2CZHA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) with phosphate ion (orthorhombic form)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
254
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTEEKDLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase 2
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 254
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2czhA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2czhA02
1EYKA 4GWZA 1FBFA 1NV2A 2JJKA 5F24A 2CZKA 1LBZA 1FBHA 2BJIA 5EQAA 1NV4A 2WBBA 1QGXA 1VDWA 1JP4A 1RDYA 2PCRA 1KA1A 3KBZA 3LV0A 1FSAA 5J16A 5I3SA 1FPKA 4N81A 1FPEA 1NUXA 1INPA 4PTKA 1EYJA 1CNQA 3RYDA 3BIGA 1LBXA 1NV3A 1FPBA 1D9QA 1FPDA 1LBWA 2P3NA 4I40A 1DBZA 4MJOA 2WEFA 3KC0A 3FBPA 1LBVA 1G0HA 1IMEA 5T3JA 1KZ8A 3RPLB 1Q9DA 1IMBA 4FBPA 1NV5A 4I3EA 1NV0A 5EQ7A 2F3BA 3IFAA 1RDXA 5ET7A 5ET8A 2CZIA 3D1RA 1FBPA 4GX6A 2WBDA 1G0IA 2QFLA 2VT5A 3IFCA 1NV6A 2FHYA 1FPLA 2Q8MA 4AS5A 4H46A 4O7IA 4H45A 2QVRA 1FJ6A 3RPLA 4AS4A 1FBDA 5ESYA 1NUZA 1SPIA 1XI6A 4GBVA 5DW8A 1FRPA 2F3DA 1NI9A 1LEVA 3QMFA 4I3YA 3BIHA 4QXDA 1BK4A 1FPGA 1FPFA 5EYHA 2FIEA 1IMDA 1EYIA 4GWWA 1FPJA 2Y5LA 1FBCA 4IR8A 1YYZA 2GQ1A 1IMCA 1FBEA 1KA0A 1FBGA 3B8BA 3A29A 4HE1A 4GWYA 1DCUA 1RDZA 2P3VA 1K9ZA 1NV7A 4GX3A 2FBPA 2FVZA 1NUYA 5EYGA 2FIXA 1NV1A 1LBYA 1AWBA 3ROJA 4GWSA 4KXPA 2DDKA 1FJ9A 2OX3A 1YXIA 5IZ1A 5EQ9A 3LUZA 2Q74A 1K9YA 1FPIA 5ET6A 4HXVA 3T0JA 1YZ0A 3KC1A 4HE2A 2QVUA 4G61A 2HHMA 4GX4A 4GWUA 1IMAA 4HE0A 5IZ3A 4GBWA 2CZHA 5FBPA 5ET5A 1FTAA 5LDZA 2Y5KA 5EQ8A 1DK4A 2R8TA 1IMFA 1NUWA 5IZ3B 2QVVA 4GWXA 2OWZA 5A5LA
chains in the Genus database with same CATH superfamily
1YTVA 4RPOA 5EHMA 3KZGA 5ELVA 4NG7A 3FVKA 4O3CA 4PTKA 4QFLA 1EYJA 2QMWA 2KLFA 1O64A 1B1HA 1LFGA 1B7HA 4PAFA 3UP9A 4ZDMA 4ZE9A 2I3WA 1KZ8A 5CI5A 1NV5A 1ZMGA 2Q2CA 3OSRA 3ONMA 1B7ZA 4Q8RA 3C4MA 1URSA 3FUZA 4TLMB 4DI3D 3C9HA 2REJA 2V93A 5H8QB 4ISUA 3QK6A 3TMGA 4ND9A 1POY1 3ECRA 2D21A 5I56B 1PB7A 2O7IA 4LZ5A 1NFTA 4EDPA 1Y4CA 5A5XB 4ELPA 2XXRA 2I48A 4GWWA 4G4PA 5H8SA 4LZ7A 4PCDA 4FORA 1PBQA 5H8QA 3ODBA 2UVIA 1P1WA 4QSDA 2FBPA 3CFZA 4FEBA 3GXAA 3D4CA 3V89B 1B1XA 3T9UA 1AWBA 5A5XA 1SVXB 5H8FB 3L6HA 3N6TA 1QW0A 3I6VA 4YICA 3PD8A 4Q30B 2VP1A 1MXVA 4ESWA 4R6HA 4PQJA 3OD7A 5DVJA 3VLVA 3VLUA 4EQBA 4JSDA 5H8FA 2NWJA 4O3BA 2GHAA 2XA5A 4XIGQ 4F1UA 1IMFA 1MY4A 4JXIA 4P3LA 4R74A 4LZ8A 1EZ9A 4RXLA 4RK2A 3TELA 4QSCA 4PFWA 1VDWA 1URGA 4DIGA 1FQBA 1B05A 2CEXA 2ONRA 1SD3A 5I3SA 4OANA 4WXJA 4IO5A 1N04A 3BKIB 1ZKBA 3TQLA 5AE4A 1LBXA 4ECFA 5LTCA 1FPBA 2WYKA 4RPNA 1G0HA 3FXQA 3O6HA 3H6VA 4OENA 3IOUA 3SETA 1MXZA 3S4UA 5ET8A 2ABHA 1KWHA 2F35A 3S9EA 3HN0A 2L5VA 2Z8EA 1SW1A 3VVFA 2XD2A 3H6WA 2F5XA 1FRPA 2V25A 3C34A 1NI9A 4G77A 1WODA 4I3YA 3HSTA 2RCAA 1FBGA 5I59B 2H99A 2BJJX 2ZZXA 1NV7A 3TUSA 3RGYA 1B3GA 5CRYA 4G68B 2KR0A 3KG2A 4KXPA 3HFUA 5I59A 1DPEA 5IGAA 4U4SA 4G68A 4GX4A 1OMPA 4F2OA 4PAIA 1IXIA 1LB9A 4JVDA 4TQUQ 2DS9A 2AYSA 2HCAA 1S7YA 1PC3A 4IO7A 3CR9A 4ZE8A 4RJZA 1IQ7A 1I6AA 1FBHA 2XXVA 3E3KA 3T22A 5AA4B 1R1NA 5J16A 3KJ7A 3E13X 3H06B 1NMUA 2E1SA 3V8XB 1D9YA 2X7QA 4I40A 2Q88A 3Q25A 1UIVA 5I2NB 2OPDA 3LUYA 5AA4A 1RYOA 4ZECA 1ZJLA 4MLQA 3DELB 3VVEA 4RYAA 3E78A 3JZJA 3S9MC 5I2NA 4IGTA 5F7VA 5ESYA 3IOVA 3EHTA 4GBVA 3TEPA 1LEVA 1FPGA 2AL4A 2FIEA 1MXYA 4IY5A 1VSOA 3KSJA 3RN8A 4DXUA 3TFLA 1QVSA 1Y3NA 1BKAA 2O1MA 2FNCA 1LBBA 4NTLA 4OXVA 4R2BA 4EF2A 3DM0A 1J1NA 1LAFE 5ET6A 3FVNA 4JWXA 3MAMA 1P1UA 1LBCA 2HAUA 5JK4A 3C36A 4AB6A 1IMAA 4PF8A 3U65A 2I49A 2X7PA 3TYHA 3O2AA 4KYSA 4WEDA 5HM4B 3OO9A 5TP9B 1NV2A 5DVFA 4R9FA 5DT6A 2XHDA 4F18A 2WBBA 3B6QA 1Y3PA 3GBBA 2H4IA 4NF0A 3THIA 2DE3A 5FHMA 5TP9A 4F2QA 4FECA 4EQ9A 5IM2A 3FV2A 3FXBA 3PTYA 2F36A 1ELJA 2ZYNA 4YKIA 3O29A 2QMXA 1LAHE 1LB8A 5I5PA 4OA4A 3FJ7A 2CEYA 4MIJA 1NV6A 2Q2AA 4O7IA 2QS1A 2QVRA 4JVIA 4IO6A 1NUZA 1SPIA 2DXYA 2ZNUA 2XXHA 5I84A 4DDDA 1WDNA 3IB2A 1IMDA 2G93A 3QAXA 3QXMA 3KN3A 4HE1A 4OMBA 1JVXA 1D9VA 4KFQA 5I58B 1T0KA 1NV1A 3UA8A 3IX1A 4HCYA 5KDTB 5IZ1A 3K1PA 4DZ1A 1UQWA 4FATA 1ZTYA 2RC9A 2XXYA 4MF3A 3T66A 1A55A 4X1DA 3TKDA 4NE4A 4XKPA 5I58A 2QJEA 3EPEA 3BFTA 5CMBA 4QFPA 5KDTA 5AA2A 3U72A 3TTMA 4PGNA 4N91A 1O63A 3RQTA 1SI1A 3H6TA 2QSXA 3HO7A 4UA8A 3TCHA 2R71A 2JJKA 2GH9A 