1HH7A

Refined crystal structure of cytochrome c2 from rhodopseudomonas palustris at 1.4 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
EDAKAGEAVFKQCMTCHRADKNMVGPALAGVVGRKAGTAAGFTYSPLNHNSGEAGLVWTADNIVPYLADPNAFLKKFLTEKGKADQAVGVTKMTFKLANEQQRKDVVAYLATLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C2
publication title Crystallization and Preliminary X-Ray Analysis of Two Ph-Dependent Forms of Cytochrome C2 from Rhodopseudomonas Palustris
pubmed doi rcsb
molecule tags Electron transport
total genus 37
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1hh7A00
4UB6V 1BE3D 3MK7C 4NFGB 1QN2A 3TGUD 5B6QA 2ORLA 1IRVA 1MG2D 3L71D 2B0ZB 1EZVD 4FA4A 1AKKA 2MTAC 3ZOWA 2BGVX 5CICB 2XTSB 3NBTA 5DJQC 3VRDA 5E79V 3NBSA 1CCHA 1RZ6A 2GIWA 1YIQA 1I6DA 1CRHA 3CU4A 3SLEA 4QAOA 1CTYA 3MK7B 3OCDB 1I55A 2BCNB 2MHMA 1CSVA 1HJ3A 1FI7A 1I8PA 4L3GA 4XYDB 1DW1A 2BCCD 2CA4B 1DVVA 1KX2A 3SWSA 4AANA 1H32B 1ZZHA 1J3SA 2CE0A 3RN1A 5DJQB 2B12B 2N9IA 3L70D 1KB0A 3WFEC 2C1UA 351CA 1KIBA 4PWAA 1CHIA 1FI9A 2FWLA 3CYTI 3SXTA 1K3GA 1HRCA 3WUIA 3ZBMA 2CXBA 1CIGA 3HQ7A 4O1WA 3DP5A 1QYZA 2CA3B 4PJ0V 3VYMA 1L0ND 2FYNB 1IQCA 1BGYD 1FCDC 1YNRA 1WVEC 1S5LV 1AOQA 1CRIA 3HQ9A 1LC1A 1CO6A 1DVHA 2DGEA 3RMZA 1H33A 4WQDA 1N15A 3H1KD 2N18B 1CSWA 2HV4A 4L1QA 1DW3A 4FA1A 1KYOD 1LC2A 1U74B 5KAIV 5IY51 4WQEA 4Y5RA 1SQXD 1CSXA 4H0KA 1CYIA 1I8OA 1W2LA 4JCGA 2L4DA 2N3BA 2PCCB 3ZOXA 2C9XB 1LMSA 1M6ZA 4U3FD 2A06D 1RZ5A 1KX7A 1DT1A 1HH7A 1M60A 2I8FA 3CXHW 1HCMA 1P84D 2YIUB 4WQ8A 1S6VB 2LIRA 1W5CT 1M70A 1GU2A 4GYDA 3TYIA 2N3YA 1CHJA 2FYUD 1C6SA 2C1VA 1AOFA 2QJPB 1CRYA 2JQRA 2B11B 4N0KA 1YEBA 1H33B 1FI3A 1CC5A 2C2CA 4WQ7A 3CX5W 3A0HV 4D6TD 2C8SA 3OA8A 1C75A 1HZUA 2ZXYA 2C1DB 1EB7A 4AX3A 5AURA 4P4QB 3ZOYA 4EIEA 1RAPA 1DIQC 1A2SA 1CRCA 2B4ZA 5CYTR 1N9CA 2BH4X 1A56A 1CIHA 2V08A 5KLIB 1CYCA 4EICA 5GTIV 5KLVD 1CHHA 2ZBOA 3NWVA 1CRGA 1H1OA 2ZONG 2OZ1A 5B5EV 3PXWA 4GEDB 2BLFB 1YTCA 4EIDA 2QJYB 1CNOA 2ZOOA 4WQAA 1HJ5A 3BCCD 1BL9A 1FOCA 3O20A 1WEJF 2PCBB 1IO3A 2BH5X 1LS9A 1PP9D 2DVHA 4UB8V 2YQBA 1NU1D 1CCRA 3O5CA 3DMIA 1SQBD 2D0SA 2AIUA 1E2RA 1I5TA 3M97X 3SJLA 1H31A 1E8EA 1NTKD 1N50A 1N90A 2PACA 1SQQD 5B66V 1CRJA 2YCCA 1C2RA 3A0BV 3CWBD 4PD4D 4DY9A 4O1QA 4FA9A 3SVWA 3VNWA 3CP5A 5CIGB 2D0WA 1FJ0A 1SQPD 2N9JA 3CXHD 2IBZD 4PW9B 3C2CA 2OZ1B 1GDVA 1YEAA 1JDLA 5EXQA 1GJQA 1L9BC 1NIRA 4FA5A 1MZ4A 1F1FA 3WFBC 4FAVA 3JBTB 3OCDA 3H1LD 3PXTA 1MG3D 451CA 2EXVA 2YK3A 1DIIC 3ORVA 1F1CA 3DR0A 4KMGA 4WQBA 3RLMA 5C0ZA 1H32A 1NTMD 1A8CA 3CX5D 4XXLA 1NNOA 1LFMA 1H31B 3WFCC 4H0JA 1OCDA 1DW2A 1IZL0 1C6OA 3L73D 5DF5A 4MU8A 1B7VA 1BCCD 1CSUA 2GC4D 1CXCA 4AAOA 3WU2V 1C6RA 2VHDA 4WQCA 1CXAA 3ZOOA 1NMIA 1H9XA 2AXTV 1NMLA 4AAMA 1L0LD 1CORA 3L75D 1GKSA 2AI5A 1GIWA 