 3IFAA 1FTKA 3W15C 2W7YA 3FJMA 3K1NA 3JZJA 1SBPA 1SVXB 2WEFA 1B58A 5ITOA 3MC2A 2I0CA 2HXRA 5I56A 4H67A 4KYSA 2QS4A 1D4NA 1URGA 1LFIA 3G3JA 1B4HA 4OVSA 3K01A 2GH9A 4JVDA 3CG3A 1IZ1A 1SYIA 4FAJA 1BKAA 4HCYA 3MUQA 3GYYA 3Q25A 1MXZA 2QPQA 4DDDA 4P47A 2ZXTA 1XOCA 2RC7A 1MPDA 1MG1A 3SEVA 1VFEA 4DCXA 2ESNA 3MP1A 1Y9UA 3OO7A 1MRPA 4FECA 3TODA 1PBPA 3PUZE 1PC3A 1B0LA 1NV4A 1RKMA 4GXSB 1FPEA 1MQIA 4FE8A 1NUZA 4O3BA 2RC8A 2VPNA 4NTLA 5DVJA 1SPIA 1YAEA 3Q27A 4ZE9A 3FD3A 3V5AA 4F1VA 1M5DA 2CZIA 2O84X 1NNFA 4NF5B 3MZ1A 1MXUA 4KYDA 3KG2A 3SZPA 3SEWA 1XVYA 3MZ9A 1OQGA 2XX8A 4Z0IA 4QBAA 3HHGA 2GFEA 1Q35A 2XD2A 4NN3A 4G8MA 4THIA 5IGAA 3KFMA 1YXIA 1MY2A 3IX1A 3IB0A 3IK6B 3KSJA 5ITPA 2WBBA 2DDKA 3C36A 3RYDA 4LVQA 3K6VA 2ANJA 2I3WA 3H4ZA 3Q28A 4X48A 1MXWA 2DSFA 4JVCA 2OLBA 1PB9A 4KCCA 1POY1 3OOAA 5ET8A 4NQ8A 1MY1A 2QRYA 3SETA 2ZYKA 1TXFA 3MZBA 1ZLQA 1FBPA 3FXRA 4OFJA 2ONRA 5EYGA 4R9GA 4QF9A 2Y7RA 1GR2A 3VVDA 4UA8A 1FBCA 4HE2A 1DTZA 1DMBA 4PF8A 4U4SA 1O63A 1LBWA 1UTBB 1LCFA 1XHYA 1BIYA 4GWYA 2OZZA 2KLFA 3LSXA 3KC1A 4YU0A 4PCDA 1FQAA 1Y20A
chains in the Genus database with same CATH topology
2PFZA 2BJIA 1FBGA 3B8BA 4NG7A 3RPLA 1FPIA 4OVPA 4N6KA 4AS4A 3T1BA 4PE3A 2FVZA 4O7IA 1FRPA 3HFUA 3T0JA 2P3NA 4PDDA 1FSAA 5EQ9A 4MNPA 5I3SA 4O94A 2KQZA 4OA4A 1FBEA 4PBQA 1LEVA 5ET7A 4PF6A 4N6DA 2OWZA 1IMFA 1KA0A 1NUXA 4OVTA 2DE2A 4MCOA 1FBFA 3KBZA 2WBDA 1NI9A 5DW8A 2Y5LA 4F1UA 4MAGA 1LBXA 4PETA 2R8TA 1KA1A 3BIGA 3U65A 1VDWA 2QVUA 2JJKA 2PCRA 4NX1A 1LBZA 4MHFA 1NV6A 1INPA 1LBVA 4P3LA 5IM2A 4I3YA 2FBPA 3RPLB 1DCUA 4P9KA 2MKZA 4PAKA 2QVVA 2CZKA 4P1LA 1IMAA 3PTYA 1NV1A 2ZZWA 5F24A 1FPBA 2HZLA 4N17A 2WYKA 4MNIA 4GBVA 4GWWA 1FPJA 2CZHA 3E79A 1G0HA 4XF5A 4NF0A 3BIHA 5EQ7A 5IZ3A 1FJ9A 2Q74A 4GX3A 1K9YA 1NV0A 1NV3A 5IZZA 2B4MA 4PDHA 4JVIA 4MEVA 3W9VA 4F19A 1IMEA 4H45A 2KR0A 1EYIA 1RDYA 4GWUA 2VT5A 2V3QA 4GX4A 4NGUA 3D1RA 2FIXA 3QMFA 2XWKA 4P8BA 4MMPA 5LDZA 4LN5A 4PFBA 4MIJA 3LV0A 4FBPA 5EQAA 2VPOA 1QGXA 1YZ0A 2V4CA 2ZZVA 4X04A 2FHYA 4QXDA 1Q9DA 2DE4A 4N4UA 4GBWA 4N8GA 5ET5A 4HE0A 4PFIA 4MNCA 4GWZA 3MYUA 2Q8MA 4IR8A 1RDXA 5ET6A 1NV2A 2DVZA 4PFRA 2XWOA 5IZ3B 5IZ1A 1FPDA 2WYPA 1D9QA 4PBHA 4P56A 3FBPA 1EYJA 2XXKA 4MX6A 1K9ZA 2DE3A 5CM6A 4G61A 5T3JA 1DK4A 1YYZA 2L5VA 1G0IA 4O8MA 4PGPA 1LBYA 4XEQA 5J1DA 3IFAA 1DBZA 2GQ1A 4PAIA 2WEFA 3EKIA 2OX3A 2CEYA 5EYHA 4H46A 2F3BA 2HXRA 4HCWA 1FTAA 2PFYA 2XWVA 2HHMA 4OVSA 2WX9A 2HZKA 4JVDA 4HXVA 3FXBA 4PTKA 5EQ8A 4HCYA 4PC9A 3CHGA 3GYYA 2CEXA 3KC0A 2QPQA 1FPLA 4P47A 3LUZA 1NV5A 4UABA 2QFLA 3E78A 1FPKA 4X9TA 1FPFA 1NV7A 5J16A 4N15A 4OVRA 5LTCA 4DI4B 1NV4A 2FIEA 2Q9TA 3ISPA 4NHBA 2XA5A 1FPEA 1NUZA 2VPNA 1SPIA 3B50A 1FBDA 4N81A 4F1VA 2F3DA 4HE1A 2CZIA 4MJOA 3MSTA 4O7MA 1KZ8A 1AWBA 2HPGA 4X8RA 1EYKA 2B4LA 3SZPA 4F18A 1NUYA 4YICA 1RDZA 4KXPA 4M1VA 4QBAA 4PAFA 4AS5A 4YZZA 4NN3A 1FBHA 5IGAA 1YXIA 1CNQA 2WBBA 2DDKA 3A29A 3RYDA 5ESYA 4I40A 