2CZHA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) with phosphate ion (orthorhombic form)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
254
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTEEKDLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase 2
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 254
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2czhA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2czhA02
1DCUA 5EYGA 3LUZA 1NV4A 1DK4A 1FBCA 1FJ9A 4I3YA 4G61A 3B8BA 1LBWA 4HE0A 2PCRA 1FPFA 1EYKA 3LV0A 1Q9DA 1FPGA 4GWWA 1G0HA 5DW8A 1IMCA 2WEFA 1SPIA 4GBVA 1FBFA 2CZHA 1NUWA 4I3EA 2WBDA 1IMAA 1JP4A 2DDKA 3RYDA 2QVUA 5I3SA 5F24A 4AS4A 1VDWA 1IMBA 5FBPA 1FJ6A 2P3VA 2JJKA 2BJIA 1FTAA 1CNQA 5A5LA 2Y5KA 3BIHA 1AWBA 1FPJA 2FIXA 4GBWA 4HXVA 1RDXA 1XI6A 1FBDA 2CZKA 5EQ9A 2Q74A 5IZ3A 1EYIA 2OWZA 3KC1A 4IR8A 1KA0A 2Y5LA 4HE1A 4N81A 3IFCA 3RPLB 1LBZA 4GX4A 4GWXA 5IZ3B 5EYHA 1NV6A 2OX3A 4I40A 4H46A 1INPA 2Q8MA 1FPIA 2F3BA 5LDZA 3IFAA 5EQ8A 1FPDA 3KC0A 2FHYA 1K9ZA 3T0JA 5J16A 2F3DA 1FBEA 2QFLA 4GWZA 1IMEA 2HHMA 1BK4A 3FBPA 1NV0A 1K9YA 4H45A 4GWYA 1FBHA 1NV7A 1IMDA 1FSAA 3A29A 1NI9A 1FPBA 2QVRA 4PTKA 1KZ8A 5ET6A 3BIGA 1NUZA 4O7IA 4KXPA 5ESYA 2R8TA 5IZ1A 1RDYA 2CZIA 1FPLA 4QXDA 2VT5A 1YYZA 1NV3A 2FIEA 4MJOA 5T3JA 1RDZA 1QGXA 2GQ1A 1D9QA 1LBVA 1NV5A 5EQ7A 1YXIA 1LBXA 4GX3A 1KA1A 5ET8A 1LEVA 1DBZA 3KBZA 4GWSA 4GX6A 4AS5A 1FPEA 2P3NA 1FRPA 5EQAA 2FVZA 5ET5A 2FBPA 1YZ0A 2WBBA 1LBYA 1NUYA 3QMFA 2QVVA 1FPKA 3ROJA 3RPLA 3D1RA 4GWUA 1FBPA 1NUXA 1IMFA 1FBGA 1EYJA 1NV1A 4HE2A 5ET7A 1NV2A 1G0IA 4FBPA
chains in the Genus database with same CATH superfamily
5ITPA 2AIXA 4PFYA 4NE4A 1VE4A 3FATA 4P11A 2VPOA 4WEPA 1N0TA 4XKNA 2RF1A 3O6GA 1MQGA 4F1YA 4AS4A 3N5LA 1MXWA 1B3HA 4I9DA 2R6GE 3RY3A 5CM6A 1POY1 4NF8B 4ZZAA 1JEVA 2OWZA 4E0XA 3UA8A 1LLSA 5I2NB 3B7DA 1VFEA 5HM4B 3G3JA 3D4GA 5M2VA 1TWYA 2ZYNA 4QSDA 4EXLA 2LAOA 1UTBA 5EQ8A 2B65A 1IUDA 1A8EA 3T0JA 4MNPA 4G68C 3RT6B 3RUMA 5CBSA 1UTHB 2I3WA 2XD3A 4MH5A 2V84A 4NG7A 4OVSA 3C9HA 4KCCA 3OD7A 1NI9A 1FPBA 4PTKA 3QYTA 4OFJA 1WVJA 3SEUA 4MF3A 4PCDA 5ICTA 4P9KA 1DPPA 1LBBA 4F39A 2FIEA 2F34A 1B05A 2QPQA 3KJ7A 4BDRA 4PFIA 3FVKA 3VVDA 2FBPA 2DVCA 1JNFA 1S9TA 4Q30B 2XHDA 2THIA 1ZIUA 1NMUA 4PAFA 1NV2A 4NF6B 4FBPA 3M3FA 3L6GA 1FTMA 3KN8A 4TLMB 4H1XA 1ZU0A 2Y7IA 3P7IA 3FXBA 4R74A 4ELQA 1MXUA 3C31A 2F7BA 2ABHA 4MHFA 3CG3A 2WBDA 3HSTA 2DDKA 3K6XA 3SESA 1B5HA 3R7XA 3CG1A 3K01A 4ECFA 4G8NA 5CMKA 5ISUA 3FASA 3UN6A 2DXYA 4RA1A 1CE2A 3ZKKA 1URDA 1B2HA 4N81A 2MKZA 2RKMA 4GX4A 1MH3A 4R9FA 4LQ5A 4MNCA 1XT8A 2Y7KA 5CMMA 1I6QA 4GQOA 1Y3QA 4NHBA 2GH9A 4KYDA 4EXKA 1O64A 2V3TA 2P1SA 1SI1A 2RCAA 1ZLQA 5I57A 1OVTA 4X9TA 5FHMA 3CIJA 2R8TA 4YKKA 3MJNA 3OENA 1B7HA 4PFUA 4RPOA 5L9SA 4RYAA 1LBCA 4F31B 1MPCA 1R6ZA 2AL4A 3V89B 1LBXA 1AIVA 1MM6A 1BP5A 1UTBB 4GX6A 3E13X 1JQFA 1XHYA 2HAUA 4THIA 1SD3A 2VP1A 1FQAA 1Y3NA 5I2KA 3KOSA 2XXVA 2QMWA 5JTYA 3I5OA 2PFZA 3GZGA 3IX1A 1Q1KA 5I5PA 4DI3D 5DEXA 2V25A 1QJMA 2H99A 1M5FA 1FQDA 1VDWA 4OVRA 3C35A 5CC2A 3G3FA 1CNQA 5A5LA 3U8QA 4R6YA 2ZYOA 2HAVA 1SYIA 2XX8A 2UXAA 1B7ZA 1EYIA 4IR8A 1NH7A 3T1BA 4GF8A 3IFCA 1LBZA 5ELVA 1ANFA 4LA9A 4XEQA 3UORA 3C34A 4EDPA 5FHOA 4N4UA 1FPDA 4OFLA 5J16A 3MSTA 1USYH 2XXRA 1OLAA 3RQTA 5ET6A 1KZ8A 2CEYA 5I56A 4LZ8A 2Y84A 2FNCA 1ZBMA 3Q28A 1XS5A 3GBAA 1UQWA 4U2RA 3MZ1A 4H8IA 1A55A 2Q8JA 1SI0A 4DDDA 2DS9A 5I7IA 3RPLA 2RCBA 3KFMA 3KG2A 5KZTA 2G29A 4YU0A 3IR1A 1G0IA 2O6AA 3MYUA 4PDHA 3LUZA 2RC7A 4ISUA 3H6UA 1MXXA 3C32A 4LVQA 4ZECA 3FD3A 3EHTA 4C0RA 3VLUA 4DXUA 4GL0A 5ICQA 3V5AA 3ISPA 2AYSA 4M4GA 4F3GA 2OZZA 3R26A 1MPDA 3LC8A 1WODA 2DVZA 4ZE8A 2FA7A 5I58B 3LR1A 1MH4A 5I2KB 1DPEA 3QK6A 4LZ7A 4PGPA 2QS2A 1P1WA 4ELRA 5CMBA 1R9LA 2XXWA 2DQVA 5DT6A 5EYHA 3TCFA 2F3BA 4KYSA 1O63A 1JVYA 4POWA 1P1QA 1US5A 2DE2A 5K2XA 4I1DA 2I4BA 3FGSA 4XXUA 4R6HA 1MG1A 4JXIA 5DVFA 3K4UA 4PBQA 3S2VA 3FXQA 4G4PA 2D21A 5I59A 4QXDA 3K1PA 3K1MA 4MBPA 5H8QB 4H5GA 4ELOA 2PBWA 4Z7EA 5KCJB 4PE3A 1D9QA 1LBVA 4L17A 3SKPA 1MQIA 3KBZA 3DM0A 5FHNA 2WBBA 4OEUA 3T9VA 5BWJA 3SZPA 5J1DA 4FE8A 4KI0E 5EYGA 5I56B 5B70A 2OWSA 1HSJA 1UIVA 4I3YA 1A99A 2NXOA 2O1MA 3K02A 2O68A 3HCQA 1EYKA 4JDFA 4ZEIA 1FBFA 1QUIA 2CZHA 1CB6A 1NUWA 