1B52A 4MH5A 3HHFA 4H67A 1JP4A 5I2KA 3Q28A 3KBZA 2UYFA 2W7YA 4P47A 4C1TA 1ZBMA 2CZLA 4OVRA 3DP6A 4PE5B 4M4GA 2ZYMA 4F1VA 4XKNA 1NNFA 3W9WA 4NGUA 1LLSA 4R73A 1JQFA 4BDQA 2Z8FA 3SEWA 3QSLA 2F3DA 3CG1A 1GR2A 1NH7A 4WKMA 2Z22A 5DEXB 4JVCA 3A29A 1SQYA 4GWYA 2RF1A 2B4MA 2QS2A 1MM6A 1VE4A 2O7UA 4NF4B 1JETA 3IJOB 3R26A 3SEXA 1ZIUA 4BDMA 3O9PA 3K0VA 1B5JA 1PDAA 3H03A 4X9TA 4I8CA 2DVZA 3TCFA 2F34A 1K9YA 4PP0A 4NF4A 4KD5A 3WAFA 4NEDA 4TOZA 4Q5TA 1Y1MA 2DVCA 5FBPA 4OEVA 4PFIA 1FTAA 3E4RA 3FASA 3K1MA 1BTJA 1B6HA 1EYKA 3R7XA 4NN3A 3VDFA 4OERA 5J1DA 3IK6B 3MVWA 2CZKA 2DE2A 4R72A 3OEKA 3MBPA 2V3QA 2PCRA 4GOTA 3FGSA 1DPPA 4R6YA 4EUOA 3RLFE 5CC2A 3PMWA 2P3NA 1FPDA 2E0SA 3KN8A 1GVCA 1CB6A 4H5GA 1FQAA 4R75A 4IO2A 2O1LA 4GLIA 2NXOA 4ZEKA 3MP6A 4AQ4A 1FTKA 5I7IA 2XD3A 1RDXA 4PF6A 1WVJA 1M5EA 4LQ5A 4G8MA 2WBDA 3KGCA 2LAOA 3PD9A 1OVBA 4HW8A 4PFUA 2PT2A 3HV1A 4AS4A 1FBDA 3KOSA 1MY0A 5DW8A 3PPRA 4U1ZA 3G7WA 3H4ZA 4HTGA 1MPBA 4ZEDA 2VHAA 3K6XA 5JTYB 3PPQA 4MEVA 4P56A 2P3VA 3PUWE 4YB6A 4IGRA 3A3UA 3GZGA 4F31B 3LSXA 2FA7A 4I62A 1Z7ME 2B3BA 1MM7A 3O6GA 3ROJA 4GWSA 1IEJA 2B3FA 2OX3A 5JTYA 3ILTB 5HBCA 3S2VA 2ANJA 3G3FA 2Q74A 1Y3QA 3U93A 4PE3A 3OMBA 2DYXA 5AA1A 4PDHA 2QRYA 3GYYA 3MZ9A 3CG3A 4C0RA 3PGFA 3C32A 2QVVA 1D3KA 4GWXA 3O97A 5A5LA 3U94A 3MWBA 1QUJA 1Y4TA 1OLCA 4JWYA 3KEIA 2XXQA 3MP8A 3MSTA 4OQOA 4KYDA 1INPA 3FV1A 3LSFB 1CNQA 3RYDA 1Q1KA 3KN7A 5CBSA 2THIA 2QS4A 2WEFA 3N5LA 2HEUA 4OFJA 3MJNA 5ISUA 5DVIA 2OJTA 1LAGE 4YKJA 4O8MA 3MVZA 3JV9A 4I3EA 3HHGA 2PMSA 1NV0A 1TFAA 2UVJA 4O7MA 4KR5A 3ZS6A 4F3PA 4QRZA 3EKIA 4N8GA 3Q29A 1VR5A 2FHYA 3TAJA 3NOHA 1UTHB 5ITPA 4QSEA 1DOTA 1XVXA 1R6ZA 4F3GA 3K6WA 2GRVA 2PX1A 1MDP1 1MY2A 1MS7A 2F8DA 3BIHA 3UIFA 4PFRA 2H9BA 1IMCA 5DYHA 1UTHA 4X8RA 3FVGA 4QFNA 1K9ZA 1GGGA 4G2ZA 2H25A 5AA2D 4ZZAA 2X26A 3H3GA 5EQ9A 3FZVA 4HXVA 2WKYA 2RC7A 4ZEFA 2DWJA 4U1OA 5FHOA 1MQJA 3F11A 4GBWA 2CZHA 3PPPA 4EXLA 3CRBA 4OZ9A 4M1VA 4U22A 4NAPA 1LCTA 1FTJA 1Y20A 1LBZA 3MZBA 3ZSFA 1A99A 4F39A 1IXHA 4PBQA 3OELA 3LV0A 1OIBA 1N3XA 2B4LA 4N81A 2B65A 4GWOA 3T9VA 3VFJA 3SKPA 2V3TA 4GL8A 1TXFA 4IY6A 2HXWA 2PFYA 3AXFA 3CSGA 4XFEA 2Y7IA 3K6UA 2Y7WA 1IMBA 5CMKA 5H8NA 1JEVA 2YJPA 4POXA 5IAIA 4IO3A 1IIWA 4H0WA 3TZAA 3C33A 3DLNA 4PETA 1QKAA 3CHGA 4RA1A 1B3FA 1EZPA 2O69A 1SBPA 2UVGA 4OVJA 1MH4A 1B4HA 1EH3A 4P9KA 2ZNTA 1NH8A 3FIRA 3DP8A 4N15A 3WAEA 4MCOA 4LP2B 2OZZA 1MXWA 3FATA 1B58A 4OETA 3M3KA 4PFTA 4YMAA 1N84A 4RNSA 2ZZWA 4KI0E 4OVPA 4R2FA 2QVUA 4P1EA 3T1BA 4EQ7A 4DCYA 5IZ3A 3CFLA 3RPWA 4U23A 3MPLA 4LQ2A 5L9SA 5M2VA 1EU8A 4GWZA 1B4ZA 5F24A 2XXWA 3EF7A 2O84X 3TPAA 2QS3A 1LGBC 4MBPA 3R6UA 3MUQA 4U4XA 2REGA 4KPTA 5L9MA 3TTNA 2ONKE 1DMBA 4ELOA 5L9OA 4LUBA 3A09A 4MJOA 2Y7RA 5KCJB 1LBVA 3OO8A 4ELRA 1URDA 1I6QA 2HQ0A 4FBPA 3MZ1A 4FIMA 3MP1A 1S50A 2DSFA 4MX6A 2XWOA 3EQ1A 2I0BA 5KCJA 4F19A 2WYPA 1F9BA 2NOOA 2DP8A 2PT1A 1XI6A 2R9JA 1XC1A 2ZXTA 5F1QA 1N7WA 1BIYA 3QMFA 3V5AA 4QXDA 5CMCA 5IZZA 3E79A 1YYZA 1MQHA 4YAHX 5TU0A 2DOJA 1DCUA 1A40A 1B5IA 1NUYA 5AA3A 2RC8A 5EYGA 2O6AA 1IUDA 2QL3A 2OWSA 1I6BA 4X48A 4N13A 5IKBA 4I1DA 1NL5A 4YKKA 4PDDA 4Z7EA 1QUIA 4HE2A 3B50A 3T96B 4YMBA 1ANFA 2XXXA 4GWUA 3MYUA 3CFXA 3PU5A 1IXCA 3SESA 2DE4A 3G3IA 2Y5KA 4QFKA 4O3AA 1NUWA 1SW4A 1B5HA 1XS5A 3PUVE 3OO6A 5AA2B 2F7BA 5EQAA 1N76A 2O68A 3QIMA 4NWCA 3VV5A 1GV8A 3RUMA 2VD2A 2H98A 3D4GA 3MVXA 1FPEA 5TPAA 5I2KB 4R9GA 3BIGA 4AB5A 1A54A 3QUFA 3TTKA 1Y1ZA 4NX1A 2PYYA 1DBZA 1QULA 4XXUA 1TT1A 2RINA 3KSXA 1Q9DA 1MQDA 1S9TA 4H5FA 1TFDA 1H43A 1QKBA 1AH5A 1NKXA 5LOMA 2Q9TA 5ET7A 3CI8A 3E9XA 3B7DA 1AIVA 5H8HB 1JW1A 3SERA 2OK2A 1SDXA 3M8UA 3SEYA 1USYE 3MPKA 2XX8A 4H6DA 2F97A 1BK4A 4YKPA 4PAKA 2HPGA 5H8HA 4ONYA 3VE1B 4JSOA 4DXCA 1Y9UA 2NUVA 3FJGA 1USYH 4FJPA 2ZMBA 1HSJA 4H65A 2DXRA 4N17A 3OO7A 4OVQA 3IORA 3FD3A 2F7CA 1YZ0A 1R9QA 4F22A 1LFIA 3G3HA 4HE0A 4MMPA 3OOAA 2V84A 5ET5A 4U2RA 1VFEA 3K2DA 1HSEA 2ESNA 3UORA 1OVTA 1FTMA 1YCJA 2Y84A 4IO4A 3IO6A 3HPIA 1B46A 1UTBB 1P99A 1OLAA 3PV0E 3QUJA 1D9QA 3TCGA 4IB2A 5BWJA 4X1BA 2P2AA 2A5TA 2O51A 1IZ1A 1JEUA 4F29A 1UTBA 3W9VA 2G29A 1QJMA 1OQHA 5EQ7A 2F3BA 3IL1B 4QFOA 5B70A 3D1RA 1FBPA 4GX6A 3EHUA 2Q8MA 4H46A 4ELQA 3LBSA 1D4NA 1B3EA 3CIJA 3TQWA 1RKMA 2PBWA 1MH3A 2I4CA 4MNCA 4DCXA 4BLAA 2Y5LA 5CBRA 