1XI6A 1FPGA 4DI3D 4NAPA 1NUWA 1BK4A 4JVCA 5I5PA 3W9WA 1IMDA 4XFEA 3IFCA 2P3VA 2QVRA 4NQ8A 5ET8A 5JK4A 1JP4A 4GWXA 1FJ6A 1FBPA 5EYGA 3ROJA 4P1EA 4PGNA 2Y5KA 1FBCA 4HE2A 2F5XA 2XWIA 5I7IA 1IMCA 5A5LA 4OANA 4GX6A 4N8YA 4PF8A 4OVQA 4N91A 1LBWA 4I3EA 4GWYA 4GWSA 3KC1A 3NOHA 4PCDA 5FBPA 1IMBA 2ZZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYZ A;  2BJI A;  1FBG A;  3B8B A;  1EYK A;  1G0I A;  3RPL A;  1FPI A;  1LBY A;  4GBV A;  1NUY A;  4AS4 A;  4GWW A;  1RDZ A;  2FVZ A;  1FPJ A;  3IFA A;  1DBZ A;  2CZH A;  4KXP A;  4O7I A;  2GQ1 A;  1G0H A;  1FRP A;  3BIH A;  3T0J A;  5EQ7 A;  5IZ3 A;  1FJ9 A;  2WEF A;  2Q74 A;  4GX3 A;  2OX3 A;  4AS5 A;  2P3N A;  1K9Y A;  1NV0 A;  1NV3 A;  1FSA A;  5EYH A;  4H46 A;  5EQ9 A;  1FBH A;  5I3S A;  1YXI A;  2F3B A;  1CNQ A;  1FBE A;  2WBB A;  2DDK A;  1LEV A;  3A29 A;  3RYD A;  5ET7 A;  1FTA A;  5ESY A;  4I40 A;  1XI6 A;  1IME A;  2OWZ A;  4H45 A;  1IMF A;  1FPG A;  1NUW A;  1BK4 A;  1EYI A;  1RDY A;  2HHM A;  1KA0 A;  1NUX A;  4GWU A;  2VT5 A;  4GX4 A;  1FBF A;  4HXV A;  3KBZ A;  1IMD A;  2WBD A;  3D1R A;  1NI9 A;  2FIX A;  3QMF A;  3IFC A;  5LDZ A;  5DW8 A;  2Y5L A;  2P3V A;  4PTK A;  3LV0 A;  5EQ8 A;  2QVR A;  5ET8 A;  1LBX A;  4FBP A;  2R8T A;  3KC0 A;  5EQA A;  1FPL A;  1JP4 A;  1KA1 A;  4GWX A;  3BIG A;  1QGX A;  3LUZ A;  1YZ0 A;  1NV5 A;  1FJ6 A;  1VDW A;  2FHY A;  4QXD A;  2QVU A;  1FBP A;  2QFL A;  2JJK A;  5EYG A;  3ROJ A;  2PCR A;  1LBZ A;  1Q9D A;  1NV6 A;  1INP A;  4GBW A;  1LBV A;  1FPK A;  2Y5K A;  1FPF A;  4HE0 A;  5ET5 A;  1FBC A;  4HE2 A;  1NV7 A;  4I3Y A;  5J16 A;  2FBP A;  4GWZ A;  3RPL B;  1DCU A;  1NV4 A;  2FIE A;  2Q8M A;  1IMC A;  4IR8 A;  5A5L A;  4GX6 A;  1RDX A;  1FPE A;  5ET6 A;  1NV2 A;  1NUZ A;  1LBW A;  2QVV A;  2CZK A;  4I3E A;  5IZ3 B;  4GWY A;  5IZ1 A;  4GWS A;  1IMA A;  3KC1 A;  1FPD A;  1NV1 A;  1D9Q A;  1SPI A;  3FBP A;  1EYJ A;  1FBD A;  5FBP A;  1K9Z A;  4N81 A;  1IMB A;  2F3D A;  2CZI A;  4HE1 A;  4MJO A;  5F24 A;  1KZ8 A;  4G61 A;  1AWB A;  1FPB A;  5T3J A;  1DK4 A; 
#chains in the Genus database with same CATH topology
 1QUJ A;  3B8B A;  4LZ8 A;  3O97 A;  3T1B A;  1FQD A;  1I69 A;  3MPL A;  3RY3 A;  1A99 A;  3O66 A;  2Q89 A;  3FAS A;  4OES A;  3T0J A;  4C1U A;  1LFG A;  4BDN A;  4ZZA A;  3F11 A;  3A09 A;  5AA2 B;  2NOO A;  3EN3 A;  3FUZ A;  5I3S A;  3FVO A;  4Q5T A;  2KQZ A;  4OA4 A;  2V93 A;  1FBE A;  3CIJ A;  4PBQ A;  2O1M A;  3E3K A;  4LZ7 A;  1P1N A;  3PUV E;  4PF6 A;  2OWZ A;  1Y4C A;  1H44 A;  2QJE A;  3IOR A;  1NL5 A;  2ZMB A;  1KA0 A;  2V3T A;  4POW A;  1LB8 A;  4MCO A;  1NI9 A;  5KDT B;  3PPO A;  5I59 B;  2RCA A;  5DW8 A;  4F1U A;  3USD A;  4MAG A;  1IXC A;  1JW1 A;  1NH7 A;  2R8T A;  4K3F A;  1SI0 A;  2UVH A;  2V25 A;  1FW0 A;  4IGR A;  1BP5 A;  3O28 A;  1NV6 A;  3Q26 A;  4PE5 B;  1INP A;  1OIB A;  3U93 A;  2VD2 A;  2RF1 A;  5CBS A;  1ZKB