2X7PA 4G8HA 3EPEA 1FCKA 2VD2A 3MZBA 3UP9A 2WKYA 3UK4A 1QVSA 1FTAA 4NF8A 2FIXA 1FPJA 1I6BA 4GBWA 5F1QA 5HPQA 3VXCA 1MQJA 5I2NA 3C33A 3E79A 3TZAA 3TTNA 3K6VA 3PTYA 3N6TA 3LBSA 1TT1A 3MW0A 4P47A 4X1DA 3MVXA 3FZVA 4KPTA 1UTHA 1LCFA 3KBRA 4PFWA 4HTGA 4P1LA 5CBRA 4IO2A 3FIRA 1H76A 4GFRA 4FECA 4ZZEA 3AXFA 4I62A 3UIFA 2NUVA 3CFZA 4IY6A 4FATA 4DCYA 3W9VA 2OCUA 2HZLA 3OOAA 3LSFB 5IM2A 4IO6A 1MDQA 2O84X 4GD5A 3T22A 4IO7A 4OMBA 3RN8A 3HFUA 4N13A 3L6HA 2Q89A 5A5XB 3ZSFA 2BJJX 1B3FA 4NF6A 3U65A 3TKDA 2B4LA 1OQHA 2GHBA 1B1HA 3MZ9A 3U92A 3N26A 1SW4A 3M3KA 3B8BA 2NVUB 2V3QA 4R72A 4NQ8A 2ZZXA 1Q9DA 1FPGA 2WX9A 1PBQA 1B0LA 2D5WA 4I3EA 4YKPA 2VOZA 2R9JA 4X8RA 2UYFA 4YB6A 4QHQA 2G93A 2OWTA 4G8MA 4HXVA 1P1NA 4QFPA 1AMFA 1B0HA 1WDNA 2Q74A 3IJXB 5CI5A 3H6VA 4P8BA 4PP0A 4MCOA 1LAXA 3QIMA 5AA2B 2RC9A 1IXHA 4GVOA 1LB8A 3FV1A 1XOCA 2OLBA 1BIYA 4KQPA 3A3CA 3VXBA 4BDNA 4BDQA 4QRZA 3FBPA 3V83A 3QSLA 2I3VA 2KLFA 2Z8FA 1K9YA 1RYXA 4N6KA 3A29A 2O1LA 3BBRA 4TQUQ 3TEPA 3BIGA 3EHUA 4JSOA 3ODBA 3QXMA 4OENA 1RDYA 1Y3PA 4GL8A 4DLDA 3PPNA 4IGRA 3MQ9A 5EQ7A 4LP2B 4P0GA 3CI8A 4F3SA 5IAIA 3FVOA 5AA4B 3CFLA 1F9BA 1B4HA 1NUYA 3IB1A 4ZEFA 1NUXA 2Z22A 2Z23A 4U4SA 3E78A 5JEIA 3TPAA 3PPQA 5IZZA 1B58A 3K2DA 1KWHA 3O2AA 2ZXTA 4F19A 3GYYA 2Y7WA 3NOHA 2V93A 2XD2A 1G0HA 4NAPA 3DP6A 3MPLA 2WEFA 3WAEA 3HV1A 4O3CA 4WEDA 2VD3A 4XKQA 3JZJA 3CSBA 4GLIA 2Q2AA 1GTKA 2L5VA 4JBZA 4BDMA 1QUJA 3IL1B 4OA4A 4F3BA 3BFTA 4E0WA 2ONKE 2H98A 1XI6A 2CZKA 4EQ9A 2XXQA 4GWOA 4OTEA 4FEBA 2I58A 1QKBA 1B32A 4ZE9A 5IZ3B 3O66A 3DLNA 4U1OA 1QW0A 3O97A 3CHGA 3KN3A 2ZZVA 3MVYA 3G3HA 3OMBA 4M1VA 4ELPA 3BFUA 1K9ZA 1HSLA 2VHAA 2DE3A 2ZNUA 2XXIA 1XVYA 4F29A 4IO4A 4GXAA 2I0CA 2H4IA 2XX9A 5EYFA 2V3UA 1TXFA 3A3UA 3H06B 4R75A 1MM7A 4MEVA 2PT2A 4QFLA 3RNNA 5KDTB 1FQFA 1JW1A 4MJOA 4NMYA 2GQ1A 3FXUA 1MXVA 3OSRA 4NF5B 3E4RA 3QUFA 5ET8A 3IAZA 1D9YA 1IXCA 2P3NA 2OBGA 2H9BA 2RINA 1DSNA 2QVVA 1IZ1A 1GVCA 3MAMA 1NNTA 1UIUA 3SDFA 1LBWA 3SEXA 1SDXA 3VFJA 1ZTYA 3PMVA 1MY1A 4GWWA 1LFHA 3TTMA 2F78A 2HQ0A 4N8GA 1O7TA 3HN0A 1S50A 2UVGA 5F24A 1Y1MA 2I4CA 5I58A 3U94A 1AWBA 1RYOA 3HHFA 4C1UA 4IO3A 1EZ9A 2H25A 5AA3A 3S9MC 4PFRA 3BKIB 1FQEA 4LATA 4AB5A 3U72A 4FAJA 4QSCA 3OSQA 4AQ4A 3R6UA 4TLLB 4AB6A 2REGA 1TFAA 1MQHA 1Y1ZA 3LUYA 2B3FA 1LCTA 3T66A 2Q9TA 4JWOA 2QVRA 1MRPA 5H8QA 3JYRA 5KCJA 4EUOA 2DWAA 1B46A 2VT5A 1LAHE 4JB7A 2AL5A 1PB9A 4JVCA 1EZPA 2ZNTA 2KR0A 5FTIA 1FTOA 1OIBA 4LN5A 2CEXA 3E9XA 4PAIA 2QS1A 1Y9UA 2I48A 2QS3A 2F6PA 1N04A 4I8CA 3T93B 1B40A 4OVTA 2PX1A 4NWCA 1FQBA 4GBVA 3OXNA 4FEDA 1BKAA 2DWHA 3HPIA 1LAGE 1ATGA 2M8CA 4NWDA 3FJ7A 4H0WA 4DE8A 4DCXA 1USYE 4OQOA 1SW1A 4OVPA 3MUQA 3MBPA 5EQ9A 1I6AA 2F36A 3O9PA 1D4NA 2XXHA 3Q29A 1BTJA 4PETA 4GRKA 2O7IA 4GWXA 2Z8EA 3SETA 3W15C 4ZEBA 4PQJA 4XFEA 1IITA 3KZGA 2Q8MA 4DZ1A 4ZEDA 4N15A 3TQWA 1FPIA 2XX7A 1QKAA 4GOTA 2HPGA 5TP9B 1BLFA 2XXPA 4GWYA 4F22A 1Y20A 2O7UA 3LSXA 4LQ2A 3M8UA 4Z0IA 3FV2A 3PPOA 2OJTA 4NX1A 1JW4A 5LTCA 1XC1A 3MVZA 2O69A 4R9GA 3THIA 4KR5A 3GBBA 2HZKA 1ZKBA 5A5XA 3PMWA 4JVDA 1GV8A 2F8DA 3T9UA 4EQBA 4RY1A 5EQAA 1FTLA 4OHNA 1R1NA 4C1TA 1FPKA 5LOMA 3RGYA 1SQYA 2F5XA 4N91A 4HE2A 3ILTB 1PDAA 4N07A 3OELA 3TQLA 4F2OA 4WXJA 2O51A 3S9EA 2WYPA 3JV9A 1SBPA 4HCYA 4RK2A 4O3AA 5I3SA 2UVIA 2ZMBA 3O6HA 1TFDA 1LAFE 5FBPA 1B3LA 1PEBA 2P0SA 4RNSA 4P3LA 2ONRA 2UYEA 2Y7RA 3PUVE 3RPWA 5AA2A 1NFTA 2A5TB 1KA0A 1FTKA 2Q2CA 5DVIA 3TTRA 1N76A 3G3KA 1MS7A 3EHSA 3O6IA 2GFEA 2FHYA 2DWJA 1LFIA 2PMSA 1IMEA 1B5JA 4MLVA 1B3GA 4FORA 3E3KA 1PC3A 1IMDA 4F18A 3FJMA 1IXIA 2B4MA 1HSEA 1RDZA 2PFYA 5AA4A 1LGBC 3TAJA 1LEVA 3RTWB 4AS5A 1FRPA 5H8SA 5L8DA 4YMAA 4GIZA 4H67A 4PFTA 1Y4TA 4GWUA 1D3KA 3MP6A 4PGNA 4MIJA 4YAHX 2ONSA 3MWBA 3IK6B 5DVJA 3TMGA 1DCUA 3I6VA 4DXBA 3VVFA 4F2QA 4YB7A 2F35A 4BDOA 3G3IA 4PBHA 3DP8A 1Q35A 2DSFA 3OEKA 1NNKA 4PDDA 2RC8A 1QUKA 3TCHA 4G77A 2D3IA 4XF5A 1FJ6A 2P3VA 1PBPA 2BJIA 3MP8A 1VR5A 3IO4A 2PYYA 1T0KA 1H45A 1I69A 2ZZWA 5IZ3A 4IB2A 2CZLA 3IO6A 4UACA 4N6PA 2OPDA 1INPA 3U93A 1LFGA 2X7QA 1DTGA 4X48A 2PVUA 3TDJA 3ZKLA 2F3DA 4GXSB 3IB0A 3IJOB 4MMPA 2HHMA 1PB7A 4OERA 4P1EA 4H45A 1YPNA 3B6TA 4MAGA 1ZJLA 5KDTA 4PC9A 2WYKA 2XWKA 4OEVA 4HW8A 4NF5A 3OEMA 4QF9A 1EU8A 1US4A 5T3JA 5H8NA 2H5YA 4ZDMA 3PGFA 1MQDA 4HCWA 3OO9A 1DBZA 