2WX9A 3B8BA 2Y7KA 5ICQA 3DP4A 2AIXA 4G8NA 2YLNA 4GX3A 5ICTA 2XXPA 2UXAA 3PMXA 3S9NC 3K1NA 3U92A 1YXIA 3SEVA 2A5SA 1N0TA 4FEDA 2XXIA 4OEUA 3T93B 2XXTA 4F3BA 3OXNA 3PPNA 2HXRA 3M3FA 4YB7A 1YAEA 2XXUA 1JNFA 1LFHA 4G68C 4GFRA 4ZZEA 1PB8A 3K02A 4LN5A 3VXCA 3OENA 3KJTA 3B6TA 4PFBA 4L17A 1TWYA 2OPEA 1P1OA 4Z0IA 4P0GA 3IO4A 4H1XA 1A8EA 3LSWA 5B7DA 3TDJA 4KCDA 2FYIA 3VXBA 3GLBA 3IJXB 3ZKKA 3FJMA 1LSTA 2P0SA 2VT5A 1P1NA 3KFMA 5I56A 1A8FA 4AS5A 3RT6B 4THIA 4H45A 1JW4A 3LC8A 1MQGA 5EYHA 2ZYOA 4NF6B 1NNPA 4JDFA 1POTA 3UN6A 4E0XA 4N6PA 4XKQA 3PUYE 4PFYA 1FQDA 4N4UA 1B3HA 4OTEA 2VPNA 1BLFA 3BFUA 1FJ9A 4YB5A 4BDOA 4NF6A 2OWTA 1M5BA 4FE8A 1MDQA 2DWIA 3OEMA 3A3CA 2ZZVA 3T0JA 3KBRA 2NVUB 1XVYA 1DSNA 3ILUB 5FHNA 1CE2A 1XOCA 3H6UA 3PUZE 3RY3A 3HCQA 2VPOA 4UACA 4HCWA 5ITOA 4HS7A 5K2XA 1FBFA 2RKMA 3RNNA 3W15C 1RDYA 5EYFA 3RTWB 1FSAA 1MXUA 4TLLB 1L5TA 1FW0A 2OCUA 3LR1A 3N94A 1B2HA 4OVSA 1H45A 2ZNSA 2HZKA 4GVOA 2I3VA 3KC0A 1FTLA 3CVGA 5CM6A 1JW5A 5T3JA 1US5A 3Q26A 1B0HA 3V83A 5I57B 4EXKA 3IAZA 4F1YA 4LATA 1DTGA 2ZYKA 1XT8A 4O94A 4OFLA 5H8NB 3RTFB 3K00A 1MXXA 2UYEA 2QFLA 3UGWA 1HSLA 1MRPA 1FJ6A 3MW0A 2OLBA 2VD3A 4QBAA 5I57A 2IEEA 1M5CA 4GXAA 1FPFA 4MLVA 1FPJA 2GQ1A 1FBEA 4DXBA 4F3SA 1RDZA 2Y7PA 4H8JA 1LAXA 3O66A 5BUUA 4ESXA 4ZEIA 1LBYA 3H7MA 1B0LA 1FQCA 2QPQA 4NF5B 3USDA 3S9LC 4R6KA 3LUZA 3TTLA 3G3JA 3SZPA 3BBRA 1MQIA 3G3KA 2RCBA 4G61A 2HHMA 1PB9A 4GQOA 4WEPA 1B51A 4NF5A 5EQ8A 2V4CA 5IZ3B 2OWZA 2I0CA 2XXKA 4KQPA 4NHBA 3K6VA 1AOVA 2F7AA 4X04A 3U8QA 1N7XA 1KA1A 2R6GE 4BDRA 3M3LA 2F78A 1XHYA 4DI4B 1NUXA 1R9LA 1LBWA 1DTZA 3I5OA 4OVTA 3FXRA 1OQGA 2Q89A 3ZKLA 1IMEA 4DE8A 3GBAA 3RPLB 2XWKA 1MPDA 4GD5A 4Q0CA 4GXSB 4GL0A 3K4UA 4EF1A 1G0IA 3IFCA 1MG1A 1FPLA 3RT8A 2DWHA 3N6UA 2CMOA 3RPLA 4OWDA 3CSBA 2D5WA 1H3DA 3MQ9A 5L8DA 4XTCQ 4H8IA 4G8HA 1AMFA 3MC2A 1KA0A 4GRKA 4N6KA 4OHNA 3IOWA 4NMYA 3IR1A 1YPNA 3C35A 4MFIA 3EHSA 1ZU0A 4NQ8A 4OESA 3O6IA 3QYTA 3SEUA 1LCFA 3PMVA 4E0WA 1BP5A 5K2YA 3VVDA 3JYRA 3O28A 3G3GA 5LDZA 4I9DA 1M5DA 1DK4A 2R8TA 4GF8A 5JEIA 1H44A 2MKZA 2H5YA 3VLWA 1FQFA 1ZLQA 5DTBA 1QUKA 3PPOA 4K3FA 1B3LA 1NV4A 2ONSA 2OBGA 4ZS9A 1SW5A 2XX7A 1FPKA 1NNKA 1N3WA 4C1UA 5FTIA 1Q35A 2DQVA 4P0IA 1NV3A 4RK9A 4N8YA 5TPAB 3FBPA 4U21A 3SDFA 3IOTA 5FTHA 4PGPA 2D3IA 2AL5A 2PFZA 3IFAA 1MPCA 1SW2A 2CZIA 3B6WA 4FAJA 3P7IA 1RYXA 2DWAA 2I6EA 4YZZA 1I69A 2KQZA 1B32A 1VFDA 3LSLA 3TTRA 2Z23A 2F6PA 1EYIA 3K01A 1II5A 3IB1A 2F6GA 4PC9A 1IITA 1FQEA 2FVZA 2XWIA 4QF9A 4NF8B 2IA4A 2HZLA 2FIXA 4JBZA 4OYVA 1MY3A 1SYHA 1PBPA 1NNTA 3UK4A 1H76A 5EHSA 3C31A 4BDLA 4POWA 4MHFA 4NF8A 4KYEA 3L6GA 4XKRA 2P1SA 4QHQA 3I3VA 3T9HB 1B40A 3PUXE 4LONB 3N26A 2ALUA 2UVHA 4RY1A 4ZEBA 4JB7A 3MVYA 4DLDA 2BJIA 2M8CA 1QGXA 5HPQA 2VGQA 1JVYA 3T9XB 1MY1A 1A7LA 3OSQA 4YU0A 2Z8DA 4MNPA 4P11A 1EZOA 2HAVA 1SI0A 4BDNA 1B7UA 1SYIA 3FXUA 1O7TA 3TODA 2A5TB 2HFBA 4MNIA 1ATGA 3IB0A 4P8BA 2XWVA 1IXGA 2GFEA 1M5FA 4KCCA 2YPNA 4OFOA 4P1LA 3Q27A 4LVQA 4UABA 5DEXA 3ISPA 4PBHA 3KOTA 1AL3A 1FBCA 1GTKA 4IR8A 3FVOA 1Z7NE 1B9JA 2VOZA 4N07A 1FTOA 5KZTA 5CMMA 4NWDA 2DDKA 4JWOA 2V3UA 1FPIA 4LA9A 3KC1A 3U1OA 1US4A 2I58A 4XEQA 1FCKA 4KHZE 2PVUA 4MAGA 4N6DA 2I4BA 1P1QA 1UIUA 2Q8JA 3EN3A 1PEBA 2GHBA 4XF5A 4GIZA 2XX9A
chains in the Genus database with same CATH topology
4GWZA 1FBFA 2JJKA 5F24A 1JP4A 1RDYA 4NG7A 3KBZA 1FSAA 4P47A 4PTKA 1EYJA 4OVSA 4OVRA 4MJOA 2HZKA 4PAFA 3KC0A 1LBVA 5CM6A 5T3JA 1KZ8A 4F1VA 4FBPA 1NV5A 3W9WA 4NGUA 4MX6A 4O94A 2XWOA 4DI3D 2QFLA 1FJ6A 4F19A 2WYPA 1XI6A 4QBAA 2F3DA 3QMFA 4QXDA 1FPFA 5IZZA 4JVCA 3E79A 4GWWA 1FPJA 1YYZA 2GQ1A 1FBEA 4PCDA 3A29A 4GWYA 1DCUA 1RDZA 2B4MA 2FBPA 1NUYA 5EYGA 1LBYA 1AWBA 4X9TA 2QPQA 2DVZA 4YICA 4PDDA 3LUZA 3SZPA 1K9YA 4HE2A 3B50A 4G61A 2HHMA 4GWUA 3MYUA 5FBPA 4PFIA 2DE4A 1FTAA 2Y5KA 5EQ8A 2XA5A 4F1UA 1IMFA 1NUWA 2V4CA 5IZ3B 4P3LA 2OWZA 2XXKA 1EYKA 4NHBA 4NN3A 5J1DA 2CZKA 5EQAA 4X04A 2DE2A 1VDWA 2V3QA 2PCRA 1KA1A 2CEXA 5I3SA 4OANA 1FPEA 4DI4B 1NUXA 3BIGA 1LBXA 5LTCA 4NX1A 1FPBA 1FPDA 1LBWA 2P3NA 2WYKA 1DBZA 4OVTA 1G0HA 1IMEA 3RPLB 1Q9DA 2XWKA 5I7IA 1RDXA 2Q9TA 5ET7A 5ET8A 4PF6A 2WBDA 1G0IA 3IFCA 2L5VA 1FPLA 3RPLA 4AS4A 1FBDA 5DW8A 2F5XA 1FRPA 1NI9A 4I3YA 1BK4A 4PAKA 2HPGA 1KA0A 1FBGA 4N6KA 4MEVA 4P56A 2P3VA 2ZZXA 1NV7A 