2BH5X

X-ray structure of the m100k variant of ferric cyt c-550 from paracoccus versutus determined at 295 k.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
EGDAAKGEKEFNKCKACHMVQAPDGTDIVKGGKTGPNLYGVVGRKIASVEGFKYGDGILEVAEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSAAKTKKTFKLGKNQADVVAFLAQHSPDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C-550
publication title The Effect of Replacing the Axial Methionine Ligand with a Lysine Residue in Cytochrome C-550 from Paracoccus Versutus Assessed by X-Ray Crystallography and Unfolding.
pubmed doi rcsb
source organism Paracoccus versutus
molecule tags Electron transfer
total genus 34
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2bh5X00
5DF5A 4WQAA 2ZZS1 2EXVA 2OZ1B 1H32A 3PXWA 1CTJA 3ZOYA 3ORVA 1KYOD 1KYOW 5CIFB 2FYUD 3WU2V 1DW1A 1C6RA 5B5EV 1YNRA 1PP9D 1IZL0 5CIGB 4AAOA 2C1VA 1C6SA 1CC5A 5KLIB 1RAQA 4V2KA 4XXLA 1H1OA 5CIEB 1J3SA 3H1ID 1HZUA 3L4OA 1WEJF 2L4DA 1YIQA 1N50A 1QL4A 1E8EA 1YICA 1S5LV 5CIDB 3RN0A 4H0KA 2ORLA 3M97X 3CWBD 3WUIA 1NNOA 1H9XA 3L75D 4UB8V 3ZOXA 4EIFA 5AURA 3L70D 1IRVA 5KAIV 2LIRA 5TISV 1BCCD 1NTMD 5GTIV 1YTCA 4QAOA 1CHHA 1CXCA 1QN2A 3NBTA 3TYIA 1W2LA 1GQ1A 1E29A 5IY51 3SLEA 1CYIA 3WC8A 1KIBA 2MHMA 1L9BC 2C8SA 1CIHA 4PW9B 1FHBA 1QKSA 4FANA 3H1LD 1LC1A 1YFCA 2BCCD 3O1YA 3HQ9A 1I5TA 1H32B 4MU8A 1U74B 1H31B 3MK7B 4EICA 1HCMA 3O20A 3PXSA 4FA9A 1CORA 2ZOOA 1CIGA 2C1DA 1M60A 3DP5A 2C9XB 1CYJA 3CX5W 2GC4D 4P4QB 1SQPD 1FCDC 3ZIYA 5DJQB 3A0BV 2I8FA 1HRCA 3O5CA 5CYTR 3CXHD 1KB0A 3CXHW 1SQQD 3MK7C 1YCCA 2BCNB 4WQ9A 4WQDA 1FI7A 2JQRA 4L3HA 1DW2A 5C0ZA 1ETPA 4JCGA 1HH7A 4J20A 2C2CA 3SXTA 1CSVA 1CHIA 1QYZA 3DR0A 1SQBD 1NMLA 5DJQC 2A06D 4GYDA 1CRHA 1A56A 2C1UA 1BL9A 3SJLA 3VRDA 1COTA 1MG3D 5E79V 1OAEA 2CE0A 3L73D 4RSZA 1CRGA 2QJYB 2VHDA 1CSXA 1KV9A 1GIWA 1N90A 3HQ8A 2B4ZA 2YQBA 4K3IA 3WFBC 1DIIC 1LC2A 5DFSA 1P84D 2LITA 2ZXYA 1IQCA 1CRIA 2BLFB 4WQ7A 3ZBMA 4FAVA 3ZOOA 5CICB 1LMSA 2AI5A 1A8CA 1N15A 1CHJA 2BH4X 1C7MA 1NU1D 1AYGA 5CIBB 2GC7D 3PXTA 1YEAA 3C2CA 1SQVD 3A9FA 2C1DB 2B0ZB 1DW0A 4O1QA 4AX3A 2D0SA 1NIRA 2N3YA 1NTKD 2N18B 1CCRA 1GU2A 155CA 2B11B 4O1WA 4XYDB 2AIUA 3CU4A 4UB6V 1AKKA 2OZ1A 1U75B 1FI3A 3OCDA 1I54A 4AAMA 2B12B 5B66V 1F1CA 3L74D 1HROA 2GB8B 1RZ6A 3SVWA 1OCDA 3NBSA 2CXBA 1CRCA 3WFEC 1MZ4A 1CNOA 2N18C 3H1JD 1E2RA 3H1HD 2BH5X 1M70A 1CSWA 4WQEA 4Y5RA 3RN1A 4GEDB 3CX5D 2D0WA 1B7VA 4PJ0V 1C2RA 1CO6A 2XTSB 1HJ5A 1EB7A 5GTHV 2MTAC 1W5CT 2V08A 3L71D 3CP5A 4WQ8A 4L1QA 2FRCA 3OA8A 2DGEA 3O0RC 4FA1A 1HZVA 2PCBB 2PACA 1GKSA 3KZIV 3WFCC 4PWAA 1ZRTD 4FB1A 1FOCA 1C6OA 4EIEA 2HV4A 3BCCD 4IL6V 3VYMA 2CE1A 4FA4A 2V07A 1N9CA 1KX2A 4WQCA 2QJKB 5KAFV 2FWLA 1AOFA 1H33A 2QJPB 4KMGA 5B6QA 3OCDB 2AXTV 2N3BA 1CYCA 1H31A 4FA5A 4D6TD 