3FFYA

Putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
b'NATAFVPALVASGLPNEKFCFEGFLPQKKGRMTKLKSLVDEHRTMVFYESPHRLLKTLTQFAEYFGPERQVSVSREISKIHEETVRGTLSELIEHFTATDPRGEIVIVLAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative tetrapyrrole (Corrin/porphyrin) methylase
publication title X-ray crystal structure of putative tetrapyrrole (corrin/porphyrin) methyltransferase from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 27
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3ffyA00
1PJTA 2NPNA 1VHVA 2EL0A 2ELDA 2PCIA 2PCMA 2DV4A 2EEQA 2Z6RA 2EK2A 2P6DA 3FQ6A 2E8SA 2EGLA 2EH2A 2PCGA 2OWVA 2ZVBA 2E8RA 2DSGA 2P6KA 2EGBA 2EGSA 2EL1A 2EMUA 2EJJA 2DEKA 2YBOA 2HR8A 1V9AA 1PJSA 1CBFA 2P9DA 2ENIA 1VE2A 2E15A 2E17A 2P5CA 5HW4A 2YBQA 2DXWA 3FFYA 1VA0A 2E07A 2EK3A 2OWGA 2EJZA 2PB4A 2DV5A 3NDCA 2HUVA 2EN5A 3I4TA 2PCAA 3NEIA 2OWKA 3KWPA 2ED3A 2EJKA 2DXVA 2PCKA 1VCEA 2EHLA 2E8QA 2BB3A 2E7RA 2HUXA 2EH4A 2E8HA 2DXXA 2E0KA 2EK7A 2DV7A 2OWUA 2EMRA 2ELEA 2E0NA 1S4DA 2ED5A 2HUQA 2DSIA 3NUTA 2E16A 2EHCA 2DV3A 2P6IA 2EKAA 1WYZA 2EH5A 2EL3A 2E4NA 2E08A 1WDEA 4E16A 1PJQA 3ND1A 2HUTA 2ZVCA 2OWFA 2PB5A 2DSHA 2PB6A 2EK4A 2QBUA 2EL2A 2P2XA 2CBFA 1WNGA 2P6LA 2PCHA 2P5FA 2E4RA
chains in the Genus database with same CATH superfamily
1PJTA 2NPNA 1VHVA 2KYYA 2EL0A 2ELDA 2PCIA 2PCMA 2DV4A 2EEQA 2Z6RA 2EK2A 2P6DA 3FQ6A 2E8SA 2EGLA 2EH2A 2PCGA 2OWVA 2ZVBA 2E8RA 2DSGA 2P6KA 2EGBA 2EGSA 2EL1A 2EMUA 2EJJA 2DEKA 2YBOA 2HR8A 1V9AA 1PJSA 1CBFA 2P9DA 2ENIA 1VE2A 2E15A 2E17A 2P5CA 5HW4A 2YBQA 2DXWA 3FFYA 1VA0A 2E07A 2EK3A 2OWGA 2EJZA 2PB4A 2DV5A 3NDCA 2HUVA 2EN5A 3I4TA 2PCAA 3NEIA 2OWKA 3KWPA 2ED3A 2EJKA 2DXVA 2PCKA 1VCEA 2EHLA 2E8QA 2BB3A 2E7RA 2HUXA 2EH4A 2E8HA 2DXXA 2E0KA 2EK7A 2DV7A 2OWUA 2EMRA 2ELEA 2E0NA 1S4DA 2ED5A 2HUQA 2DSIA 3NUTA 2E16A 2EHCA 2DV3A 2P6IA 2EKAA 1WYZA 2EH5A 2EL3A 2E4NA 2E08A 1WDEA 4E16A 1PJQA 3ND1A 2HUTA 2ZVCA 2OWFA 2PB5A 2DSHA 2PB6A 2EK4A 2QBUA 2EL2A 2P2XA 2CBFA 1WNGA 2P6LA 3LMMA 2PCHA 2P5FA 2E4RA
chains in the Genus database with same CATH topology