1DOTA 3MPKA 4DIGA 5AA1A 4O94A 3T96B 2YLNA 3A09A 2YPNA 1EZOA 3B6QA 2V4CA 1MDP1 3N94A 5H8HB 4K3FA 4ONYA 4YICA 1M5DA 2XXUA 1GR2A 1M5CA 3SEYA 3SEWA 1DK4A 3C36A 3LSLA 4G68B 5F7VA 4F1UA 4PAKA 2F7AA 1D9VA 4QBAA 3DELB 4U23A 1B6HA 4TOZA 2XXTA 1JW5A 2F7CA 3VV5A 1IMAA 4OFOA 2UVHA 5L9MA 1N3XA 4FJPA 4QFOA 3QAXA 1RDXA 1QULA 4RPNA 4LUBA 3USDA 2ZYKA 3RLFE 4O7MA 3CR9A 4H46A 3FXRA 4G2ZA 3OO8A 4JVIA 2HCAA 3KC0A 2YJPA 3SEVA 1MY3A 5DTBA 1NNFA 5IGAA 5TPAB 4EF2A 3CVGA 1P1UA 1NV7A 5H8FB 3TTLA 2NOOA 1FSAA 3IOWA 2ALUA 3PPPA 1NUZA 4H8JA 4FIMA 5ESYA 4R2BA 3LSWA 1JETA 1NV3A 3PUZE 2XXXA 1M5EA 4R6KA 1POTA 4F1VA 4OWDA 4GX3A 1KA1A 1AOVA 4GWSA 1RKMA 1FPEA 3PD9A 5HBCA 3WAFA 1VFDA 4U4XA 5ET5A 3W9WA 1IXGA 2CMOA 3KJTA 3VDFA 1SW2A 5ET7A 1MY2A 3S4UA 1J1NA 2XWIA 3KOTA 3G7WA 1A40A 3EN3A 5H8NB 1B9JA 1N7WA 3MVWA 2ZNSA 3IB2A 2UVJA 4O8MA 3OO7A 3FUZA 3V8XB 2QVUA 4KHZE 4ESXA 3ILUB 4MFIA 1DTZA 3BIHA 3S9LC 1JEUA 3Q25A 2NWJA 3KC1A 1GGGA 1H3DA 1N7XA 1YCJA 4JWYA 3CFXA 2DXRA 2OX3A 4I40A 1B52A 4OESA 4Q5TA 2QS4A 1L5TA 3IOUA 3PPRA 1AH5A 4N6DA 2DE4A 5TP9A 4NF4A 1FQCA 3B50A 4PFBA 1M5BA 4WKMA 3OO6A 4GWZA 4P0IA 3PV0E 4R73A 1YAEA 2XXYA 3CRBA 1MPBA 4YKIA 1H44A 4OYVA 4YB5A 5AA2D 4DXCA 4EQ7A 3FVGA 4O7IA 4KXPA 1PB8A 3PUYE 5IZ1A 2CZIA 3K0VA 1YYZA 4N17A 2REJA 3PUWE 1Y4CA 1URGA 2R71A 4OVQA 4PE5B 3TTKA 4UABA 3K6WA 3FVNA 2F97A 3PD8A 3KN7A 4NEDA 3SERA 1ELJA 1ZMGA 1A54A 4IY5A 3ROJA 3H7MA 4N8YA 2HXWA 1IMFA 1FBGA 1EYJA 1Z7NE 4UA8A 3H4ZA 5FTHA 4QFKA 4KYEA 5L9OA 5K2YA 3RT8A 1FBCA 4HE0A 3FJGA 3ONMA 1B5IA 3H3GA 3K00A 3HO7A 3RTFB 3PUXE 5I84A 4YKJA 3EKIA 2DOJA 2DP8A 2I6EA 4H5FA 4HS7A 5TU0A 2GHAA 2ESNA 2Q88A 1XVXA 3M3LA 2A5TA 2IA4A 2VGQA 5DYHA 4OETA 4BLAA 4OANA 4P56A 4U21A 3TELA 2Y5LA 4XKRA 4ZEKA 3MC2A 4MLQA 3VVEA 1NV6A 1NNPA 4NTLA 3Q26A 2HFBA 1B4ZA 4MX6A 5LDZA 2I0BA 5EHMA 5IKBA 4KCDA 1OVBA 1DMBA 3D4CA 2E0SA 1FBHA 1MY4A 4NN3A 2DYXA 2ANJA 4U1ZA 1EH3A 2QMXA 4Q8RA 4YMBA 3PU5A 1OLCA 3T9XB 1A8FA 3U1OA 5I57B 2OPEA 3K6UA 2HEUA 4H6DA 4NF0A 1QGXA 4XTCQ 4OXVA 1Z7ME 1YXIA 1MXYA 1NH8A 1R9QA 4NF4B 2FVZA 2QL3A 2B3BA 1LBYA 2VPNA 1A7LA 4OVJA 1SVXB 3C4MA 3S9NC 3TODA 1P99A 2QRYA 4KD5A 4IGTA 1NV4A 1YTVA 4G61A 2OK2A 3H6WA 2W7YA 1FTJA 4POXA 5JTYB 3UGWA 2X26A 2FYIA 3VE1B 3VLWA 3F11A 4RJZA 1IMCA 1SPIA 2IEEA 2XA5A 1JP4A 4DI4B 5B7DA 3RYDA 2HXRA 5DEXB 4YZZA 5AE4A 4RXLA 2Y5KA 3G3GA 3T9HB 4X04A 1B3EA 1NKXA 5EHSA 3GXAA 2XWVA 4HE1A 3KEIA 3IOTA 5BUUA 3TYHA 3B6WA 2DWIA 3H6TA 3GLBA 3VLVA 1II5A 1S7YA 1IIWA 4ND9A 4BDLA 4R2FA 4OZ9A 4PF8A 3Q27A 3ECRA 1N84A 1SW5A 3K1NA 2P2AA 4ZS9A 2Y7PA 1LSTA 1B51A 3H03A 3O28A 1NV5A 3KSJA 2F6GA 4QSEA 5H8HA 4KFQA 3TUSA 1YZ0A 2Z8DA 4MNIA 4JWXA 5ITOA 3D1RA 1B1XA 1FBPA 1VSOA 4Q0CA 4JSDA 3DP4A 4G68A 3HHGA 1MXZA 3RPLB 3KGCA 2E1SA 2XWOA 3MP1A 1FJ9A 3TFLA 3QUJA 2PCRA 2I49A 1FPFA 3CSGA 3LV0A 2GRVA 1LB9A 5JK4A 5DW8A 2ZYMA 4QFNA 2XXKA 3KSXA 3PMXA 3I3VA 2PT1A 3N6UA 1OMPA 1H43A 1IMBA 2JJKA 1IEJA 4RK9A 1FBDA 2A5SA 4H65A 4XIGQ 1JVXA 1IQ7A 3TCGA 1N3WA 4U22A 4O3BA 3IFAA 1B7UA 5TPAA 2QJEA 1NL5A 1FBEA 2QFLA 3EF7A 3IOVA 4XKPA 5H8FA 2QSXA 1BK4A 4ESWA 1NV0A 3O29A 4LONB 1MY0A 4PF6A 4F3PA 3EQ1A 1URSA 1FPLA 4X1BA 1OQGA 1FW0A 3IORA 4IO5A 3ZS6A 5I59B 4LZ5A 4EF1A 1P1OA 5CRYA 3QMFA 1SYHA 1AL3A 2KQZA 1NV1A 5CMCA 4NGUA
chains in the Genus database with same CATH topology
5EYGA 4I3YA 4OVTA 1EYKA 2VPOA 4GBVA 1FBFA 2CZHA 1NUWA 4O8MA 2QVUA 4AS4A 1FTAA 3BIHA 2FIXA 1FPJA 4GBWA 4OVPA 5CM6A 5EQ9A 3E79A 2OWZA 3KC1A 3PTYA 4PETA 4GWXA 4P47A 2OX3A 4I40A 4XFEA 2Q8MA 4N15A 1FPIA 4N6DA 2DE4A 5EQ8A 4PFBA 3B50A 3T0JA 4MNPA 4P1LA 2HPGA 4GWZA 4GWYA 4NG7A 4OVSA 1NI9A 1FPBA 4PTKA 4O7IA 4KXPA 4NX1A 3W9VA 5IZ1A 5LTCA 2CZIA 2HZLA 4PCDA 4P9KA 1YYZA 4N17A 5IM2A 2FIEA 2HZKA 4OVQA 4JVDA 4UABA 2QPQA 3HFUA 4PFIA 5EQAA 2FBPA 1FPKA 3ROJA 4N91A 2F5XA 4N8YA 4HE2A 1IMFA 1FBGA 1EYJA 3U65A 4PAFA 2B4LA 1NV2A 4FBPA 1FBCA 3B8BA 4HE0A 2V3QA 3FXBA 4NQ8A 2ZZXA 1Q9DA 1FPGA 2WX9A 2WYPA 3EKIA 4MHFA 4I3EA 2WBDA 4HCYA 2DDKA 5I3SA 4X8RA 5FBPA 4P3LA 4HXVA 4OANA 2Q74A 4P56A 4P8BA 4MCOA 1KA0A 2Y5LA 4N81A 2MKZA 4GX4A 1NV6A 4MNCA 4MX6A 5LDZA 2FHYA 1IMEA 4NHBA 3FBPA 1K9YA 1FBHA 4NN3A 1IMDA 4F18A 4N6KA 3A29A 4X9TA 3BIGA 2R8TA 2B4MA 1RDYA 1RDZA 4NF0A 1QGXA 5EQ7A 1YXIA 1LBXA 2PFYA 1LEVA 4GX6A 4AS5A 1FRPA 2FVZA 1LBYA 1NUYA 4GWUA 