3TGUD 2IBZD 1NMIA 3HQ6A 1DT1A 1VYDA 4Q5PA 1K3HA 1CRJA 3DMIA 5KLVD 1CTZA 4AANA 3ZOWA 3VNWA 1R0QA 2YK3A 2JTIB 3X39A 3SWSA 4PD4D 1QL3A 3L4MA 4LJIA 1DVVA 2BPBB 4AALA 4U3FD 5C9MA 5KKZB 1CSUA 1IO3A 4L3GA 4NFGB 2YIUB 1DW3A 4EIDA 1PPJD 3NWVA 1KB9D 1AOQA 1MG2D 1IRWA 4N0KA 2YCCA 1DIQC 1CXAA 1C2NA 3OA8B 4YE1A 1KX7A 1M6ZA 1SQXD 1WVEC 5EXQA 1F1FA 1L0ND 4H0JA 1K3GA 1CTYA 2DVHA 1FI9A 2N9IA 1CIFA 1I6DA 351CA 1CEDA 1GDVA 1EZVD 3A0HV 1BGYD 1H33B 1L9JC 3L72D 1I8OA 1ZZHA 2CA3B 1H9YA 1DVHA 1YEBA 1HJ3A 1CRYA 1HJ4A 5H2FV 1S6VB 1C52A 3RLMA 1LS9A 2BGVX 2B10B 451CA 1JDLA 1LFMA 1RAPA 1FJ0A 3ZCFA 4WQBA 1A2SA 1I55A 2CA4B 1RZ5A 1CCHA 2ZONG 2ZBOA 1GJQA 1BE3D 4DY9A 3PH2B 2PCCB 1C75A 3HQ7A 3WFDC 1I6EA 3H1KD 1I8PA 3RMZA 3JBTB 2GIWA 2N9JA 2FYNB 1CIEA 1NTZD 1L0LD 5CIHB 3CYTI
chains in the Genus database with same CATH superfamily
5DF5A 4WQAA 2ZZS1 2EXVA 2OZ1B 1H32A 3PXWA 1CTJA 3ZOYA 3ORVA 1KYOD 1KYOW 5CIFB 2FYUD 3WU2V 1DW1A 1C6RA 5B5EV 1YNRA 1PP9D 1IZL0 5CIGB 4AAOA 2C1VA 1C6SA 1CC5A 5KLIB 1RAQA 4V2KA 4XXLA 1H1OA 5CIEB 1J3SA 3H1ID 1HZUA 3L4OA 1WEJF 2L4DA 1YIQA 1N50A 1QL4A 1E8EA 1YICA 1S5LV 5CIDB 3RN0A 4H0KA 2ORLA 3M97X 3CWBD 3WUIA 1NNOA 1H9XA 3L75D 4UB8V 3ZOXA 4EIFA 5AURA 3L70D 1IRVA 5KAIV 2LIRA 5TISV 1BCCD 1NTMD 5GTIV 1YTCA 4QAOA 1CHHA 1CXCA 1QN2A 3NBTA 3TYIA 1W2LA 1GQ1A 1E29A 5IY51 3SLEA 1CYIA 3WC8A 1KIBA 2MHMA 1L9BC 2C8SA 1CIHA 4PW9B 1FHBA 1QKSA 4FANA 3H1LD 1LC1A 1YFCA 2BCCD 3O1YA 3HQ9A 1I5TA 1H32B 4MU8A 1U74B 1H31B 3MK7B 4EICA 1HCMA 3O20A 3PXSA 4FA9A 1CORA 2ZOOA 1CIGA 2C1DA 1M60A 3DP5A 2C9XB 1CYJA 3CX5W 2GC4D 4P4QB 1SQPD 1FCDC 3ZIYA 5DJQB 3A0BV 2I8FA 1HRCA 3O5CA 5CYTR 3CXHD 1KB0A 3CXHW 1SQQD 3MK7C 1YCCA 2BCNB 4WQ9A 4WQDA 1FI7A 2JQRA 4L3HA 1DW2A 5C0ZA 1ETPA 4JCGA 1HH7A 4J20A 2C2CA 3SXTA 1CSVA 1CHIA 1QYZA 3DR0A 1SQBD 1NMLA 5DJQC 2A06D 4GYDA 1CRHA 1A56A 2C1UA 1BL9A 3SJLA 3VRDA 1COTA 1MG3D 5E79V 1OAEA 2CE0A 3L73D 4RSZA 1CRGA 2QJYB 2VHDA 1CSXA 1KV9A 1GIWA 1N90A 3HQ8A 2B4ZA 2YQBA 4K3IA 3WFBC 1DIIC 1LC2A 5DFSA 1P84D 2LITA 2ZXYA 1IQCA 1CRIA 2BLFB 4WQ7A 3ZBMA 4FAVA 3ZOOA 5CICB 1LMSA 2AI5A 1A8CA 1N15A 1CHJA 2BH4X 1C7MA 1NU1D 1AYGA 5CIBB 2GC7D 3PXTA 1YEAA 3C2CA 1SQVD 3A9FA 2C1DB 2B0ZB 1DW0A 4O1QA 4AX3A 2D0SA 1NIRA 2N3YA 1NTKD 2N18B 1CCRA 1GU2A 155CA 2B11B 4O1WA 4XYDB 2AIUA 3CU4A 4UB6V 1AKKA 2OZ1A 1U75B 1FI3A 3OCDA 1I54A 4AAMA 2B12B 5B66V 1F1CA 3L74D 1HROA 2GB8B 1RZ6A 3SVWA 1OCDA 3NBSA 2CXBA 1CRCA 3WFEC 1MZ4A 1CNOA 2N18C 3H1JD 1E2RA 3H1HD 2BH5X 1M70A 1CSWA 4WQEA 4Y5RA 3RN1A 4GEDB 3CX5D 2D0WA 1B7VA 4PJ0V 1C2RA 1CO6A 2XTSB 1HJ5A 1EB7A 5GTHV 2MTAC 1W5CT 2V08A 3L71D 3CP5A 4WQ8A 4L1QA 2FRCA 3OA8A 2DGEA 3O0RC 4FA1A 1HZVA 2PCBB 2PACA 1GKSA 3KZIV 3WFCC 4PWAA 1ZRTD 4FB1A 1FOCA 1C6OA 4EIEA 2HV4A 3BCCD 4IL6V 3VYMA 2CE1A 4FA4A 2V07A 1N9CA 1KX2A 4WQCA 