4NQ8A 2KR0A 3ROJA 4GWSA 4KXPA 2OX3A 4N17A 3HFUA 4OVQA 5IGAA 2Q74A 1YZ0A 4PE3A 4GX4A 4PDHA 3GYYA 4PAIA 4HE0A 4MMPA 4JVDA 5ET5A 5LDZA 1DK4A 2R8TA 2QVVA 2MKZA 4GWXA 5A5LA 1FBHA 1NV4A 5J16A 3MSTA 1FPKA 1INPA 1CNQA 3RYDA 1NV3A 1D9QA 4I40A 2WEFA 4N8YA 3FBPA 4O8MA 4PGPA 3W9VA 4I3EA 1NV0A 5EQ7A 2F3BA 2PFZA 3IFAA 4O7MA 3E78A 2CZIA 3D1RA 1FBPA 4GX6A 3EKIA 4N8GA 2FHYA 4YZZA 2Q8MA 4H46A 3NOHA 2KQZA 5ESYA 4GBVA 1LEVA 3BIHA 1FPGA 2FIEA 1EYIA 4MNCA 2Y5LA 4PFRA 2WX9A 1IMCA 3B8BA 4X8RA 1K9ZA 4PC9A 4GX3A 2FVZA 2XWIA 2HZLA 2FIXA 1YXIA 5EQ9A 5ET6A 4HXVA 4MHFA 5JK4A 1IMAA 4PF8A 4GBWA 2CZHA 3U65A 2HXRA 4M1VA 4NAPA 1NV2A 1LBZA 2BJIA 4F18A 2WBBA 1QGXA 4PBQA 3LV0A 4LN5A 4NF0A 2B4LA 4N81A 4MNPA 2DE3A 4PFBA 5IM2A 3FXBA 3PTYA 2PFYA 4XFEA 1IMBA 4MNIA 4P8BA 2XWVA 5I5PA 4OA4A 2CEYA 4MIJA 2VT5A 1NV6A 4PETA 4AS5A 4O7IA 4H45A 3CHGA 4P1LA 4UABA 4JVIA 1NUZA 1SPIA 3ISPA 4PBHA 5EYHA 1IMDA 1FBCA 4IR8A 4P9KA 4HE1A 4N15A 4N4UA 2VPNA 4MCOA 1NV1A 4HCYA 2DDKA 1FJ9A 5IZ1A 1FPIA 2ZZVA 2ZZWA 4OVPA 3T0JA 3KC1A 2QVUA 4XEQA 4P1EA 3T1BA 4MAGA 5IZ3A 4N6DA 4PGNA 4N91A 2VPOA 4XF5A 4HCWA 2QVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYK A;  4GWZ A;  1FBF A;  1NV2 A;  2JJK A;  5F24 A;  2CZK A;  1LBZ A;  1FBH A;  2BJI A;  5EQA A;  1NV4 A;  2WBB A;  1QGX A;  1VDW A;  1JP4 A;  1RDY A;  2PCR A;  1KA1 A;  3KBZ A;  3LV0 A;  1FSA A;  5J16 A;  5I3S A;  1FPK A;  4N81 A;  1FPE A;  1NUX A;  1INP A;  4PTK A;  1EYJ A;  1CNQ A;  3RYD A;  3BIG A;  1LBX A;  1NV3 A;  1FPB A;  1D9Q A;  1FPD A;  1LBW A;  2P3N A;  4I40 A;  1DBZ A;  4MJO A;  2WEF A;  3KC0 A;  3FBP A;  1LBV A;  1G0H A;  1IME A;  5T3J A;  1KZ8 A;  3RPL B;  1Q9D A;  1IMB A;  4FBP A;  1NV5 A;  4I3E A;  1NV0 A;  5EQ7 A;  2F3B A;  3IFA A;  1RDX A;  5ET7 A;  5ET8 A;  2CZI A;  3D1R A;  1FBP A;  4GX6 A;  2WBD A;  1G0I A;  2QFL A;  2VT5 A;  3IFC A;  1NV6 A;  2FHY A;  1FPL A;  2Q8M A;  4AS5 A;  4H46 A;  4O7I A;  4H45 A;  2QVR A;  1FJ6 A;  3RPL A;  4AS4 A;  1FBD A;  5ESY A;  1NUZ A;  1SPI A;  1XI6 A;  4GBV A;  5DW8 A;  1FRP A;  2F3D A;  1NI9 A;  1LEV A;  3QMF A;  4I3Y A;  3BIH A;  4QXD A;  1BK4 A;  1FPG A;  1FPF A;  5EYH A;  2FIE A;  1IMD A;  1EYI A;  4GWW A;  1FPJ A;  2Y5L A;  1FBC A;  4IR8 A;  1YYZ A;  2GQ1 A;  1IMC A;  1FBE A;  1KA0 A;  1FBG A;  3B8B A;  3A29 A;  4HE1 A;  4GWY A;  1DCU A;  1RDZ A;  2P3V A;  1K9Z A;  1NV7 A;  4GX3 A;  2FBP A;  2FVZ A;  1NUY A;  5EYG A;  2FIX A;  1NV1 A;  1LBY A;  1AWB A;  3ROJ A;  4GWS A;  4KXP A;  2DDK A;  1FJ9 A;  2OX3 A;  1YXI A;  5IZ1 A;  5EQ9 A;  3LUZ A;  2Q74 A;  1K9Y A;  1FPI A;  5ET6 A;  4HXV A;  3T0J A;  1YZ0 A;  3KC1 A;  4HE2 A;  2QVU A;  4G61 A;  2HHM A;  4GX4 A;  4GWU A;  1IMA A;  4HE0 A;  5IZ3 A;  4GBW A;  2CZH A;  5FBP A;  5ET5 A;  1FTA A;  5LDZ A;  2Y5K A;  5EQ8 A;  1DK4 A;  2R8T A;  1IMF A;  1NUW A;  5IZ3 B;  2QVV A;  4GWX A;  2OWZ A;  5A5L A; 
#chains in the Genus database with same CATH topology
 1YTV A;  4RPO A;  5EHM A;  3KZG A;  5ELV A;  4NG7 A;  3FVK A;  4O3C A;  4PTK A;  4QFL A;  1EYJ A;  2QMW A;  2KLF A;  1O64 A;  1B1H A;  1LFG A;  1B7H A;  4PAF A;  3UP9 A;  4ZDM A;  4ZE9 A;  2I3W A;  1KZ8 A;  5CI5 A;  1NV5 A;  1ZMG A;  2Q2C A;  3OSR A;  3ONM A;  1B7Z A;  4Q8R A;  3C4M A;  1URS A;  3FUZ A;  4TLM B;  4DI3 D;  3C9H A;  2REJ A;  2V93 A;  5H8Q B;  4ISU A;  3QK6 A;  3TMG A;  4ND9 A;  1POY 1;  3ECR A;  2D21 A;  5I56 B;  1PB7 A;  2O7I A;  4LZ5 A;  1NFT A;  4EDP A;  1Y4C A;  5A5X B;  4ELP A;  2XXR A;  2I48 A;  4GWW A;  4G4P A;  5H8S A;  4LZ7 A;  4PCD A;  4FOR A;  1PBQ A;  5H8Q A;  3ODB A;  2UVI A;  1P1W A;  4QSD A;  2FBP A;  3CFZ A;  4FEB A;  3GXA A;  3D4C A;  3V89 B;  1B1X A;  3T9U A;  1AWB A;  5A5X A;  1SVX B;  5H8F B;  3L6H A;  3N6T A;  1QW0 A;  3I6V A;  4YIC A;  3PD8 A;  4Q30 B;  2VP1 A;  1MXV A;  4ESW A;  4R6H A;  4PQJ A;  3OD7 A;  5DVJ A;  3VLV A;  3VLU A;  4EQB A;  4JSD A;  5H8F A;  2NWJ A;  4O3B A;  2GHA A;  2XA5 A;  4XIG Q;  4F1U A;  1IMF A;  1MY4 A;  4JXI A;  4P3L A;  4R74 A;  4LZ8 A;  1EZ9 A;  4RXL A;  4RK2 A;  3TEL A;  4QSC A;  4PFW A;  1VDW A;  1URG A;  4DIG A;  1FQB A;  1B05 A;  2CEX A;  2ONR A;  1SD3 A;  5I3S A;  4OAN A;  4WXJ A;  4IO5 A;  1N04 A;  3BKI B;  1ZKB A;  3TQL A;  5AE4 A;  1LBX A;  4ECF