4J20A 3HQ6A 5CIBB 5GTHV 4FANA 5CIFB 4K3IA 1QKSA 1CIFA 1SQVD 1RAQA 3PH2B 1NTZD 1YICA 1R0QA 4V2KA 3ZIYA 3L72D 1GQ1A 1KV9A 5CIHB 1VYDA 1L9JC 3A9FA 5CIDB 3L74D 3WFDC 1AYGA 1I6EA 1I54A 3H1JD 3H1ID 2CE1A 4AALA 4RSZA 1CTJA 3O1YA 2GB8B 2N18C 1CIEA 3O0RC 1CYJA 1KB9D 4YE1A 1ETPA 2JTIB 1C52A 5DFSA 4LJIA 3L4MA 1C2NA 1IRWA 3OA8B 5H2FV 5C9MA 2QJKB 3RN0A 3X39A 1C7MA 155CA 1FHBA 4L3HA 2B10B 2ZZS1 1YFCA 1DW0A 2FRCA 3WC8A 2V07A 3KZIV 1H9YA 1K3HA 1HZVA 5KKZB 1PPJD 2BPBB 1HROA 1YCCA 1U75B 4FB1A 1CEDA 3L4OA 2GC7D 5TISV 4EIFA 1CTZA 1E29A 2C1DA 1HJ4A 1QL3A 1OAEA 3H1HD 1COTA 1ZRTD 3HQ8A 4WQ9A 2LITA 4Q5PA 5CIEB 1KYOW 5KAFV 4IL6V 3ZCFA 1QL4A 3PXSA
chains in the Genus database with same CATH superfamily
4UB6V 1BE3D 3MK7C 4NFGB 1QN2A 3TGUD 5B6QA 2ORLA 1IRVA 1MG2D 3L71D 2B0ZB 1EZVD 4FA4A 1AKKA 2MTAC 3ZOWA 2BGVX 5CICB 2XTSB 3NBTA 5DJQC 3VRDA 5E79V 3NBSA 1CCHA 1RZ6A 2GIWA 1YIQA 1I6DA 1CRHA 3CU4A 3SLEA 4QAOA 1CTYA 3MK7B 3OCDB 1I55A 2BCNB 2MHMA 1CSVA 1HJ3A 1FI7A 1I8PA 4L3GA 4XYDB 1DW1A 2BCCD 2CA4B 1DVVA 1KX2A 3SWSA 4AANA 1H32B 1ZZHA 1J3SA 2CE0A 3RN1A 5DJQB 2B12B 2N9IA 3L70D 1KB0A 3WFEC 2C1UA 351CA 1KIBA 4PWAA 1CHIA 1FI9A 2FWLA 3CYTI 3SXTA 1K3GA 1HRCA 3WUIA 3ZBMA 2CXBA 1CIGA 3HQ7A 4O1WA 3DP5A 1QYZA 2CA3B 4PJ0V 3VYMA 1L0ND 2FYNB 1IQCA 1BGYD 1FCDC 1YNRA 1WVEC 1S5LV 1AOQA 1CRIA 3HQ9A 1LC1A 1CO6A 1DVHA 2DGEA 3RMZA 1H33A 4WQDA 1N15A 3H1KD 2N18B 1CSWA 2HV4A 4L1QA 1DW3A 4FA1A 1KYOD 1LC2A 1U74B 5KAIV 5IY51 4WQEA 4Y5RA 1SQXD 1CSXA 4H0KA 1CYIA 1I8OA 1W2LA 4JCGA 2L4DA 2N3BA 2PCCB 3ZOXA 2C9XB 1LMSA 1M6ZA 4U3FD 2A06D 1RZ5A 1KX7A 1DT1A 1HH7A 1M60A 2I8FA 3CXHW 1HCMA 1P84D 2YIUB 4WQ8A 1S6VB 2LIRA 1W5CT 1M70A 1GU2A 3D0WA 4GYDA 3TYIA 2N3YA 1CHJA 2FYUD 1C6SA 2C1VA 1AOFA 2QJPB 1CRYA 2JQRA 2B11B 4N0KA 1YEBA 1H33B 1FI3A 1CC5A 2C2CA 4WQ7A 3CX5W 3A0HV 4D6TD 2C8SA 3OA8A 1C75A 1HZUA 2ZXYA 2C1DB 1EB7A 4AX3A 5AURA 4P4QB 3ZOYA 4EIEA 1RAPA 1DIQC 1A2SA 1CRCA 2B4ZA 5CYTR 1N9CA 2BH4X 1A56A 1CIHA 2V08A 5KLIB 1CYCA 4EICA 5GTIV 5KLVD 1CHHA 2ZBOA 3NWVA 1CRGA 1H1OA 2ZONG 2OZ1A 5B5EV 3PXWA 4GEDB 2BLFB 1YTCA 4EIDA 2QJYB 1CNOA 2ZOOA 4WQAA 1HJ5A 3BCCD 1BL9A 1FOCA 3O20A 1WEJF 2PCBB 1IO3A 2BH5X 1LS9A 1PP9D 2DVHA 4UB8V 2YQBA 1NU1D 1CCRA 3O5CA 3DMIA 1SQBD 2D0SA 2AIUA 1E2RA 1I5TA 3M97X 3SJLA 1H31A 1E8EA 1NTKD 1N50A 1N90A 2PACA 1SQQD 5B66V 1CRJA 2YCCA 1C2RA 3A0BV 3CWBD 4PD4D 4DY9A 4O1QA 4FA9A 3SVWA 3VNWA 3CP5A 5CIGB 2D0WA 1FJ0A 1SQPD 2N9JA 3CXHD 2IBZD 4PW9B 3C2CA 2OZ1B 1GDVA 1YEAA 1JDLA 5EXQA 1GJQA 1L9BC 1NIRA 4FA5A 1MZ4A 1F1FA 3WFBC 4FAVA 3JBTB 3OCDA 3H1LD 3PXTA 1MG3D 451CA 2EXVA 2YK3A 1DIIC 3ORVA 1F1CA 3DR0A 4KMGA 4WQBA 3RLMA 5C0ZA 1H32A 1NTMD 1A8CA 3CX5D 4XXLA 1NNOA 1LFMA 1H31B 3WFCC 4H0JA 1OCDA 1DW2A 1IZL0 1C6OA 3L73D 5DF5A 4MU8A 1B7VA 1BCCD 1CSUA 2GC4D 