A;  2UVI A;  4AQ4 A;  1QVS A;  4PAK A;  4PQJ A;  2NXO A;  2ZNS A;  5AA1 A;  4XKN A;  3PTY A;  3FGS A;  4I62 A;  2B3F A;  4GD5 A;  4ZEK A;  1NKX A;  4XKQ A;  1B3F A;  1MQG A;  2F7C A;  1FPB A;  4N17 A;  4O3C A;  3S4U A;  5KDT A;  1P1U A;  1UIU A;  1B5J A;  2WYK A;  3T9H B;  3S9M C;  2Z23 A;  1D3K A;  1S9T A;  1VE4 A;  3CRB A;  1N76 A;  3B6T A;  3IJO B;  4NF6 A;  4GRK A;  4RYA A;  2F34 A;  3RT6 B;  4BDR A;  3C4M A;  2B4M A;  3N6U A;  1EZ9 A;  3CR9 A;  4JVI A;  4MEV A;  1IME A;  1FQB A;  4MLQ A;  3PD9 A;  4NF4 A;  2KR0 A;  4IO5 A;  4ELR A;  2F6G A;  1DOT A;  1SW4 A;  4ESX A;  2P1S A;  3SEY A;  2FIX A;  4LP2 B;  4TOZ A;  2XWK A;  1LAF E;  1ZBM A;  1ZIU A;  4MMP A;  4PFB A;  4XTC Q;  3KN3 A;  2DWI A;  4ZEI A;  5K2X A;  1EU8 A;  1SW1 A;  4RPO A;  3LSL A;  2THI A;  1P1W A;  4XKR A;  4PFW A;  3UIF A;  1SI1 A;  2QS1 A;  2FHY A;  1JVY A;  4KHZ E;  3D4G A;  3MBP A;  1II5 A;  3PMV A;  4GBW A;  4JSO A;  1ELJ A;  2DP8 A;  5ET5 A;  4MBP A;  4GWZ A;  4IY6 A;  1FQF A;  3VFJ A;  2B3B A;  4G68 A;  4IO6 A;  5ET6 A;  1Q1K A;  1A40 A;  5H8N B;  1MXV A;  4F39 A;  3CFL A;  1B0H A;  2DWH A;  4X1D A;  3DLN A;  1D9Q A;  3I5O A;  4G8H A;  3OXN A;  1N3W A;  1B4Z A;  4ZEC A;  1K9Z A;  3IOT A;  3OEM A;  4G61 A;  1B9J A;  3EQ1 A;  4OER A;  3M8U A;  3T96 B;  3TFL A;  3I6V A;  4GQO A;  1A55 A;  4YMB A;  2UVJ A;  4IO3 A;  4XEQ A;  1B7Z A;  3M3K A;  1DBZ A;  2D3I A;  3EKI A;  2OX3 A;  5ISU A;  5L9M A;  5H8F A;  2O7U A;  1GGG A;  4U22 A;  2P2A A;  2F3B A;  3SES A;  3EHU A;  2NVU B;  3K2D A;  5EHM A;  2XXV A;  2XWV A;  1TFA A;  4G8N A;  5AA4 A;  2RKM A;  5FHM A;  4HXV A;  4OYV A;  3FXB A;  3GBB A;  2E1S A;  3QUJ A;  4XXU A;  4PC9 A;  5A5X A;  3C33 A;  2NWJ A;  2WKY A;  1FPL A;  4N13 A;  5ICT A;  3H6U A;  1NV5 A;  2QFL A;  4C1T A;  5L8D A;  4GXA A;  3S9L C;  1B40 A;  1FPK A;  1JVX A;  4X9T A;  3ILT B;  1NV7 A;  4BDO A;  1B46 A;  1IXI A;  4DI4 B;  3HST A;  2FIE A;  3ISP A;  2IEE A;  4NHB A;  4RK2 A;  2OCU A;  4ECF A;  2Y7W A;  1TFD A;  2AYS A;  3N26 A;  1POT A;  2B65 A;  1FTO A;  3LSF B;  3TUS A;  3G3I A;  1FBD A;  1D9Y A;  1HSJ A;  3O6I A;  4O3A A;  4ZED A;  4YKI A;  2GRV A;  5I56 B;  3ECR A;  3FV2 A;  4KPT A;  1N04 A;  2A5S A;  2B4L A;  3KJ7 A;  3RT8 A;  4U2R A;  2O51 A;  2HQ0 A;  3HV1 A;  3LUY A;  5I84 A;  1R1N A;  1ZTY A;  4PAF A;  4DLD A;  3BKI B;  4YZZ A;  1USY H;  3TCF A;  2DQV A;  1QUL A;  4H0W A;  3A29 A;  3E4R A;  3K6U A;  4ESW A;  4R75 A;  4OFO A;  1AL3 A;  4DI3 D;  3KOT A;  1B51 A;  4NAP A;  2REG A;  2DS9 A;  2BJJ X;  3C35 A;  1IMD A;  4XFE A;  3B7D A;  3TMG A;  3ONM A;  1BLF A;  2P3V A;  2QS2 A;  4F22 A;  5CMB A;  2CZL A;  5JK4 A;  3U92 A;  4GWX A;  4H5G A;  1FJ6 A;  3MWB A;  2Y7K A;  3ROJ A;  2Z8F A;  4PFU A;  4P1E A;  3EHS A;  2Y5K A;  3OSQ A;  3FAT A;  1ANF A;  5I7I A;  3MJN A;  4GLI A;  4GX6 A;  4N6P A;  5H8Q B;  2I6E A;  1MQJ A;  3KGC A;  