3FFYA

Putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
NATAFVPALVASGLPNEKFCFEGFLPQKKGRMTKLKSLVDEHRTMVFYESPHRLLKTLTQFAEYFGPERQVSVSREISKIHEETVRGTLSELIEHFTATDPRGEIVIVLAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of putative tetrapyrrole (corrin/porphyrin) methyltransferase from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords Putative tetrapyrrole (Corrin/porphyrin) methylase
total genus 27
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3ffyA00
2EL2A 2YBQA 2EKAA 2ZVBA 2PB5A 2DSGA 2EJJA 2HR8A 2OWKA 2PB4A 2HUXA 2EK4A 2E07A 2P6DA 1PJQA 1VCEA 2E17A 2EH4A 2EL3A 4E16A 2E08A 2PB6A 2E4RA 2DV3A 3NEIA 1WNGA 2OWVA 1CBFA 2HUTA 2ENIA 1VHVA 2P9DA 2E15A 2OWGA 2ED5A 2PCHA 2DV4A 2ELEA 2QBUA 1WDEA 2E7RA 3ND1A 3FQ6A 2DEKA 2DXXA 2EK2A 2HUQA 2DSIA 1V9AA 2EK3A 2E8RA 2ELDA 2EH2A 3KWPA 2EN5A 2OWFA 3NDCA 2DSHA 5HW4A 2EHCA 3FFYA 2P2XA 2P5CA 2EEQA 1VE2A 2PCKA 2EGBA 2EGLA 2P5FA 2EJKA 2PCAA 1S4DA 2BB3A 2HUVA 2E8HA 2EK7A 2E0KA 2PCIA 2PCMA 1WYZA 2CBFA 2NPNA 2EGSA 1VA0A 2P6LA 2E0NA 3I4TA 2ZVCA 2PCGA 2EHLA 2P6KA 2YBOA 2EH5A 2Z6RA 2EL0A 2DV7A 2DXWA 2EMUA 2ED3A 2EMRA 2E16A 2E4NA 1PJSA 2EL1A 1PJTA 2EJZA 2E8SA 3NUTA 2DXVA 2OWUA 2E8QA 2P6IA 2DV5A
chains in the Genus database with same CATH superfamily
2EL2A 2YBQA 2EKAA 2ZVBA 2PB5A 2DSGA 2EJJA 2HR8A 2OWKA 2PB4A 2HUXA 2EK4A 2E07A 2P6DA 1PJQA 1VCEA 2E17A 2EH4A 2EL3A 4E16A 2E08A 2PB6A 2E4RA 2DV3A 3NEIA 1WNGA 2OWVA 1CBFA 2HUTA 2ENIA 1VHVA 2P9DA 2E15A 2OWGA 2ED5A 2PCHA 2DV4A 2ELEA 2QBUA 1WDEA 2E7RA 3ND1A 3FQ6A 2DEKA 2DXXA 2EK2A 2HUQA 2DSIA 1V9AA 2EK3A 2E8RA 2ELDA 2EH2A 3KWPA 2EN5A 2OWFA 3NDCA 2DSHA 5HW4A 2EHCA 3FFYA 2P2XA 2P5CA 2EEQA 1VE2A 2PCKA 2EGBA 2EGLA 2P5FA 2EJKA 2PCAA 1S4DA 2BB3A 2HUVA 2E8HA 2EK7A 2E0KA 2PCIA 2KYYA 2PCMA 1WYZA 2CBFA 2NPNA 2EGSA 1VA0A 2P6LA 2E0NA 3I4TA 2ZVCA 2PCGA 3LMMA 2EHLA 2P6KA 2YBOA 2EH5A 2Z6RA 2EL0A 2DV7A 2DXWA 2EMUA 2ED3A 2EMRA 2E16A 2E4NA 1PJSA 2EL1A 1PJTA 2EJZA 2E8SA 3NUTA 2DXVA 2OWUA 2E8QA 2P6IA 2DV5A
chains in the Genus database with same CATH topology