2VPNA 4MIJA 4PGNA 1NUXA 1DCUA 3E78A 1NV4A 5IZZA 4G61A 2PFZA 4F19A 3GYYA 4PBHA 3NOHA 1G0HA 4NAPA 5I5PA 4DI3D 1IMCA 2WEFA 1SPIA 2XA5A 4PDDA 1JP4A 4DI4B 3RYDA 2HXRA 2L5VA 4YZZA 1VDWA 4OVRA 4XF5A 1FJ6A 2P3VA 4OA4A 2BJIA 1CNQA 5A5LA 2Y5KA 1XI6A 4X04A 2CZKA 2ZZWA 5IZ3A 1EYIA 4IR8A 2XWVA 3T1BA 4HE1A 3IFCA 1LBZA 5IZ3B 4XEQA 1INPA 3CHGA 2ZZVA 4N4UA 4M1VA 1FPDA 1K9ZA 5J16A 2F3DA 4PF8A 4MMPA 2DE3A 3MSTA 2HHMA 4P1EA 4H45A 4MAGA 5ET6A 1KZ8A 2CEYA 4PC9A 4MEVA 2WYKA 2XWKA 4MJOA 5T3JA 2GQ1A 1NV5A 4HCWA 5ET8A 1DBZA 4O94A 2P3NA 1YZ0A 4MNIA 2QVVA 5I7IA 3RPLA 3D1RA 2V4CA 1FBPA 4YICA 3RPLB 1G0IA 3MYUA 4PDHA 3LUZA 2XWOA 1DK4A 1FJ9A 4F1UA 4PAKA 1LBWA 4QBAA 2PCRA 1FPFA 3LV0A 4GWWA 5JK4A 5DW8A 3ISPA 4N8GA 1IMAA 2XXKA 5F24A 1IMBA 2JJKA 2DVZA 1AWBA 1RDXA 1FBDA 4PGPA 4PFRA 4O7MA 5EYHA 4H46A 4JVIA 2F3BA 3IFAA 3KC0A 2DE2A 1FBEA 2QFLA 1BK4A 1NV0A 5IGAA 1NV7A 1FSAA 4PF6A 2Q9TA 2QVRA 4PBQA 1NUZA 5ESYA 1FPLA 4QXDA 2VT5A 1NV3A 4JVCA 4PE3A 1D9QA 1LBVA 2KR0A 4F1VA 4GX3A 1KA1A 3KBZA 4GWSA 1FPEA 4LN5A 5ET5A 3W9WA 2CEXA 2WBBA 3QMFA 4PAIA 2KQZA 1NV1A 3SZPA 5ET7A 5J1DA 4NGUA 2XWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCU A;  5EYG A;  3LUZ A;  1NV4 A;  1DK4 A;  1FBC A;  1FJ9 A;  4I3Y A;  4G61 A;  3B8B A;  1LBW A;  4HE0 A;  2PCR A;  1FPF A;  1EYK A;  3LV0 A;  1Q9D A;  1FPG A;  4GWW A;  1G0H A;  5DW8 A;  1IMC A;  2WEF A;  1SPI A;  4GBV A;  1FBF A;  2CZH A;  1NUW A;  4I3E A;  2WBD A;  1IMA A;  1JP4 A;  2DDK A;  3RYD A;  2QVU A;  5I3S A;  5F24 A;  4AS4 A;  1VDW A;  1IMB A;  5FBP A;  1FJ6 A;  2P3V A;  2JJK A;  2BJI A;  1FTA A;  1CNQ A;  5A5L A;  2Y5K A;  3BIH A;  1AWB A;  1FPJ A;  2FIX A;  4GBW A;  4HXV A;  1RDX A;  1XI6 A;  1FBD A;  2CZK A;  5EQ9 A;  2Q74 A;  5IZ3 A;  1EYI A;  2OWZ A;  3KC1 A;  4IR8 A;  1KA0 A;  2Y5L A;  4HE1 A;  4N81 A;  3IFC A;  3RPL B;  1LBZ A;  4GX4 A;  4GWX A;  5IZ3 B;  5EYH A;  1NV6 A;  2OX3 A;  4I40 A;  4H46 A;  1INP A;  2Q8M A;  1FPI A;  2F3B A;  5LDZ A;  3IFA A;  5EQ8 A;  1FPD A;  3KC0 A;  2FHY A;  1K9Z A;  3T0J A;  5J16 A;  2F3D A;  1FBE A;  2QFL A;  4GWZ A;  1IME A;  2HHM A;  1BK4 A;  3FBP A;  1NV0 A;  1K9Y A;  4H45 A;  4GWY A;  1FBH A;  1NV7 A;  1IMD A;  1FSA A;  3A29 A;  1NI9 A;  1FPB A;  2QVR A;  4PTK A;  1KZ8 A;  5ET6 A;  3BIG A;  1NUZ A;  4O7I A;  4KXP A;  5ESY A;  2R8T A;  5IZ1 A;  1RDY A;  2CZI A;  1FPL A;  4QXD A;  2VT5 A;  1YYZ A;  1NV3 A;  2FIE A;  4MJO A;  5T3J A;  1RDZ A;  1QGX A;  2GQ1 A;  1D9Q A;  1LBV A;  1NV5 A;  5EQ7 A;  1YXI A;  1LBX A;  4GX3 A;  1KA1 A;  5ET8 A;  1LEV A;  1DBZ A;  3KBZ A;  4GWS A;  4GX6 A;  4AS5 A;  1FPE A;  2P3N A;  1FRP A;  5EQA A;  2FVZ A;  5ET5 A;  2FBP A;  1YZ0 A;  2WBB A;  1LBY A;  1NUY A;  3QMF A;  2QVV A;  1FPK A;  3ROJ A;  3RPL A;  3D1R A;  4GWU A;  1FBP A;  1NUX A;  1IMF A;  1FBG A;  1EYJ A;  1NV1 A;  4HE2 A;  5ET7 A;  1NV2 A;  1G0I A;  4FBP A; 
#chains in the Genus database with same CATH topology
 5ITP A;  2AIX A;  4PFY A;  4NE4 A;  1VE4 A;  3FAT A;  4P11 A;  2VPO A;  4WEP A;  1N0T A;  4XKN A;  2RF1 A;  3O6G A;  1MQG A;  4F1Y A;  4AS4 A;  3N5L A;  1MXW A;  1B3H A;  4I9D A;  2R6G E;  3RY3 A;  5CM6 A;  1POY 1;  4NF8 B;  4ZZA A;  1JEV A;  2OWZ A;  4E0X A;  3UA8 A;  1LLS A;  5I2N B;  3B7D A;  1VFE A;  5HM4 B;  3G3J A;  3D4G A;  5M2V A;  1TWY A;  2ZYN A;  4QSD A;  4EXL A;  2LAO A;  1UTB A;  5EQ8 A;  2B65 A;  1IUD A;  1A8E A;  3T0J A;  4MNP A;  4G68 C;  3RT6 B;  3RUM A;  5CBS A;  1UTH B;  2I3W A;  2XD3 A;  4MH5 A;  2V84 A;  4NG7 A;  4OVS A;  3C9H A;  4KCC A;  3OD7 A;  1NI9 A;  1FPB A;  4PTK A;  3QYT A;  4OFJ A;  1WVJ A;  3SEU A;  4MF3 A;  4PCD A;  5ICT A;  4P9K A;  1DPP A;  1LBB A;  4F39 A;  2FIE A;  2F34 A;  1B05 A;  2QPQ A;  3KJ7 A;  4BDR A;  4PFI A;  3FVK A;  3VVD A;  2FBP A;  2DVC A;  1JNF A;  1S9T A;  4Q30 B;  2XHD A;  2THI A;  1ZIU A;  1NMU A;  4PAF A;  1NV2 A;  4NF6 B;  4FBP A;  3M3F A;  3L6G A;  1FTM A;  3KN8 A;  4TLM B;  4H1X A;  1ZU0 A;  2Y7I A;  3P7I A;  3FXB A;  4R74 A;  4ELQ A;  1MXU A;  3C31 A;  2F7B A;  2ABH A;  4MHF A;  3CG3 A;  2WBD A;  3HST A;  2DDK A;  3K6X A;  3SES A;  1B5H A;  3R7X A;  3CG1 A;  3K01 A;  4ECF A;  4G8N A;  5CMK A;  5ISU A;  3FAS A;  3UN6 A;  2DXY A;  4RA1 A;  1CE2 A;  3ZKK A;  1URD