4LZ5 A;  2FNC A;  2OBG A;  4GWS A;  4NWD A;  5TPA A;  3NOH A;  4BDQ A;  4QRZ A;  4G68 C;  5IAI A;  2UYE A;  1IMB A;  4YB6 A;  2BJI A;  3OSR A;  2H5Y A;  4NG7 A;  4U1O A;  3RPL A;  4OVP A;  1PB8 A;  1MXX A;  2VHA A;  3C34 A;  2FVZ A;  1Z7M E;  2HXW A;  4O7I A;  3CSG A;  3JYR A;  3HFU A;  3MQ9 A;  5IKB A;  3PU5 A;  4YKP A;  3H6W A;  2DWJ A;  1JNF A;  1I6Q A;  2ZYN A;  1NNT A;  4PDD A;  1BTJ A;  1JET A;  2HCA A;  5EQ9 A;  2V84 A;  4F2O A;  4P0G A;  2YJP A;  4JWY A;  4R2B A;  5KCJ A;  2Z8E A;  3PMX A;  5HM4 B;  1IMF A;  4I1D A;  4E0X A;  5H8Q A;  4IGT A;  5H8H A;  4R6Y A;  1IXG A;  2DE2 A;  4F3G A;  3TYH A;  2UYF A;  4F31 B;  4PP0 A;  1SW5 A;  2I58 A;  4POX A;  3LC8 A;  4GIZ A;  4EF1 A;  2DWA A;  1LFH A;  3P7I A;  3U65 A;  4H5F A;  4OZ9 A;  2PT2 A;  4NX1 A;  4ONY A;  2PVU A;  3N6T A;  2Y7I A;  1YTV A;  1EZO A;  2H25 A;  1FTJ A;  1OVB A;  3WAF A;  2MKZ A;  3TQW A;  3PD8 A;  2UVG A;  2QVV A;  2CZK A;  1MY4 A;  2R6G E;  4IY5 A;  4OFL A;  2ABH A;  4WED A;  1B3L A;  1NV1 A;  1IUD A;  4FAT A;  4DZ1 A;  4MLV A;  5F24 A;  1M5C A;  1R9L A;  3IR1 A;  4U21 A;  4GL0 A;  1S50 A;  2ZNT A;  3A3C A;  3V89 B;  1B7H A;  4GWW A;  1FPJ A;  3E79 A;  1G0H A;  5EQ7 A;  2OPD A;  1LAX A;  1FJ9 A;  1Y3Q A;  2Q74 A;  4GX3 A;  3UN6 A;  1K9Y A;  2VGQ A;  4OMB A;  4G77 A;  4I8C A;  3BFT A;  3RUM A;  2PYY A;  3FJG A;  5AA3 A;  4PDH A;  4JDF A;  2F8D A;  3D4C A;  3DP4 A;  5JEI A;  1JEV A;  3DP8 A;  4QFK A;  3FJ7 A;  3FV1 A;  3IOU A;  1JW5 A;  2XXP A;  2Y7P A;  2V3U A;  1QUI A;  3O9P A;  3D1R A;  1MH3 A;  1LAH E;  4MIJ A;  2I0B A;  4FBP A;  1GTK A;  3VLU A;  5DVF A;  3V8X B;  2V4C A;  2F7A A;  4WXJ A;  4X04 A;  2H9B A;  4JWO A;  1NFT A;  2REJ A;  1H43 A;  1Q9D A;  2XXQ A;  1F9B A;  4PFI A;  3S9E A;  3MYU A;  4R2F A;  1MQD A;  1CE2 A;  4OTE A;  1JW4 A;  2ZYM A;  2DVZ A;  2XXT A;  4KCD A;  4PFR A;  4ZZE A;  2XXI A;  5CMM A;  1ZMG A;  4NF6 B;  5IZ1 A;  2XXH A;  1FPD A;  2Q88 A;  4ZS9 A;  2WYP A;  4PBH A;  5AE4 A;  1LBB A;  4LQ2 A;  4EUO A;  2DE3 A;  2G93 A;  4QFL A;  3K0V A;  1DK4 A;  1YYZ A;  2O68 A;  2L5V A;  3TQL A;  1IIT A;  4O8M A;  4PGP A;  3RN8 A;  2O69 A;  1LBY A;  1IIW A;  4FIM A;  4NF4 B;  3TTR A;  5J1D A;  4R6K A;  2GQ1 A;  4GFR A;  2XXU A;  3TAJ A;  3H06 B;  3CI8 A;  2X7P A;  4H46 A;  3V83 A;  4HCW A;  1QKA A;  5B70 A;  4OEV A;  2PFY A;  4DIG A;  1MM6 A;  1I6B A;  3RNN A;  3HPI A;  2HHM A;  1FQE A;  2HZK A;  2OK2 A;  4QFP A;  1UTH B;  3QSL A;  3TPA A;  4LQ5 A;  1PEB A;  1MH4 A;  4PTK A;  4G68 B;  3CHG A;  4FED A;  3TKD A;  2CEX A;  3KC0 A;  1QUK A;  4I9D A;  1MY0 A;  1USY E;  3LUZ A;  1SDX A;  3O29 A;  4U1Z A;  1DSN A;  3E78 A;  3SEU A;  3FXQ A;  1B1X A;  5J16 A;  2I4B A;  4N15 A;  3I3V A;  2Q9T A;  1ZJL A;  3RPW A;  2DXY A;  3S9N C;  2H4I A;  2OWT A;  3M3L A;  2Z22 A;  3K1P A;  1N7X A;  1WDN A;  3B50 A;  4DXU A;  3UK4 A;  1MPB A;  5H8F B;  3RTW