1PJTA 2NPNA 1VHVA 2KYYA 2EL0A 2ELDA 2PCIA 2PCMA 2DV4A 2EEQA 2Z6RA 2EK2A 2P6DA 3FQ6A 2E8SA 2EGLA 2EH2A 2PCGA 2OWVA 2ZVBA 2E8RA 2DSGA 2P6KA 2EGBA 2EGSA 2EL1A 2EMUA 2EJJA 2DEKA 2YBOA 2HR8A 1V9AA 1PJSA 1CBFA 2P9DA 2ENIA 1VE2A 2E15A 2E17A 2P5CA 5HW4A 2YBQA 2DXWA 3FFYA 1VA0A 2E07A 2EK3A 2OWGA 2EJZA 2PB4A 2DV5A 3NDCA 2HUVA 2EN5A 3I4TA 2PCAA 3NEIA 2OWKA 3KWPA 2ED3A 2EJKA 2DXVA 2PCKA 1VCEA 2EHLA 2E8QA 2BB3A 2E7RA 2HUXA 2EH4A 2E8HA 2DXXA 2E0KA 2EK7A 2DV7A 2OWUA 2EMRA 2ELEA 2E0NA 1S4DA 2ED5A 2HUQA 2DSIA 3NUTA 2E16A 2EHCA 2DV3A 2P6IA 2EKAA 1WYZA 2EH5A 2EL3A 2E4NA 2E08A 1WDEA 4E16A 1PJQA 3ND1A 2HUTA 2ZVCA 2OWFA 2PB5A 2DSHA 2PB6A 2EK4A 2QBUA 2EL2A 2P2XA 2CBFA 1WNGA 2P6LA 3LMMA 2PCHA 2P5FA 2E4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJT A;  2NPN A;  1VHV A;  2EL0 A;  2ELD A;  2PCI A;  2PCM A;  2DV4 A;  2EEQ A;  2Z6R A;  2EK2 A;  2P6D A;  3FQ6 A;  2E8S A;  2EGL A;  2EH2 A;  2PCG A;  2OWV A;  2ZVB A;  2E8R A;  2DSG A;  2P6K A;  2EGB A;  2EGS A;  2EL1 A;  2EMU A;  2EJJ A;  2DEK A;  2YBO A;  2HR8 A;  1V9A A;  1PJS A;  1CBF A;  2P9D A;  2ENI A;  1VE2 A;  2E15 A;  2E17 A;  2P5C A;  5HW4 A;  2YBQ A;  2DXW A;  3FFY A;  1VA0 A;  2E07 A;  2EK3 A;  2OWG A;  2EJZ A;  2PB4 A;  2DV5 A;  3NDC A;  2HUV A;  2EN5 A;  3I4T A;  2PCA A;  3NEI A;  2OWK A;  3KWP A;  2ED3 A;  2EJK A;  2DXV A;  2PCK A;  1VCE A;  2EHL A;  2E8Q A;  2BB3 A;  2E7R A;  2HUX A;  2EH4 A;  2E8H A;  2DXX A;  2E0K A;  2EK7 A;  2DV7 A;  2OWU A;  2EMR A;  2ELE A;  2E0N A;  1S4D A;  2ED5 A;  2HUQ A;  2DSI A;  3NUT A;  2E16 A;  2EHC A;  2DV3 A;  2P6I A;  2EKA A;  1WYZ A;  2EH5 A;  2EL3 A;  2E4N A;  2E08 A;  1WDE A;  4E16 A;  1PJQ A;  3ND1 A;  2HUT A;  2ZVC A;  2OWF A;  2PB5 A;  2DSH A;  2PB6 A;  2EK4 A;  2QBU A;  2EL2 A;  2P2X A;  2CBF A;  1WNG A;  2P6L A;  2PCH A;  2P5F A;  2E4R A; 
#chains in the Genus database with same CATH topology
