3FFYA

Putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
NATAFVPALVASGLPNEKFCFEGFLPQKKGRMTKLKSLVDEHRTMVFYESPHRLLKTLTQFAEYFGPERQVSVSREISKIHEETVRGTLSELIEHFTATDPRGEIVIVLAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of putative tetrapyrrole (corrin/porphyrin) methyltransferase from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords Putative tetrapyrrole (Corrin/porphyrin) methylase
total genus 27
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3ffyA00
1CBFA 2PCMA 2ENIA 2E17A 2HUVA 2EMRA 2PB6A 2P6LA 2PCAA 2EH2A 2EN5A 2EJZA 2E7RA 3NUTA 2EMUA 2DSGA 2EEQA 2YBQA 2E0KA 1PJTA 2HR8A 2E4RA 2PCIA 1PJQA 2DV4A 5HW4A 2DXXA 2DXVA 2ZVBA 3I4TA 2P2XA 2ED3A 2EJJA 2HUTA 2P6IA 2EGSA 2E0NA 2DSIA 2DXWA 2EK2A 1VHVA 2DV5A 2E07A 2E8RA 2EL3A 3NEIA 2EL1A 2EGBA 2PB4A 1V9AA 2EHCA 1PJSA 2NPNA 2P9DA 2ZVCA 4E16A 2P6DA 2EK4A 2E4NA 2DV3A 1WNGA 2EKAA 2EL2A 2ED5A 2PB5A 1VCEA 3KWPA 2E8QA 2HUXA 2OWGA 1WDEA 2P5FA 2YBOA 3NDCA 3FFYA 2OWKA 2PCGA 2EHLA 2EK3A 2BB3A 2DSHA 1WYZA 2OWUA 2EH4A 2P6KA 2DV7A 2ELEA 2PCHA 2EL0A 1VA0A 2CBFA 2DEKA 2OWFA 2Z6RA 3ND1A 2QBUA 2OWVA 1S4DA 1VE2A 2EK7A 2E15A 2EGLA 2E8HA 3FQ6A 2E08A 2E16A 2E8SA 2EJKA 2EH5A 2P5CA 2ELDA 2PCKA 2HUQA
chains in the Genus database with same CATH superfamily
1CBFA 2PCMA 2ENIA 2E17A 2HUVA 2EMRA 2PB6A 2P6LA 2PCAA 2EH2A 2EN5A 2EJZA 2E7RA 3NUTA 2EMUA 2DSGA 2EEQA 2YBQA 2E0KA 1PJTA 2HR8A 2E4RA 2PCIA 1PJQA 2DV4A 5HW4A 2DXXA 2DXVA 2ZVBA 3I4TA 3LMMA 2P2XA 2ED3A 2EJJA 2HUTA 2P6IA 2EGSA 2E0NA 2DSIA 2DXWA 2EK2A 1VHVA 2DV5A 2E07A 2E8RA 2EL3A 3NEIA 2EL1A 2EGBA 2PB4A 1V9AA 2EHCA 1PJSA 2NPNA 2P9DA 2ZVCA 4E16A 2P6DA 2EK4A 2E4NA 2DV3A 1WNGA 2EKAA 2EL2A 2ED5A 2PB5A 1VCEA 3KWPA 2E8QA 2HUXA 2OWGA 1WDEA 2P5FA 2YBOA 3NDCA 3FFYA 2OWKA 2PCGA 2EHLA 2EK3A 2BB3A 2KYYA 2DSHA 1WYZA 2OWUA 2EH4A 2P6KA 2DV7A 2ELEA 2PCHA 2EL0A 1VA0A 2CBFA 2DEKA 2OWFA 2Z6RA 3ND1A 2QBUA 2OWVA 1S4DA 1VE2A 2EK7A 2E15A 2EGLA 2E8HA 3FQ6A 2E08A 2E16A 2E8SA 2EJKA 2EH5A 2P5CA 2ELDA 2PCKA 2HUQA
chains in the Genus database with same CATH topology
