4N81A

Another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
253
Chain Sequence
RSAYEDDIRLAHRLADVAADIIRPFFRAPLTIDLKADHSPVTKADRGAEQAMRAILEQERPEDGIFGESRPDARRLWVLDPIDGTRAFIGGRASFGTLIALVEDGRPVLGIINQPIHQERWVGVKDLPTSFNGEVIHTRSCPALDHALLATTSPWLFEKEGEVHFDKIRLKCRDTLLGGDCYNYGLLSLGHCDLVVEQGLKFYDFAALVPIVEGAGGIMRDWQNRPLNKNSVGEVIAAGDHHLIEPALSAMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
publication title Crystal structure of cbbF from Zymomonas mobilis and its functional implication
pubmed doi rcsb
source organism Zymomonas mobilis
total genus 87
structure length 253
sequence length 257
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4n81A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4n81A02
5EQAA 4I40A 2P3NA 3RPLB 1FPKA 2FBPA 4G61A 4O7IA 2BJIA 1KZ8A 2Q74A 1FJ6A 2QFLA 3KC0A 1NV0A 2CZHA 5EQ8A 1LBZA 4H45A 2CZKA 2DDKA 4GWXA 3FBPA 3LUZA 4GX3A 5T3JA 1FPFA 3LV0A 1FPEA 1YZ0A 5ESYA 1FJ9A 5ET5A 1RDXA 4HE0A 1LBXA 1XI6A 2F3BA 4KXPA 1FBFA 1EYIA 2OX3A 1NV5A 4IR8A 4GBVA 1KA1A 2WEFA 5LDZA 1IMCA 1NV6A 4I3YA 1NUWA 5A5LA 5IZ3A 1FSAA 1FBCA 1EYJA 3IFCA 5EYHA 4GWUA 2GQ1A 1LBWA 1IMFA 3T0JA 1YYZA 4GWSA 5I3SA 5F24A 1LEVA 1FPBA 1NUZA 2P3VA 1JP4A 3D1RA 5EYGA 3IFAA 1KA0A 5IZ1A 4HE2A 2QVVA 1IMAA 2WBBA 5EQ9A 1G0HA 5ET7A 4MJOA 4GX4A 1NV7A 5DW8A 4HXVA 3A29A 1FPJA 3BIHA 2Y5LA 2F3DA 2FVZA 1YXIA 1FBPA 3QMFA 5FBPA 5ET8A 1LBYA 4GWWA 5ET6A 1RDYA 1NUXA 1NV4A 1NV3A 1EYKA 2WBDA 4GWZA 4H46A 1FBHA 1NV2A 4FBPA 1FPGA 2QVUA 4N81A 3KBZA 4GWYA 1D9QA 5IZ3B 1FBGA 2HHMA 4PTKA 2FHYA 1NI9A 4GBWA 1FTAA 1G0IA 4HE1A 3RPLA 4AS4A 2FIEA 1VDWA 3KC1A 2PCRA 3ROJA 3RYDA 1IMDA 1DBZA 1FPLA 2QVRA 1DK4A 1NV1A 1BK4A 4QXDA 2JJKA 2FIXA 4I3EA 1FPIA 1NUYA 1IMEA 1DCUA 1LBVA 5EQ7A 2CZIA 1FBEA 1FBDA 1IMBA 1Q9DA 2VT5A 1K9YA 5J16A 1K9ZA 1FRPA 1SPIA 2OWZA 3B8BA 3BIGA 2Q8MA 4GX6A 1RDZA 2Y5KA 1FPDA 4AS5A 1INPA 1QGXA 2R8TA 1AWBA 1CNQA
chains in the Genus database with same CATH superfamily
5EQAA 4LN5A 4G61A 2OBGA 5IKBA 2HXWA 4GVOA 3VLUA 1NV0A 1LBZA 1FTMA 4HTGA 4YB6A 1LCFA 4KCCA 2F5XA 1SI0A 1GTKA 5AA2A 2FNCA 1POTA 2PFYA 3LUYA 1FTJA 2ZNUA 4G4PA 2B65A 2XXPA 2O69A 3IB1A 4P0IA 3RN8A 1MQIA 3EF7A 1MPDA 2B3BA 3MZ9A 1B1XA 3ZKKA 1BTJA 4ISUA 3E9XA 3EN3A 3O9PA 5B7DA 2VHAA 1FPJA 2XXWA 4OFJA 1J1NA 2Z8DA 4YAHX 1FBHA 1T0KA 3OEMA 3OSRA 4C1UA 2GHBA 1G0IA 4PE5B 4QBAA 1NV1A 3V8XB 1Y3NA 1DCUA 3SESA 4RXLA 1SD3A 1MY0A 3SEYA 1B51A 1ZU0A 2Q8MA 3PD8A 4YKJA 1DTZA 5BWJA 4N8GA 4X1DA 2A5SA 3HN0A 3MQ9A 4DCXA 4EXLA 1ZIUA 1LB8A 3OENA 2QFLA 2WYKA 1QUJA 3IK6B 4PFTA 1P1WA 4R9FA 1TFAA 5I57A 4P9KA 3PPQA 3MWBA 2NOOA 4EF1A 5AA2D 2DE4A 3TFLA 1FSAA 3KFMA 3LSXA 1MDP1 1MH3A 1IMFA 3E3KA 4KYDA 3UORA 5F24A 3CHGA 3B6TA 5F1QA 2QVVA 1M5DA 3O66A 5ET7A 2AL5A 5I84A 1URSA 4NN3A 4ZE8A 1AOVA 4Q0CA 2VP1A 2I4BA 1FPGA 1AMFA 3MW0A 4TOZA 4R6YA 1NI9A 4GBWA 3N26A 4XIGQ 3M3FA 2XXHA 3ROJA 4H5FA 4RY1A 2JJKA 5F7VA 1FTOA 4NTLA 4ZZEA 4GQOA 3O6HA 1SPIA 1OVBA 3B8BA 4PFIA 5HBCA 4EQ7A 4NWDA 2XWIA 4HCWA 1N7XA 2ABHA 3NOHA 1INPA 3MAMA 4M4GA 1EU8A 3QMFA 2HFBA 4XEQA 4UACA 2ONKE 4O7IA 4N8YA 5H8FB 1JW4A 2DVCA 4K3FA 2XA5A 4OVJA 2UXAA 3CFZA 4OERA 2CZKA 1OVTA 3CVGA 4GX3A 1NH8A 3OEKA 3HHFA 3IX1A 1IITA 3MZBA 2Q2CA 2WEFA 1LBBA 4DDDA 2PMSA 3CRBA 2D5WA 5JK4A 3EHSA 4DLDA 3U93A 3PD9A 2ZYOA 4NF4B 5I59A 4P1EA 2REGA 4UA8A 3O6IA 1MQHA 2H99A 1A7LA 4MMPA 1DPPA 5A5XB 5ICTA 3JZJA 4N07A 3MC2A 2GHAA 1NFTA 3JYRA 1NV4A 1B5JA 1QUIA 4ONYA 4XTCQ 4IB2A 3ILTB 1D9QA 1MM7A 2QSXA 1FQDA 3IOWA 3M3LA 2FIEA 1PC3A 3EQ1A 1Q35A 2QVRA 3LSLA 3Q26A 1IMEA 3KSXA 3C9HA 3CR9A 4O3BA 4ZECA 3HSTA 3MUQA 1OQGA 5K2XA 3QSLA 1YCJA 5JTYA 1QKBA 2HQ0A 4ND9A 3RT6B 5KZTA 1F9BA 2DXYA 2I48A 1Y3QA 3KOSA 3B6WA 1Y20A 3C35A 5H8NB 2B3FA 4ZE9A 1IQ7A 2NUVA 4YMBA 1B7HA 3U72A 3MYUA 4PF6A 4N6PA 3T9XB 2HEUA 5IM2A 3LV0A 4FATA 1B40A 3K1PA 3T9VA 3K1NA 1KA1A 4FE8A 1LCTA 3BFUA 3O6GA 3IFCA 1QVSA 1LBCA 3FV1A 2QRYA 3E13X 3T22A 4R9GA 2QMXA 3N6UA 5I58B 4IO4A 3B6QA 2AIXA 5B70A 4R2FA 3O29A 4GD5A 3ODBA 1EYKA 2OWTA 1IZ1A 2XXTA 3TELA 4ELPA 4YZZA 5DTBA 5DT6A 5AA1A 3E78A 2I0CA 4C0RA 4QRZA 1IXGA 1S50A 3W9VA 4OVTA 4F1YA 1FPIA 4EQ9A 5I2NB 3FJMA 4NGUA 4M1VA 4AQ4A 2V4CA 3L6HA 3D4CA 1LB9A 3CSGA 4PAFA 4FIMA 2A5TA 3GBBA 2XHDA 3T9UA 3G3FA 2Q74A 3SZPA 5TP9B 3PTYA 3RQTA 3G3JA 1YZ0A 4I1DA 4ZEBA 1H45A 5KDTB 3PPPA 3QAXA 1XS5A 