1CXCA 4AAOA 3WU2V 1C6RA 2VHDA 4WQCA 1CXAA 3ZOOA 1NMIA 1H9XA 2AXTV 1NMLA 4AAMA 1L0LD 1CORA 3L75D 1GKSA 2AI5A 1GIWA 4J20A 3HQ6A 5CIBB 5GTHV 4FANA 5CIFB 4K3IA 1QKSA 1CIFA 1SQVD 1RAQA 3PH2B 1NTZD 1YICA 1R0QA 4V2KA 3ZIYA 3L72D 1GQ1A 1KV9A 5CIHB 1VYDA 1L9JC 3A9FA 5CIDB 3L74D 3WFDC 1AYGA 1I6EA 1I54A 3H1JD 3H1ID 2CE1A 4AALA 4RSZA 1CTJA 3O1YA 2GB8B 2N18C 1CIEA 3O0RC 1CYJA 1KB9D 4YE1A 1ETPA 2JTIB 1C52A 5DFSA 4LJIA 3L4MA 1C2NA 1IRWA 3OA8B 5H2FV 5C9MA 2QJKB 3RN0A 3X39A 1C7MA 155CA 1FHBA 4L3HA 2B10B 2ZZS1 1YFCA 1DW0A 2FRCA 3WC8A 2V07A 3KZIV 1H9YA 1K3HA 1HZVA 5KKZB 1PPJD 2BPBB 1HROA 1YCCA 1U75B 4FB1A 1CEDA 3L4OA 2GC7D 5TISV 4EIFA 1CTZA 1E29A 2C1DA 1HJ4A 1QL3A 1OAEA 3H1HD 1COTA 1ZRTD 3HQ8A 4WQ9A 2LITA 4Q5PA 5CIEB 1KYOW 5KAFV 4IL6V 3ZCFA 1QL4A 3PXSA
chains in the Genus database with same CATH topology
4UB6V 1BE3D 3MK7C 4NFGB 1QN2A 3TGUD 5B6QA 2ORLA 1IRVA 1MG2D 3L71D 2B0ZB 1EZVD 4FA4A 1AKKA 2MTAC 3ZOWA 2BGVX 5CICB 2XTSB 3NBTA 5DJQC 3VRDA 5E79V 3NBSA 1CCHA 1RZ6A 2GIWA 1YIQA 1I6DA 1CRHA 3CU4A 3SLEA 4QAOA 1CTYA 3MK7B 3OCDB 1I55A 2BCNB 2MHMA 1CSVA 1HJ3A 1FI7A 1I8PA 4L3GA 4XYDB 1DW1A 2BCCD 2CA4B 1DVVA 1KX2A 3SWSA 4AANA 1H32B 1ZZHA 1J3SA 2CE0A 3RN1A 5DJQB 2B12B 2N9IA 3L70D 1KB0A 3WFEC 2C1UA 351CA 1KIBA 4PWAA 1CHIA 1FI9A 2FWLA 3CYTI 3SXTA 1K3GA 1HRCA 3WUIA 3ZBMA 2CXBA 1CIGA 3HQ7A 4O1WA 3DP5A 1QYZA 2CA3B 4PJ0V 3VYMA 1L0ND 2FYNB 1IQCA 1BGYD 1FCDC 1YNRA 1WVEC 1S5LV 1AOQA 1CRIA 3HQ9A 1LC1A 1CO6A 1DVHA 2DGEA 3RMZA 1H33A 4WQDA 1N15A 3H1KD 2N18B 1CSWA 2HV4A 4L1QA 1DW3A 4FA1A 1KYOD 1LC2A 1U74B 5KAIV 5IY51 4WQEA 4Y5RA 1SQXD 1CSXA 4H0KA 1CYIA 1I8OA 1W2LA 4JCGA 2L4DA 2N3BA 2PCCB 3ZOXA 2C9XB 1LMSA 1M6ZA 4U3FD 2A06D 1RZ5A 1KX7A 1DT1A 1HH7A 1M60A 2I8FA 3CXHW 1HCMA 1P84D 2YIUB 4WQ8A 1S6VB 2LIRA 1W5CT 1M70A 1GU2A 4GYDA 3TYIA 2N3YA 1CHJA 2FYUD 1C6SA 2C1VA 1AOFA 2QJPB 1CRYA 2JQRA 2B11B 4N0KA 1YEBA 1H33B 1FI3A 1CC5A 2C2CA 4WQ7A 3CX5W 3A0HV 4D6TD 2C8SA 3OA8A 1C75A 1HZUA 2ZXYA 2C1DB 1EB7A 4AX3A 5AURA 4P4QB 3ZOYA 4EIEA 1RAPA 1DIQC 1A2SA 1CRCA 2B4ZA 5CYTR 1N9CA 2BH4X 1A56A 1CIHA 2V08A 5KLIB 1CYCA 4EICA 5GTIV 5KLVD 1CHHA 2ZBOA 3NWVA 1CRGA 1H1OA 2ZONG 2OZ1A 5B5EV 3PXWA 4GEDB 2BLFB 1YTCA 4EIDA 2QJYB 1CNOA 2ZOOA 4WQAA 1HJ5A 3BCCD 1BL9A 1FOCA 3O20A 1WEJF 2PCBB 1IO3A 2BH5X 1LS9A 1PP9D 2DVHA 4UB8V 2YQBA 1NU1D 1CCRA 3O5CA 3DMIA 1SQBD 2D0SA 2AIUA 1E2RA 1I5TA 3M97X 3SJLA 1H31A 1E8EA 1NTKD 1N50A 1N90A 2PACA 1SQQD 5B66V 1CRJA 2YCCA 1C2RA 3A0BV 3CWBD 4PD4D 4DY9A 4O1QA 4FA9A 3SVWA 3VNWA 3CP5A 5CIGB 2D0WA 1FJ0A 1SQPD 2N9JA 3CXHD 2IBZD 4PW9B 3C2CA 2OZ1B 1GDVA 1YEAA 1JDLA 5EXQA 1GJQA 1L9BC 1NIRA 4FA5A 1MZ4A 1F1FA 3WFBC 4FAVA 3JBTB 3OCDA 3H1LD 3PXTA 1MG3D 451CA 2EXVA 2YK3A 1DIIC 3ORVA 1F1CA 3DR0A 4KMGA 4WQBA 3RLMA 5C0ZA 1H32A 1NTMD 1A8CA 