A;  1B2H A;  4N81 A;  2MKZ A;  2RKM A;  4GX4 A;  1MH3 A;  4R9F A;  4LQ5 A;  4MNC A;  1XT8 A;  2Y7K A;  5CMM A;  1I6Q A;  4GQO A;  1Y3Q A;  4NHB A;  2GH9 A;  4KYD A;  4EXK A;  1O64 A;  2V3T A;  2P1S A;  1SI1 A;  2RCA A;  1ZLQ A;  5I57 A;  1OVT A;  4X9T A;  5FHM A;  3CIJ A;  2R8T A;  4YKK A;  3MJN A;  3OEN A;  1B7H A;  4PFU A;  4RPO A;  5L9S A;  4RYA A;  1LBC A;  4F31 B;  1MPC A;  1R6Z A;  2AL4 A;  3V89 B;  1LBX A;  1AIV A;  1MM6 A;  1BP5 A;  1UTB B;  4GX6 A;  3E13 X;  1JQF A;  1XHY A;  2HAU A;  4THI A;  1SD3 A;  2VP1 A;  1FQA A;  1Y3N A;  5I2K A;  3KOS A;  2XXV A;  2QMW A;  5JTY A;  3I5O A;  2PFZ A;  3GZG A;  3IX1 A;  1Q1K A;  5I5P A;  4DI3 D;  5DEX A;  2V25 A;  1QJM A;  2H99 A;  1M5F A;  1FQD A;  1VDW A;  4OVR A;  3C35 A;  5CC2 A;  3G3F A;  1CNQ A;  5A5L A;  3U8Q A;  4R6Y A;  2ZYO A;  2HAV A;  1SYI A;  2XX8 A;  2UXA A;  1B7Z A;  1EYI A;  4IR8 A;  1NH7 A;  3T1B A;  4GF8 A;  3IFC A;  1LBZ A;  5ELV A;  1ANF A;  4LA9 A;  4XEQ A;  3UOR A;  3C34 A;  4EDP A;  5FHO A;  4N4U A;  1FPD A;  4OFL A;  5J16 A;  3MST A;  1USY H;  2XXR A;  1OLA A;  3RQT A;  5ET6 A;  1KZ8 A;  2CEY A;  5I56 A;  4LZ8 A;  2Y84 A;  2FNC A;  1ZBM A;  3Q28 A;  1XS5 A;  3GBA A;  1UQW A;  4U2R A;  3MZ1 A;  4H8I A;  1A55 A;  2Q8J A;  1SI0 A;  4DDD A;  2DS9 A;  5I7I A;  3RPL A;  2RCB A;  3KFM A;  3KG2 A;  5KZT A;  2G29 A;  4YU0 A;  3IR1 A;  1G0I A;  2O6A A;  3MYU A;  4PDH A;  3LUZ A;  2RC7 A;  4ISU A;  3H6U A;  1MXX A;  3C32 A;  4LVQ A;  4ZEC A;  3FD3 A;  3EHT A;  4C0R A;  3VLU A;  4DXU A;  4GL0 A;  5ICQ A;  3V5A A;  3ISP A;  2AYS A;  4M4G A;  4F3G A;  2OZZ A;  3R26 A;  1MPD A;  3LC8 A;  1WOD A;  2DVZ A;  4ZE8 A;  2FA7 A;  5I58 B;  3LR1 A;  1MH4 A;  5I2K B;  1DPE A;  3QK6 A;  4LZ7 A;  4PGP A;  2QS2 A;  1P1W A;  4ELR A;  5CMB A;  1R9L A;  2XXW A;  2DQV A;  5DT6 A;  5EYH A;  3TCF A;  2F3B A;  4KYS A;  1O63 A;  1JVY A;  4POW A;  1P1Q A;  1US5 A;  2DE2 A;  5K2X A;  4I1D A;  2I4B A;  3FGS A;  4XXU A;  4R6H A;  1MG1 A;  4JXI A;  5DVF A;  3K4U A;  4PBQ A;  3S2V A;  3FXQ A;  4G4P A;  2D21 A;  5I59 A;  4QXD A;  3K1P A;  3K1M A;  4MBP A;  5H8Q B;  4H5G A;  4ELO A;  2PBW A;  4Z7E A;  5KCJ B;  4PE3 A;  1D9Q A;  1LBV A;  4L17 A;  3SKP A;  1MQI A;  3KBZ A;  3DM0 A;  5FHN A;  2WBB A;  4OEU A;  3T9V A;  5BWJ A;  3SZP A;  5J1D A;  4FE8 A;  4KI0 E;  5EYG A;  5I56 B;  5B70 A;  2OWS A;  1HSJ A;  1UIV A;  4I3Y A;  1A99 A;  2NXO A;  2O1M A;  3K02 A;  2O68 A;  3HCQ A;  1EYK A;  4JDF A;  4ZEI A;  1FBF A;  1QUI A;  2CZH A;  1CB6 A;  1NUW A;  2X7P A;  4G8H A;  3EPE A;  1FCK A;  2VD2 A;  3MZB A;  3UP9 A;  2WKY A;  3UK4 A;  1QVS A;  1FTA A;  4NF8 A;  2FIX A;  1FPJ A;  1I6B A;  4GBW A;  5F1Q A;  5HPQ A;  3VXC A;  1MQJ A;  5I2N A;  3C33 A;  3E79 A;  3TZA A;  3TTN A;  3K6V A;  3PTY A;  3N6T A;  3LBS A;  1TT1 A;  3MW0 A;  4P47 A;  4X1D A;  3MVX A;  3FZV A;  4KPT A;  1UTH A;  1LCF A;  3KBR A;  4PFW A;  4HTG A;  4P1L A;  5CBR A;  4IO2 A;  3FIR A;  1H76 A;  4GFR A;  4FEC A;  4ZZE A;  3AXF A;  4I62 A;  3UIF A;  2NUV A;  3CFZ A;  4IY6 A;  4FAT A;  4DCY A;  3W9V A;  2OCU A;  2HZL A;  3OOA A;  3LSF B;  5IM2 A;  4IO6 A;  1MDQ A;  2O84 X;  4GD5 A;  3T22 A;  4IO7 A;  4OMB A;  3RN8 A;  3HFU A;  4N13 A;  3L6H A;  2Q89 A;  5A5X B;  3ZSF A;  2BJJ X;  1B3F A;  4NF6 A;  3U65 A;  3TKD A;  2B4L A;  1OQH A;  2GHB A;  1B1H A;  3MZ9 A;  3U92 A;  3N26 A;  1SW4 A;  3M3K A;  3B8B A;  2NVU B;  2V3Q A;  4R72 A;  4NQ8 A;  2ZZX A;  1Q9D A;  1FPG A;  2WX9 A;  1PBQ A;  1B0L A;  2D5W A;  4I3E A;  4YKP A;  2VOZ A;  2R9J A;  4X8R A;  2UYF A;  4YB6 A;  4QHQ A;  2G93 A;  2OWT A;  4G8M A;  4HXV A;  1P1N A;  4QFP A;  1AMF A;  1B0H A;  1WDN A;  2Q74 A;  3IJX B;  5CI5 A;  3H6V A;  4P8B A;  4PP0 A;  4MCO A;  1LAX A;  3QIM A;  5AA2 B;  2RC9 A;  1IXH A;  4GVO A;  1LB8 A;  3FV1 A;  1XOC A;  2OLB A;  1BIY A;  4KQP A;  3A3C A;  3VXB A;  4BDN A;  4BDQ A;  4QRZ A;  3FBP A;  3V83 A;  3QSL A;  2I3V A;  2KLF A;  2Z8F A;  1K9Y A;  1RYX A;  4N6K A;  3A29 A;  2O1L A;  3BBR A;  4TQU Q;  3TEP A;  3BIG A;  3EHU A;  4JSO A;  3ODB A;  3QXM A;  4OEN A;  1RDY A;  1Y3P A;  4GL8 A;  4DLD A;  3PPN A;  4IGR A;  3MQ9 A;  5EQ7 A;  4LP2 B;  4P0G A;  3CI8 A;  4F3S A;  5IAI A;  3FVO A;  5AA4 B;  