B;  2F3D A;  4HE1 A;  4O7M A;  2RIN A;  1UTH A;  4X8R A;  3LSW A;  4F18 A;  1NUY A;  4Q8R A;  3L6G A;  5AA4 B;  4KI0 E;  4FEB A;  5ICQ A;  1TWY A;  3B6Q A;  2QL3 A;  3RGY A;  1T0K A;  4H8J A;  4AS5 A;  5CRY A;  1B3H A;  4JBZ A;  3VV5 A;  1SYH A;  5A5X B;  4F3P A;  1FBH A;  2QS3 A;  3CVG A;  5HBC A;  1CNQ A;  3OEK A;  4P0I A;  4I40 A;  1XI6 A;  1YPN A;  3G3K A;  1FPG A;  5K2Y A;  3QXM A;  5I5P A;  4NWC A;  3W9W A;  3N5L A;  3QAX A;  1XC1 A;  2OPE A;  4F3B A;  3OEL A;  1I6A A;  3MAM A;  3IFC A;  3H03 A;  4QFN A;  4XIG Q;  1QKB A;  1LAG E;  1JP4 A;  3U8Q A;  5JTY A;  1N7W A;  2XXY A;  3E9X A;  4TLL B;  4EXK A;  2AL5 A;  1NMU A;  3GZG A;  4EDP A;  2F5X A;  4ISU A;  4RXL A;  3ZKL A;  4OAN A;  4KR5 A;  4N8Y A;  4OVQ A;  4N91 A;  4DE8 A;  4HTG A;  2OWS A;  2YPN A;  4AB6 A;  4I3E A;  2D5W A;  4NF8 B;  1B05 A;  4WEP A;  3IO4 A;  5FBP A;  5CC2 A;  1B52 A;  2ZZX A;  3FVG A;  1B1H A;  4C0R A;  2UXA A;  2IA4 A;  2FA7 A;  2HFB A;  3R7X A;  1N84 A;  2PFZ A;  3VVE A;  1PB7 A;  2XX9 A;  5EYF A;  2HAV A;  1FPI A;  3UOR A;  4N6K A;  4IO2 A;  3TDJ A;  4AS4 A;  4KFQ A;  3L6H A;  1SQY A;  4F2Q A;  3IB2 A;  4PE3 A;  5I2N A;  1B32 A;  4ZEF A;  2O7I A;  3TEL A;  1FRP A;  5AA2 D;  3UGW A;  3VLV A;  5CI5 A;  3TCH A;  3IL1 B;  4OHN A;  2P3N A;  5F1Q A;  5BWJ A;  4G4P A;  3HN0 A;  4O94 A;  3S2V A;  5ET7 A;  2P0S A;  1LB9 A;  1HSE A;  4N6D A;  3BFU A;  4R72 A;  4R73 A;  4HS7 A;  3OO8 A;  3K02 A;  1NUX A;  4ZEB A;  4PFY A;  5LOM A;  3ODB A;  3KBZ A;  2WBD A;  3TTL A;  4NF8 A;  2Y84 A;  1EZP A;  5B7D A;  2Y5L A;  1B5H A;  2H98 A;  4YB5 A;  2M8C A;  2Q2C A;  1S7Y A;  1SD3 A;  2NUV A;  4PET A;  5L9O A;  1EH3 A;  3PPQ A;  1IXH A;  1KA1 A;  2A5T B;  3BIG A;  3K00 A;  2F36 A;  3TTK A;  3JV9 A;  5TPA B;  1VDW A;  3G7W A;  2JJK A;  2PCR A;  1LBZ A;  4MHF A;  3OO6 A;  3KSX A;  1LBV A;  5IM2 A;  1N0T A;  2X7Q A;  4QSD A;  2FBP A;  4GWO A;  3RPL B;  3O2A A;  4DCY A;  1IQ7 A;  1N3X A;  1UQW A;  2R9J A;  1URD A;  4P1L A;  2I4C A;  3BBR A;  4ELO A;  1H3D A;  1L5T A;  2ALU A;  1XS5 A;  3KZG A;  1TT1 A;  2ZZW A;  5TU0 A;  3QYT A;  1D9V A;  1LST A;  2DOJ A;  4Z7E A;  1FQC A;  1MS7 A;  5KCJ B;  4MNI A;  3O6G A;  3C9H A;  5H8H B;  2CZH A;  1P1Q A;  2A5T A;  4OET A;  4XF5 A;  3RTF B;  3WAE A;  5TP9 A;  1OQH A;  1MY3 A;  3FXU A;  5IZ3 A;  3O6H A;  3PUY E;  1NV0 A;  1NV3 A;  3KN7 A;  4GVO A;  3ZS6 A;  4NMY A;  5IZZ A;  4ZDM A;  3VXB A;  1LLS A;  1MM7 A;  1XVX A;  4OEN A;  1LBC A;  1Y3P A;  1VSO A;  1YCJ A;  3K1M A;  3KN8 A;  1PDA A;  1JQF A;  4OWD A;  4GWU A;  2VT5 A;  4BDM A;  3MVX A;  5H8S A;  1QJM A;  2VD3 A;  4P8B A;  5LDZ A;  4LN5 A;  3MVW A;  4QFO A;  3PPR A;  3LV0 A;  4R9F A;  1A7L A;  5EQA A;  5FTH A;  1Y4T A;  2VPO A;  1QGX A;  3C32 A;  1UIV A;  4UAC A;  1VFD A;  2ZZV A;  3E13 X;  4QXD A;  2DXR A;  3LBS A;  1JEU A;  2DYX A;  4IO4 A;  2DE4 A;  4N4U A;  4N8G A;  