1US5A 4NF5B 3PUYE 4OZ9A 5I5PA 3DLNA 1UTHB 1NMUA 1FQAA 1DMBA 1OLCA 2F34A 4OEVA 2F35A 3OXNA 2RINA 1JP4A 3A3CA 1PB9A 3TYHA 4FORA 4ZZAA 2V93A 3RY3A 4YB5A 5DVFA 4EF2A 2HXRA 1PBPA 4GF8A 1SBPA 5AA2B 3CFLA 4N81A 1HSEA 1Y1ZA 3KBZA 1B3HA 4MIJA 4O3AA 3RPLA 4DXCA 3S9NC 3CG1A 4PP0A 2PCRA 1B6HA 1LGBC 4N6KA 4ZEKA 4QXDA 4JVCA 5H8HB 3QK6A 2XXXA 4OWDA 1LBVA 2PT1A 4P11A 4QSCA 1AIVA 1SDXA 3W9WA 2P1SA 4EXKA 3MVYA 4GX6A 4NE4A 5CMBA 2OPEA 1AH5A 3PUXE 4OA4A 3R7XA 2O7IA 4PF8A 1MPCA 1WVJA 3S9LC 1RYOA 1UIVA 2ONSA 4F29A 1UIUA 3H6TA 5ET5A 1M5FA 3KGCA 1XI6A 4BDRA 2OLBA 1NV5A 1NL5A 1EZ9A 2DE2A 4H1XA 1B7ZA 2RF1A 1FCKA 4F2OA 5I56A 1TXFA 1B58A 2F7AA 4OFLA 3SEVA 3PUWE 3HO7A 5EHSA 3G3GA 4H0WA 1IXIA 4RNSA 3KEIA 3C34A 3GLBA 3RTWB 4LONB 2WBBA 1PEBA 4R74A 4RYAA 2B4LA 4BDQA 5I57B 4HXVA 3IORA 4R72A 2DS9A 4PDDA 3IO4A 3TQWA 1VE4A 1Z7ME 5ITOA 2PFZA 2GFEA 2YPNA 3T93B 5FTHA 2HHMA 3C33A 4PTKA 2OWSA 3LBSA 4U4SA 4ZEIA 2UYEA 3E79A 4H6DA 1GVCA 1FTLA 4PGNA 3P7IA 1FRPA 2NVUB 2OWZA 3BIGA 2KLFA 4E0WA 4KFQA 4PBQA 4DIGA 1Y4TA 4MHFA 2VD2A 2VOZA 1QW0A 4ELOA 4MX6A 1QGXA 2DQVA 4Q5TA 3FVGA 4IGTA 2FBPA 1R6ZA 1US4A 2BJJX 4JBZA 1FQEA 4MEVA 2HZLA 4O3CA 2XXVA 3MVZA 3K6UA 4PFYA 1HSLA 4MBPA 4MNIA 4LVQA 1O64A 1II5A 2Q89A 4WEDA 2RCBA 2PBWA 1B7UA 3QIMA 4ELQA 3OO6A 1P1OA 3ONMA 4R2BA 3SEUA 1B1HA 2QS1A 1QUKA 1S9TA 2QS4A 3ILUB 2ZYMA 2DYXA 1L5TA 3UN6A 2I0BA 1NKXA 3MP6A 5TPAA 3MJNA 1MXUA 3Q28A 2DWJA 3D1RA 5EYGA 2PVUA 4ZEDA 3S2VA 5DVIA 3CSBA 4MJOA 3TCFA 3A29A 3FATA 3Q25A 2FVZA 2VPNA 3KG2A 1TWYA 1N04A 1SVXB 1B32A 2Q2AA 4JSOA 2DWAA 4G68A 4HE1A 4F22A 5ISUA 2V3UA 4OEUA 1ZMGA 1MH4A 2PX1A 1PDAA 2PYYA 1NUYA 5I59B 5EQ7A 4L17A 1P1NA 2CZIA 2DWIA 3Q29A 4ZS9A 3E4RA 2V3TA 4U23A 4NF0A 4PFUA 2XXKA 2H98A 4AB5A 2O1MA 4YKKA 4LATA 5DEXA 2XXUA 3T66A 4OXVA 4N13A 3GXAA 1LFGA 4R6KA 3VVDA 5CC2A 5AA4B 4JVIA 1USYH 3K1MA 3VVEA 2BJIA 4YKIA 2CMOA 4KYSA 4EDPA 3N94A 3H6WA 4H45A 3FIRA 4NMYA 1VSOA 1GV8A 3K4UA 4XKQA 1MG1A 1SI1A 5JTYB 1NV6A 2QS2A 3RGYA 5AA3A 1FBCA 4IO6A 4H5GA 4YB7A 3IB2A 5EYHA 4OVRA 1RYXA 4JWOA 1CE2A 5I3SA 1FPBA 4U1ZA 2P3VA 5DVJA 4F3GA 5LTCA 1B4HA 1D9YA 5EHMA 1DTGA 1D3KA 2WBDA 2HAVA 1Z7NE 4P1LA 4NAPA 4OQOA 2ZZVA 1B4ZA 2UVJA 3ISPA 2E1SA 1Y9UA 4RA1A 4NF8A 1DBZA 3U94A 2XXYA 3TTLA 4GLIA 2HPGA 1SW5A 3KBRA 4IY5A 1JW1A 3USDA 4DCYA 1FBEA 3PMVA 3VLWA 3TMGA 2YJPA 4IO2A 3RNNA 5FTIA 3MVXA 4POXA 1DSNA 2Y5KA 1KWHA 4HCYA 1FTKA 4OETA 2FYIA 1ZKBA 3OO8A 1O7TA 4O7MA 1BIYA 3K6VA 3TTMA 4ZEFA 1B5HA 2Y7PA 2ALUA 4KHZE 1FQCA 1FJ6A 1B0HA 2Y7KA 3K02A 3O28A 1TFDA 4GWXA 3DP6A 3FBPA 1FPFA 2F6PA 3SEWA 1B3GA 3IAZA 2O68A 3OMBA 1RDXA 3S9MC 3TQLA 5CBSA 4X48A 1LAXA 1B52A 5H8QA 4U4XA 3I5OA 2A5TB 1NNTA 4PAIA 2Z8EA 3TTRA 3U1OA 3KJ7A 3VLVA 4OVQA 3A3UA 1NNPA 3IFAA 3IB0A 5FHMA 3OELA 5EQ9A 4H65A 3H03A 2HAUA 1POY1 4POWA 4NQ8A 2DWHA 4QFNA 4PETA 3FZVA 2HCAA 3T96B 4FBPA 4ESWA 2UVGA 1MRPA 4X04A 3O97A 1FTAA 4U21A 4OVSA 1VDWA 1JEVA 1LAGE 1AL3A 1SW2A 3RYDA 4OTEA 1DK4A 2IEEA 2X7PA 4X9TA 1BP5A 3I3VA 5L9OA 4F2QA 3IOVA 4BLAA 2VT5A 1K9YA 5J16A 2VPOA 4MNPA 4MF3A 4WXJA 3PV0E 4RK2A 1A8EA 3ZS6A 1Y3PA 4AS5A 4TLLB 3FXUA 5CMKA 4LZ7A 4U1OA 2W7YA 2R6GE 1WODA 2O51A 3RPLB 2F36A 1ZJLA 5I2KA 4FJPA 2XXRA 1IXHA 2H5YA 2ESNA 2L5VA 3IOUA 1N84A 4OENA 5CI5A 2CZHA 4P47A 2DDKA 1MXXA 1B3EA 4NF6A 3UGWA 1FJ9A 5KCJA 3V89B 1FW0A 3EPEA 4MNCA 4PQJA 4U2RA 2PT2A 3CIJA 3IR1A 1P1QA 1Y4CA 1M5BA 4OHNA 1FQFA 4PDHA 4IO7A 3BKIB 4I62A 3OOAA 1HSJA 4RPNA 4QF9A 2V3QA 1MQDA 3VE1B 5L9SA 4QSEA 3S9EA 1LAHE 2XD3A 2I58A 3KN3A 2AL4A 4KCDA 4GWWA 5ET6A 4OVPA 4H46A 4GFRA 3TTKA 3SERA 1EZPA 3T9HB 3V83A 2G29A 3FVKA 3OO9A 4KD5A 1IEJA 4JSDA 2QVUA 1NNKA 1JVXA 4JVDA 5I56B 4I8CA 4GOTA 4NWCA 2O1LA 4AS4A 2DP8A 2I3VA 4LQ2A 5CRYA 3KC1A 4HW8A 2QL3A 1NH7A 3K0VA 3QXMA 1BK4A 4PC9A 4F3SA 4QFLA 3H4ZA 2P0SA 3BFTA 4OMBA 1ZTYA 1P99A 1IMBA 2REJA 3HFUA 1MQJA 4EQBA 2QJEA 4PE3A 4BDMA 3JV9A 4IO3A 2Z22A 3K2DA 3VVFA 5IZZA 3VFJA 4H67A 4PFBA 4BDNA 2R8TA 1CNQA 2ZZXA 2ZYKA 3U92A 4OESA 2M8CA 4GWOA 4KI0E 4E0XA 4THIA 3CFXA 3SKPA 3HV1A 1FPEA 4OANA 3GYYA 4DI4B 4PGPA 3MVWA 4KYEA 2O7UA 2OK2A 1FBFA 5I2NA 4G8NA 1UTBA 2I49A 2Q88A 3TCHA 1QJMA 2B4MA 3SEXA 4RK9A 1UQWA 2UYFA 5ELVA 2VGQA 3KSJA 1ZBMA 4ECFA 1LBWA 3DM0A 4IY6A 4C1TA 4DXBA 3PPNA 1R1NA 2WX9A 3C31A 3MZ1A 2XXQA 5AE4A 4HE2A 3HHGA 1MM6A 1NNFA 1XT8A 4Q8RA 1A40A 4PBHA 1URDA 5DW8A 