3CFL A;  1F9B A;  1B4H A;  1NUY A;  3IB1 A;  4ZEF A;  1NUX A;  2Z22 A;  2Z23 A;  4U4S A;  3E78 A;  5JEI A;  3TPA A;  3PPQ A;  5IZZ A;  1B58 A;  3K2D A;  1KWH A;  3O2A A;  2ZXT A;  4F19 A;  3GYY A;  2Y7W A;  3NOH A;  2V93 A;  2XD2 A;  1G0H A;  4NAP A;  3DP6 A;  3MPL A;  2WEF A;  3WAE A;  3HV1 A;  4O3C A;  4WED A;  2VD3 A;  4XKQ A;  3JZJ A;  3CSB A;  4GLI A;  2Q2A A;  1GTK A;  2L5V A;  4JBZ A;  4BDM A;  1QUJ A;  3IL1 B;  4OA4 A;  4F3B A;  3BFT A;  4E0W A;  2ONK E;  2H98 A;  1XI6 A;  2CZK A;  4EQ9 A;  2XXQ A;  4GWO A;  4OTE A;  4FEB A;  2I58 A;  1QKB A;  1B32 A;  4ZE9 A;  5IZ3 B;  3O66 A;  3DLN A;  4U1O A;  1QW0 A;  3O97 A;  3CHG A;  3KN3 A;  2ZZV A;  3MVY A;  3G3H A;  3OMB A;  4M1V A;  4ELP A;  3BFU A;  1K9Z A;  1HSL A;  2VHA A;  2DE3 A;  2ZNU A;  2XXI A;  1XVY A;  4F29 A;  4IO4 A;  4GXA A;  2I0C A;  2H4I A;  2XX9 A;  5EYF A;  2V3U A;  1TXF A;  3A3U A;  3H06 B;  4R75 A;  1MM7 A;  4MEV A;  2PT2 A;  4QFL A;  3RNN A;  5KDT B;  1FQF A;  1JW1 A;  4MJO A;  4NMY A;  2GQ1 A;  3FXU A;  1MXV A;  3OSR A;  4NF5 B;  3E4R A;  3QUF A;  5ET8 A;  3IAZ A;  1D9Y A;  1IXC A;  2P3N A;  2OBG A;  2H9B A;  2RIN A;  1DSN A;  2QVV A;  1IZ1 A;  1GVC A;  3MAM A;  1NNT A;  1UIU A;  3SDF A;  1LBW A;  3SEX A;  1SDX A;  3VFJ A;  1ZTY A;  3PMV A;  1MY1 A;  4GWW A;  1LFH A;  3TTM A;  2F78 A;  2HQ0 A;  4N8G A;  1O7T A;  3HN0 A;  1S50 A;  2UVG A;  5F24 A;  1Y1M A;  2I4C A;  5I58 A;  3U94 A;  1AWB A;  1RYO A;  3HHF A;  4C1U A;  4IO3 A;  1EZ9 A;  2H25 A;  5AA3 A;  3S9M C;  4PFR A;  3BKI B;  1FQE A;  4LAT A;  4AB5 A;  3U72 A;  4FAJ A;  4QSC A;  3OSQ A;  4AQ4 A;  3R6U A;  4TLL B;  4AB6 A;  2REG A;  1TFA A;  1MQH A;  1Y1Z A;  3LUY A;  2B3F A;  1LCT A;  3T66 A;  2Q9T A;  4JWO A;  2QVR A;  1MRP A;  5H8Q A;  3JYR A;  5KCJ A;  4EUO A;  2DWA A;  1B46 A;  2VT5 A;  1LAH E;  4JB7 A;  2AL5 A;  1PB9 A;  4JVC A;  1EZP A;  2ZNT A;  2KR0 A;  5FTI A;  1FTO A;  1OIB A;  4LN5 A;  2CEX A;  3E9X A;  4PAI A;  2QS1 A;  1Y9U A;  2I48 A;  2QS3 A;  2F6P A;  1N04 A;  4I8C A;  3T93 B;  1B40 A;  4OVT A;  2PX1 A;  4NWC A;  1FQB A;  4GBV A;  3OXN A;  4FED A;  1BKA A;  2DWH A;  3HPI A;  1LAG E;  1ATG A;  2M8C A;  4NWD A;  3FJ7 A;  4H0W A;  4DE8 A;  4DCX A;  1USY E;  4OQO A;  1SW1 A;  4OVP A;  3MUQ A;  3MBP A;  5EQ9 A;  1I6A A;  2F36 A;  3O9P A;  1D4N A;  2XXH A;  3Q29 A;  1BTJ A;  4PET A;  4GRK A;  2O7I A;  4GWX A;  2Z8E A;  3SET A;  3W15 C;  4ZEB A;  4PQJ A;  4XFE A;  1IIT A;  3KZG A;  2Q8M A;  4DZ1 A;  4ZED A;  4N15 A;  3TQW A;  1FPI A;  2XX7 A;  1QKA A;  4GOT A;  2HPG A;  5TP9 B;  1BLF A;  2XXP A;  4GWY A;  4F22 A;  1Y20 A;  2O7U A;  3LSX A;  4LQ2 A;  3M8U A;  4Z0I A;  3FV2 A;  3PPO A;  2OJT A;  4NX1 A;  1JW4 A;  5LTC A;  1XC1 A;  3MVZ A;  2O69 A;  4R9G A;  3THI A;  4KR5 A;  3GBB A;  2HZK A;  1ZKB A;  5A5X A;  3PMW A;  4JVD A;  1GV8 A;  2F8D A;  3T9U A;  4EQB A;  4RY1 A;  5EQA A;  1FTL A;  4OHN A;  1R1N A;  4C1T A;  1FPK A;  5LOM A;  3RGY A;  1SQY A;  2F5X A;  4N91 A;  4HE2 A;  3ILT B;  1PDA A;  4N07 A;  3OEL A;  3TQL A;  4F2O A;  4WXJ A;  2O51 A;  3S9E A;  2WYP A;  3JV9 A;  1SBP A;  4HCY A;  4RK2 A;  4O3A A;  5I3S A;  2UVI A;  2ZMB A;  3O6H A;  1TFD A;  1LAF E;  5FBP A;  1B3L A;  1PEB A;  2P0S A;  4RNS A;  4P3L A;  2ONR A;  2UYE A;  2Y7R A;  3PUV E;  3RPW A;  5AA2 A;  1NFT A;  2A5T B;  1KA0 A;  1FTK A;  2Q2C A;  5DVI A;  3TTR A;  1N76 A;  3G3K A;  1MS7 A;  3EHS A;  3O6I A;  2GFE A;  2FHY A;  2DWJ A;  1LFI A;  2PMS A;  1IME A;  1B5J A;  4MLV A;  1B3G A;  4FOR A;  3E3K A;  1PC3 A;  1IMD A;  4F18 A;  3FJM A;  1IXI A;  2B4M A;  1HSE A;  1RDZ A;  2PFY A;  5AA4 A;  1LGB C;  3TAJ A;  1LEV A;  3RTW B;  4AS5 A;  1FRP A;  5H8S A;  5L8D A;  4YMA A;  4GIZ A;  4H67 A;  4PFT A;  1Y4T A;  4GWU A;  1D3K A;  3MP6 A;  4PGN A;  4MIJ A;  4YAH X;  2ONS A;  3MWB A;  3IK6 B;  5DVJ A;  3TMG A;  1DCU A;  3I6V A;  4DXB A;  3VVF A;  4F2Q A;  4YB7 A;  2F35 A;  4BDO A;  3G3I A;  4PBH A;  3DP8 A;  1Q35 A;  2DSF A;  3OEK A;  1NNK A;  4PDD A;  2RC8 A;  1QUK A;  3TCH A;  4G77 A;  2D3I A;  4XF5 A;  1FJ6 A;  2P3V A;  1PBP A;  2BJI A;  3MP8 A;  1VR5 A;  3IO4 A;  2PYY A;  1T0K A;  1H45 A;  1I69 A;  2ZZW A;  5IZ3 A;  4IB2 A;  2CZL A;  3IO6 A;  4UAC A;  4N6P