2QJKB 5KAFV 2FWLA 1AOFA 1H33A 2QJPB 4KMGA 5B6QA 3OCDB 2AXTV 2N3BA 1CYCA 1H31A 4FA5A 4D6TD 3TGUD 2IBZD 1NMIA 3HQ6A 1DT1A 1VYDA 4Q5PA 1K3HA 1CRJA 3DMIA 5KLVD 1CTZA 4AANA 3ZOWA 3VNWA 1R0QA 2YK3A 2JTIB 3X39A 3SWSA 4PD4D 1QL3A 3L4MA 4LJIA 1DVVA 2BPBB 4AALA 4U3FD 5C9MA 5KKZB 1CSUA 1IO3A 4L3GA 4NFGB 2YIUB 1DW3A 4EIDA 1PPJD 3NWVA 1KB9D 1AOQA 1MG2D 1IRWA 4N0KA 2YCCA 1DIQC 1CXAA 1C2NA 3OA8B 4YE1A 1KX7A 1M6ZA 1SQXD 1WVEC 5EXQA 1F1FA 1L0ND 4H0JA 1K3GA 1CTYA 2DVHA 1FI9A 2N9IA 1CIFA 1I6DA 351CA 1CEDA 1GDVA 1EZVD 3A0HV 1BGYD 1H33B 1L9JC 3L72D 1I8OA 1ZZHA 2CA3B 1H9YA 1DVHA 1YEBA 1HJ3A 1CRYA 1HJ4A 5H2FV 1S6VB 1C52A 3RLMA 1LS9A 2BGVX 2B10B 451CA 3D0WA 1JDLA 1LFMA 1RAPA 1FJ0A 3ZCFA 4WQBA 1A2SA 1I55A 2CA4B 1RZ5A 1CCHA 2ZONG 2ZBOA 1GJQA 1BE3D 4DY9A 3PH2B 2PCCB 1C75A 3HQ7A 3WFDC 1I6EA 3H1KD 1I8PA 3RMZA 3JBTB 2GIWA 2N9JA 2FYNB 1CIEA 1NTZD 1L0LD 5CIHB 3CYTI
chains in the Genus database with same CATH topology
5DF5A 4WQAA 2ZZS1 2EXVA 2OZ1B 1H32A 3PXWA 1CTJA 3ZOYA 3ORVA 1KYOD 1KYOW 5CIFB 2FYUD 3WU2V 1DW1A 1C6RA 5B5EV 1YNRA 1PP9D 1IZL0 5CIGB 4AAOA 2C1VA 1C6SA 1CC5A 5KLIB 1RAQA 4V2KA 4XXLA 1H1OA 5CIEB 1J3SA 3H1ID 1HZUA 3L4OA 1WEJF 2L4DA 1YIQA 1N50A 1QL4A 1E8EA 1YICA 1S5LV 5CIDB 3RN0A 4H0KA 2ORLA 3M97X 3CWBD 3WUIA 1NNOA 1H9XA 3L75D 4UB8V 3ZOXA 4EIFA 5AURA 3L70D 1IRVA 5KAIV 2LIRA 5TISV 1BCCD 1NTMD 5GTIV 1YTCA 4QAOA 1CHHA 1CXCA 1QN2A 3NBTA 3TYIA 1W2LA 1GQ1A 1E29A 5IY51 3SLEA 1CYIA 3WC8A 1KIBA 2MHMA 1L9BC 2C8SA 1CIHA 4PW9B 1FHBA 1QKSA 4FANA 3H1LD 1LC1A 1YFCA 2BCCD 3O1YA 3HQ9A 1I5TA 1H32B 4MU8A 1U74B 1H31B 3MK7B 4EICA 1HCMA 3O20A 3PXSA 4FA9A 1CORA 2ZOOA 1CIGA 2C1DA 1M60A 3DP5A 2C9XB 1CYJA 3CX5W 2GC4D 4P4QB 1SQPD 1FCDC 3ZIYA 5DJQB 3A0BV 2I8FA 1HRCA 3O5CA 5CYTR 3CXHD 1KB0A 3CXHW 1SQQD 3MK7C 1YCCA 2BCNB 4WQ9A 4WQDA 1FI7A 2JQRA 4L3HA 1DW2A 5C0ZA 1ETPA 4JCGA 1HH7A 4J20A 2C2CA 3SXTA 1CSVA 1CHIA 1QYZA 3DR0A 1SQBD 1NMLA 5DJQC 2A06D 4GYDA 1CRHA 1A56A 2C1UA 1BL9A 3SJLA 3VRDA 1COTA 1MG3D 5E79V 1OAEA 2CE0A 3L73D 4RSZA 1CRGA 2QJYB 2VHDA 1CSXA 1KV9A 1GIWA 1N90A 3HQ8A 2B4ZA 2YQBA 4K3IA 3WFBC 1DIIC 1LC2A 5DFSA 1P84D 2LITA 2ZXYA 1IQCA 1CRIA 2BLFB 4WQ7A 3ZBMA 4FAVA 3ZOOA 5CICB 1LMSA 2AI5A 1A8CA 1N15A 1CHJA 2BH4X 1C7MA 1NU1D 1AYGA 5CIBB 2GC7D 3PXTA 1YEAA 3C2CA 1SQVD 3A9FA 2C1DB 2B0ZB 1DW0A 4O1QA 4AX3A 2D0SA 1NIRA 2N3YA 1NTKD 2N18B 1CCRA 1GU2A 155CA 2B11B 4O1WA 4XYDB 2AIUA 3CU4A 4UB6V 1AKKA 2OZ1A 1U75B 1FI3A 3OCDA 1I54A 4AAMA 2B12B 5B66V 1F1CA 3L74D 1HROA 2GB8B 1RZ6A 3SVWA 1OCDA 3NBSA 2CXBA 1CRCA 3WFEC 1MZ4A 1CNOA 2N18C 3H1JD 1E2RA 3H1HD 2BH5X 1M70A 1CSWA 4WQEA 4Y5RA 3RN1A 4GEDB 3CX5D 2D0WA 1B7VA 4PJ0V 1C2RA 1CO6A 2XTSB 1HJ5A 1EB7A 5GTHV 2MTAC 1W5CT 2V08A 3L71D 3CP5A 4WQ8A 4L1QA 2FRCA 3OA8A 2DGEA 3O0RC 4FA1A 1HZVA 2PCBB 2PACA 1GKSA 3KZIV 3WFCC 