3CX5D 4XXLA 1NNOA 1LFMA 1H31B 3WFCC 4H0JA 1OCDA 1DW2A 1IZL0 1C6OA 3L73D 5DF5A 4MU8A 1B7VA 1BCCD 1CSUA 2GC4D 1CXCA 4AAOA 3WU2V 1C6RA 2VHDA 4WQCA 1CXAA 3ZOOA 1NMIA 1H9XA 2AXTV 1NMLA 4AAMA 1L0LD 1CORA 3L75D 1GKSA 2AI5A 1GIWA 4J20A 3HQ6A 5CIBB 5GTHV 4FANA 5CIFB 4K3IA 1QKSA 1CIFA 1SQVD 1RAQA 3PH2B 1NTZD 1YICA 1R0QA 4V2KA 3ZIYA 3L72D 1GQ1A 1KV9A 5CIHB 1VYDA 1L9JC 3A9FA 5CIDB 3L74D 3WFDC 1AYGA 1I6EA 1I54A 3H1JD 3H1ID 2CE1A 4AALA 4RSZA 1CTJA 3O1YA 2GB8B 2N18C 1CIEA 3O0RC 1CYJA 1KB9D 4YE1A 1ETPA 2JTIB 1C52A 5DFSA 4LJIA 3L4MA 1C2NA 1IRWA 3OA8B 5H2FV 5C9MA 2QJKB 3RN0A 3X39A 1C7MA 155CA 1FHBA 4L3HA 2B10B 2ZZS1 1YFCA 1DW0A 2FRCA 3WC8A 2V07A 3KZIV 1H9YA 1K3HA 1HZVA 5KKZB 1PPJD 2BPBB 1HROA 1YCCA 1U75B 4FB1A 1CEDA 3L4OA 2GC7D 5TISV 4EIFA 1CTZA 1E29A 2C1DA 1HJ4A 1QL3A 1OAEA 3H1HD 1COTA 1ZRTD 3HQ8A 4WQ9A 2LITA 4Q5PA 5CIEB 1KYOW 5KAFV 4IL6V 3ZCFA 1QL4A 3PXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 V;  1BE3 D;  3MK7 C;  4NFG B;  1QN2 A;  3TGU D;  5B6Q A;  2ORL A;  1IRV A;  1MG2 D;  3L71 D;  2B0Z B;  1EZV D;  4FA4 A;  1AKK A;  2MTA C;  3ZOW A;  2BGV X;  5CIC B;  2XTS B;  3NBT A;  5DJQ C;  3VRD A;  5E79 V;  3NBS A;  1CCH A;  1RZ6 A;  2GIW A;  1YIQ A;  1I6D A;  1CRH A;  3CU4 A;  3SLE A;  4QAO A;  1CTY A;  3MK7 B;  3OCD B;  1I55 A;  2BCN B;  2MHM A;  1CSV A;  1HJ3 A;  1FI7 A;  1I8P A;  4L3G A;  4XYD B;  1DW1 A;  2BCC D;  2CA4 B;  1DVV A;  1KX2 A;  3SWS A;  4AAN A;  1H32 B;  1ZZH A;  1J3S A;  2CE0 A;  3RN1 A;  5DJQ B;  2B12 B;  2N9I A;  3L70 D;  1KB0 A;  3WFE C;  2C1U A;  351C A;  1KIB A;  4PWA A;  1CHI A;  1FI9 A;  2FWL A;  3CYT I;  3SXT A;  1K3G A;  1HRC A;  3WUI A;  3ZBM A;  2CXB A;  1CIG A;  3HQ7 A;  4O1W A;  3DP5 A;  1QYZ A;  2CA3 B;  4PJ0 V;  3VYM A;  1L0N D;  2FYN B;  1IQC A;  1BGY D;  1FCD C;  1YNR A;  1WVE C;  1S5L V;  1AOQ A;  1CRI A;  3HQ9 A;  1LC1 A;  1CO6 A;  1DVH A;  2DGE A;  3RMZ A;  1H33 A;  4WQD A;  1N15 A;  3H1K D;  2N18 B;  1CSW A;  2HV4 A;  4L1Q A;  1DW3 A;  4FA1 A;  1KYO D;  1LC2 A;  1U74 B;  5KAI V;  5IY5 1;  4WQE A;  4Y5R A;  1SQX D;  1CSX A;  4H0K A;  1CYI A;  1I8O A;  1W2L A;  4JCG A;  2L4D A;  2N3B A;  2PCC B;  3ZOX A;  2C9X B;  1LMS A;  1M6Z A;  4U3F D;  2A06 D;  1RZ5 A;  1KX7 A;  1DT1 A;  1HH7 A;  1M60 A;  2I8F A;  3CXH W;  1HCM A;  1P84 D;  2YIU B;  4WQ8 A;  1S6V B;  2LIR A;  1W5C T;  1M70 A;  1GU2 A;  4GYD A;  3TYI A;  2N3Y A;  1CHJ A;  2FYU D;  1C6S A;  2C1V A;  1AOF A;  2QJP B;  1CRY A;  2JQR A;  2B11 B;  4N0K A;  1YEB A;  1H33 B;  1FI3 A;  1CC5 A;  2C2C A;  4WQ7 A;  3CX5 W;  3A0H V;  4D6T D;  2C8S A;  3OA8 A;  1C75 A;  1HZU A;  2ZXY A;  2C1D B;  1EB7 A;  4AX3 A;  5AUR A;  4P4Q B;  3ZOY A;  4EIE A;  1RAP A;  1DIQ C;  1A2S A;  1CRC A;  2B4Z A;  5CYT R;  1N9C