4RPN A;  2F97 A;  4YKK A;  3PUX E;  3DM0 A;  2Q8M A;  4IR8 A;  1HSL A;  4FJP A;  1RDX A;  2I48 A;  1NV2 A;  3CSB A;  1Y1Z A;  4Q30 B;  1P1O A;  1SW2 A;  4U4X A;  5DEX B;  3FBP A;  1EYJ A;  2XXK A;  1B3G A;  2ZNU A;  5DVI A;  5CM6 A;  1M5B A;  1QW0 A;  3ZSF A;  1G0I A;  3IO6 A;  1KWH A;  2D21 A;  1VR5 A;  3T93 B;  3R26 A;  3OEN A;  4PAI A;  1WOD A;  3EF7 A;  3KEI A;  3QIM A;  3U1O A;  4JSD A;  2PT1 A;  2CEY A;  1A8F A;  3VVF A;  5EYH A;  3PPP A;  3G3H A;  1MXY A;  1FTA A;  5BUU A;  4NF5 A;  3G3G A;  4RJZ A;  4YAH X;  1A54 A;  2WX9 A;  4KYE A;  4M4G A;  1RYO A;  4ELP A;  5DEX A;  1H76 A;  3T66 A;  1ZU0 A;  3H6T A;  3TTN A;  5EQ8 A;  3FIR A;  4E0W A;  4MF3 A;  3PGF A;  4DXC A;  3G3F A;  4KQP A;  4UAB A;  1P99 A;  1MQH A;  1Y1M A;  2F78 A;  2XX7 A;  4NED A;  2ONS A;  3OO9 A;  1ATG A;  1IEJ A;  3CFZ A;  1FPF A;  4MH5 A;  1DPP A;  4OVR A;  4XKP A;  5LTC A;  1AIV A;  1AOV A;  3T9X B;  3MP8 A;  2XA5 A;  5FHO A;  2AL4 A;  4BDL A;  3IAZ A;  5I2K B;  3GXA A;  3SKP A;  1PBQ A;  4ND9 A;  1AH5 A;  3HHF A;  4N81 A;  4MJO A;  3MST A;  3VE1 B;  1KZ8 A;  4QHQ A;  1AWB A;  4IB2 A;  2HPG A;  4BLA A;  4LUB A;  3T9U A;  1EYK A;  1FTL A;  2G29 A;  3HCQ A;  2HAU A;  4YIC A;  1RDZ A;  3A3U A;  4KXP A;  3KJT A;  3KBR A;  1UTB A;  4M1V A;  4N07 A;  3TTM A;  4P11 A;  1DPE A;  3DEL B;  2FYI A;  3R6U A;  4WKM A;  5DYH A;  5ESY A;  3CFX A;  4QSC A;  1NNK A;  3CG1 A;  1NUW A;  1BK4 A;  1R9Q A;  2ZYO A;  5I2K A;  4H1X A;  3QK6 A;  3THI A;  1MPC A;  4LON B;  1J1N A;  2F7B A;  3GLB A;  2QVR A;  4DXB A;  3EPE A;  5AA2 A;  4HW8 A;  3IOV A;  4GL8 A;  1R6Z A;  3RLF E;  5F7V A;  3SDF A;  4RNS A;  4R74 A;  2OJT A;  5M2V A;  3FVK A;  1CB6 A;  4PGN A;  2XWI A;  1LCT A;  3FVN A;  4JWX A;  3RQT A;  5I59 A;  1IMC A;  5A5L A;  3ILU B;  2LAO A;  3KOS A;  4RA1 A;  2HEU A;  1US4 A;  1NNP A;  1B7U A;  3DP6 A;  4F29 A;  4F1Y A;  4JXI A;  1OLC A;  3H7M A;  3K4U A;  3U94 A;  3T22 A;  3H6V A;  3UA8 A;  4EQB A;  4YMA A;  1OMP A;  1FBG A;  4OEU A;  4OVJ A;  3Q29 A;  2VP1 A;  1B3E A;  2GHB A;  2GHA A;  2Q8J A;  3VLW A;  2RCB A;  3MVY A;  3T9V A;  4RK9 A;  1FSA A;  2XD3 A;  2XHD A;  4MNP A;  2H99 A;  2VOZ A;  4NE4 A;  5JTY B;  1LEV A;  5FHN A;  1GV8 A;  1GVC A;  5I57 B;  3EHT A;  3MVZ A;  5FTI A;  3SER A;  3H3G A;  3QUF A;  4OVT A;  1B6H A;  5KZT A;  1FBF A;  4QSE A;  2F6P A;  2DVC A;  3GBA A;  3MP6 A;  2RC9 A;  1LBX A;  1WVJ A;  3C31 A;  3OMB A;  3TCG A;  4FOR A;  4MFI A;  3VDF A;  1DTG A;  2QVU A;  3PMW A;  1US5 A;  4EQ9 A;  4P3L A;  4I3Y A;  4TLM B;  1FCK A;  2QMW A;  1DCU A;  4OXV A;  4P9K A;  1OVT A;  3MPK A;  4R6H A;  1MDQ A;  5I2N B;  4EXL A;  3PV0 E;  3IB1 A;  2E0S A;  4PFT A;  4KD5 A;  5I57 A;  1IMA A;  2AIX A;  3ZKK A;  3PPN A;  2QSX A;  5DTB A;  3M3F A;  3IJX B;  5I58 B;  4H65 A;  4AB5 A;  5EHS A;  2HZL A;  3FZV A;  3LR1 A;  2F35 A;  5L9S A;  4GBV A;  4L17 A;  4LAT