4PWAA 1ZRTD 4FB1A 1FOCA 1C6OA 4EIEA 2HV4A 3BCCD 4IL6V 3VYMA 2CE1A 4FA4A 2V07A 1N9CA 1KX2A 4WQCA 2QJKB 5KAFV 2FWLA 1AOFA 1H33A 2QJPB 4KMGA 5B6QA 3OCDB 2AXTV 2N3BA 1CYCA 1H31A 4FA5A 4D6TD 3TGUD 2IBZD 1NMIA 3HQ6A 1DT1A 1VYDA 4Q5PA 1K3HA 1CRJA 3DMIA 5KLVD 1CTZA 4AANA 3ZOWA 3VNWA 1R0QA 2YK3A 2JTIB 3X39A 3SWSA 4PD4D 1QL3A 3L4MA 4LJIA 1DVVA 2BPBB 4AALA 4U3FD 5C9MA 5KKZB 1CSUA 1IO3A 4L3GA 4NFGB 2YIUB 1DW3A 4EIDA 1PPJD 3NWVA 1KB9D 1AOQA 1MG2D 1IRWA 4N0KA 2YCCA 1DIQC 1CXAA 1C2NA 3OA8B 4YE1A 1KX7A 1M6ZA 1SQXD 1WVEC 5EXQA 1F1FA 1L0ND 4H0JA 1K3GA 1CTYA 2DVHA 1FI9A 2N9IA 1CIFA 1I6DA 351CA 1CEDA 1GDVA 1EZVD 3A0HV 1BGYD 1H33B 1L9JC 3L72D 1I8OA 1ZZHA 2CA3B 1H9YA 1DVHA 1YEBA 1HJ3A 1CRYA 1HJ4A 5H2FV 1S6VB 1C52A 3RLMA 1LS9A 2BGVX 2B10B 451CA 1JDLA 1LFMA 1RAPA 1FJ0A 3ZCFA 4WQBA 1A2SA 1I55A 2CA4B 1RZ5A 1CCHA 2ZONG 2ZBOA 1GJQA 1BE3D 4DY9A 3PH2B 2PCCB 1C75A 3HQ7A 3WFDC 1I6EA 3H1KD 1I8PA 3RMZA 3JBTB 2GIWA 2N9JA 2FYNB 1CIEA 1NTZD 1L0LD 5CIHB 3CYTI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DF5 A;  4WQA A;  2ZZS 1;  2EXV A;  2OZ1 B;  1H32 A;  3PXW A;  1CTJ A;  3ZOY A;  3ORV A;  1KYO D;  1KYO W;  5CIF B;  2FYU D;  3WU2 V;  1DW1 A;  1C6R A;  5B5E V;  1YNR A;  1PP9 D;  1IZL 0;  5CIG B;  4AAO A;  2C1V A;  1C6S A;  1CC5 A;  5KLI B;  1RAQ A;  4V2K A;  4XXL A;  1H1O A;  5CIE B;  1J3S A;  3H1I D;  1HZU A;  3L4O A;  1WEJ F;  2L4D A;  1YIQ A;  1N50 A;  1QL4 A;  1E8E A;  1YIC A;  1S5L V;  5CID B;  3RN0 A;  4H0K A;  2ORL A;  3M97 X;  3CWB D;  3WUI A;  1NNO A;  1H9X A;  3L75 D;  4UB8 V;  3ZOX A;  4EIF A;  5AUR A;  3L70 D;  1IRV A;  5KAI V;  2LIR A;  5TIS V;  1BCC D;  1NTM D;  5GTI V;  1YTC A;  4QAO A;  1CHH A;  1CXC A;  1QN2 A;  3NBT A;  3TYI A;  1W2L A;  1GQ1 A;  1E29 A;  5IY5 1;  3SLE A;  1CYI A;  3WC8 A;  1KIB A;  2MHM A;  1L9B C;  2C8S A;  1CIH A;  4PW9 B;  1FHB A;  1QKS A;  4FAN A;  3H1L D;  1LC1 A;  1YFC A;  2BCC D;  3O1Y A;  3HQ9 A;  1I5T A;  1H32 B;  4MU8 A;  1U74 B;  1H31 B;  3MK7 B;  4EIC A;  1HCM A;  3O20 A;  3PXS A;  4FA9 A;  1COR A;  2ZOO A;  1CIG A;  2C1D A;  1M60 A;  3DP5 A;  2C9X B;  1CYJ A;  3CX5 W;  2GC4 D;  4P4Q B;  1SQP D;  1FCD C;  3ZIY A;  5DJQ B;  3A0B V;  2I8F A;  1HRC A;  3O5C A;  5CYT R;  3CXH D;  1KB0 A;  3CXH W;  1SQQ D;  3MK7 C;  1YCC A;  2BCN B;  4WQ9 A;  4WQD A;  1FI7 A;  2JQR A;  4L3H A;  1DW2 A;  5C0Z A;  1ETP A;  4JCG A;  1HH7 A;  4J20 A;  2C2C A;  3SXT A;  1CSV A;  1CHI A;  1QYZ A;  3DR0 A;  1SQB D;  1NML A;  5DJQ C;  2A06 D;  4GYD A;  1CRH A;  1A56 A;  2C1U A;  1BL9 A;  3SJL A;  3VRD A;  1COT A;  1MG3 D;  5E79 V;  1OAE A;  2CE0 A;  3L73 D;  4RSZ A;  1CRG A;  2QJY B;  2VHD A;  1CSX A;  1KV9 A;  1GIW A;  1N90 A;  3HQ8 A;  2B4Z A;  2YQB A;  4K3I A;  3WFB C;  1DII C;  1LC2 A;  5DFS A;  1P84 