A;  2BH4 X;  1A56 A;  1CIH A;  2V08 A;  5KLI B;  1CYC A;  4EIC A;  5GTI V;  5KLV D;  1CHH A;  2ZBO A;  3NWV A;  1CRG A;  1H1O A;  2ZON G;  2OZ1 A;  5B5E V;  3PXW A;  4GED B;  2BLF B;  1YTC A;  4EID A;  2QJY B;  1CNO A;  2ZOO A;  4WQA A;  1HJ5 A;  3BCC D;  1BL9 A;  1FOC A;  3O20 A;  1WEJ F;  2PCB B;  1IO3 A;  2BH5 X;  1LS9 A;  1PP9 D;  2DVH A;  4UB8 V;  2YQB A;  1NU1 D;  1CCR A;  3O5C A;  3DMI A;  1SQB D;  2D0S A;  2AIU A;  1E2R A;  1I5T A;  3M97 X;  3SJL A;  1H31 A;  1E8E A;  1NTK D;  1N50 A;  1N90 A;  2PAC A;  1SQQ D;  5B66 V;  1CRJ A;  2YCC A;  1C2R A;  3A0B V;  3CWB D;  4PD4 D;  4DY9 A;  4O1Q A;  4FA9 A;  3SVW A;  3VNW A;  3CP5 A;  5CIG B;  2D0W A;  1FJ0 A;  1SQP D;  2N9J A;  3CXH D;  2IBZ D;  4PW9 B;  3C2C A;  2OZ1 B;  1GDV A;  1YEA A;  1JDL A;  5EXQ A;  1GJQ A;  1L9B C;  1NIR A;  4FA5 A;  1MZ4 A;  1F1F A;  3WFB C;  4FAV A;  3JBT B;  3OCD A;  3H1L D;  3PXT A;  1MG3 D;  451C A;  2EXV A;  2YK3 A;  1DII C;  3ORV A;  1F1C A;  3DR0 A;  4KMG A;  4WQB A;  3RLM A;  5C0Z A;  1H32 A;  1NTM D;  1A8C A;  3CX5 D;  4XXL A;  1NNO A;  1LFM A;  1H31 B;  3WFC C;  4H0J A;  1OCD A;  1DW2 A;  1IZL 0;  1C6O A;  3L73 D;  5DF5 A;  4MU8 A;  1B7V A;  1BCC D;  1CSU A;  2GC4 D;  1CXC A;  4AAO A;  3WU2 V;  1C6R A;  2VHD A;  4WQC A;  1CXA A;  3ZOO A;  1NMI A;  1H9X A;  2AXT V;  1NML A;  4AAM A;  1L0L D;  1COR A;  3L75 D;  1GKS A;  2AI5 A;  1GIW A;  4J20 A;  3HQ6 A;  5CIB B;  5GTH V;  4FAN A;  5CIF B;  4K3I A;  1QKS A;  1CIF A;  1SQV D;  1RAQ A;  3PH2 B;  1NTZ D;  1YIC A;  1R0Q A;  4V2K A;  3ZIY A;  3L72 D;  1GQ1 A;  1KV9 A;  5CIH B;  1VYD A;  1L9J C;  3A9F A;  5CID B;  3L74 D;  3WFD C;  1AYG A;  1I6E A;  1I54 A;  3H1J D;  3H1I D;  2CE1 A;  4AAL A;  4RSZ A;  1CTJ A;  3O1Y A;  2GB8 B;  2N18 C;  1CIE A;  3O0R C;  1CYJ A;  1KB9 D;  4YE1 A;  1ETP A;  2JTI B;  1C52 A;  5DFS A;  4LJI A;  3L4M A;  1C2N A;  1IRW A;  3OA8 B;  5H2F V;  5C9M A;  2QJK B;  3RN0 A;  3X39 A;  1C7M A;  155C A;  1FHB A;  4L3H A;  2B10 B;  2ZZS 1;  1YFC A;  1DW0 A;  2FRC A;  3WC8 A;  2V07 A;  3KZI V;  1H9Y A;  1K3H A;  1HZV A;  5KKZ B;  1PPJ D;  2BPB B;  1HRO A;  1YCC A;  1U75 B;  4FB1 A;  1CED A;  3L4O A;  2GC7 D;  5TIS V;  4EIF A;  1CTZ A;  1E29 A;  2C1D A;  1HJ4 A;  1QL3 A;  1OAE A;  3H1H D;  1COT A;  1ZRT D;  3HQ8 A;  4WQ9 A;  2LIT A;  4Q5P A;  5CIE B;  1KYO W;  5KAF V;  4IL6 V;  3ZCF A;  1QL4 A;  3PXS A; 
#chains in the Genus database with same CATH topology