A;  5LTC A;  1FPB A;  2WYK A;  4RPN A;  1G0H A;  3FXQ A;  3O6H A;  3H6V A;  4OEN A;  3IOU A;  3SET A;  1MXZ A;  3S4U A;  5ET8 A;  2ABH A;  1KWH A;  2F35 A;  3S9E A;  3HN0 A;  2L5V A;  2Z8E A;  1SW1 A;  3VVF A;  2XD2 A;  3H6W A;  2F5X A;  1FRP A;  2V25 A;  3C34 A;  1NI9 A;  4G77 A;  1WOD A;  4I3Y A;  3HST A;  2RCA A;  1FBG A;  5I59 B;  2H99 A;  2BJJ X;  2ZZX A;  1NV7 A;  3TUS A;  3RGY A;  1B3G A;  5CRY A;  4G68 B;  2KR0 A;  3KG2 A;  4KXP A;  3HFU A;  5I59 A;  1DPE A;  5IGA A;  4U4S A;  4G68 A;  4GX4 A;  1OMP A;  4F2O A;  4PAI A;  1IXI A;  1LB9 A;  4JVD A;  4TQU Q;  2DS9 A;  2AYS A;  2HCA A;  1S7Y A;  1PC3 A;  4IO7 A;  3CR9 A;  4ZE8 A;  4RJZ A;  1IQ7 A;  1I6A A;  1FBH A;  2XXV A;  3E3K A;  3T22 A;  5AA4 B;  1R1N A;  5J16 A;  3KJ7 A;  3E13 X;  3H06 B;  1NMU A;  2E1S A;  3V8X B;  1D9Y A;  2X7Q A;  4I40 A;  2Q88 A;  3Q25 A;  1UIV A;  5I2N B;  2OPD A;  3LUY A;  5AA4 A;  1RYO A;  4ZEC A;  1ZJL A;  4MLQ A;  3DEL B;  3VVE A;  4RYA A;  3E78 A;  3JZJ A;  3S9M C;  5I2N A;  4IGT A;  5F7V A;  5ESY A;  3IOV A;  3EHT A;  4GBV A;  3TEP A;  1LEV A;  1FPG A;  2AL4 A;  2FIE A;  1MXY A;  4IY5 A;  1VSO A;  3KSJ A;  3RN8 A;  4DXU A;  3TFL A;  1QVS A;  1Y3N A;  1BKA A;  2O1M A;  2FNC A;  1LBB A;  4NTL A;  4OXV A;  4R2B A;  4EF2 A;  3DM0 A;  1J1N A;  1LAF E;  5ET6 A;  3FVN A;  4JWX A;  3MAM A;  1P1U A;  1LBC A;  2HAU A;  5JK4 A;  3C36 A;  4AB6 A;  1IMA A;  4PF8 A;  3U65 A;  2I49 A;  2X7P A;  3TYH A;  3O2A A;  4KYS A;  4WED A;  5HM4 B;  3OO9 A;  5TP9 B;  1NV2 A;  5DVF A;  4R9F A;  5DT6 A;  2XHD A;  4F18 A;  2WBB A;  3B6Q A;  1Y3P A;  3GBB A;  2H4I A;  4NF0 A;  3THI A;  2DE3 A;  5FHM A;  5TP9 A;  4F2Q A;  4FEC A;  4EQ9 A;  5IM2 A;  3FV2 A;  3FXB A;  3PTY A;  2F36 A;  1ELJ A;  2ZYN A;  4YKI A;  3O29 A;  2QMX A;  1LAH E;  1LB8 A;  5I5P A;  4OA4 A;  3FJ7 A;  2CEY A;  4MIJ A;  1NV6 A;  2Q2A A;  4O7I A;  2QS1 A;  2QVR A;  4JVI A;  4IO6 A;  1NUZ A;  1SPI A;  2DXY A;  2ZNU A;  2XXH A;  5I84 A;  4DDD A;  1WDN A;  3IB2 A;  1IMD A;  2G93 A;  3QAX A;  3QXM A;  3KN3 A;  4HE1 A;  4OMB A;  1JVX A;  1D9V A;  4KFQ A;  5I58 B;  1T0K A;  1NV1 A;  3UA8 A;  3IX1 A;  4HCY A;  5KDT B;  5IZ1 A;  3K1P A;  4DZ1 A;  1UQW A;  4FAT A;  1ZTY A;  2RC9 A;  2XXY A;  4MF3 A;  3T66 A;  1A55 A;  4X1D A;  3TKD A;  4NE4 A;  4XKP A;  5I58 A;  2QJE A;  3EPE A;  3BFT A;  5CMB A;  4QFP A;  5KDT A;  5AA2 A;  3U72 A;  3TTM A;  4PGN A;  4N91 A;  1O63 A;  3RQT A;  1SI1 A;  3H6T A;  2QSX A;  3HO7 A;  4UA8 A;  3TCH A;  2R71 A;  2JJK A;  2GH9 A;  1B52 A;  4MH5 A;  3HHF A;  4H67 A;  1JP4 A;  5I2K A;  3Q28 A;  3KBZ A;  2UYF A;  2W7Y A;  4P47 A;  4C1T A;  1ZBM A;  2CZL A;  4OVR A;  3DP6 A;  4PE5 B;  4M4G A;  2ZYM A;  4F1V A;  4XKN A;  1NNF A;  3W9W A;  4NGU A;  1LLS A;  4R73 A;  1JQF A;  4BDQ A;  2Z8F A;  3SEW A;  3QSL A;  2F3D A;  3CG1 A;  1GR2 A;  1NH7 A;  4WKM A;  2Z22 A;  5DEX B;  4JVC A;  3A29 A;  1SQY A;  4GWY A;  2RF1 A;  2B4M A;  2QS2 A;  1MM6 A;  1VE4 A;  2O7U A;  4NF4 B;  1JET A;  3IJO B;  3R26 A;  3SEX A;  1ZIU A;  4BDM A;  3O9P A;  3K0V A;  1B5J A;  1PDA A;  3H03 A;  4X9T A;  4I8C A;  2DVZ A;  3TCF A;  2F34 A;  1K9Y A;  4PP0 A;  4NF4 A;  4KD5 A;  3WAF A;  4NED A;  4TOZ A;  4Q5T A;  1Y1M A;  2DVC A;  5FBP A;  4OEV A;  4PFI A;  1FTA A;  3E4R A;  3FAS A;  3K1M A;  1BTJ A;  1B6H A;  1EYK A;  3R7X A;  4NN3 A;  3VDF A;  4OER A;  5J1D A;  3IK6 B;  3MVW A;  2CZK A;  2DE2 A;  4R72 A;  3OEK A;  3MBP A;  2V3Q A;  2PCR A;  4GOT A;  3FGS A;  1DPP A;  4R6Y A;  4EUO A;  3RLF E;  5CC2 A;  3PMW A;  2P3N A;  1FPD A;  2E0S A;  3KN8 A;  1GVC A;  1CB6 A;  4H5G A;  1FQA A;  4R75 A;  4IO2 A;  2O1L A;  4GLI A;  2NXO A;  4ZEK A;  3MP6 A;  4AQ4 A;  1FTK A;  5I7I A;  2XD3 A;  1RDX A;  4PF6 A;  1WVJ A;  1M5E A;  4LQ5 A;  4G8M A;  2WBD A;  3KGC A;  2LAO A;  3PD9 A;  1OVB A;  4HW8 A;  4PFU A;  2PT2 A;  3HV1 A;  4AS4 A;  1FBD A;  3KOS A;  1MY0 A;  5DW8 A;  3PPR A;  4U1Z A;  3G7W A;  3H4Z A;  4HTG A;  1MPB A;  4ZED A;  2VHA A;  3K6X A;  5JTY B;  3PPQ A;  4MEV A;  4P56 A;  2P3V A;  3PUW E;  4YB6 A;  4IGR A;  3A3U A;  3GZG A;  4F31 B;  3LSX A;  2FA7 A;  4I62 A;  1Z7M E;  2B3B A;  1MM7 A;  3O6G A;  3ROJ A;  4GWS A;  1IEJ A;  2B3F A;  2OX3 A;  5JTY A;  