A;  2XXX A;  3HO7 A;  1H45 A;  4IO7 A;  1Z7N E;  5H8N A;  4NF0 A;  3BIH A;  3TEP A;  4Q0C A;  4H6D A;  2PMS A;  3UP9 A;  2R71 A;  4G2Z A;  3U72 A;  1A8E A;  5ELV A;  3TZA A;  3N94 A;  1AMF A;  2XXR A;  1Y3N A;  3W9V A;  4F19 A;  3VXC A;  3K6W A;  4H45 A;  1M5F A;  2PX1 A;  4RY1 A;  1EYI A;  1RDY A;  2XXW A;  5DT6 A;  4GOT A;  2V3Q A;  4GX4 A;  3AXF A;  1FTM A;  4NGU A;  1RYX A;  4TQU Q;  5CMK A;  3QMF A;  2CMO A;  4LA9 A;  2I3V A;  5I58 A;  3MW0 A;  3B6W A;  1B5I A;  2O6A A;  1MDP 1;  1O7T A;  1URS A;  3PUW E;  2QMX A;  1YZ0 A;  2X26 A;  4ELQ A;  4YB7 A;  4U23 A;  2Z8D A;  2PBW A;  1XT8 A;  2Q2A A;  1M5E A;  4HE0 A;  5HPQ A;  4MNC A;  1O64 A;  4GF8 A;  4YKJ A;  1B2H A;  1NH8 A;  1LGB C;  3K6X A;  5CBR A;  5TP9 B;  4OQO A;  2XWO A;  5IZ3 B;  5CMC A;  4F3S A;  3IOW A;  1OLA A;  4H8I A;  4P56 A;  2I49 A;  4MX6 A;  4EQ7 A;  5T3J A;  2YLN A;  3SEX A;  4ZE8 A;  4EF2 A;  4JB7 A;  3OD7 A;  2O1L A;  4X1B A;  2ONK E;  3IFA A;  1FTK A;  3W15 C;  2W7Y A;  3FJM A;  3K1N A;  3JZJ A;  1SBP A;  1SVX B;  2WEF A;  1B58 A;  5ITO A;  3MC2 A;  2I0C A;  2HXR A;  5I56 A;  4H67 A;  4KYS A;  2QS4 A;  1D4N A;  1URG A;  1LFI A;  3G3J A;  1B4H A;  4OVS A;  3K01 A;  2GH9 A;  4JVD A;  3CG3 A;  1IZ1 A;  1SYI A;  4FAJ A;  1BKA A;  4HCY A;  3MUQ A;  3GYY A;  3Q25 A;  1MXZ A;  2QPQ A;  4DDD A;  4P47 A;  2ZXT A;  1XOC A;  2RC7 A;  1MPD A;  1MG1 A;  3SEV A;  1VFE A;  4DCX A;  2ESN A;  3MP1 A;  1Y9U A;  3OO7 A;  1MRP A;  4FEC A;  3TOD A;  1PBP A;  3PUZ E;  1PC3 A;  1B0L A;  1NV4 A;  1RKM A;  4GXS B;  1FPE A;  1MQI A;  4FE8 A;  1NUZ A;  4O3B A;  2RC8 A;  2VPN A;  4NTL A;  5DVJ A;  1SPI A;  1YAE A;  3Q27 A;  4ZE9 A;  3FD3 A;  3V5A A;  4F1V A;  1M5D A;  2CZI A;  2O84 X;  1NNF A;  4NF5 B;  3MZ1 A;  1MXU A;  4KYD A;  3KG2 A;  3SZP A;  3SEW A;  1XVY A;  3MZ9 A;  1OQG A;  2XX8 A;  4Z0I A;  4QBA A;  3HHG A;  2GFE A;  1Q35 A;  2XD2 A;  4NN3 A;  4G8M A;  4THI A;  5IGA A;  3KFM A;  1YXI A;  1MY2 A;  3IX1 A;  3IB0 A;  3IK6 B;  3KSJ A;  5ITP A;  2WBB A;  2DDK A;  3C36 A;  3RYD A;  4LVQ A;  3K6V A;  2ANJ A;  2I3W A;  3H4Z A;  3Q28 A;  4X48 A;  1MXW A;  2DSF A;  4JVC A;  2OLB A;  1PB9 A;  4KCC A;  1POY 1;  3OOA A;  5ET8 A;  4NQ8 A;  1MY1 A;  2QRY A;  3SET A;  2ZYK A;  1TXF A;  3MZB A;  1ZLQ A;  1FBP A;  3FXR A;  4OFJ A;  2ONR A;  5EYG A;  4R9G A;  4QF9 A;  2Y7R A;  1GR2 A;  3VVD A;  4UA8 A;  1FBC A;  4HE2 A;  1DTZ A;  1DMB A;  4PF8 A;  4U4S A;  1O63 A;  1LBW A;  1UTB B;  1LCF A;  1XHY A;  1BIY A;  4GWY A;  2OZZ A;  2KLF A;  3LSX A;  3KC1 A;  4YU0 A;  4PCD A;  1FQA A;  1Y20 A; 
#chains in the Genus database with same CATH homology