 4UB6 V;  1BE3 D;  3MK7 C;  4NFG B;  1QN2 A;  3TGU D;  5B6Q A;  2ORL A;  1IRV A;  1MG2 D;  3L71 D;  2B0Z B;  1EZV D;  4FA4 A;  1AKK A;  2MTA C;  3ZOW A;  2BGV X;  5CIC B;  2XTS B;  3NBT A;  5DJQ C;  3VRD A;  5E79 V;  3NBS A;  1CCH A;  1RZ6 A;  2GIW A;  1YIQ A;  1I6D A;  1CRH A;  3CU4 A;  3SLE A;  4QAO A;  1CTY A;  3MK7 B;  3OCD B;  1I55 A;  2BCN B;  2MHM A;  1CSV A;  1HJ3 A;  1FI7 A;  1I8P A;  4L3G A;  4XYD B;  1DW1 A;  2BCC D;  2CA4 B;  1DVV A;  1KX2 A;  3SWS A;  4AAN A;  1H32 B;  1ZZH A;  1J3S A;  2CE0 A;  3RN1 A;  5DJQ B;  2B12 B;  2N9I A;  3L70 D;  1KB0 A;  3WFE C;  2C1U A;  351C A;  1KIB A;  4PWA A;  1CHI A;  1FI9 A;  2FWL A;  3CYT I;  3SXT A;  1K3G A;  1HRC A;  3WUI A;  3ZBM A;  2CXB A;  1CIG A;  3HQ7 A;  4O1W A;  3DP5 A;  1QYZ A;  2CA3 B;  4PJ0 V;  3VYM A;  1L0N D;  2FYN B;  1IQC A;  1BGY D;  1FCD C;  1YNR A;  1WVE C;  1S5L V;  1AOQ A;  1CRI A;  3HQ9 A;  1LC1 A;  1CO6 A;  1DVH A;  2DGE A;  3RMZ A;  1H33 A;  4WQD A;  1N15 A;  3H1K D;  2N18 B;  1CSW A;  2HV4 A;  4L1Q A;  1DW3 A;  4FA1 A;  1KYO D;  1LC2 A;  1U74 B;  5KAI V;  5IY5 1;  4WQE A;  4Y5R A;  1SQX D;  1CSX A;  4H0K A;  1CYI A;  1I8O A;  1W2L A;  4JCG A;  2L4D A;  2N3B A;  2PCC B;  3ZOX A;  2C9X B;  1LMS A;  1M6Z A;  4U3F D;  2A06 D;  1RZ5 A;  1KX7 A;  1DT1 A;  1HH7 A;  1M60 A;  2I8F A;  3CXH W;  1HCM A;  1P84 D;  2YIU B;  4WQ8 A;  1S6V B;  2LIR A;  1W5C T;  1M70 A;  1GU2 A;  3D0W A;  4GYD A;  3TYI A;  2N3Y A;  1CHJ A;  2FYU D;  1C6S A;  2C1V A;  1AOF A;  2QJP B;  1CRY A;  2JQR A;  2B11 B;  4N0K A;  1YEB A;  1H33 B;  1FI3 A;  1CC5 A;  2C2C A;  4WQ7 A;  3CX5 W;  3A0H V;  4D6T D;  2C8S A;  3OA8 A;  1C75 A;  1HZU A;  2ZXY A;  2C1D B;  1EB7 A;  4AX3 A;  5AUR A;  4P4Q B;  3ZOY A;  4EIE A;  1RAP A;  1DIQ C;  1A2S A;  1CRC A;  2B4Z A;  5CYT R;  1N9C A;  2BH4 X;  1A56 A;  1CIH A;  2V08 A;  5KLI B;  1CYC A;  4EIC A;  5GTI V;  5KLV D;  1CHH A;  2ZBO A;  3NWV A;  1CRG A;  1H1O A;  2ZON G;  2OZ1 A;  5B5E V;  3PXW A;  4GED B;  2BLF B;  1YTC A;  4EID A;  2QJY B;  1CNO A;  2ZOO A;  4WQA A;  1HJ5 A;  3BCC D;  1BL9 A;  1FOC A;  3O20 A;  1WEJ F;  2PCB B;  1IO3 A;  2BH5 X;  1LS9 A;  1PP9 D;  2DVH A;  4UB8 V;  2YQB A;  1NU1 D;  1CCR A;  3O5C A;  3DMI A;  1SQB D;  2D0S A;  2AIU A;  1E2R A;  1I5T A;  3M97 X;  3SJL A;  1H31 A;  1E8E A;  1NTK D;  1N50 A;  1N90 A;  2PAC A;  1SQQ D;  5B66 V;  1CRJ A;  2YCC A;  1C2R A;  3A0B V;  3CWB D;  4PD4 D;  4DY9 A;  4O1Q A;  4FA9 A;  3SVW A;  3VNW A;  3CP5 A;  5CIG B;  2D0W A;  1FJ0 A;  1SQP D;  2N9J A;  3CXH D;  2IBZ D;  4PW9 B;  3C2C A;  2OZ1 B;  1GDV A;  1YEA A;  1JDL A;  5EXQ A;  1GJQ A;  1L9B C;  1NIR A;  4FA5 A;  1MZ4 A;  1F1F A;  3WFB C;  4FAV A;  3JBT B;  3OCD A;  3H1L D;  3PXT A;  1MG3 D;  451C A;  2EXV A;  2YK3 A;  1DII C;  3ORV A;  1F1C A;  3DR0 A;  4KMG A;  4WQB A;  3RLM A;  5C0Z A;  1H32 A;  1NTM D;  1A8C A;  3CX5 D;  4XXL A;  1NNO A;  1LFM A;  1H31 B;  3WFC C;  4H0J A;  1OCD A;  1DW2 A;  1IZL 0;  1C6O A;  3L73 D;  5DF5 A;  4MU8 A;  1B7V A;  1BCC D;  1CSU A;  