A;  2OPD A;  1INP A;  3U93 A;  1LFG A;  2X7Q A;  1DTG A;  4X48 A;  2PVU A;  3TDJ A;  3ZKL A;  2F3D A;  4GXS B;  3IB0 A;  3IJO B;  4MMP A;  2HHM A;  1PB7 A;  4OER A;  4P1E A;  4H45 A;  1YPN A;  3B6T A;  4MAG A;  1ZJL A;  5KDT A;  4PC9 A;  2WYK A;  2XWK A;  4OEV A;  4HW8 A;  4NF5 A;  3OEM A;  4QF9 A;  1EU8 A;  1US4 A;  5T3J A;  5H8N A;  2H5Y A;  4ZDM A;  3PGF A;  1MQD A;  4HCW A;  3OO9 A;  1DBZ A;  1DOT A;  3MPK A;  4DIG A;  5AA1 A;  4O94 A;  3T96 B;  2YLN A;  3A09 A;  2YPN A;  1EZO A;  3B6Q A;  2V4C A;  1MDP 1;  3N94 A;  5H8H B;  4K3F A;  4ONY A;  4YIC A;  1M5D A;  2XXU A;  1GR2 A;  1M5C A;  3SEY A;  3SEW A;  1DK4 A;  3C36 A;  3LSL A;  4G68 B;  5F7V A;  4F1U A;  4PAK A;  2F7A A;  1D9V A;  4QBA A;  3DEL B;  4U23 A;  1B6H A;  4TOZ A;  2XXT A;  1JW5 A;  2F7C A;  3VV5 A;  1IMA A;  4OFO A;  2UVH A;  5L9M A;  1N3X A;  4FJP A;  4QFO A;  3QAX A;  1RDX A;  1QUL A;  4RPN A;  4LUB A;  3USD A;  2ZYK A;  3RLF E;  4O7M A;  3CR9 A;  4H46 A;  3FXR A;  4G2Z A;  3OO8 A;  4JVI A;  2HCA A;  3KC0 A;  2YJP A;  3SEV A;  1MY3 A;  5DTB A;  1NNF A;  5IGA A;  5TPA B;  4EF2 A;  3CVG A;  1P1U A;  1NV7 A;  5H8F B;  3TTL A;  2NOO A;  1FSA A;  3IOW A;  2ALU A;  3PPP A;  1NUZ A;  4H8J A;  4FIM A;  5ESY A;  4R2B A;  3LSW A;  1JET A;  1NV3 A;  3PUZ E;  2XXX A;  1M5E A;  4R6K A;  1POT A;  4F1V A;  4OWD A;  4GX3 A;  1KA1 A;  1AOV A;  4GWS A;  1RKM A;  1FPE A;  3PD9 A;  5HBC A;  3WAF A;  1VFD A;  4U4X A;  5ET5 A;  3W9W A;  1IXG A;  2CMO A;  3KJT A;  3VDF A;  1SW2 A;  5ET7 A;  1MY2 A;  3S4U A;  1J1N A;  2XWI A;  3KOT A;  3G7W A;  1A40 A;  3EN3 A;  5H8N B;  1B9J A;  1N7W A;  3MVW A;  2ZNS A;  3IB2 A;  2UVJ A;  4O8M A;  3OO7 A;  3FUZ A;  3V8X B;  2QVU A;  4KHZ E;  4ESX A;  3ILU B;  4MFI A;  1DTZ A;  3BIH A;  3S9L C;  1JEU A;  3Q25 A;  2NWJ A;  3KC1 A;  1GGG A;  1H3D A;  1N7X A;  1YCJ A;  4JWY A;  3CFX A;  2DXR A;  2OX3 A;  4I40 A;  1B52 A;  4OES A;  4Q5T A;  2QS4 A;  1L5T A;  3IOU A;  3PPR A;  1AH5 A;  4N6D A;  2DE4 A;  5TP9 A;  4NF4 A;  1FQC A;  3B50 A;  4PFB A;  1M5B A;  4WKM A;  3OO6 A;  4GWZ A;  4P0I A;  3PV0 E;  4R73 A;  1YAE A;  2XXY A;  3CRB A;  1MPB A;  4YKI A;  1H44 A;  4OYV A;  4YB5 A;  5AA2 D;  4DXC A;  4EQ7 A;  3FVG A;  4O7I A;  4KXP A;  1PB8 A;  3PUY E;  5IZ1 A;  2CZI A;  3K0V A;  1YYZ A;  4N17 A;  2REJ A;  3PUW E;  1Y4C A;  1URG A;  2R71 A;  4OVQ A;  4PE5 B;  3TTK A;  4UAB A;  3K6W A;  3FVN A;  2F97 A;  3PD8 A;  3KN7 A;  4NED A;  3SER A;  1ELJ A;  1ZMG A;  1A54 A;  4IY5 A;  3ROJ A;  3H7M A;  4N8Y A;  2HXW A;  1IMF A;  1FBG A;  1EYJ A;  1Z7N E;  4UA8 A;  3H4Z A;  5FTH A;  4QFK A;  4KYE A;  5L9O A;  5K2Y A;  3RT8 A;  1FBC A;  4HE0 A;  3FJG A;  3ONM A;  1B5I A;  3H3G A;  3K00 A;  3HO7 A;  3RTF B;  3PUX E;  5I84 A;  4YKJ A;  3EKI A;  2DOJ A;  2DP8 A;  2I6E A;  4H5F A;  4HS7 A;  5TU0 A;  2GHA A;  2ESN A;  2Q88 A;  1XVX A;  3M3L A;  2A5T A;  2IA4 A;  2VGQ A;  5DYH A;  4OET A;  4BLA A;  4OAN A;  4P56 A;  4U21 A;  3TEL A;  2Y5L A;  4XKR A;  4ZEK A;  3MC2 A;  4MLQ A;  3VVE A;  1NV6 A;  1NNP A;  4NTL A;  3Q26 A;  2HFB A;  1B4Z A;  4MX6 A;  5LDZ A;  2I0B A;  5EHM A;  5IKB A;  4KCD A;  1OVB A;  1DMB A;  3D4C A;  2E0S A;  1FBH A;  1MY4 A;  4NN3 A;  2DYX A;  2ANJ A;  4U1Z A;  1EH3 A;  2QMX A;  4Q8R A;  4YMB A;  3PU5 A;  1OLC A;  3T9X B;  1A8F A;  3U1O A;  5I57 B;  2OPE A;  3K6U A;  2HEU A;  4H6D A;  4NF0 A;  1QGX A;  4XTC Q;  4OXV A;  1Z7M E;  1YXI A;  1MXY A;  1NH8 A;  1R9Q A;  4NF4 B;  2FVZ A;  2QL3 A;  2B3B A;  1LBY A;  2VPN A;  1A7L A;  4OVJ A;  1SVX B;  3C4M A;  3S9N C;  3TOD A;  1P99 A;  2QRY A;  4KD5 A;  4IGT A;  1NV4 A;  1YTV A;  4G61 A;  2OK2 A;  3H6W A;  2W7Y A;  1FTJ A;  4POX A;  5JTY B;  3UGW A;  2X26 A;  2FYI A;  3VE1 B;  3VLW A;  3F11 A;  4RJZ A;  1IMC A;  1SPI A;  2IEE A;  2XA5 A;  1JP4 A;  4DI4 B;  5B7D A;  3RYD A;  2HXR A;  5DEX B;  4YZZ A;  5AE4 A;  4RXL A;  2Y5K A;  3G3G A;  3T9H B;  4X04 A;  1B3E A;  1NKX A;  5EHS A;  3GXA A;  2XWV A;  4HE1 A;  3KEI A;  3IOT A;  5BUU A;  3TYH A;  3B6W A;  2DWI A;  3H6T A;  3GLB A;  3VLV A;  1II5 A;  1S7Y A;  1IIW A;  4ND9 A;  4BDL A;  4R2F A;  4OZ9 A;  4PF8 A;  3Q27 A;  3ECR A;  1N84 A;  1SW5 A;  3K1N A;  2P2A A;  4ZS9 A;  2Y7P A;  1LST A;  