2EL2A 2YBQA 2EKAA 2ZVBA 2PB5A 2DSGA 2EJJA 2HR8A 2OWKA 2PB4A 2HUXA 2EK4A 2E07A 2P6DA 1PJQA 1VCEA 2E17A 2EH4A 2EL3A 4E16A 2E08A 2PB6A 2E4RA 2DV3A 3NEIA 1WNGA 2OWVA 1CBFA 2HUTA 2ENIA 1VHVA 2P9DA 2E15A 2OWGA 2ED5A 2PCHA 2DV4A 2ELEA 2QBUA 1WDEA 2E7RA 3ND1A 3FQ6A 2DEKA 2DXXA 2EK2A 2HUQA 2DSIA 1V9AA 2EK3A 2E8RA 2ELDA 2EH2A 3KWPA 2EN5A 2OWFA 3NDCA 2DSHA 5HW4A 2EHCA 3FFYA 2P2XA 2P5CA 2EEQA 1VE2A 2PCKA 2EGBA 2EGLA 2P5FA 2EJKA 2PCAA 1S4DA 2BB3A 2HUVA 2E8HA 2EK7A 2E0KA 2PCIA 2KYYA 2PCMA 1WYZA 2CBFA 2NPNA 2EGSA 1VA0A 2P6LA 2E0NA 3I4TA 2ZVCA 2PCGA 3LMMA 2EHLA 2P6KA 2YBOA 2EH5A 2Z6RA 2EL0A 2DV7A 2DXWA 2EMUA 2ED3A 2EMRA 2E16A 2E4NA 1PJSA 2EL1A 1PJTA 2EJZA 2E8SA 3NUTA 2DXVA 2OWUA 2E8QA 2P6IA 2DV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL2 A;  2YBQ A;  2EKA A;  2ZVB A;  2PB5 A;  2DSG A;  2EJJ A;  2HR8 A;  2OWK A;  2PB4 A;  2HUX A;  2EK4 A;  2E07 A;  2P6D A;  1PJQ A;  1VCE A;  2E17 A;  2EH4 A;  2EL3 A;  4E16 A;  2E08 A;  2PB6 A;  2E4R A;  2DV3 A;  3NEI A;  1WNG A;  2OWV A;  1CBF A;  2HUT A;  2ENI A;  1VHV A;  2P9D A;  2E15 A;  2OWG A;  2ED5 A;  2PCH A;  2DV4 A;  2ELE A;  2QBU A;  1WDE A;  2E7R A;  3ND1 A;  3FQ6 A;  2DEK A;  2DXX A;  2EK2 A;  2HUQ A;  2DSI A;  1V9A A;  2EK3 A;  2E8R A;  2ELD A;  2EH2 A;  3KWP A;  2EN5 A;  2OWF A;  3NDC A;  2DSH A;  5HW4 A;  2EHC A;  3FFY A;  2P2X A;  2P5C A;  2EEQ A;  1VE2 A;  2PCK A;  2EGB A;  2EGL A;  2P5F A;  2EJK A;  2PCA A;  1S4D A;  2BB3 A;  2HUV A;  2E8H A;  2EK7 A;  2E0K A;  2PCI A;  2PCM A;  1WYZ A;  2CBF A;  2NPN A;  2EGS A;  1VA0 A;  2P6L A;  2E0N A;  3I4T A;  2ZVC A;  2PCG A;  2EHL A;  2P6K A;  2YBO A;  2EH5 A;  2Z6R A;  2EL0 A;  2DV7 A;  2DXW A;  2EMU A;  2ED3 A;  2EMR A;  2E16 A;  2E4N A;  1PJS A;  2EL1 A;  1PJT A;  2EJZ A;  2E8S A;  3NUT A;  2DXV A;  2OWU A;  2E8Q A;  2P6I A;  2DV5 A; 
#chains in the Genus database with same CATH topology