 1PJT A;  2NPN A;  1VHV A;  2KYY A;  2EL0 A;  2ELD A;  2PCI A;  2PCM A;  2DV4 A;  2EEQ A;  2Z6R A;  2EK2 A;  2P6D A;  3FQ6 A;  2E8S A;  2EGL A;  2EH2 A;  2PCG A;  2OWV A;  2ZVB A;  2E8R A;  2DSG A;  2P6K A;  2EGB A;  2EGS A;  2EL1 A;  2EMU A;  2EJJ A;  2DEK A;  2YBO A;  2HR8 A;  1V9A A;  1PJS A;  1CBF A;  2P9D A;  2ENI A;  1VE2 A;  2E15 A;  2E17 A;  2P5C A;  5HW4 A;  2YBQ A;  2DXW A;  3FFY A;  1VA0 A;  2E07 A;  2EK3 A;  2OWG A;  2EJZ A;  2PB4 A;  2DV5 A;  3NDC A;  2HUV A;  2EN5 A;  3I4T A;  2PCA A;  3NEI A;  2OWK A;  3KWP A;  2ED3 A;  2EJK A;  2DXV A;  2PCK A;  1VCE A;  2EHL A;  2E8Q A;  2BB3 A;  2E7R A;  2HUX A;  2EH4 A;  2E8H A;  2DXX A;  2E0K A;  2EK7 A;  2DV7 A;  2OWU A;  2EMR A;  2ELE A;  2E0N A;  1S4D A;  2ED5 A;  2HUQ A;  2DSI A;  3NUT A;  2E16 A;  2EHC A;  2DV3 A;  2P6I A;  2EKA A;  1WYZ A;  2EH5 A;  2EL3 A;  2E4N A;  2E08 A;  1WDE A;  4E16 A;  1PJQ A;  3ND1 A;  2HUT A;  2ZVC A;  2OWF A;  2PB5 A;  2DSH A;  2PB6 A;  2EK4 A;  2QBU A;  2EL2 A;  2P2X A;  2CBF A;  1WNG A;  2P6L A;  3LMM A;  2PCH A;  2P5F A;  2E4R A; 
#chains in the Genus database with same CATH homology
 1PJT A;  2NPN A;  1VHV A;  2KYY A;  2EL0 A;  2ELD A;  2PCI A;  2PCM A;  2DV4 A;  2EEQ A;  2Z6R A;  2EK2 A;  2P6D A;  3FQ6 A;  2E8S A;  2EGL A;  2EH2 A;  2PCG A;  2OWV A;  2ZVB A;  2E8R A;  2DSG A;  2P6K A;  2EGB A;  2EGS A;  2EL1 A;  2EMU A;  2EJJ A;  2DEK A;  2YBO A;  2HR8 A;  1V9A A;  1PJS A;  1CBF A;  2P9D A;  2ENI A;  1VE2 A;  2E15 A;  2E17 A;  2P5C A;  5HW4 A;  2YBQ A;  2DXW A;  3FFY A;  1VA0 A;  2E07 A;  2EK3 A;  2OWG A;  2EJZ A;  2PB4 A;  2DV5 A;  3NDC A;  2HUV A;  2EN5 A;  3I4T A;  2PCA A;  3NEI A;  2OWK A;  3KWP A;  2ED3 A;  2EJK A;  2DXV A;  2PCK A;  1VCE A;  2EHL A;  2E8Q A;  2BB3 A;  2E7R A;  2HUX A;  2EH4 A;  2E8H A;  2DXX A;  2E0K A;  2EK7 A;  2DV7 A;  2OWU A;  2EMR A;  2ELE A;  2E0N A;  1S4D A;  2ED5 A;  2HUQ A;  2DSI A;  3NUT A;  2E16 A;  2EHC A;  2DV3 A;  2P6I A;  2EKA A;  1WYZ A;  2EH5 A;  2EL3 A;  2E4N A;  2E08 A;  1WDE A;  4E16 A;  1PJQ A;  3ND1 A;  2HUT A;  2ZVC A;  2OWF A;  2PB5 A;  2DSH A;  2PB6 A;  2EK4 A;  2QBU A;  2EL2 A;  2P2X A;  2CBF A;  1WNG A;  2P6L A;  3LMM A;  2PCH A;  2P5F A;  2E4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...