D;  2LIT A;  2ZXY A;  1IQC A;  1CRI A;  2BLF B;  4WQ7 A;  3ZBM A;  4FAV A;  3ZOO A;  5CIC B;  1LMS A;  2AI5 A;  1A8C A;  1N15 A;  1CHJ A;  2BH4 X;  1C7M A;  1NU1 D;  1AYG A;  5CIB B;  2GC7 D;  3PXT A;  1YEA A;  3C2C A;  1SQV D;  3A9F A;  2C1D B;  2B0Z B;  1DW0 A;  4O1Q A;  4AX3 A;  2D0S A;  1NIR A;  2N3Y A;  1NTK D;  2N18 B;  1CCR A;  1GU2 A;  155C A;  2B11 B;  4O1W A;  4XYD B;  2AIU A;  3CU4 A;  4UB6 V;  1AKK A;  2OZ1 A;  1U75 B;  1FI3 A;  3OCD A;  1I54 A;  4AAM A;  2B12 B;  5B66 V;  1F1C A;  3L74 D;  1HRO A;  2GB8 B;  1RZ6 A;  3SVW A;  1OCD A;  3NBS A;  2CXB A;  1CRC A;  3WFE C;  1MZ4 A;  1CNO A;  2N18 C;  3H1J D;  1E2R A;  3H1H D;  2BH5 X;  1M70 A;  1CSW A;  4WQE A;  4Y5R A;  3RN1 A;  4GED B;  3CX5 D;  2D0W A;  1B7V A;  4PJ0 V;  1C2R A;  1CO6 A;  2XTS B;  1HJ5 A;  1EB7 A;  5GTH V;  2MTA C;  1W5C T;  2V08 A;  3L71 D;  3CP5 A;  4WQ8 A;  4L1Q A;  2FRC A;  3OA8 A;  2DGE A;  3O0R C;  4FA1 A;  1HZV A;  2PCB B;  2PAC A;  1GKS A;  3KZI V;  3WFC C;  4PWA A;  1ZRT D;  4FB1 A;  1FOC A;  1C6O A;  4EIE A;  2HV4 A;  3BCC D;  4IL6 V;  3VYM A;  2CE1 A;  4FA4 A;  2V07 A;  1N9C A;  1KX2 A;  4WQC A;  2QJK B;  5KAF V;  2FWL A;  1AOF A;  1H33 A;  2QJP B;  4KMG A;  5B6Q A;  3OCD B;  2AXT V;  2N3B A;  1CYC A;  1H31 A;  4FA5 A;  4D6T D;  3TGU D;  2IBZ D;  1NMI A;  3HQ6 A;  1DT1 A;  1VYD A;  4Q5P A;  1K3H A;  1CRJ A;  3DMI A;  5KLV D;  1CTZ A;  4AAN A;  3ZOW A;  3VNW A;  1R0Q A;  2YK3 A;  2JTI B;  3X39 A;  3SWS A;  4PD4 D;  1QL3 A;  3L4M A;  4LJI A;  1DVV A;  2BPB B;  4AAL A;  4U3F D;  5C9M A;  5KKZ B;  1CSU A;  1IO3 A;  4L3G A;  4NFG B;  2YIU B;  1DW3 A;  4EID A;  1PPJ D;  3NWV A;  1KB9 D;  1AOQ A;  1MG2 D;  1IRW A;  4N0K A;  2YCC A;  1DIQ C;  1CXA A;  1C2N A;  3OA8 B;  4YE1 A;  1KX7 A;  1M6Z A;  1SQX D;  1WVE C;  5EXQ A;  1F1F A;  1L0N D;  4H0J A;  1K3G A;  1CTY A;  2DVH A;  1FI9 A;  2N9I A;  1CIF A;  1I6D A;  351C A;  1CED A;  1GDV A;  1EZV D;  3A0H V;  1BGY D;  1H33 B;  1L9J C;  3L72 D;  1I8O A;  1ZZH A;  2CA3 B;  1H9Y A;  1DVH A;  1YEB A;  1HJ3 A;  1CRY A;  1HJ4 A;  5H2F V;  1S6V B;  1C52 A;  3RLM A;  1LS9 A;  2BGV X;  2B10 B;  451C A;  1JDL A;  1LFM A;  1RAP A;  1FJ0 A;  3ZCF A;  4WQB A;  1A2S A;  1I55 A;  2CA4 B;  1RZ5 A;  1CCH A;  2ZON G;  2ZBO A;  1GJQ A;  1BE3 D;  4DY9 A;  3PH2 B;  2PCC B;  1C75 A;  3HQ7 A;  3WFD C;  1I6E A;  3H1K D;  1I8P A;  3RMZ A;  3JBT B;  2GIW A;  2N9J A;  2FYN B;  1CIE A;  1NTZ D;  1L0L D;  5CIH B;  3CYT I; 
#chains in the Genus database with same CATH topology