3ILT B;  5HBC A;  3S2V A;  2ANJ A;  3G3F A;  2Q74 A;  1Y3Q A;  3U93 A;  4PE3 A;  3OMB A;  2DYX A;  5AA1 A;  4PDH A;  2QRY A;  3GYY A;  3MZ9 A;  3CG3 A;  4C0R A;  3PGF A;  3C32 A;  2QVV A;  1D3K A;  4GWX A;  3O97 A;  5A5L A;  3U94 A;  3MWB A;  1QUJ A;  1Y4T A;  1OLC A;  4JWY A;  3KEI A;  2XXQ A;  3MP8 A;  3MST A;  4OQO A;  4KYD A;  1INP A;  3FV1 A;  3LSF B;  1CNQ A;  3RYD A;  1Q1K A;  3KN7 A;  5CBS A;  2THI A;  2QS4 A;  2WEF A;  3N5L A;  2HEU A;  4OFJ A;  3MJN A;  5ISU A;  5DVI A;  2OJT A;  1LAG E;  4YKJ A;  4O8M A;  3MVZ A;  3JV9 A;  4I3E A;  3HHG A;  2PMS A;  1NV0 A;  1TFA A;  2UVJ A;  4O7M A;  4KR5 A;  3ZS6 A;  4F3P A;  4QRZ A;  3EKI A;  4N8G A;  3Q29 A;  1VR5 A;  2FHY A;  3TAJ A;  3NOH A;  1UTH B;  5ITP A;  4QSE A;  1DOT A;  1XVX A;  1R6Z A;  4F3G A;  3K6W A;  2GRV A;  2PX1 A;  1MDP 1;  1MY2 A;  1MS7 A;  2F8D A;  3BIH A;  3UIF A;  4PFR A;  2H9B A;  1IMC A;  5DYH A;  1UTH A;  4X8R A;  3FVG A;  4QFN A;  1K9Z A;  1GGG A;  4G2Z A;  2H25 A;  5AA2 D;  4ZZA A;  2X26 A;  3H3G A;  5EQ9 A;  3FZV A;  4HXV A;  2WKY A;  2RC7 A;  4ZEF A;  2DWJ A;  4U1O A;  5FHO A;  1MQJ A;  3F11 A;  4GBW A;  2CZH A;  3PPP A;  4EXL A;  3CRB A;  4OZ9 A;  4M1V A;  4U22 A;  4NAP A;  1LCT A;  1FTJ A;  1Y20 A;  1LBZ A;  3MZB A;  3ZSF A;  1A99 A;  4F39 A;  1IXH A;  4PBQ A;  3OEL A;  3LV0 A;  1OIB A;  1N3X A;  2B4L A;  4N81 A;  2B65 A;  4GWO A;  3T9V A;  3VFJ A;  3SKP A;  2V3T A;  4GL8 A;  1TXF A;  4IY6 A;  2HXW A;  2PFY A;  3AXF A;  3CSG A;  4XFE A;  2Y7I A;  3K6U A;  2Y7W A;  1IMB A;  5CMK A;  5H8N A;  1JEV A;  2YJP A;  4POX A;  5IAI A;  4IO3 A;  1IIW A;  4H0W A;  3TZA A;  3C33 A;  3DLN A;  4PET A;  1QKA A;  3CHG A;  4RA1 A;  1B3F A;  1EZP A;  2O69 A;  1SBP A;  2UVG A;  4OVJ A;  1MH4 A;  1B4H A;  1EH3 A;  4P9K A;  2ZNT A;  1NH8 A;  3FIR A;  3DP8 A;  4N15 A;  3WAE A;  4MCO A;  4LP2 B;  2OZZ A;  1MXW A;  3FAT A;  1B58 A;  4OET A;  3M3K A;  4PFT A;  4YMA A;  1N84 A;  4RNS A;  2ZZW A;  4KI0 E;  4OVP A;  4R2F A;  2QVU A;  4P1E A;  3T1B A;  4EQ7 A;  4DCY A;  5IZ3 A;  3CFL A;  3RPW A;  4U23 A;  3MPL A;  4LQ2 A;  5L9S A;  5M2V A;  1EU8 A;  4GWZ A;  1B4Z A;  5F24 A;  2XXW A;  3EF7 A;  2O84 X;  3TPA A;  2QS3 A;  1LGB C;  4MBP A;  3R6U A;  3MUQ A;  4U4X A;  2REG A;  4KPT A;  5L9M A;  3TTN A;  2ONK E;  1DMB A;  4ELO A;  5L9O A;  4LUB A;  3A09 A;  4MJO A;  2Y7R A;  5KCJ B;  1LBV A;  3OO8 A;  4ELR A;  1URD A;  1I6Q A;  2HQ0 A;  4FBP A;  3MZ1 A;  4FIM A;  3MP1 A;  1S50 A;  2DSF A;  4MX6 A;  2XWO A;  3EQ1 A;  2I0B A;  5KCJ A;  4F19 A;  2WYP A;  1F9B A;  2NOO A;  2DP8 A;  2PT1 A;  1XI6 A;  2R9J A;  1XC1 A;  2ZXT A;  5F1Q A;  1N7W A;  1BIY A;  3QMF A;  3V5A A;  4QXD A;  5CMC A;  5IZZ A;  3E79 A;  1YYZ A;  1MQH A;  4YAH X;  5TU0 A;  2DOJ A;  1DCU A;  1A40 A;  1B5I A;  1NUY A;  5AA3 A;  2RC8 A;  5EYG A;  2O6A A;  1IUD A;  2QL3 A;  2OWS A;  1I6B A;  4X48 A;  4N13 A;  5IKB A;  4I1D A;  1NL5 A;  4YKK A;  4PDD A;  4Z7E A;  1QUI A;  4HE2 A;  3B50 A;  3T96 B;  4YMB A;  1ANF A;  2XXX A;  4GWU A;  3MYU A;  3CFX A;  3PU5 A;  1IXC A;  3SES A;  2DE4 A;  3G3I A;  2Y5K A;  4QFK A;  4O3A A;  1NUW A;  1SW4 A;  1B5H A;  1XS5 A;  3PUV E;  3OO6 A;  5AA2 B;  2F7B A;  5EQA A;  1N76 A;  2O68 A;  3QIM A;  4NWC A;  3VV5 A;  1GV8 A;  3RUM A;  2VD2 A;  2H98 A;  3D4G A;  3MVX A;  1FPE A;  5TPA A;  5I2K B;  4R9G A;  3BIG A;  4AB5 A;  1A54 A;  3QUF A;  3TTK A;  1Y1Z A;  4NX1 A;  2PYY A;  1DBZ A;  1QUL A;  4XXU A;  1TT1 A;  2RIN A;  3KSX A;  1Q9D A;  1MQD A;  1S9T A;  4H5F A;  1TFD A;  1H43 A;  1QKB A;  1AH5 A;  1NKX A;  5LOM A;  2Q9T A;  5ET7 A;  3CI8 A;  3E9X A;  3B7D A;  1AIV A;  5H8H B;  1JW1 A;  3SER A;  2OK2 A;  1SDX A;  3M8U A;  3SEY A;  1USY E;  3MPK A;  2XX8 A;  4H6D A;  2F97 A;  1BK4 A;  4YKP A;  4PAK A;  2HPG A;  5H8H A;  4ONY A;  3VE1 B;  4JSO A;  4DXC A;  1Y9U A;  2NUV A;  3FJG A;  1USY H;  4FJP A;  2ZMB A;  1HSJ A;  4H65 A;  2DXR A;  4N17 A;  3OO7 A;  4OVQ A;  3IOR A;  3FD3 A;  2F7C A;  1YZ0 A;  1R9Q A;  4F22 A;  1LFI A;  3G3H A;  4HE0 A;  4MMP A;  3OOA A;  2V84 A;  5ET5 A;  4U2R A;  1VFE A;  3K2D A;  1HSE A;  2ESN A;  3UOR A;  1OVT A;  1FTM A;  1YCJ A;  2Y84 A;  4IO4 A;  3IO6 A;  3HPI A;  1B46 A;  1UTB B;  1P99 A;  1OLA