3VXCA 4MAGA 1YTVA 3RLFE 3FASA 1M5CA 1URGA 4ZDMA 1LFIA 3G3KA 3B7DA 3TEPA 2RC7A 4F1VA 4R73A 3W15C 3FUZA 5EYFA 4FEBA 1UTHA 2X26A 5TPAB 1JW5A 1PBQA 4FEDA 4FECA 3RUMA 2UVIA 3SETA 4F19A 3OD7A 1B5IA 3MBPA 4P8BA 3KJTA 4P3LA 4MFIA 1RDZA 2F6GA 2F7CA 3U65A 4X8RA 2DSFA 3H6UA 4EUOA 4IGRA 4G68B 5HPQA 2P3NA 4QSDA 5IAIA 1A8FA 3EHUA 5EQ8A 3PMWA 4G2ZA 3LUZA 4GRKA 3TUSA 2RC9A 4DE8A 3FGSA 5H8HA 1A55A 1LLSA 1Y1MA 2G93A 3FXRA 1I6AA 4KQPA 3H6VA 2XX7A 4LQ5A 3LR1A 2O84X 5I7IA 5IZ3A 2YLNA 2R9JA 5DEXB 1B46A 2OCUA 2GQ1A 1ELJA 2HZKA 5H8SA 5CBRA 2ZNSA 3DP8A 5K2YA 3PMXA 3TAJA 5IZ1A 1G0HA 2X7QA 1GGGA 1O63A 2Y84A 2GRVA 3M8UA 1YXIA 1B3FA 1CB6A 2XX9A 2Q9TA 3UK4A 3N6TA 4XKPA 2H25A 2I3WA 3VV5A 1FQBA 2VD3A 3V5AA 3FJGA 4P56A 1VFDA 2AYSA 1FBGA 4N6DA 2WYPA 2H4IA 2FHYA 4N17A 1GR2A 1MXVA 1MY2A 2NXOA 1IMDA 1FPLA 2P2AA 1MS7A 1PB8A 1Q1KA 4P0GA 3THIA 1VR5A 3UIFA 1TT1A 4ESXA 3PU5A 4XFEA 4YU0A 3LSWA 3ZKLA 4IO5A 1DOTA 2LAOA 2Q8JA 3TCGA 1SYHA 3T1BA 1I6BA 4GIZA 3KN7A 4MCOA 3ECRA 4NF8B 1FPKA 1QULA 3ZSFA 2R71A 3RTFB 1SW4A 3HPIA 5IGAA 3H7MA 5T3JA 5TU0A 2XD2A 5ESYA 4HE0A 3A09A 4KXPA 2V84A 4I9DA 3PUVE 5LDZA 2XWKA 4Z7EA 2Z8FA 3O2AA 2ZYNA 3TZAA 4LZ5A 2ZMBA 4BDOA 1H43A 1BKAA 3Q27A 2E0SA 2KR0A 2H9BA 4YICA 4DI3D 4F3BA 2Y7WA 1KA0A 3I6VA 5FHNA 3TPAA 1IMAA 3C36A 1JNFA 4GX4A 1NV7A 3BIHA 2Y5LA 3MPLA 4BDLA 5ET8A 1N0TA 2DE3A 1LBYA 3WAEA 1RDYA 1NUXA 1NV3A 5DYHA 1LFHA 3DELB 5H8QB 2D21A 1JQFA 2Z23A 3L6GA 1EH3A 4NG7A 1XOCA 3K01A 3QUFA 4LA9A 4NHBA 1VFEA 4NX1A 1FBDA 3CG3A 1SQYA 3LC8A 1XVXA 2XWOA 5BUUA 3R26A 3FVOA 4LZ8A 1MY4A 1S7YA 4F3PA 1PB7A 3C4MA 3HCQA 5CMMA 3QYTA 4MLQA 5CMCA 2CEXA 4G8MA 5L9MA 1N7WA 1MXYA 1P1UA 3PPRA 4XKNA 3KC0A 1B0LA 3G3IA 5CM6A 4XXUA 4R6HA 2O6AA 4N4UA 2DOJA 1H76A 1LBXA 3IJOB 4QHQA 2F3BA 4PFWA 2UVHA 4PCDA 4GBVA 1OLAA 4R75A 3VXBA 2CZLA 1NUWA 2Y7RA 3VDFA 1OQHA 1B9JA 4GWSA 3PGFA 4GL0A 4KR5A 1LEVA 1NUZA 3S4UA 5I2KB 5AA4A 1SW1A 4F39A 2DXRA 1MY3A 4F1UA 2ZXTA 4NF6B 3TTNA 4H8IA 4JXIA 5KCJB 5J1DA 1D9VA 2KQZA 3UA8A 1B2HA 4FAJA 1QKAA 1YAEA 3CI8A 3F11A 4GWYA 1B05A 1N3WA 3MSTA 5ICQA 1B3LA 4RPOA 2NWJA 3U8QA 2Y7IA 3BBRA 5H8FA 2QMWA 3UP9A 1LSTA 1BLFA 2ZNTA 1XVYA 4H8JA 2F97A 3FVNA 1Q9DA 4JWYA 1M5EA 5FHOA 2DVZA 4RJZA 4F18A 3MP1A 3IOTA 1A99A 3GZGA 4KPTA 4DXUA 3TDJA 4WKMA 1LAFE 1USYE 5M2VA 4I40A 1XHYA 5ITPA 2I6EA 4NF4A 1KZ8A 3G7WA 4MLVA 3G3HA 2XWVA 5A5XA 1IIWA 1EYIA 2OX3A 2QS3A 3D4GA 5LOMA 1OMPA 1IMCA 3IJXB 4UABA 4G8HA 4O8MA 2OJTA 1XC1A 3B50A 1ZLQA 3RPWA 4GWUA 1YYZA 4G77A 1JEUA 1I6QA 1MQGA 3KOTA 4OYVA 1JVYA 4QFPA 3M3KA 1MY1A 3PUZE 3RT8A 2F7BA 4YMAA 2F3DA 1EZOA 5FBPA 4N15A 3LSFB 1SYIA 1UTBB 3GBAA 4LUBA 2ZZWA 2CEYA 3K6XA 4LP2B 5H8NA 4JB7A 2I4CA 3DP4A 2XX8A 3R6UA 3N5LA 3TODA 1IXCA 3EHTA 4Q30B 4ELRA 1MDQA 4MH5A 3EKIA 2OPDA 1WDNA 2THIA 3FXBA 2OZZA 1ANFA 1R9QA 3FD3A 4GXAA 4GL8A 4XF5A 3IL1B 3TKDA 1DPEA 1ATGA 2RKMA 2WKYA 4TQUQ 4WEPA 2MKZA 3IO6A 2RCAA 4NEDA 3OO7A 4QFKA 3KN8A 4OFOA 3FJ7A 3MP8A 5I58A 3WAFA 3OSQA 4IR8A 1H44A 4QFOA 2IA4A 5JEIA 4U22A 4AB6A 4XKRA 4I3YA 5A5LA 3KZGA 1EYJA 1YPNA 2FA7A 3T0JA 4YKPA 4F31B 2ANJA 5L8DA 2RC8A 4X1BA 4JWXA 2QPQA 2F78A 1OIBA 3K6WA 3H3GA 1MPBA 4Z0IA 4JDFA 4PFRA 4GXSB 1FBPA 3K00A 4GWZA 3QUJA 1D4NA 1H3DA 1NV2A 3H06B 3FV2A 1IUDA 5IZ3B 2ONRA 1RKMA 4PAKA 3MPKA 4TLMB 4O94A 1N76A 1I69A 2GH9A 2XXIA 2F8DA 3SDFA 2D3IA 5TP9A 2FIXA 4I3EA 5KDTA 4G68C 1MXZA 3PPOA 3AXFA 4NF5A 1K9ZA 4DZ1A 5HM4B 1N3XA 4N91A 1MXWA 3FXQA 2V25A 1FPDA 4HS7A 3C32A 1A54A 1JETA 1AWBA 1R9LA
chains in the Genus database with same CATH topology
5EQAA 4MCOA 4LN5A 1FPKA 4G61A 2Q74A 1FJ6A 3SZPA 1NV0A 3PTYA 5IGAA 1LBZA 4GWXA 3FBPA 5T3JA 1FPFA 1YZ0A 5ESYA 1RDXA 4HE0A 2F5XA 4KXPA 5LDZA 2XWKA 5I5PA 2PFYA 4PAIA 2KR0A 4OVQA 4YICA 4DI3D 1JP4A 3IFAA 1KA0A 1IMAA 5EQ9A 4GX4A 1NV7A 1FPJA 3BIHA 2HXRA 2Y5LA 5ET8A 2DE3A 1LBYA 1RDYA 1NUXA 1NV3A 4NQ8A 4PETA 1FBHA 4FBPA 4N81A 3KBZA 4X04A 4MIJA 1FTAA 1G0IA 3RPLA 4OVSA 1VDWA 2PCRA 3RYDA 4N6KA 4QBAA 1DK4A 1NV1A 4QXDA 4NG7A 4X9TA 4JVCA 4NHBA 1LBVA 1DCUA 4NX1A 1FBDA 2VT5A 1K9YA 5J16A 2VPOA 4MNPA 3W9WA 2XWOA 2Q8MA 4GX6A 4N8GA 4AS5A 4OA4A 4PF8A 2CEXA 3RPLB 3KC0A 2QFLA 2WYKA 2L5VA 2CZHA 5CM6A 4P47A 2DDKA 4N4UA 4P9KA 1FJ9A 5ET5A 1LBXA 1XI6A 2F3BA 1NV5A 4MNCA 4PCDA 4GBVA 2DE2A 2DE4A 1NUWA 1FSAA 4PDHA 1IMFA 4GWSA 5F24A 3CHGA 1LEVA 1NUZA 2V3QA 2QVVA 2WBBA 5ET7A 