 5DF5 A;  4WQA A;  2ZZS 1;  2EXV A;  2OZ1 B;  1H32 A;  3PXW A;  1CTJ A;  3ZOY A;  3ORV A;  1KYO D;  1KYO W;  5CIF B;  2FYU D;  3WU2 V;  1DW1 A;  1C6R A;  5B5E V;  1YNR A;  1PP9 D;  1IZL 0;  5CIG B;  4AAO A;  2C1V A;  1C6S A;  1CC5 A;  5KLI B;  1RAQ A;  4V2K A;  4XXL A;  1H1O A;  5CIE B;  1J3S A;  3H1I D;  1HZU A;  3L4O A;  1WEJ F;  2L4D A;  1YIQ A;  1N50 A;  1QL4 A;  1E8E A;  1YIC A;  1S5L V;  5CID B;  3RN0 A;  4H0K A;  2ORL A;  3M97 X;  3CWB D;  3WUI A;  1NNO A;  1H9X A;  3L75 D;  4UB8 V;  3ZOX A;  4EIF A;  5AUR A;  3L70 D;  1IRV A;  5KAI V;  2LIR A;  5TIS V;  1BCC D;  1NTM D;  5GTI V;  1YTC A;  4QAO A;  1CHH A;  1CXC A;  1QN2 A;  3NBT A;  3TYI A;  1W2L A;  1GQ1 A;  1E29 A;  5IY5 1;  3SLE A;  1CYI A;  3WC8 A;  1KIB A;  2MHM A;  1L9B C;  2C8S A;  1CIH A;  4PW9 B;  1FHB A;  1QKS A;  4FAN A;  3H1L D;  1LC1 A;  1YFC A;  2BCC D;  3O1Y A;  3HQ9 A;  1I5T A;  1H32 B;  4MU8 A;  1U74 B;  1H31 B;  3MK7 B;  4EIC A;  1HCM A;  3O20 A;  3PXS A;  4FA9 A;  1COR A;  2ZOO A;  1CIG A;  2C1D A;  1M60 A;  3DP5 A;  2C9X B;  1CYJ A;  3CX5 W;  2GC4 D;  4P4Q B;  1SQP D;  1FCD C;  3ZIY A;  5DJQ B;  3A0B V;  2I8F A;  1HRC A;  3O5C A;  5CYT R;  3CXH D;  1KB0 A;  3CXH W;  1SQQ D;  3MK7 C;  1YCC A;  2BCN B;  4WQ9 A;  4WQD A;  1FI7 A;  2JQR A;  4L3H A;  1DW2 A;  5C0Z A;  1ETP A;  4JCG A;  1HH7 A;  4J20 A;  2C2C A;  3SXT A;  1CSV A;  1CHI A;  1QYZ A;  3DR0 A;  1SQB D;  1NML A;  5DJQ C;  2A06 D;  4GYD A;  1CRH A;  1A56 A;  2C1U A;  1BL9 A;  3SJL A;  3VRD A;  1COT A;  1MG3 D;  5E79 V;  1OAE A;  2CE0 A;  3L73 D;  4RSZ A;  1CRG A;  2QJY B;  2VHD A;  1CSX A;  1KV9 A;  1GIW A;  1N90 A;  3HQ8 A;  2B4Z A;  2YQB A;  4K3I A;  3WFB C;  1DII C;  1LC2 A;  5DFS A;  1P84 D;  2LIT A;  2ZXY A;  1IQC A;  1CRI A;  2BLF B;  4WQ7 A;  3ZBM A;  4FAV A;  3ZOO A;  5CIC B;  1LMS A;  2AI5 A;  1A8C A;  1N15 A;  1CHJ A;  2BH4 X;  1C7M A;  1NU1 D;  1AYG A;  5CIB B;  2GC7 D;  3PXT A;  1YEA A;  3C2C A;  1SQV D;  3A9F A;  2C1D B;  2B0Z B;  1DW0 A;  4O1Q A;  4AX3 A;  2D0S A;  1NIR A;  2N3Y A;  1NTK D;  2N18 B;  1CCR A;  1GU2 A;  155C A;  2B11 B;  4O1W A;  4XYD B;  2AIU A;  3CU4 A;  4UB6 V;  1AKK A;  2OZ1 A;  1U75 B;  1FI3 A;  3OCD A;  1I54 A;  4AAM A;  2B12 B;  5B66 V;  1F1C A;  3L74 D;  1HRO A;  2GB8 B;  1RZ6 A;  3SVW A;  1OCD A;  3NBS A;  2CXB A;  1CRC A;  3WFE C;  1MZ4 A;  1CNO A;  2N18 C;  3H1J D;  1E2R A;  3H1H D;  2BH5 X;  1M70 A;  1CSW A;  4WQE A;  4Y5R A;  3RN1 A;  4GED B;  3CX5 D;  2D0W A;  1B7V A;  4PJ0 V;  1C2R A;  1CO6 A;  2XTS B;  1HJ5 A;  1EB7 A;  5GTH V;  2MTA C;  1W5C T;  2V08 A;  3L71 D;  3CP5 A;  4WQ8 A;  4L1Q A;  2FRC A;  3OA8 A;  2DGE A;  3O0R C;  4FA1 A;  1HZV A;  2PCB B;  2PAC A;  1GKS A;  3KZI V;  3WFC C;  4PWA A;  1ZRT D;  4FB1 A;  1FOC A;  1C6O A;  4EIE A;  2HV4 A;  3BCC D;  4IL6 V;  3VYM A;  2CE1 A;  4FA4 A;  2V07 A;  1N9C A;  1KX2 A;  4WQC A;  2QJK B;  5KAF V;  2FWL A;  1AOF A;  1H33 A;  2QJP B;  4KMG A;  5B6Q A;  3OCD B;  2AXT V;  2N3B A;  1CYC A;  