 2PFZ A;  2BJI A;  1FBG A;  3B8B A;  4NG7 A;  3RPL A;  1FPI A;  4OVP A;  4N6K A;  4AS4 A;  3T1B A;  4PE3 A;  2FVZ A;  4O7I A;  1FRP A;  3HFU A;  3T0J A;  2P3N A;  4PDD A;  1FSA A;  5EQ9 A;  4MNP A;  5I3S A;  4O94 A;  2KQZ A;  4OA4 A;  1FBE A;  4PBQ A;  1LEV A;  5ET7 A;  4PF6 A;  4N6D A;  2OWZ A;  1IMF A;  1KA0 A;  1NUX A;  4OVT A;  2DE2 A;  4MCO A;  1FBF A;  3KBZ A;  2WBD A;  1NI9 A;  5DW8 A;  2Y5L A;  4F1U A;  4MAG A;  1LBX A;  4PET A;  2R8T A;  1KA1 A;  3BIG A;  3U65 A;  1VDW A;  2QVU A;  2JJK A;  2PCR A;  4NX1 A;  1LBZ A;  4MHF A;  1NV6 A;  1INP A;  1LBV A;  4P3L A;  5IM2 A;  4I3Y A;  2FBP A;  3RPL B;  1DCU A;  4P9K A;  2MKZ A;  4PAK A;  2QVV A;  2CZK A;  4P1L A;  1IMA A;  3PTY A;  1NV1 A;  2ZZW A;  5F24 A;  1FPB A;  2HZL A;  4N17 A;  2WYK A;  4MNI A;  4GBV A;  4GWW A;  1FPJ A;  2CZH A;  3E79 A;  1G0H A;  4XF5 A;  4NF0 A;  3BIH A;  5EQ7 A;  5IZ3 A;  1FJ9 A;  2Q74 A;  4GX3 A;  1K9Y A;  1NV0 A;  1NV3 A;  5IZZ A;  2B4M A;  4PDH A;  4JVI A;  4MEV A;  3W9V A;  4F19 A;  1IME A;  4H45 A;  2KR0 A;  1EYI A;  1RDY A;  4GWU A;  2VT5 A;  2V3Q A;  4GX4 A;  4NGU A;  3D1R A;  2FIX A;  3QMF A;  2XWK A;  4P8B A;  4MMP A;  5LDZ A;  4LN5 A;  4PFB A;  4MIJ A;  3LV0 A;  4FBP A;  5EQA A;  2VPO A;  1QGX A;  1YZ0 A;  2V4C A;  2ZZV A;  4X04 A;  2FHY A;  4QXD A;  1Q9D A;  2DE4 A;  4N4U A;  4GBW A;  4N8G A;  5ET5 A;  4HE0 A;  4PFI A;  4MNC A;  4GWZ A;  3MYU A;  2Q8M A;  4IR8 A;  1RDX A;  5ET6 A;  1NV2 A;  2DVZ A;  4PFR A;  2XWO A;  5IZ3 B;  5IZ1 A;  1FPD A;  2WYP A;  1D9Q A;  4PBH A;  4P56 A;  3FBP A;  1EYJ A;  2XXK A;  4MX6 A;  1K9Z A;  2DE3 A;  5CM6 A;  4G61 A;  5T3J A;  1DK4 A;  1YYZ A;  2L5V A;  1G0I A;  4O8M A;  4PGP A;  1LBY A;  4XEQ A;  5J1D A;  3IFA A;  1DBZ A;  2GQ1 A;  4PAI A;  2WEF A;  3EKI A;  2OX3 A;  2CEY A;  5EYH A;  4H46 A;  2F3B A;  2HXR A;  4HCW A;  1FTA A;  2PFY A;  2XWV A;  2HHM A;  4OVS A;  2WX9 A;  2HZK A;  4JVD A;  4HXV A;  3FXB A;  4PTK A;  5EQ8 A;  4HCY A;  4PC9 A;  3CHG A;  3GYY A;  2CEX A;  3KC0 A;  2QPQ A;  1FPL A;  4P47 A;  3LUZ A;  1NV5 A;  4UAB A;  2QFL A;  3E78 A;  1FPK A;  4X9T A;  1FPF A;  1NV7 A;  5J16 A;  4N15 A;  4OVR A;  5LTC A;  4DI4 B;  1NV4 A;  2FIE A;  2Q9T A;  3ISP A;  4NHB A;  2XA5 A;  1FPE A;  1NUZ A;  2VPN A;  1SPI A;  3B50 A;  1FBD A;  4N81 A;  4F1V A;  2F3D A;  4HE1 A;  2CZI A;  4MJO A;  3MST A;  4O7M A;  1KZ8 A;  1AWB A;  2HPG A;  4X8R A;  1EYK A;  2B4L A;  3SZP A;  4F18 A;  1NUY A;  4YIC A;  1RDZ A;  4KXP A;  4M1V A;  4QBA A;  4PAF A;  4AS5 A;  4YZZ A;  4NN3 A;  1FBH A;  5IGA A;  1YXI A;  1CNQ A;  2WBB A;  2DDK A;  3A29 A;  3RYD A;  5ESY A;  4I40 A;  1XI6 A;  1FPG A;  4DI3 D;  4NAP A;  1NUW A;  1BK4 A;  4JVC A;  5I5P A;  3W9W A;  1IMD A;  4XFE A;  3IFC A;  2P3V A;  2QVR A;  4NQ8 A;  5ET8 A;  5JK4 A;  1JP4 A;  4GWX A;  1FJ6 A;  1FBP A;  5EYG A;  3ROJ A;  4P1E A;  4PGN A;  2Y5K A;  1FBC A;  4HE2 A;  2F5X A;  2XWI A;  5I7I A;  1IMC A;  5A5L A;  4OAN A;  4GX6 A;  4N8Y A;  4PF8 A;  4OVQ A;  4N91 A;  1LBW A;  4I3E A;  4GWY A;  4GWS A;  3KC1 A;  3NOH A;  4PCD A;  5FBP A;  1IMB A;  2ZZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...