2B4LA 4HXVA 5J1DA 4PDDA 2KQZA 4GWWA 5ET6A 4NN3A 4OVPA 4H46A 1FPGA 2QVUA 2PFZA 4GWYA 4JVDA 2HHMA 4PTKA 1NI9A 4GBWA 3MSTA 4AS4A 3E79A 3KC1A 3ROJA 1BK4A 4PC9A 2JJKA 4PGNA 1IMBA 3HFUA 1Q9DA 4PE3A 1FRPA 1SPIA 2OWZA 3B8BA 2DVZA 3BIGA 4PFIA 4F18A 2XWIA 4HCWA 4PBQA 4MHFA 5IZZA 3NOHA 4PFBA 1INPA 1QGXA 2R8TA 4MX6A 2ZZXA 3QMFA 1CNQA 4I40A 4XEQA 2FBPA 4O7IA 4N8YA 4MEVA 1KZ8A 2HZLA 2XA5A 2CZKA 4MNIA 4GX3A 4OANA 1FPEA 3GYYA 2XWVA 4DI4B 4PGPA 1FBFA 1EYIA 2OX3A 2WEFA 2B4MA 1IMCA 4UABA 4O8MA 3B50A 4GWUA 1LBWA 1YYZA 5JK4A 3D1RA 5EYGA 2WX9A 4HE2A 4P1EA 4PBHA 4MJOA 5DW8A 3A29A 2F3DA 4MAGA 2FVZA 4MMPA 2VPNA 5FBPA 4N15A 1NV4A 2ZZWA 2CEYA 1D9QA 4HE1A 4F1VA 2FIEA 2QVRA 1NUYA 1IMEA 5EQ7A 2CZIA 4F19A 3EKIA 3FXBA 4NF0A 4P8BA 2XXKA 4P3LA 4XF5A 1RDZA 3U65A 4X8RA 2MKZA 2P3NA 4JVIA 2BJIA 3MYUA 4PF6A 5EQ8A 4H45A 3LUZA 5IM2A 3LV0A 4IR8A 1KA1A 1NV6A 4I3YA 5A5LA 5I7IA 5IZ3A 1FBCA 1EYJA 3IFCA 5EYHA 4OVRA 2GQ1A 2HZKA 3T0JA 5I3SA 1FPBA 2P3VA 5LTCA 2QPQA 5IZ1A 1G0HA 4PFRA 1YXIA 1FBPA 2WBDA 4GWZA 1EYKA 2Q9TA 4P1LA 4NAPA 1NV2A 2ZZVA 3ISPA 4P56A 5IZ3B 1FBGA 4N6DA 4PAKA 4YZZA 2WYPA 2FHYA 4N17A 3E78A 4O94A 1IMDA 1DBZA 1FPLA 3W9VA 4OVTA 2HPGA 2FIXA 4I3EA 1FPIA 1FBEA 4NGUA 1K9ZA 4M1VA 4N91A 4XFEA 2V4CA 2Y5KA 1FPDA 4HCYA 4PAFA 4O7MA 3T1BA 1AWBA 4F1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQA A;  4I40 A;  2P3N A;  3RPL B;  1FPK A;  2FBP A;  4G61 A;  4O7I A;  2BJI A;  1KZ8 A;  2Q74 A;  1FJ6 A;  2QFL A;  3KC0 A;  1NV0 A;  2CZH A;  5EQ8 A;  1LBZ A;  4H45 A;  2CZK A;  2DDK A;  4GWX A;  3FBP A;  3LUZ A;  4GX3 A;  5T3J A;  1FPF A;  3LV0 A;  1FPE A;  1YZ0 A;  5ESY A;  1FJ9 A;  5ET5 A;  1RDX A;  4HE0 A;  1LBX A;  1XI6 A;  2F3B A;  4KXP A;  1FBF A;  1EYI A;  2OX3 A;  1NV5 A;  4IR8 A;  4GBV A;  1KA1 A;  2WEF A;  5LDZ A;  1IMC A;  1NV6 A;  4I3Y A;  1NUW A;  5A5L A;  5IZ3 A;  1FSA A;  1FBC A;  1EYJ A;  3IFC A;  5EYH A;  4GWU A;  2GQ1 A;  1LBW A;  1IMF A;  3T0J A;  1YYZ A;  4GWS A;  5I3S A;  5F24 A;  1LEV A;  1FPB A;  1NUZ A;  2P3V A;  1JP4 A;  3D1R A;  5EYG A;  3IFA A;  1KA0 A;  5IZ1 A;  4HE2 A;  2QVV A;  1IMA A;  2WBB A;  5EQ9 A;  1G0H A;  5ET7 A;  4MJO A;  4GX4 A;  1NV7 A;  5DW8 A;  4HXV A;  3A29 A;  1FPJ A;  3BIH A;  2Y5L A;  2F3D A;  2FVZ A;  1YXI A;  1FBP A;  3QMF A;  5FBP A;  5ET8 A;  1LBY A;  4GWW A;  5ET6 A;  1RDY A;  1NUX A;  1NV4 A;  1NV3 A;  1EYK A;  2WBD A;  4GWZ A;  4H46 A;  1FBH A;  1NV2 A;  4FBP A;  1FPG A;  2QVU A;  4N81 A;  3KBZ A;  4GWY A;  1D9Q A;  5IZ3 B;  1FBG A;  2HHM A;  4PTK A;  2FHY A;  1NI9 A;  4GBW A;  1FTA A;  1G0I A;  4HE1 A;  3RPL A;  4AS4 A;  2FIE A;  1VDW A;  3KC1 A;  2PCR A;  3ROJ A;  3RYD A;  1IMD A;  1DBZ A;  1FPL A;  2QVR A;  1DK4 A;  1NV1 A;  1BK4 A;  4QXD A;  2JJK A;  2FIX A;  4I3E A;  1FPI A;  1NUY A;  1IME A;  1DCU A;  1LBV A;  5EQ7 A;  2CZI A;  1FBE A;  1FBD A;  1IMB A;  1Q9D A;  2VT5 A;  1K9Y A;  5J16 A;  1K9Z A;  1FRP A;  1SPI A;  2OWZ A;  3B8B A;  3BIG A;  2Q8M A;  4GX6 A;  1RDZ A;  2Y5K A;  1FPD A;  4AS5 A;  1INP A;  1QGX A;  2R8T A;  1AWB A;  1CNQ A; 
#chains in the Genus database with same CATH topology
 5EQA A;  4LN5 A;  4G61 A;  2OBG A;  5IKB A;  2HXW A;  4GVO A;  3VLU A;  1NV0 A;  1LBZ A;  1FTM A;  4HTG A;  4YB6 A;  1LCF A;  4KCC A;  2F5X A;  1SI0 A;  1GTK A;  5AA2 A;  2FNC A;  1POT A;  2PFY A;  3LUY A;  1FTJ A;  2ZNU A;  4G4P A;  2B65 A;  2XXP A;  2O69 A;  3IB1 A;  4P0I A;  3RN8 A;  1MQI A;  3EF7 A;  1MPD A;  2B3B A;  3MZ9 A;  1B1X A;  3ZKK A;  1BTJ A;  4ISU A;  3E9X A;  3EN3 A;  3O9P A;  5B7D A;  2VHA A;  1FPJ A;  2XXW A;  4OFJ A;  1J1N A;  2Z8D A;  4YAH X;  1FBH A;  1T0K A;  3OEM A;  3OSR A;  4C1U A;  2GHB A;  1G0I A;  4PE5 B;  4QBA A;  1NV1 A;  3V8X B;  1Y3N A;  1DCU A;  3SES A;  4RXL A;  1SD3 A;  1MY0 A;  3SEY A;  1B51 A;  1ZU0 A;  2Q8M A;  3PD8 A;  4YKJ A;  1DTZ A;  5BWJ A;  4N8G A;  4X1D A;  2A5S A;  3HN0 A;  3MQ9 A;  4DCX A;  4EXL A;  1ZIU A;  1LB8 A;  3OEN A;  2QFL A;  2WYK A;  1QUJ A;  3IK6 B;  4PFT A;  1P1W A;  4R9F A;  1TFA A;  5I57 A;  4P9K A;  3PPQ A;  3MWB A;  2NOO A;  4EF1 A;  5AA2 D;  2DE4 A;  3TFL A;  1FSA A;  3KFM A;  3LSX A;  1MDP 1;  1MH3 A;  1IMF A;  3E3K A;  4KYD A;  3UOR A;  5F24 A;  3CHG A;  3B6T A;  5F1Q A;  2QVV A;  1M5D A;  3O66 A;  5ET7 A;  2AL5 A;  5I84 A;  