A;  3PV0 E;  3QUJ A;  1D9Q A;  3TCG A;  4IB2 A;  5BWJ A;  4X1B A;  2P2A A;  2A5T A;  2O51 A;  1IZ1 A;  1JEU A;  4F29 A;  1UTB A;  3W9V A;  2G29 A;  1QJM A;  1OQH A;  5EQ7 A;  2F3B A;  3IL1 B;  4QFO A;  5B70 A;  3D1R A;  1FBP A;  4GX6 A;  3EHU A;  2Q8M A;  4H46 A;  4ELQ A;  3LBS A;  1D4N A;  1B3E A;  3CIJ A;  3TQW A;  1RKM A;  2PBW A;  1MH3 A;  2I4C A;  4MNC A;  4DCX A;  4BLA A;  2Y5L A;  5CBR A;  2WX9 A;  3B8B A;  2Y7K A;  5ICQ A;  3DP4 A;  2AIX A;  4G8N A;  2YLN A;  4GX3 A;  5ICT A;  2XXP A;  2UXA A;  3PMX A;  3S9N C;  3K1N A;  3U92 A;  1YXI A;  3SEV A;  2A5S A;  1N0T A;  4FED A;  2XXI A;  4OEU A;  3T93 B;  2XXT A;  4F3B A;  3OXN A;  3PPN A;  2HXR A;  3M3F A;  4YB7 A;  1YAE A;  2XXU A;  1JNF A;  1LFH A;  4G68 C;  4GFR A;  4ZZE A;  1PB8 A;  3K02 A;  4LN5 A;  3VXC A;  3OEN A;  3KJT A;  3B6T A;  4PFB A;  4L17 A;  1TWY A;  2OPE A;  1P1O A;  4Z0I A;  4P0G A;  3IO4 A;  4H1X A;  1A8E A;  3LSW A;  5B7D A;  3TDJ A;  4KCD A;  2FYI A;  3VXB A;  3GLB A;  3IJX B;  3ZKK A;  3FJM A;  1LST A;  2P0S A;  2VT5 A;  1P1N A;  3KFM A;  5I56 A;  1A8F A;  4AS5 A;  3RT6 B;  4THI A;  4H45 A;  1JW4 A;  3LC8 A;  1MQG A;  5EYH A;  2ZYO A;  4NF6 B;  1NNP A;  4JDF A;  1POT A;  3UN6 A;  4E0X A;  4N6P A;  4XKQ A;  3PUY E;  4PFY A;  1FQD A;  4N4U A;  1B3H A;  4OTE A;  2VPN A;  1BLF A;  3BFU A;  1FJ9 A;  4YB5 A;  4BDO A;  4NF6 A;  2OWT A;  1M5B A;  4FE8 A;  1MDQ A;  2DWI A;  3OEM A;  3A3C A;  2ZZV A;  3T0J A;  3KBR A;  2NVU B;  1XVY A;  1DSN A;  3ILU B;  5FHN A;  1CE2 A;  1XOC A;  3H6U A;  3PUZ E;  3RY3 A;  3HCQ A;  2VPO A;  4UAC A;  4HCW A;  5ITO A;  4HS7 A;  5K2X A;  1FBF A;  2RKM A;  3RNN A;  3W15 C;  1RDY A;  5EYF A;  3RTW B;  1FSA A;  1MXU A;  4TLL B;  1L5T A;  1FW0 A;  2OCU A;  3LR1 A;  3N94 A;  1B2H A;  4OVS A;  1H45 A;  2ZNS A;  2HZK A;  4GVO A;  2I3V A;  3KC0 A;  1FTL A;  3CVG A;  5CM6 A;  1JW5 A;  5T3J A;  1US5 A;  3Q26 A;  1B0H A;  3V83 A;  5I57 B;  4EXK A;  3IAZ A;  4F1Y A;  4LAT A;  1DTG A;  2ZYK A;  1XT8 A;  4O94 A;  4OFL A;  5H8N B;  3RTF B;  3K00 A;  1MXX A;  2UYE A;  2QFL A;  3UGW A;  1HSL A;  1MRP A;  1FJ6 A;  3MW0 A;  2OLB A;  2VD3 A;  4QBA A;  5I57 A;  2IEE A;  1M5C A;  4GXA A;  1FPF A;  4MLV A;  1FPJ A;  2GQ1 A;  1FBE A;  4DXB A;  4F3S A;  1RDZ A;  2Y7P A;  4H8J A;  1LAX A;  3O66 A;  5BUU A;  4ESX A;  4ZEI A;  1LBY A;  3H7M A;  1B0L A;  1FQC A;  2QPQ A;  4NF5 B;  3USD A;  3S9L C;  4R6K A;  3LUZ A;  3TTL A;  3G3J A;  3SZP A;  3BBR A;  1MQI A;  3G3K A;  2RCB A;  4G61 A;  2HHM A;  1PB9 A;  4GQO A;  4WEP A;  1B51 A;  4NF5 A;  5EQ8 A;  2V4C A;  5IZ3 B;  2OWZ A;  2I0C A;  2XXK A;  4KQP A;  4NHB A;  3K6V A;  1AOV A;  2F7A A;  4X04 A;  3U8Q A;  1N7X A;  1KA1 A;  2R6G E;  4BDR A;  3M3L A;  2F78 A;  1XHY A;  4DI4 B;  1NUX A;  1R9L A;  1LBW A;  1DTZ A;  3I5O A;  4OVT A;  3FXR A;  1OQG A;  2Q89 A;  3ZKL A;  1IME A;  4DE8 A;  3GBA A;  3RPL B;  2XWK A;  1MPD A;  4GD5 A;  4Q0C A;  4GXS B;  4GL0 A;  3K4U A;  4EF1 A;  1G0I A;  3IFC A;  1MG1 A;  1FPL A;  3RT8 A;  2DWH A;  3N6U A;  2CMO A;  3RPL A;  4OWD A;  3CSB A;  2D5W A;  1H3D A;  3MQ9 A;  5L8D A;  4XTC Q;  4H8I A;  4G8H A;  1AMF A;  3MC2 A;  1KA0 A;  4GRK A;  4N6K A;  4OHN A;  3IOW A;  4NMY A;  3IR1 A;  1YPN A;  3C35 A;  4MFI A;  3EHS A;  1ZU0 A;  4NQ8 A;  4OES A;  3O6I A;  3QYT A;  3SEU A;  1LCF A;  3PMV A;  4E0W A;  1BP5 A;  5K2Y A;  3VVD A;  3JYR A;  3O28 A;  3G3G A;  5LDZ A;  4I9D A;  1M5D A;  1DK4 A;  2R8T A;  4GF8 A;  5JEI A;  1H44 A;  2MKZ A;  2H5Y A;  3VLW A;  1FQF A;  1ZLQ A;  5DTB A;  1QUK A;  3PPO A;  4K3F A;  1B3L A;  1NV4 A;  2ONS A;  2OBG A;  4ZS9 A;  1SW5 A;  2XX7 A;  1FPK A;  1NNK A;  1N3W A;  4C1U A;  5FTI A;  1Q35 A;  2DQV A;  4P0I A;  1NV3 A;  4RK9 A;  4N8Y A;  5TPA B;  3FBP A;  4U21 A;  3SDF A;  3IOT A;  5FTH A;  4PGP A;  2D3I A;  2AL5 A;  2PFZ A;  3IFA A;  1MPC A;  1SW2 A;  2CZI A;  3B6W A;  4FAJ A;  3P7I A;  1RYX A;  2DWA A;  2I6E A;  4YZZ A;  1I69 A;  2KQZ A;  1B32 A;  1VFD A;  3LSL A;  3TTR A;  2Z23 A;  2F6P A;  1EYI A;  3K01 A;  1II5 A;  3IB1 A;  2F6G A;  4PC9 A;  1IIT A;  1FQE A;  2FVZ A;  2XWI A;  4QF9 A;  4NF8 B;  2IA4 A;  2HZL A;  2FIX A;  4JBZ A;  4OYV A;  1MY3 A;  1SYH A;  1PBP A;  1NNT A;  3UK4 A;  