2GC4 D;  1CXC A;  4AAO A;  3WU2 V;  1C6R A;  2VHD A;  4WQC A;  1CXA A;  3ZOO A;  1NMI A;  1H9X A;  2AXT V;  1NML A;  4AAM A;  1L0L D;  1COR A;  3L75 D;  1GKS A;  2AI5 A;  1GIW A;  4J20 A;  3HQ6 A;  5CIB B;  5GTH V;  4FAN A;  5CIF B;  4K3I A;  1QKS A;  1CIF A;  1SQV D;  1RAQ A;  3PH2 B;  1NTZ D;  1YIC A;  1R0Q A;  4V2K A;  3ZIY A;  3L72 D;  1GQ1 A;  1KV9 A;  5CIH B;  1VYD A;  1L9J C;  3A9F A;  5CID B;  3L74 D;  3WFD C;  1AYG A;  1I6E A;  1I54 A;  3H1J D;  3H1I D;  2CE1 A;  4AAL A;  4RSZ A;  1CTJ A;  3O1Y A;  2GB8 B;  2N18 C;  1CIE A;  3O0R C;  1CYJ A;  1KB9 D;  4YE1 A;  1ETP A;  2JTI B;  1C52 A;  5DFS A;  4LJI A;  3L4M A;  1C2N A;  1IRW A;  3OA8 B;  5H2F V;  5C9M A;  2QJK B;  3RN0 A;  3X39 A;  1C7M A;  155C A;  1FHB A;  4L3H A;  2B10 B;  2ZZS 1;  1YFC A;  1DW0 A;  2FRC A;  3WC8 A;  2V07 A;  3KZI V;  1H9Y A;  1K3H A;  1HZV A;  5KKZ B;  1PPJ D;  2BPB B;  1HRO A;  1YCC A;  1U75 B;  4FB1 A;  1CED A;  3L4O A;  2GC7 D;  5TIS V;  4EIF A;  1CTZ A;  1E29 A;  2C1D A;  1HJ4 A;  1QL3 A;  1OAE A;  3H1H D;  1COT A;  1ZRT D;  3HQ8 A;  4WQ9 A;  2LIT A;  4Q5P A;  5CIE B;  1KYO W;  5KAF V;  4IL6 V;  3ZCF A;  1QL4 A;  3PXS A; 
#chains in the Genus database with same CATH homology
 4UB6 V;  1BE3 D;  3MK7 C;  4NFG B;  1QN2 A;  3TGU D;  5B6Q A;  2ORL A;  1IRV A;  1MG2 D;  3L71 D;  2B0Z B;  1EZV D;  4FA4 A;  1AKK A;  2MTA C;  3ZOW A;  2BGV X;  5CIC B;  2XTS B;  3NBT A;  5DJQ C;  3VRD A;  5E79 V;  3NBS A;  1CCH A;  1RZ6 A;  2GIW A;  1YIQ A;  1I6D A;  1CRH A;  3CU4 A;  3SLE A;  4QAO A;  1CTY A;  3MK7 B;  3OCD B;  1I55 A;  2BCN B;  2MHM A;  1CSV A;  1HJ3 A;  1FI7 A;  1I8P A;  4L3G A;  4XYD B;  1DW1 A;  2BCC D;  2CA4 B;  1DVV A;  1KX2 A;  3SWS A;  4AAN A;  1H32 B;  1ZZH A;  1J3S A;  2CE0 A;  3RN1 A;  5DJQ B;  2B12 B;  2N9I A;  3L70 D;  1KB0 A;  3WFE C;  2C1U A;  351C A;  1KIB A;  4PWA A;  1CHI A;  1FI9 A;  2FWL A;  3CYT I;  3SXT A;  1K3G A;  1HRC A;  3WUI A;  3ZBM A;  2CXB A;  1CIG A;  3HQ7 A;  4O1W A;  3DP5 A;  1QYZ A;  2CA3 B;  4PJ0 V;  3VYM A;  1L0N D;  2FYN B;  1IQC A;  1BGY D;  1FCD C;  1YNR A;  1WVE C;  1S5L V;  1AOQ A;  1CRI A;  3HQ9 A;  1LC1 A;  1CO6 A;  1DVH A;  2DGE A;  3RMZ A;  1H33 A;  4WQD A;  1N15 A;  3H1K D;  2N18 B;  1CSW A;  2HV4 A;  4L1Q A;  1DW3 A;  4FA1 A;  1KYO D;  1LC2 A;  1U74 B;  5KAI V;  5IY5 1;  4WQE A;  4Y5R A;  1SQX D;  1CSX A;  4H0K A;  1CYI A;  1I8O A;  1W2L A;  4JCG A;  2L4D A;  2N3B A;  2PCC B;  3ZOX A;  2C9X B;  1LMS A;  1M6Z A;  4U3F D;  2A06 D;  1RZ5 A;  1KX7 A;  1DT1 A;  1HH7 A;  1M60 A;  2I8F A;  3CXH W;  1HCM A;  1P84 D;  2YIU B;  4WQ8 A;  1S6V B;  2LIR A;  1W5C T;  1M70 A;  1GU2 A;  4GYD A;  3TYI A;  2N3Y A;  1CHJ A;  2FYU D;  1C6S A;  2C1V A;  1AOF A;  2QJP B;  