 2EL2 A;  2YBQ A;  2EKA A;  2ZVB A;  2PB5 A;  2DSG A;  2EJJ A;  2HR8 A;  2OWK A;  2PB4 A;  2HUX A;  2EK4 A;  2E07 A;  2P6D A;  1PJQ A;  1VCE A;  2E17 A;  2EH4 A;  2EL3 A;  4E16 A;  2E08 A;  2PB6 A;  2E4R A;  2DV3 A;  3NEI A;  1WNG A;  2OWV A;  1CBF A;  2HUT A;  2ENI A;  1VHV A;  2P9D A;  2E15 A;  2OWG A;  2ED5 A;  2PCH A;  2DV4 A;  2ELE A;  2QBU A;  1WDE A;  2E7R A;  3ND1 A;  3FQ6 A;  2DEK A;  2DXX A;  2EK2 A;  2HUQ A;  2DSI A;  1V9A A;  2EK3 A;  2E8R A;  2ELD A;  2EH2 A;  3KWP A;  2EN5 A;  2OWF A;  3NDC A;  2DSH A;  5HW4 A;  2EHC A;  3FFY A;  2P2X A;  2P5C A;  2EEQ A;  1VE2 A;  2PCK A;  2EGB A;  2EGL A;  2P5F A;  2EJK A;  2PCA A;  1S4D A;  2BB3 A;  2HUV A;  2E8H A;  2EK7 A;  2E0K A;  2PCI A;  2KYY A;  2PCM A;  1WYZ A;  2CBF A;  2NPN A;  2EGS A;  1VA0 A;  2P6L A;  2E0N A;  3I4T A;  2ZVC A;  2PCG A;  3LMM A;  2EHL A;  2P6K A;  2YBO A;  2EH5 A;  2Z6R A;  2EL0 A;  2DV7 A;  2DXW A;  2EMU A;  2ED3 A;  2EMR A;  2E16 A;  2E4N A;  1PJS A;  2EL1 A;  1PJT A;  2EJZ A;  2E8S A;  3NUT A;  2DXV A;  2OWU A;  2E8Q A;  2P6I A;  2DV5 A; 
#chains in the Genus database with same CATH homology
 2EL2 A;  2YBQ A;  2EKA A;  2ZVB A;  2PB5 A;  2DSG A;  2EJJ A;  2HR8 A;  2OWK A;  2PB4 A;  2HUX A;  2EK4 A;  2E07 A;  2P6D A;  1PJQ A;  1VCE A;  2E17 A;  2EH4 A;  2EL3 A;  4E16 A;  2E08 A;  2PB6 A;  2E4R A;  2DV3 A;  3NEI A;  1WNG A;  2OWV A;  1CBF A;  2HUT A;  2ENI A;  1VHV A;  2P9D A;  2E15 A;  2OWG A;  2ED5 A;  2PCH A;  2DV4 A;  2ELE A;  2QBU A;  1WDE A;  2E7R A;  3ND1 A;  3FQ6 A;  2DEK A;  2DXX A;  2EK2 A;  2HUQ A;  2DSI A;  1V9A A;  2EK3 A;  2E8R A;  2ELD A;  2EH2 A;  3KWP A;  2EN5 A;  2OWF A;  3NDC A;  2DSH A;  5HW4 A;  2EHC A;  3FFY A;  2P2X A;  2P5C A;  2EEQ A;  1VE2 A;  2PCK A;  2EGB A;  2EGL A;  2P5F A;  2EJK A;  2PCA A;  1S4D A;  2BB3 A;  2HUV A;  2E8H A;  2EK7 A;  2E0K A;  2PCI A;  2KYY A;  2PCM A;  1WYZ A;  2CBF A;  2NPN A;  2EGS A;  1VA0 A;  2P6L A;  2E0N A;  3I4T A;  2ZVC A;  2PCG A;  3LMM A;  2EHL A;  2P6K A;  2YBO A;  2EH5 A;  2Z6R A;  2EL0 A;  2DV7 A;  2DXW A;  2EMU A;  2ED3 A;  2EMR A;  2E16 A;  2E4N A;  1PJS A;  2EL1 A;  1PJT A;  2EJZ A;  2E8S A;  3NUT A;  2DXV A;  2OWU A;  2E8Q A;  2P6I A;  2DV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...