1H31 A;  4FA5 A;  4D6T D;  3TGU D;  2IBZ D;  1NMI A;  3HQ6 A;  1DT1 A;  1VYD A;  4Q5P A;  1K3H A;  1CRJ A;  3DMI A;  5KLV D;  1CTZ A;  4AAN A;  3ZOW A;  3VNW A;  1R0Q A;  2YK3 A;  2JTI B;  3X39 A;  3SWS A;  4PD4 D;  1QL3 A;  3L4M A;  4LJI A;  1DVV A;  2BPB B;  4AAL A;  4U3F D;  5C9M A;  5KKZ B;  1CSU A;  1IO3 A;  4L3G A;  4NFG B;  2YIU B;  1DW3 A;  4EID A;  1PPJ D;  3NWV A;  1KB9 D;  1AOQ A;  1MG2 D;  1IRW A;  4N0K A;  2YCC A;  1DIQ C;  1CXA A;  1C2N A;  3OA8 B;  4YE1 A;  1KX7 A;  1M6Z A;  1SQX D;  1WVE C;  5EXQ A;  1F1F A;  1L0N D;  4H0J A;  1K3G A;  1CTY A;  2DVH A;  1FI9 A;  2N9I A;  1CIF A;  1I6D A;  351C A;  1CED A;  1GDV A;  1EZV D;  3A0H V;  1BGY D;  1H33 B;  1L9J C;  3L72 D;  1I8O A;  1ZZH A;  2CA3 B;  1H9Y A;  1DVH A;  1YEB A;  1HJ3 A;  1CRY A;  1HJ4 A;  5H2F V;  1S6V B;  1C52 A;  3RLM A;  1LS9 A;  2BGV X;  2B10 B;  451C A;  3D0W A;  1JDL A;  1LFM A;  1RAP A;  1FJ0 A;  3ZCF A;  4WQB A;  1A2S A;  1I55 A;  2CA4 B;  1RZ5 A;  1CCH A;  2ZON G;  2ZBO A;  1GJQ A;  1BE3 D;  4DY9 A;  3PH2 B;  2PCC B;  1C75 A;  3HQ7 A;  3WFD C;  1I6E A;  3H1K D;  1I8P A;  3RMZ A;  3JBT B;  2GIW A;  2N9J A;  2FYN B;  1CIE A;  1NTZ D;  1L0L D;  5CIH B;  3CYT I; 
#chains in the Genus database with same CATH homology
 5DF5 A;  4WQA A;  2ZZS 1;  2EXV A;  2OZ1 B;  1H32 A;  3PXW A;  1CTJ A;  3ZOY A;  3ORV A;  1KYO D;  1KYO W;  5CIF B;  2FYU D;  3WU2 V;  1DW1 A;  1C6R A;  5B5E V;  1YNR A;  1PP9 D;  1IZL 0;  5CIG B;  4AAO A;  2C1V A;  1C6S A;  1CC5 A;  5KLI B;  1RAQ A;  4V2K A;  4XXL A;  1H1O A;  5CIE B;  1J3S A;  3H1I D;  1HZU A;  3L4O A;  1WEJ F;  2L4D A;  1YIQ A;  1N50 A;  1QL4 A;  1E8E A;  1YIC A;  1S5L V;  5CID B;  3RN0 A;  4H0K A;  2ORL A;  3M97 X;  3CWB D;  3WUI A;  1NNO A;  1H9X A;  3L75 D;  4UB8 V;  3ZOX A;  4EIF A;  5AUR A;  3L70 D;  1IRV A;  5KAI V;  2LIR A;  5TIS V;  1BCC D;  1NTM D;  5GTI V;  1YTC A;  4QAO A;  1CHH A;  1CXC A;  1QN2 A;  3NBT A;  3TYI A;  1W2L A;  1GQ1 A;  1E29 A;  5IY5 1;  3SLE A;  1CYI A;  3WC8 A;  1KIB A;  2MHM A;  1L9B C;  2C8S A;  1CIH A;  4PW9 B;  1FHB A;  1QKS A;  4FAN A;  3H1L D;  1LC1 A;  1YFC A;  2BCC D;  3O1Y A;  3HQ9 A;  1I5T A;  1H32 B;  4MU8 A;  1U74 B;  1H31 B;  3MK7 B;  4EIC A;  1HCM A;  3O20 A;  3PXS A;  4FA9 A;  1COR A;  2ZOO A;  1CIG A;  2C1D A;  1M60 A;  3DP5 A;  2C9X B;  1CYJ A;  3CX5 W;  2GC4 D;  4P4Q B;  1SQP D;  1FCD C;  3ZIY A;  5DJQ B;  3A0B V;  2I8F A;  1HRC A;  3O5C A;  5CYT R;  3CXH D;  1KB0 A;  3CXH W;  1SQQ D;  3MK7 C;  1YCC A;  2BCN B;  4WQ9 A;  4WQD A;  1FI7 A;  2JQR A;  4L3H A;  1DW2 A;  5C0Z A;  1ETP A;  4JCG A;  1HH7 A;  4J20 A;  2C2C A;  3SXT A;  1CSV A;  1CHI A;  1QYZ A;  3DR0 A;  1SQB D;  1NML A;  5DJQ C;  2A06 D;  4GYD A;  1CRH A;  1A56 A;  2C1U A;  1BL9 