1H76 A;  5EHS A;  3C31 A;  4BDL A;  4POW A;  4MHF A;  4NF8 A;  4KYE A;  3L6G A;  4XKR A;  2P1S A;  4QHQ A;  3I3V A;  3T9H B;  1B40 A;  3PUX E;  4LON B;  3N26 A;  2ALU A;  2UVH A;  4RY1 A;  4ZEB A;  4JB7 A;  3MVY A;  4DLD A;  2BJI A;  2M8C A;  1QGX A;  5HPQ A;  2VGQ A;  1JVY A;  3T9X B;  1MY1 A;  1A7L A;  3OSQ A;  4YU0 A;  2Z8D A;  4MNP A;  4P11 A;  1EZO A;  2HAV A;  1SI0 A;  4BDN A;  1B7U A;  1SYI A;  3FXU A;  1O7T A;  3TOD A;  2A5T B;  2HFB A;  4MNI A;  1ATG A;  3IB0 A;  4P8B A;  2XWV A;  1IXG A;  2GFE A;  1M5F A;  4KCC A;  2YPN A;  4OFO A;  4P1L A;  3Q27 A;  4LVQ A;  4UAB A;  5DEX A;  3ISP A;  4PBH A;  3KOT A;  1AL3 A;  1FBC A;  1GTK A;  4IR8 A;  3FVO A;  1Z7N E;  1B9J A;  2VOZ A;  4N07 A;  1FTO A;  5KZT A;  5CMM A;  4NWD A;  2DDK A;  4JWO A;  2V3U A;  1FPI A;  4LA9 A;  3KC1 A;  3U1O A;  1US4 A;  2I58 A;  4XEQ A;  1FCK A;  4KHZ E;  2PVU A;  4MAG A;  4N6D A;  2I4B A;  1P1Q A;  1UIU A;  2Q8J A;  3EN3 A;  1PEB A;  2GHB A;  4XF5 A;  4GIZ A;  2XX9 A; 
#chains in the Genus database with same CATH homology
 4GWZ A;  1FBF A;  2JJK A;  5F24 A;  1JP4 A;  1RDY A;  4NG7 A;  3KBZ A;  1FSA A;  4P47 A;  4PTK A;  1EYJ A;  4OVS A;  4OVR A;  4MJO A;  2HZK A;  4PAF A;  3KC0 A;  1LBV A;  5CM6 A;  5T3J A;  1KZ8 A;  4F1V A;  4FBP A;  1NV5 A;  3W9W A;  4NGU A;  4MX6 A;  4O94 A;  2XWO A;  4DI3 D;  2QFL A;  1FJ6 A;  4F19 A;  2WYP A;  1XI6 A;  4QBA A;  2F3D A;  3QMF A;  4QXD A;  1FPF A;  5IZZ A;  4JVC A;  3E79 A;  4GWW A;  1FPJ A;  1YYZ A;  2GQ1 A;  1FBE A;  4PCD A;  3A29 A;  4GWY A;  1DCU A;  1RDZ A;  2B4M A;  2FBP A;  1NUY A;  5EYG A;  1LBY A;  1AWB A;  4X9T A;  2QPQ A;  2DVZ A;  4YIC A;  4PDD A;  3LUZ A;  3SZP A;  1K9Y A;  4HE2 A;  3B50 A;  4G61 A;  2HHM A;  4GWU A;  3MYU A;  5FBP A;  4PFI A;  2DE4 A;  1FTA A;  2Y5K A;  5EQ8 A;  2XA5 A;  4F1U A;  1IMF A;  1NUW A;  2V4C A;  5IZ3 B;  4P3L A;  2OWZ A;  2XXK A;  1EYK A;  4NHB A;  4NN3 A;  5J1D A;  2CZK A;  5EQA A;  4X04 A;  2DE2 A;  1VDW A;  2V3Q A;  2PCR A;  1KA1 A;  2CEX A;  5I3S A;  4OAN A;  1FPE A;  4DI4 B;  1NUX A;  3BIG A;  1LBX A;  5LTC A;  4NX1 A;  1FPB A;  1FPD A;  1LBW A;  2P3N A;  2WYK A;  1DBZ A;  4OVT A;  1G0H A;  1IME A;  3RPL B;  1Q9D A;  2XWK A;  5I7I A;  1RDX A;  2Q9T A;  5ET7 A;  5ET8 A;  4PF6 A;  2WBD A;  1G0I A;  3IFC A;  2L5V A;  1FPL A;  3RPL A;  4AS4 A;  1FBD A;  5DW8 A;  2F5X A;  1FRP A;  1NI9 A;  4I3Y A;  1BK4 A;  4PAK A;  2HPG A;  1KA0 A;  1FBG A;  4N6K A;  4MEV A;  4P56 A;  2P3V A;  2ZZX A;  1NV7 A;  4NQ8 A;  2KR0 A;  3ROJ A;  4GWS A;  4KXP A;  2OX3 A;  4N17 A;  3HFU A;  4OVQ A;  5IGA A;  2Q74 A;  1YZ0 A;  4PE3 A;  4GX4 A;  4PDH A;  3GYY A;  4PAI A;  4HE0 A;  4MMP A;  4JVD A;  5ET5 A;  5LDZ A;  1DK4 A;  2R8T A;  2QVV A;  2MKZ A;  4GWX A;  5A5L A;  1FBH A;  1NV4 A;  5J16 A;  3MST A;  1FPK A;  1INP A;  1CNQ A;  3RYD A;  1NV3 A;  1D9Q A;  4I40 A;  2WEF A;  4N8Y A;  3FBP A;  4O8M A;  4PGP A;  3W9V A;  4I3E A;  1NV0 A;  5EQ7 A;  2F3B A;  2PFZ A;  3IFA A;  4O7M A;  3E78 A;  2CZI A;  3D1R A;  1FBP A;  4GX6 A;  3EKI A;  4N8G A;  2FHY A;  4YZZ A;  2Q8M A;  4H46 A;  3NOH A;  2KQZ A;  5ESY A;  4GBV A;  1LEV A;  3BIH A;  1FPG A;  2FIE A;  1EYI A;  4MNC A;  2Y5L A;  4PFR A;  2WX9 A;  1IMC A;  3B8B A;  4X8R A;  1K9Z A;  4PC9 A;  4GX3 A;  2FVZ A;  2XWI A;  2HZL A;  2FIX A;  1YXI A;  5EQ9 A;  5ET6 A;  4HXV A;  4MHF A;  5JK4 A;  1IMA A;  4PF8 A;  4GBW A;  2CZH A;  3U65 A;  2HXR A;  4M1V A;  4NAP A;  1NV2 A;  1LBZ A;  2BJI A;  4F18 A;  2WBB A;  1QGX A;  4PBQ A;  3LV0 A;  4LN5 A;  4NF0 A;  2B4L A;  4N81 A;  4MNP A;  2DE3 A;  4PFB A;  5IM2 A;  3FXB A;  3PTY A;  2PFY A;  4XFE A;  1IMB A;  4MNI A;  4P8B A;  2XWV A;  5I5P A;  4OA4 A;  2CEY A;  4MIJ A;  2VT5 A;  1NV6 A;  4PET A;  4AS5 A;  4O7I A;  4H45 A;  3CHG A;  4P1L A;  4UAB A;  4JVI A;  1NUZ A;  1SPI A;  3ISP A;  4PBH A;  5EYH A;  1IMD A;  1FBC A;  4IR8 A;  4P9K A;  4HE1 A;  4N15 A;  4N4U A;  2VPN A;  4MCO A;  1NV1 A;  4HCY A;  2DDK A;  1FJ9 A;  5IZ1 A;  1FPI A;  2ZZV A;  2ZZW A;  4OVP A;  3T0J A;  3KC1 A;  2QVU A;  4XEQ A;  4P1E A;  3T1B A;  4MAG A;  5IZ3 A;  4N6D A;  4PGN A;  4N91 A;  2VPO A;  4XF5 A;  4HCW A;  2QVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...