1URS A;  4NN3 A;  4ZE8 A;  1AOV A;  4Q0C A;  2VP1 A;  2I4B A;  1FPG A;  1AMF A;  3MW0 A;  4TOZ A;  4R6Y A;  1NI9 A;  4GBW A;  3N26 A;  4XIG Q;  3M3F A;  2XXH A;  3ROJ A;  4H5F A;  4RY1 A;  2JJK A;  5F7V A;  1FTO A;  4NTL A;  4ZZE A;  4GQO A;  3O6H A;  1SPI A;  1OVB A;  3B8B A;  4PFI A;  5HBC A;  4EQ7 A;  4NWD A;  2XWI A;  4HCW A;  1N7X A;  2ABH A;  3NOH A;  1INP A;  3MAM A;  4M4G A;  1EU8 A;  3QMF A;  2HFB A;  4XEQ A;  4UAC A;  2ONK E;  4O7I A;  4N8Y A;  5H8F B;  1JW4 A;  2DVC A;  4K3F A;  2XA5 A;  4OVJ A;  2UXA A;  3CFZ A;  4OER A;  2CZK A;  1OVT A;  3CVG A;  4GX3 A;  1NH8 A;  3OEK A;  3HHF A;  3IX1 A;  1IIT A;  3MZB A;  2Q2C A;  2WEF A;  1LBB A;  4DDD A;  2PMS A;  3CRB A;  2D5W A;  5JK4 A;  3EHS A;  4DLD A;  3U93 A;  3PD9 A;  2ZYO A;  4NF4 B;  5I59 A;  4P1E A;  2REG A;  4UA8 A;  3O6I A;  1MQH A;  2H99 A;  1A7L A;  4MMP A;  1DPP A;  5A5X B;  5ICT A;  3JZJ A;  4N07 A;  3MC2 A;  2GHA A;  1NFT A;  3JYR A;  1NV4 A;  1B5J A;  1QUI A;  4ONY A;  4XTC Q;  4IB2 A;  3ILT B;  1D9Q A;  1MM7 A;  2QSX A;  1FQD A;  3IOW A;  3M3L A;  2FIE A;  1PC3 A;  3EQ1 A;  1Q35 A;  2QVR A;  3LSL A;  3Q26 A;  1IME A;  3KSX A;  3C9H A;  3CR9 A;  4O3B A;  4ZEC A;  3HST A;  3MUQ A;  1OQG A;  5K2X A;  3QSL A;  1YCJ A;  5JTY A;  1QKB A;  2HQ0 A;  4ND9 A;  3RT6 B;  5KZT A;  1F9B A;  2DXY A;  2I48 A;  1Y3Q A;  3KOS A;  3B6W A;  1Y20 A;  3C35 A;  5H8N B;  2B3F A;  4ZE9 A;  1IQ7 A;  2NUV A;  4YMB A;  1B7H A;  3U72 A;  3MYU A;  4PF6 A;  4N6P A;  3T9X B;  2HEU A;  5IM2 A;  3LV0 A;  4FAT A;  1B40 A;  3K1P A;  3T9V A;  3K1N A;  1KA1 A;  4FE8 A;  1LCT A;  3BFU A;  3O6G A;  3IFC A;  1QVS A;  1LBC A;  3FV1 A;  2QRY A;  3E13 X;  3T22 A;  4R9G A;  2QMX A;  3N6U A;  5I58 B;  4IO4 A;  3B6Q A;  2AIX A;  5B70 A;  4R2F A;  3O29 A;  4GD5 A;  3ODB A;  1EYK A;  2OWT A;  1IZ1 A;  2XXT A;  3TEL A;  4ELP A;  4YZZ A;  5DTB A;  5DT6 A;  5AA1 A;  3E78 A;  2I0C A;  4C0R A;  4QRZ A;  1IXG A;  1S50 A;  3W9V A;  4OVT A;  4F1Y A;  1FPI A;  4EQ9 A;  5I2N B;  3FJM A;  4NGU A;  4M1V A;  4AQ4 A;  2V4C A;  3L6H A;  3D4C A;  1LB9 A;  3CSG A;  4PAF A;  4FIM A;  2A5T A;  3GBB A;  2XHD A;  3T9U A;  3G3F A;  2Q74 A;  3SZP A;  5TP9 B;  3PTY A;  3RQT A;  3G3J A;  1YZ0 A;  4I1D A;  4ZEB A;  1H45 A;  5KDT B;  3PPP A;  3QAX A;  1XS5 A;  1US5 A;  4NF5 B;  3PUY E;  4OZ9 A;  5I5P A;  3DLN A;  1UTH B;  1NMU A;  1FQA A;  1DMB A;  1OLC A;  2F34 A;  4OEV A;  2F35 A;  3OXN A;  2RIN A;  1JP4 A;  3A3C A;  1PB9 A;  3TYH A;  4FOR A;  4ZZA A;  2V93 A;  3RY3 A;  4YB5 A;  5DVF A;  4EF2 A;  2HXR A;  1PBP A;  4GF8 A;  1SBP A;  5AA2 B;  3CFL A;  4N81 A;  1HSE A;  1Y1Z A;  3KBZ A;  1B3H A;  4MIJ A;  4O3A A;  3RPL A;  4DXC A;  3S9N C;  3CG1 A;  4PP0 A;  2PCR A;  1B6H A;  1LGB C;  4N6K A;  4ZEK A;  4QXD A;  4JVC A;  5H8H B;  3QK6 A;  2XXX A;  4OWD A;  1LBV A;  2PT1 A;  4P11 A;  4QSC A;  1AIV A;  1SDX A;  3W9W A;  2P1S A;  4EXK A;  3MVY A;  4GX6 A;  4NE4 A;  5CMB A;  2OPE A;  1AH5 A;  3PUX E;  4OA4 A;  3R7X A;  2O7I A;  4PF8 A;  1MPC A;  1WVJ A;  3S9L C;  1RYO A;  1UIV A;  2ONS A;  4F29 A;  1UIU A;  3H6T A;  5ET5 A;  1M5F A;  3KGC A;  1XI6 A;  4BDR A;  2OLB A;  1NV5 A;  1NL5 A;  1EZ9 A;  2DE2 A;  4H1X A;  1B7Z A;  2RF1 A;  1FCK A;  4F2O A;  5I56 A;  1TXF A;  1B58 A;  2F7A A;  4OFL A;  3SEV A;  3PUW E;  3HO7 A;  5EHS A;  3G3G A;  4H0W A;  1IXI A;  4RNS A;  3KEI A;  3C34 A;  3GLB A;  3RTW B;  4LON B;  2WBB A;  1PEB A;  4R74 A;  4RYA A;  2B4L A;  4BDQ A;  5I57 B;  4HXV A;  3IOR A;  4R72 A;  2DS9 A;  4PDD A;  3IO4 A;  3TQW A;  1VE4 A;  1Z7M E;  5ITO A;  2PFZ A;  2GFE A;  2YPN A;  3T93 B;  5FTH A;  2HHM A;  3C33 A;  4PTK A;  2OWS A;  3LBS A;  4U4S A;  4ZEI A;  2UYE A;  3E79 A;  4H6D A;  1GVC A;  1FTL A;  4PGN A;  3P7I A;  1FRP A;  2NVU B;  2OWZ A;  3BIG A;  2KLF A;  4E0W A;  4KFQ A;  4PBQ A;  4DIG A;  1Y4T A;  4MHF A;  2VD2 A;  2VOZ A;  1QW0 A;  4ELO A;  4MX6 A;  1QGX A;  2DQV A;  4Q5T A;  3FVG A;  4IGT A;  2FBP A;  1R6Z A;  1US4 A;  2BJJ X;  4JBZ A;  1FQE A;  4MEV A;  2HZL A;  4O3C A;  2XXV A;  3MVZ A;  3K6U A;  4PFY A;  1HSL A;  4MBP A;  4MNI A;  4LVQ A;  1O64 A;  1II5 A;  2Q89 A;  4WED A;  2RCB A;  2PBW A;  1B7U A;  3QIM A;  4ELQ A;  3OO6 A;  1P1O A;  3ONM A;  4R2B A;  3SEU A;  1B1H A;  