A;  3SJL A;  3VRD A;  1COT A;  1MG3 D;  5E79 V;  1OAE A;  2CE0 A;  3L73 D;  4RSZ A;  1CRG A;  2QJY B;  2VHD A;  1CSX A;  1KV9 A;  1GIW A;  1N90 A;  3HQ8 A;  2B4Z A;  2YQB A;  4K3I A;  3WFB C;  1DII C;  1LC2 A;  5DFS A;  1P84 D;  2LIT A;  2ZXY A;  1IQC A;  1CRI A;  2BLF B;  4WQ7 A;  3ZBM A;  4FAV A;  3ZOO A;  5CIC B;  1LMS A;  2AI5 A;  1A8C A;  1N15 A;  1CHJ A;  2BH4 X;  1C7M A;  1NU1 D;  1AYG A;  5CIB B;  2GC7 D;  3PXT A;  1YEA A;  3C2C A;  1SQV D;  3A9F A;  2C1D B;  2B0Z B;  1DW0 A;  4O1Q A;  4AX3 A;  2D0S A;  1NIR A;  2N3Y A;  1NTK D;  2N18 B;  1CCR A;  1GU2 A;  155C A;  2B11 B;  4O1W A;  4XYD B;  2AIU A;  3CU4 A;  4UB6 V;  1AKK A;  2OZ1 A;  1U75 B;  1FI3 A;  3OCD A;  1I54 A;  4AAM A;  2B12 B;  5B66 V;  1F1C A;  3L74 D;  1HRO A;  2GB8 B;  1RZ6 A;  3SVW A;  1OCD A;  3NBS A;  2CXB A;  1CRC A;  3WFE C;  1MZ4 A;  1CNO A;  2N18 C;  3H1J D;  1E2R A;  3H1H D;  2BH5 X;  1M70 A;  1CSW A;  4WQE A;  4Y5R A;  3RN1 A;  4GED B;  3CX5 D;  2D0W A;  1B7V A;  4PJ0 V;  1C2R A;  1CO6 A;  2XTS B;  1HJ5 A;  1EB7 A;  5GTH V;  2MTA C;  1W5C T;  2V08 A;  3L71 D;  3CP5 A;  4WQ8 A;  4L1Q A;  2FRC A;  3OA8 A;  2DGE A;  3O0R C;  4FA1 A;  1HZV A;  2PCB B;  2PAC A;  1GKS A;  3KZI V;  3WFC C;  4PWA A;  1ZRT D;  4FB1 A;  1FOC A;  1C6O A;  4EIE A;  2HV4 A;  3BCC D;  4IL6 V;  3VYM A;  2CE1 A;  4FA4 A;  2V07 A;  1N9C A;  1KX2 A;  4WQC A;  2QJK B;  5KAF V;  2FWL A;  1AOF A;  1H33 A;  2QJP B;  4KMG A;  5B6Q A;  3OCD B;  2AXT V;  2N3B A;  1CYC A;  1H31 A;  4FA5 A;  4D6T D;  3TGU D;  2IBZ D;  1NMI A;  3HQ6 A;  1DT1 A;  1VYD A;  4Q5P A;  1K3H A;  1CRJ A;  3DMI A;  5KLV D;  1CTZ A;  4AAN A;  3ZOW A;  3VNW A;  1R0Q A;  2YK3 A;  2JTI B;  3X39 A;  3SWS A;  4PD4 D;  1QL3 A;  3L4M A;  4LJI A;  1DVV A;  2BPB B;  4AAL A;  4U3F D;  5C9M A;  5KKZ B;  1CSU A;  1IO3 A;  4L3G A;  4NFG B;  2YIU B;  1DW3 A;  4EID A;  1PPJ D;  3NWV A;  1KB9 D;  1AOQ A;  1MG2 D;  1IRW A;  4N0K A;  2YCC A;  1DIQ C;  1CXA A;  1C2N A;  3OA8 B;  4YE1 A;  1KX7 A;  1M6Z A;  1SQX D;  1WVE C;  5EXQ A;  1F1F A;  1L0N D;  4H0J A;  1K3G A;  1CTY A;  2DVH A;  1FI9 A;  2N9I A;  1CIF A;  1I6D A;  351C A;  1CED A;  1GDV A;  1EZV D;  3A0H V;  1BGY D;  1H33 B;  1L9J C;  3L72 D;  1I8O A;  1ZZH A;  2CA3 B;  1H9Y A;  1DVH A;  1YEB A;  1HJ3 A;  1CRY A;  1HJ4 A;  5H2F V;  1S6V B;  1C52 A;  3RLM A;  1LS9 A;  2BGV X;  2B10 B;  451C A;  1JDL A;  1LFM A;  1RAP A;  1FJ0 A;  3ZCF A;  4WQB A;  1A2S A;  1I55 A;  2CA4 B;  1RZ5 A;  1CCH A;  2ZON G;  2ZBO A;  1GJQ A;  1BE3 D;  4DY9 A;  3PH2 B;  2PCC B;  1C75 A;  3HQ7 A;  3WFD C;  1I6E A;  3H1K D;  1I8P A;  3RMZ A;  3JBT B;  2GIW A;  2N9J A;  2FYN B;  1CIE A;  1NTZ D;  1L0L D;  5CIH B;  3CYT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...