1CBFA 2PCMA 2ENIA 2E17A 2HUVA 2EMRA 2PB6A 2P6LA 2PCAA 2EH2A 2EN5A 2EJZA 2E7RA 3NUTA 2EMUA 2DSGA 2EEQA 2YBQA 2E0KA 1PJTA 2HR8A 2E4RA 2PCIA 1PJQA 2DV4A 5HW4A 2DXXA 2DXVA 2ZVBA 3I4TA 3LMMA 2P2XA 2ED3A 2EJJA 2HUTA 2P6IA 2EGSA 2E0NA 2DSIA 2DXWA 2EK2A 1VHVA 2DV5A 2E07A 2E8RA 2EL3A 3NEIA 2EL1A 2EGBA 2PB4A 1V9AA 2EHCA 1PJSA 2NPNA 2P9DA 2ZVCA 4E16A 2P6DA 2EK4A 2E4NA 2DV3A 1WNGA 2EKAA 2EL2A 2ED5A 2PB5A 1VCEA 3KWPA 2E8QA 2HUXA 2OWGA 1WDEA 2P5FA 2YBOA 3NDCA 3FFYA 2OWKA 2PCGA 2EHLA 2EK3A 2BB3A 2KYYA 2DSHA 1WYZA 2OWUA 2EH4A 2P6KA 2DV7A 2ELEA 2PCHA 2EL0A 1VA0A 2CBFA 2DEKA 2OWFA 2Z6RA 3ND1A 2QBUA 2OWVA 1S4DA 1VE2A 2EK7A 2E15A 2EGLA 2E8HA 3FQ6A 2E08A 2E16A 2E8SA 2EJKA 2EH5A 2P5CA 2ELDA 2PCKA 2HUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CBF A;  2PCM A;  2ENI A;  2E17 A;  2HUV A;  2EMR A;  2PB6 A;  2P6L A;  2PCA A;  2EH2 A;  2EN5 A;  2EJZ A;  2E7R A;  3NUT A;  2EMU A;  2DSG A;  2EEQ A;  2YBQ A;  2E0K A;  1PJT A;  2HR8 A;  2E4R A;  2PCI A;  1PJQ A;  2DV4 A;  5HW4 A;  2DXX A;  2DXV A;  2ZVB A;  3I4T A;  2P2X A;  2ED3 A;  2EJJ A;  2HUT A;  2P6I A;  2EGS A;  2E0N A;  2DSI A;  2DXW A;  2EK2 A;  1VHV A;  2DV5 A;  2E07 A;  2E8R A;  2EL3 A;  3NEI A;  2EL1 A;  2EGB A;  2PB4 A;  1V9A A;  2EHC A;  1PJS A;  2NPN A;  2P9D A;  2ZVC A;  4E16 A;  2P6D A;  2EK4 A;  2E4N A;  2DV3 A;  1WNG A;  2EKA A;  2EL2 A;  2ED5 A;  2PB5 A;  1VCE A;  3KWP A;  2E8Q A;  2HUX A;  2OWG A;  1WDE A;  2P5F A;  2YBO A;  3NDC A;  3FFY A;  2OWK A;  2PCG A;  2EHL A;  2EK3 A;  2BB3 A;  2DSH A;  1WYZ A;  2OWU A;  2EH4 A;  2P6K A;  2DV7 A;  2ELE A;  2PCH A;  2EL0 A;  1VA0 A;  2CBF A;  2DEK A;  2OWF A;  2Z6R A;  3ND1 A;  2QBU A;  2OWV A;  1S4D A;  1VE2 A;  2EK7 A;  2E15 A;  2EGL A;  2E8H A;  3FQ6 A;  2E08 A;  2E16 A;  2E8S A;  2EJK A;  2EH5 A;  2P5C A;  2ELD A;  2PCK A;  2HUQ A; 
#chains in the Genus database with same CATH topology