2QS1 A;  1QUK A;  1S9T A;  2QS4 A;  3ILU B;  2ZYM A;  2DYX A;  1L5T A;  3UN6 A;  2I0B A;  1NKX A;  3MP6 A;  5TPA A;  3MJN A;  1MXU A;  3Q28 A;  2DWJ A;  3D1R A;  5EYG A;  2PVU A;  4ZED A;  3S2V A;  5DVI A;  3CSB A;  4MJO A;  3TCF A;  3A29 A;  3FAT A;  3Q25 A;  2FVZ A;  2VPN A;  3KG2 A;  1TWY A;  1N04 A;  1SVX B;  1B32 A;  2Q2A A;  4JSO A;  2DWA A;  4G68 A;  4HE1 A;  4F22 A;  5ISU A;  2V3U A;  4OEU A;  1ZMG A;  1MH4 A;  2PX1 A;  1PDA A;  2PYY A;  1NUY A;  5I59 B;  5EQ7 A;  4L17 A;  1P1N A;  2CZI A;  2DWI A;  3Q29 A;  4ZS9 A;  3E4R A;  2V3T A;  4U23 A;  4NF0 A;  4PFU A;  2XXK A;  2H98 A;  4AB5 A;  2O1M A;  4YKK A;  4LAT A;  5DEX A;  2XXU A;  3T66 A;  4OXV A;  4N13 A;  3GXA A;  1LFG A;  4R6K A;  3VVD A;  5CC2 A;  5AA4 B;  4JVI A;  1USY H;  3K1M A;  3VVE A;  2BJI A;  4YKI A;  2CMO A;  4KYS A;  4EDP A;  3N94 A;  3H6W A;  4H45 A;  3FIR A;  4NMY A;  1VSO A;  1GV8 A;  3K4U A;  4XKQ A;  1MG1 A;  1SI1 A;  5JTY B;  1NV6 A;  2QS2 A;  3RGY A;  5AA3 A;  1FBC A;  4IO6 A;  4H5G A;  4YB7 A;  3IB2 A;  5EYH A;  4OVR A;  1RYX A;  4JWO A;  1CE2 A;  5I3S A;  1FPB A;  4U1Z A;  2P3V A;  5DVJ A;  4F3G A;  5LTC A;  1B4H A;  1D9Y A;  5EHM A;  1DTG A;  1D3K A;  2WBD A;  2HAV A;  1Z7N E;  4P1L A;  4NAP A;  4OQO A;  2ZZV A;  1B4Z A;  2UVJ A;  3ISP A;  2E1S A;  1Y9U A;  4RA1 A;  4NF8 A;  1DBZ A;  3U94 A;  2XXY A;  3TTL A;  4GLI A;  2HPG A;  1SW5 A;  3KBR A;  4IY5 A;  1JW1 A;  3USD A;  4DCY A;  1FBE A;  3PMV A;  3VLW A;  3TMG A;  2YJP A;  4IO2 A;  3RNN A;  5FTI A;  3MVX A;  4POX A;  1DSN A;  2Y5K A;  1KWH A;  4HCY A;  1FTK A;  4OET A;  2FYI A;  1ZKB A;  3OO8 A;  1O7T A;  4O7M A;  1BIY A;  3K6V A;  3TTM A;  4ZEF A;  1B5H A;  2Y7P A;  2ALU A;  4KHZ E;  1FQC A;  1FJ6 A;  1B0H A;  2Y7K A;  3K02 A;  3O28 A;  1TFD A;  4GWX A;  3DP6 A;  3FBP A;  1FPF A;  2F6P A;  3SEW A;  1B3G A;  3IAZ A;  2O68 A;  3OMB A;  1RDX A;  3S9M C;  3TQL A;  5CBS A;  4X48 A;  1LAX A;  1B52 A;  5H8Q A;  4U4X A;  3I5O A;  2A5T B;  1NNT A;  4PAI A;  2Z8E A;  3TTR A;  3U1O A;  3KJ7 A;  3VLV A;  4OVQ A;  3A3U A;  1NNP A;  3IFA A;  3IB0 A;  5FHM A;  3OEL A;  5EQ9 A;  4H65 A;  3H03 A;  2HAU A;  1POY 1;  4POW A;  4NQ8 A;  2DWH A;  4QFN A;  4PET A;  3FZV A;  2HCA A;  3T96 B;  4FBP A;  4ESW A;  2UVG A;  1MRP A;  4X04 A;  3O97 A;  1FTA A;  4U21 A;  4OVS A;  1VDW A;  1JEV A;  1LAG E;  1AL3 A;  1SW2 A;  3RYD A;  4OTE A;  1DK4 A;  2IEE A;  2X7P A;  4X9T A;  1BP5 A;  3I3V A;  5L9O A;  4F2Q A;  3IOV A;  4BLA A;  2VT5 A;  1K9Y A;  5J16 A;  2VPO A;  4MNP A;  4MF3 A;  4WXJ A;  3PV0 E;  4RK2 A;  1A8E A;  3ZS6 A;  1Y3P A;  4AS5 A;  4TLL B;  3FXU A;  5CMK A;  4LZ7 A;  4U1O A;  2W7Y A;  2R6G E;  1WOD A;  2O51 A;  3RPL B;  2F36 A;  1ZJL A;  5I2K A;  4FJP A;  2XXR A;  1IXH A;  2H5Y A;  2ESN A;  2L5V A;  3IOU A;  1N84 A;  4OEN A;  5CI5 A;  2CZH A;  4P47 A;  2DDK A;  1MXX A;  1B3E A;  4NF6 A;  3UGW A;  1FJ9 A;  5KCJ A;  3V89 B;  1FW0 A;  3EPE A;  4MNC A;  4PQJ A;  4U2R A;  2PT2 A;  3CIJ A;  3IR1 A;  1P1Q A;  1Y4C A;  1M5B A;  4OHN A;  1FQF A;  4PDH A;  4IO7 A;  3BKI B;  4I62 A;  3OOA A;  1HSJ A;  4RPN A;  4QF9 A;  2V3Q A;  1MQD A;  3VE1 B;  5L9S A;  4QSE A;  3S9E A;  1LAH E;  2XD3 A;  2I58 A;  3KN3 A;  2AL4 A;  4KCD A;  4GWW A;  5ET6 A;  4OVP A;  4H46 A;  4GFR A;  3TTK A;  3SER A;  1EZP A;  3T9H B;  3V83 A;  2G29 A;  3FVK A;  3OO9 A;  4KD5 A;  1IEJ A;  4JSD A;  2QVU A;  1NNK A;  1JVX A;  4JVD A;  5I56 B;  4I8C A;  4GOT A;  4NWC A;  2O1L A;  4AS4 A;  2DP8 A;  2I3V A;  4LQ2 A;  5CRY A;  3KC1 A;  4HW8 A;  2QL3 A;  1NH7 A;  3K0V A;  3QXM A;  1BK4 A;  4PC9 A;  4F3S A;  4QFL A;  3H4Z A;  2P0S A;  3BFT A;  4OMB A;  1ZTY A;  1P99 A;  1IMB A;  2REJ A;  3HFU A;  1MQJ A;  4EQB A;  2QJE A;  4PE3 A;  4BDM A;  3JV9 A;  4IO3 A;  2Z22 A;  3K2D A;  3VVF A;  5IZZ A;  3VFJ A;  4H67 A;  4PFB A;  4BDN A;  2R8T A;  1CNQ A;  2ZZX A;  2ZYK A;  3U92 A;  4OES A;  2M8C A;  4GWO A;  4KI0 E;  4E0X A;  4THI A;  3CFX A;  3SKP A;  3HV1 A;  1FPE A;  4OAN A;  3GYY A;  4DI4 B;  4PGP A;  3MVW A;  4KYE A;  2O7U A;  2OK2 A;  1FBF A;  5I2N A;  4G8N A;  1UTB A;  2I49 A;  2Q88 A;  3TCH A;  1QJM A;  2B4M A;  3SEX A;  4RK9 A;  1UQW A;  2UYF A;  5ELV A;  2VGQ A;  3KSJ A;  1ZBM A;  4ECF A;  1LBW A;  3DM0 A;  4IY6 A;  