1B51 A;  3H03 A;  3O28 A;  1NV5 A;  3KSJ A;  2F6G A;  4QSE A;  5H8H A;  4KFQ A;  3TUS A;  1YZ0 A;  2Z8D A;  4MNI A;  4JWX A;  5ITO A;  3D1R A;  1B1X A;  1FBP A;  1VSO A;  4Q0C A;  4JSD A;  3DP4 A;  4G68 A;  3HHG A;  1MXZ A;  3RPL B;  3KGC A;  2E1S A;  2XWO A;  3MP1 A;  1FJ9 A;  3TFL A;  3QUJ A;  2PCR A;  2I49 A;  1FPF A;  3CSG A;  3LV0 A;  2GRV A;  1LB9 A;  5JK4 A;  5DW8 A;  2ZYM A;  4QFN A;  2XXK A;  3KSX A;  3PMX A;  3I3V A;  2PT1 A;  3N6U A;  1OMP A;  1H43 A;  1IMB A;  2JJK A;  1IEJ A;  4RK9 A;  1FBD A;  2A5S A;  4H65 A;  4XIG Q;  1JVX A;  1IQ7 A;  3TCG A;  1N3W A;  4U22 A;  4O3B A;  3IFA A;  1B7U A;  5TPA A;  2QJE A;  1NL5 A;  1FBE A;  2QFL A;  3EF7 A;  3IOV A;  4XKP A;  5H8F A;  2QSX A;  1BK4 A;  4ESW A;  1NV0 A;  3O29 A;  4LON B;  1MY0 A;  4PF6 A;  4F3P A;  3EQ1 A;  1URS A;  1FPL A;  4X1B A;  1OQG A;  1FW0 A;  3IOR A;  4IO5 A;  3ZS6 A;  5I59 B;  4LZ5 A;  4EF1 A;  1P1O A;  5CRY A;  3QMF A;  1SYH A;  1AL3 A;  2KQZ A;  1NV1 A;  5CMC A;  4NGU A; 
#chains in the Genus database with same CATH homology
 5EYG A;  4I3Y A;  4OVT A;  1EYK A;  2VPO A;  4GBV A;  1FBF A;  2CZH A;  1NUW A;  4O8M A;  2QVU A;  4AS4 A;  1FTA A;  3BIH A;  2FIX A;  1FPJ A;  4GBW A;  4OVP A;  5CM6 A;  5EQ9 A;  3E79 A;  2OWZ A;  3KC1 A;  3PTY A;  4PET A;  4GWX A;  4P47 A;  2OX3 A;  4I40 A;  4XFE A;  2Q8M A;  4N15 A;  1FPI A;  4N6D A;  2DE4 A;  5EQ8 A;  4PFB A;  3B50 A;  3T0J A;  4MNP A;  4P1L A;  2HPG A;  4GWZ A;  4GWY A;  4NG7 A;  4OVS A;  1NI9 A;  1FPB A;  4PTK A;  4O7I A;  4KXP A;  4NX1 A;  3W9V A;  5IZ1 A;  5LTC A;  2CZI A;  2HZL A;  4PCD A;  4P9K A;  1YYZ A;  4N17 A;  5IM2 A;  2FIE A;  2HZK A;  4OVQ A;  4JVD A;  4UAB A;  2QPQ A;  3HFU A;  4PFI A;  5EQA A;  2FBP A;  1FPK A;  3ROJ A;  4N91 A;  2F5X A;  4N8Y A;  4HE2 A;  1IMF A;  1FBG A;  1EYJ A;  3U65 A;  4PAF A;  2B4L A;  1NV2 A;  4FBP A;  1FBC A;  3B8B A;  4HE0 A;  2V3Q A;  3FXB A;  4NQ8 A;  2ZZX A;  1Q9D A;  1FPG A;  2WX9 A;  2WYP A;  3EKI A;  4MHF A;  4I3E A;  2WBD A;  4HCY A;  2DDK A;  5I3S A;  4X8R A;  5FBP A;  4P3L A;  4HXV A;  4OAN A;  2Q74 A;  4P56 A;  4P8B A;  4MCO A;  1KA0 A;  2Y5L A;  4N81 A;  2MKZ A;  4GX4 A;  1NV6 A;  4MNC A;  4MX6 A;  5LDZ A;  2FHY A;  1IME A;  4NHB A;  3FBP A;  1K9Y A;  1FBH A;  4NN3 A;  1IMD A;  4F18 A;  4N6K A;  3A29 A;  4X9T A;  3BIG A;  2R8T A;  2B4M A;  1RDY A;  1RDZ A;  4NF0 A;  1QGX A;  5EQ7 A;  1YXI A;  1LBX A;  2PFY A;  1LEV A;  4GX6 A;  4AS5 A;  1FRP A;  2FVZ A;  1LBY A;  1NUY A;  4GWU A;  2VPN A;  4MIJ A;  4PGN A;  1NUX A;  1DCU A;  3E78 A;  1NV4 A;  5IZZ A;  4G61 A;  2PFZ A;  4F19 A;  3GYY A;  4PBH A;  3NOH A;  1G0H A;  4NAP A;  5I5P A;  4DI3 D;  1IMC A;  2WEF A;  1SPI A;  2XA5 A;  4PDD A;  1JP4 A;  4DI4 B;  3RYD A;  2HXR A;  2L5V A;  4YZZ A;  1VDW A;  4OVR A;  4XF5 A;  1FJ6 A;  2P3V A;  4OA4 A;  2BJI A;  1CNQ A;  5A5L A;  2Y5K A;  1XI6 A;  4X04 A;  2CZK A;  2ZZW A;  5IZ3 A;  1EYI A;  4IR8 A;  2XWV A;  3T1B A;  4HE1 A;  3IFC A;  1LBZ A;  5IZ3 B;  4XEQ A;  1INP A;  3CHG A;  2ZZV A;  4N4U A;  4M1V A;  1FPD A;  1K9Z A;  5J16 A;  2F3D A;  4PF8 A;  4MMP A;  2DE3 A;  3MST A;  2HHM A;  4P1E A;  4H45 A;  4MAG A;  5ET6 A;  1KZ8 A;  2CEY A;  4PC9 A;  4MEV A;  2WYK A;  2XWK A;  4MJO A;  5T3J A;  2GQ1 A;  1NV5 A;  4HCW A;  5ET8 A;  1DBZ A;  4O94 A;  2P3N A;  1YZ0 A;  4MNI A;  2QVV A;  5I7I A;  3RPL A;  3D1R A;  2V4C A;  1FBP A;  4YIC A;  3RPL B;  1G0I A;  3MYU A;  4PDH A;  3LUZ A;  2XWO A;  1DK4 A;  1FJ9 A;  4F1U A;  4PAK A;  1LBW A;  4QBA A;  2PCR A;  1FPF A;  3LV0 A;  4GWW A;  5JK4 A;  5DW8 A;  3ISP A;  4N8G A;  1IMA A;  2XXK A;  5F24 A;  1IMB A;  2JJK A;  2DVZ A;  1AWB A;  1RDX A;  1FBD A;  4PGP A;  4PFR A;  4O7M A;  5EYH A;  4H46 A;  4JVI A;  2F3B A;  3IFA A;  3KC0 A;  2DE2 A;  1FBE A;  2QFL A;  1BK4 A;  1NV0 A;  5IGA A;  1NV7 A;  1FSA A;  4PF6 A;  2Q9T A;  2QVR A;  4PBQ A;  1NUZ A;  5ESY A;  1FPL A;  4QXD A;  2VT5 A;  1NV3 A;  4JVC A;  4PE3 A;  1D9Q A;  1LBV A;  2KR0 A;  4F1V A;  4GX3 A;  1KA1 A;  3KBZ A;  4GWS A;  1FPE A;  4LN5 A;  5ET5 A;  3W9W A;  2CEX A;  2WBB A;  3QMF A;  4PAI A;  2KQZ A;  1NV1 A;  3SZP A;  5ET7 A;  5J1D A;  4NGU A;  2XWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...