 1CBF A;  2PCM A;  2ENI A;  2E17 A;  2HUV A;  2EMR A;  2PB6 A;  2P6L A;  2PCA A;  2EH2 A;  2EN5 A;  2EJZ A;  2E7R A;  3NUT A;  2EMU A;  2DSG A;  2EEQ A;  2YBQ A;  2E0K A;  1PJT A;  2HR8 A;  2E4R A;  2PCI A;  1PJQ A;  2DV4 A;  5HW4 A;  2DXX A;  2DXV A;  2ZVB A;  3I4T A;  3LMM A;  2P2X A;  2ED3 A;  2EJJ A;  2HUT A;  2P6I A;  2EGS A;  2E0N A;  2DSI A;  2DXW A;  2EK2 A;  1VHV A;  2DV5 A;  2E07 A;  2E8R A;  2EL3 A;  3NEI A;  2EL1 A;  2EGB A;  2PB4 A;  1V9A A;  2EHC A;  1PJS A;  2NPN A;  2P9D A;  2ZVC A;  4E16 A;  2P6D A;  2EK4 A;  2E4N A;  2DV3 A;  1WNG A;  2EKA A;  2EL2 A;  2ED5 A;  2PB5 A;  1VCE A;  3KWP A;  2E8Q A;  2HUX A;  2OWG A;  1WDE A;  2P5F A;  2YBO A;  3NDC A;  3FFY A;  2OWK A;  2PCG A;  2EHL A;  2EK3 A;  2BB3 A;  2KYY A;  2DSH A;  1WYZ A;  2OWU A;  2EH4 A;  2P6K A;  2DV7 A;  2ELE A;  2PCH A;  2EL0 A;  1VA0 A;  2CBF A;  2DEK A;  2OWF A;  2Z6R A;  3ND1 A;  2QBU A;  2OWV A;  1S4D A;  1VE2 A;  2EK7 A;  2E15 A;  2EGL A;  2E8H A;  3FQ6 A;  2E08 A;  2E16 A;  2E8S A;  2EJK A;  2EH5 A;  2P5C A;  2ELD A;  2PCK A;  2HUQ A; 
#chains in the Genus database with same CATH homology
 1CBF A;  2PCM A;  2ENI A;  2E17 A;  2HUV A;  2EMR A;  2PB6 A;  2P6L A;  2PCA A;  2EH2 A;  2EN5 A;  2EJZ A;  2E7R A;  3NUT A;  2EMU A;  2DSG A;  2EEQ A;  2YBQ A;  2E0K A;  1PJT A;  2HR8 A;  2E4R A;  2PCI A;  1PJQ A;  2DV4 A;  5HW4 A;  2DXX A;  2DXV A;  2ZVB A;  3I4T A;  3LMM A;  2P2X A;  2ED3 A;  2EJJ A;  2HUT A;  2P6I A;  2EGS A;  2E0N A;  2DSI A;  2DXW A;  2EK2 A;  1VHV A;  2DV5 A;  2E07 A;  2E8R A;  2EL3 A;  3NEI A;  2EL1 A;  2EGB A;  2PB4 A;  1V9A A;  2EHC A;  1PJS A;  2NPN A;  2P9D A;  2ZVC A;  4E16 A;  2P6D A;  2EK4 A;  2E4N A;  2DV3 A;  1WNG A;  2EKA A;  2EL2 A;  2ED5 A;  2PB5 A;  1VCE A;  3KWP A;  2E8Q A;  2HUX A;  2OWG A;  1WDE A;  2P5F A;  2YBO A;  3NDC A;  3FFY A;  2OWK A;  2PCG A;  2EHL A;  2EK3 A;  2BB3 A;  2KYY A;  2DSH A;  1WYZ A;  2OWU A;  2EH4 A;  2P6K A;  2DV7 A;  2ELE A;  2PCH A;  2EL0 A;  1VA0 A;  2CBF A;  2DEK A;  2OWF A;  2Z6R A;  3ND1 A;  2QBU A;  2OWV A;  1S4D A;  1VE2 A;  2EK7 A;  2E15 A;  2EGL A;  2E8H A;  3FQ6 A;  2E08 A;  2E16 A;  2E8S A;  2EJK A;  2EH5 A;  2P5C A;  2ELD A;  2PCK A;  2HUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...