4C1T A;  4DXB A;  3PPN A;  1R1N A;  2WX9 A;  3C31 A;  3MZ1 A;  2XXQ A;  5AE4 A;  4HE2 A;  3HHG A;  1MM6 A;  1NNF A;  1XT8 A;  4Q8R A;  1A40 A;  4PBH A;  1URD A;  5DW8 A;  3VXC A;  4MAG A;  1YTV A;  3RLF E;  3FAS A;  1M5C A;  1URG A;  4ZDM A;  1LFI A;  3G3K A;  3B7D A;  3TEP A;  2RC7 A;  4F1V A;  4R73 A;  3W15 C;  3FUZ A;  5EYF A;  4FEB A;  1UTH A;  2X26 A;  5TPA B;  1JW5 A;  1PBQ A;  4FED A;  4FEC A;  3RUM A;  2UVI A;  3SET A;  4F19 A;  3OD7 A;  1B5I A;  3MBP A;  4P8B A;  3KJT A;  4P3L A;  4MFI A;  1RDZ A;  2F6G A;  2F7C A;  3U65 A;  4X8R A;  2DSF A;  3H6U A;  4EUO A;  4IGR A;  4G68 B;  5HPQ A;  2P3N A;  4QSD A;  5IAI A;  1A8F A;  3EHU A;  5EQ8 A;  3PMW A;  4G2Z A;  3LUZ A;  4GRK A;  3TUS A;  2RC9 A;  4DE8 A;  3FGS A;  5H8H A;  1A55 A;  1LLS A;  1Y1M A;  2G93 A;  3FXR A;  1I6A A;  4KQP A;  3H6V A;  2XX7 A;  4LQ5 A;  3LR1 A;  2O84 X;  5I7I A;  5IZ3 A;  2YLN A;  2R9J A;  5DEX B;  1B46 A;  2OCU A;  2GQ1 A;  1ELJ A;  2HZK A;  5H8S A;  5CBR A;  2ZNS A;  3DP8 A;  5K2Y A;  3PMX A;  3TAJ A;  5IZ1 A;  1G0H A;  2X7Q A;  1GGG A;  1O63 A;  2Y84 A;  2GRV A;  3M8U A;  1YXI A;  1B3F A;  1CB6 A;  2XX9 A;  2Q9T A;  3UK4 A;  3N6T A;  4XKP A;  2H25 A;  2I3W A;  3VV5 A;  1FQB A;  2VD3 A;  3V5A A;  3FJG A;  4P56 A;  1VFD A;  2AYS A;  1FBG A;  4N6D A;  2WYP A;  2H4I A;  2FHY A;  4N17 A;  1GR2 A;  1MXV A;  1MY2 A;  2NXO A;  1IMD A;  1FPL A;  2P2A A;  1MS7 A;  1PB8 A;  1Q1K A;  4P0G A;  3THI A;  1VR5 A;  3UIF A;  1TT1 A;  4ESX A;  3PU5 A;  4XFE A;  4YU0 A;  3LSW A;  3ZKL A;  4IO5 A;  1DOT A;  2LAO A;  2Q8J A;  3TCG A;  1SYH A;  3T1B A;  1I6B A;  4GIZ A;  3KN7 A;  4MCO A;  3ECR A;  4NF8 B;  1FPK A;  1QUL A;  3ZSF A;  2R71 A;  3RTF B;  1SW4 A;  3HPI A;  5IGA A;  3H7M A;  5T3J A;  5TU0 A;  2XD2 A;  5ESY A;  4HE0 A;  3A09 A;  4KXP A;  2V84 A;  4I9D A;  3PUV E;  5LDZ A;  2XWK A;  4Z7E A;  2Z8F A;  3O2A A;  2ZYN A;  3TZA A;  4LZ5 A;  2ZMB A;  4BDO A;  1H43 A;  1BKA A;  3Q27 A;  2E0S A;  2KR0 A;  2H9B A;  4YIC A;  4DI3 D;  4F3B A;  2Y7W A;  1KA0 A;  3I6V A;  5FHN A;  3TPA A;  1IMA A;  3C36 A;  1JNF A;  4GX4 A;  1NV7 A;  3BIH A;  2Y5L A;  3MPL A;  4BDL A;  5ET8 A;  1N0T A;  2DE3 A;  1LBY A;  3WAE A;  1RDY A;  1NUX A;  1NV3 A;  5DYH A;  1LFH A;  3DEL B;  5H8Q B;  2D21 A;  1JQF A;  2Z23 A;  3L6G A;  1EH3 A;  4NG7 A;  1XOC A;  3K01 A;  3QUF A;  4LA9 A;  4NHB A;  1VFE A;  4NX1 A;  1FBD A;  3CG3 A;  1SQY A;  3LC8 A;  1XVX A;  2XWO A;  5BUU A;  3R26 A;  3FVO A;  4LZ8 A;  1MY4 A;  1S7Y A;  4F3P A;  1PB7 A;  3C4M A;  3HCQ A;  5CMM A;  3QYT A;  4MLQ A;  5CMC A;  2CEX A;  4G8M A;  5L9M A;  1N7W A;  1MXY A;  1P1U A;  3PPR A;  4XKN A;  3KC0 A;  1B0L A;  3G3I A;  5CM6 A;  4XXU A;  4R6H A;  2O6A A;  4N4U A;  2DOJ A;  1H76 A;  1LBX A;  3IJO B;  4QHQ A;  2F3B A;  4PFW A;  2UVH A;  4PCD A;  4GBV A;  1OLA A;  4R75 A;  3VXB A;  2CZL A;  1NUW A;  2Y7R A;  3VDF A;  1OQH A;  1B9J A;  4GWS A;  3PGF A;  4GL0 A;  4KR5 A;  1LEV A;  1NUZ A;  3S4U A;  5I2K B;  5AA4 A;  1SW1 A;  4F39 A;  2DXR A;  1MY3 A;  4F1U A;  2ZXT A;  4NF6 B;  3TTN A;  4H8I A;  4JXI A;  5KCJ B;  5J1D A;  1D9V A;  2KQZ A;  3UA8 A;  1B2H A;  4FAJ A;  1QKA A;  1YAE A;  3CI8 A;  3F11 A;  4GWY A;  1B05 A;  1N3W A;  3MST A;  5ICQ A;  1B3L A;  4RPO A;  2NWJ A;  3U8Q A;  2Y7I A;  3BBR A;  5H8F A;  2QMW A;  3UP9 A;  1LST A;  1BLF A;  2ZNT A;  1XVY A;  4H8J A;  2F97 A;  3FVN A;  1Q9D A;  4JWY A;  1M5E A;  5FHO A;  2DVZ A;  4RJZ A;  4F18 A;  3MP1 A;  3IOT A;  1A99 A;  3GZG A;  4KPT A;  4DXU A;  3TDJ A;  4WKM A;  1LAF E;  1USY E;  5M2V A;  4I40 A;  1XHY A;  5ITP A;  2I6E A;  4NF4 A;  1KZ8 A;  3G7W A;  4MLV A;  3G3H A;  2XWV A;  5A5X A;  1IIW A;  1EYI A;  2OX3 A;  2QS3 A;  3D4G A;  5LOM A;  1OMP A;  1IMC A;  3IJX B;  4UAB A;  4G8H A;  4O8M A;  2OJT A;  1XC1 A;  3B50 A;  1ZLQ A;  3RPW A;  4GWU A;  1YYZ A;  4G77 A;  1JEU A;  1I6Q A;  1MQG A;  3KOT A;  4OYV A;  1JVY A;  4QFP A;  3M3K A;  1MY1 A;  3PUZ E;  3RT8 A;  2F7B A;  4YMA A;  2F3D A;  1EZO A;  5FBP A;  4N15 A;  3LSF B;  1SYI A;  1UTB B;  3GBA A;  4LUB A;  2ZZW A;  2CEY A;  3K6X A;  4LP2 B;  5H8N A;  4JB7 A;  2I4C A;  3DP4 A;  2XX8 A;  3R6U A;  3N5L A;  3TOD A;  1IXC A;  3EHT A;  4Q30 B;  4ELR A;  1MDQ A;  4MH5 A;  3EKI A;  2OPD A;  1WDN