1CRY A;  2JQR A;  2B11 B;  4N0K A;  1YEB A;  1H33 B;  1FI3 A;  1CC5 A;  2C2C A;  4WQ7 A;  3CX5 W;  3A0H V;  4D6T D;  2C8S A;  3OA8 A;  1C75 A;  1HZU A;  2ZXY A;  2C1D B;  1EB7 A;  4AX3 A;  5AUR A;  4P4Q B;  3ZOY A;  4EIE A;  1RAP A;  1DIQ C;  1A2S A;  1CRC A;  2B4Z A;  5CYT R;  1N9C A;  2BH4 X;  1A56 A;  1CIH A;  2V08 A;  5KLI B;  1CYC A;  4EIC A;  5GTI V;  5KLV D;  1CHH A;  2ZBO A;  3NWV A;  1CRG A;  1H1O A;  2ZON G;  2OZ1 A;  5B5E V;  3PXW A;  4GED B;  2BLF B;  1YTC A;  4EID A;  2QJY B;  1CNO A;  2ZOO A;  4WQA A;  1HJ5 A;  3BCC D;  1BL9 A;  1FOC A;  3O20 A;  1WEJ F;  2PCB B;  1IO3 A;  2BH5 X;  1LS9 A;  1PP9 D;  2DVH A;  4UB8 V;  2YQB A;  1NU1 D;  1CCR A;  3O5C A;  3DMI A;  1SQB D;  2D0S A;  2AIU A;  1E2R A;  1I5T A;  3M97 X;  3SJL A;  1H31 A;  1E8E A;  1NTK D;  1N50 A;  1N90 A;  2PAC A;  1SQQ D;  5B66 V;  1CRJ A;  2YCC A;  1C2R A;  3A0B V;  3CWB D;  4PD4 D;  4DY9 A;  4O1Q A;  4FA9 A;  3SVW A;  3VNW A;  3CP5 A;  5CIG B;  2D0W A;  1FJ0 A;  1SQP D;  2N9J A;  3CXH D;  2IBZ D;  4PW9 B;  3C2C A;  2OZ1 B;  1GDV A;  1YEA A;  1JDL A;  5EXQ A;  1GJQ A;  1L9B C;  1NIR A;  4FA5 A;  1MZ4 A;  1F1F A;  3WFB C;  4FAV A;  3JBT B;  3OCD A;  3H1L D;  3PXT A;  1MG3 D;  451C A;  2EXV A;  2YK3 A;  1DII C;  3ORV A;  1F1C A;  3DR0 A;  4KMG A;  4WQB A;  3RLM A;  5C0Z A;  1H32 A;  1NTM D;  1A8C A;  3CX5 D;  4XXL A;  1NNO A;  1LFM A;  1H31 B;  3WFC C;  4H0J A;  1OCD A;  1DW2 A;  1IZL 0;  1C6O A;  3L73 D;  5DF5 A;  4MU8 A;  1B7V A;  1BCC D;  1CSU A;  2GC4 D;  1CXC A;  4AAO A;  3WU2 V;  1C6R A;  2VHD A;  4WQC A;  1CXA A;  3ZOO A;  1NMI A;  1H9X A;  2AXT V;  1NML A;  4AAM A;  1L0L D;  1COR A;  3L75 D;  1GKS A;  2AI5 A;  1GIW A;  4J20 A;  3HQ6 A;  5CIB B;  5GTH V;  4FAN A;  5CIF B;  4K3I A;  1QKS A;  1CIF A;  1SQV D;  1RAQ A;  3PH2 B;  1NTZ D;  1YIC A;  1R0Q A;  4V2K A;  3ZIY A;  3L72 D;  1GQ1 A;  1KV9 A;  5CIH B;  1VYD A;  1L9J C;  3A9F A;  5CID B;  3L74 D;  3WFD C;  1AYG A;  1I6E A;  1I54 A;  3H1J D;  3H1I D;  2CE1 A;  4AAL A;  4RSZ A;  1CTJ A;  3O1Y A;  2GB8 B;  2N18 C;  1CIE A;  3O0R C;  1CYJ A;  1KB9 D;  4YE1 A;  1ETP A;  2JTI B;  1C52 A;  5DFS A;  4LJI A;  3L4M A;  1C2N A;  1IRW A;  3OA8 B;  5H2F V;  5C9M A;  2QJK B;  3RN0 A;  3X39 A;  1C7M A;  155C A;  1FHB A;  4L3H A;  2B10 B;  2ZZS 1;  1YFC A;  1DW0 A;  2FRC A;  3WC8 A;  2V07 A;  3KZI V;  1H9Y A;  1K3H A;  1HZV A;  5KKZ B;  1PPJ D;  2BPB B;  1HRO A;  1YCC A;  1U75 B;  4FB1 A;  1CED A;  3L4O A;  2GC7 D;  5TIS V;  4EIF A;  1CTZ A;  1E29 A;  2C1D A;  1HJ4 A;  1QL3 A;  1OAE A;  3H1H D;  1COT A;  1ZRT D;  3HQ8 A;  4WQ9 A;  2LIT A;  4Q5P A;  5CIE B;  1KYO W;  5KAF V;  4IL6 V;  3ZCF A;  1QL4 A;  3PXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...