A;  2THI A;  3FXB A;  2OZZ A;  1ANF A;  1R9Q A;  3FD3 A;  4GXA A;  4GL8 A;  4XF5 A;  3IL1 B;  3TKD A;  1DPE A;  1ATG A;  2RKM A;  2WKY A;  4TQU Q;  4WEP A;  2MKZ A;  3IO6 A;  2RCA A;  4NED A;  3OO7 A;  4QFK A;  3KN8 A;  4OFO A;  3FJ7 A;  3MP8 A;  5I58 A;  3WAF A;  3OSQ A;  4IR8 A;  1H44 A;  4QFO A;  2IA4 A;  5JEI A;  4U22 A;  4AB6 A;  4XKR A;  4I3Y A;  5A5L A;  3KZG A;  1EYJ A;  1YPN A;  2FA7 A;  3T0J A;  4YKP A;  4F31 B;  2ANJ A;  5L8D A;  2RC8 A;  4X1B A;  4JWX A;  2QPQ A;  2F78 A;  1OIB A;  3K6W A;  3H3G A;  1MPB A;  4Z0I A;  4JDF A;  4PFR A;  4GXS B;  1FBP A;  3K00 A;  4GWZ A;  3QUJ A;  1D4N A;  1H3D A;  1NV2 A;  3H06 B;  3FV2 A;  1IUD A;  5IZ3 B;  2ONR A;  1RKM A;  4PAK A;  3MPK A;  4TLM B;  4O94 A;  1N76 A;  1I69 A;  2GH9 A;  2XXI A;  2F8D A;  3SDF A;  2D3I A;  5TP9 A;  2FIX A;  4I3E A;  5KDT A;  4G68 C;  1MXZ A;  3PPO A;  3AXF A;  4NF5 A;  1K9Z A;  4DZ1 A;  5HM4 B;  1N3X A;  4N91 A;  1MXW A;  3FXQ A;  2V25 A;  1FPD A;  4HS7 A;  3C32 A;  1A54 A;  1JET A;  1AWB A;  1R9L A; 
#chains in the Genus database with same CATH homology
 5EQA A;  4MCO A;  4LN5 A;  1FPK A;  4G61 A;  2Q74 A;  1FJ6 A;  3SZP A;  1NV0 A;  3PTY A;  5IGA A;  1LBZ A;  4GWX A;  3FBP A;  5T3J A;  1FPF A;  1YZ0 A;  5ESY A;  1RDX A;  4HE0 A;  2F5X A;  4KXP A;  5LDZ A;  2XWK A;  5I5P A;  2PFY A;  4PAI A;  2KR0 A;  4OVQ A;  4YIC A;  4DI3 D;  1JP4 A;  3IFA A;  1KA0 A;  1IMA A;  5EQ9 A;  4GX4 A;  1NV7 A;  1FPJ A;  3BIH A;  2HXR A;  2Y5L A;  5ET8 A;  2DE3 A;  1LBY A;  1RDY A;  1NUX A;  1NV3 A;  4NQ8 A;  4PET A;  1FBH A;  4FBP A;  4N81 A;  3KBZ A;  4X04 A;  4MIJ A;  1FTA A;  1G0I A;  3RPL A;  4OVS A;  1VDW A;  2PCR A;  3RYD A;  4N6K A;  4QBA A;  1DK4 A;  1NV1 A;  4QXD A;  4NG7 A;  4X9T A;  4JVC A;  4NHB A;  1LBV A;  1DCU A;  4NX1 A;  1FBD A;  2VT5 A;  1K9Y A;  5J16 A;  2VPO A;  4MNP A;  3W9W A;  2XWO A;  2Q8M A;  4GX6 A;  4N8G A;  4AS5 A;  4OA4 A;  4PF8 A;  2CEX A;  3RPL B;  3KC0 A;  2QFL A;  2WYK A;  2L5V A;  2CZH A;  5CM6 A;  4P47 A;  2DDK A;  4N4U A;  4P9K A;  1FJ9 A;  5ET5 A;  1LBX A;  1XI6 A;  2F3B A;  1NV5 A;  4MNC A;  4PCD A;  4GBV A;  2DE2 A;  2DE4 A;  1NUW A;  1FSA A;  4PDH A;  1IMF A;  4GWS A;  5F24 A;  3CHG A;  1LEV A;  1NUZ A;  2V3Q A;  2QVV A;  2WBB A;  5ET7 A;  2B4L A;  4HXV A;  5J1D A;  4PDD A;  2KQZ A;  4GWW A;  5ET6 A;  4NN3 A;  4OVP A;  4H46 A;  1FPG A;  2QVU A;  2PFZ A;  4GWY A;  4JVD A;  2HHM A;  4PTK A;  1NI9 A;  4GBW A;  3MST A;  4AS4 A;  3E79 A;  3KC1 A;  3ROJ A;  1BK4 A;  4PC9 A;  2JJK A;  4PGN A;  1IMB A;  3HFU A;  1Q9D A;  4PE3 A;  1FRP A;  1SPI A;  2OWZ A;  3B8B A;  2DVZ A;  3BIG A;  4PFI A;  4F18 A;  2XWI A;  4HCW A;  4PBQ A;  4MHF A;  5IZZ A;  3NOH A;  4PFB A;  1INP A;  1QGX A;  2R8T A;  4MX6 A;  2ZZX A;  3QMF A;  1CNQ A;  4I40 A;  4XEQ A;  2FBP A;  4O7I A;  4N8Y A;  4MEV A;  1KZ8 A;  2HZL A;  2XA5 A;  2CZK A;  4MNI A;  4GX3 A;  4OAN A;  1FPE A;  3GYY A;  2XWV A;  4DI4 B;  4PGP A;  1FBF A;  1EYI A;  2OX3 A;  2WEF A;  2B4M A;  1IMC A;  4UAB A;  4O8M A;  3B50 A;  4GWU A;  1LBW A;  1YYZ A;  5JK4 A;  3D1R A;  5EYG A;  2WX9 A;  4HE2 A;  4P1E A;  4PBH A;  4MJO A;  5DW8 A;  3A29 A;  2F3D A;  4MAG A;  2FVZ A;  4MMP A;  2VPN A;  5FBP A;  4N15 A;  1NV4 A;  2ZZW A;  2CEY A;  1D9Q A;  4HE1 A;  4F1V A;  2FIE A;  2QVR A;  1NUY A;  1IME A;  5EQ7 A;  2CZI A;  4F19 A;  3EKI A;  3FXB A;  4NF0 A;  4P8B A;  2XXK A;  4P3L A;  4XF5 A;  1RDZ A;  3U65 A;  4X8R A;  2MKZ A;  2P3N A;  4JVI A;  2BJI A;  3MYU A;  4PF6 A;  5EQ8 A;  4H45 A;  3LUZ A;  5IM2 A;  3LV0 A;  4IR8 A;  1KA1 A;  1NV6 A;  4I3Y A;  5A5L A;  5I7I A;  5IZ3 A;  1FBC A;  1EYJ A;  3IFC A;  5EYH A;  4OVR A;  2GQ1 A;  2HZK A;  3T0J A;  5I3S A;  1FPB A;  2P3V A;  5LTC A;  2QPQ A;  5IZ1 A;  1G0H A;  4PFR A;  1YXI A;  1FBP A;  2WBD A;  4GWZ A;  1EYK A;  2Q9T A;  4P1L A;  4NAP A;  1NV2 A;  2ZZV A;  3ISP A;  4P56 A;  5IZ3 B;  1FBG A;  4N6D A;  4PAK A;  4YZZ A;  2WYP A;  2FHY A;  4N17 A;  3E78 A;  4O94 A;  1IMD A;  1DBZ A;  1FPL A;  3W9V A;  4OVT A;  2HPG A;  2FIX A;  4I3E A;  1FPI A;  1FBE A;  4NGU A;  1K9Z A;  4M1V A;  4N91 A;  4XFE A;  2V4C A;  2Y5K A;  1FPD A;  4HCY A;  4PAF A;  4O7M A;  3T1B A;  1AWB A;  4F1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...