1SQBD

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqbD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqbD01
2MTAC 1SQVD 1E29A 1AYGA 3PH2B 3CX5D 5CIHB 1WEJF 3ZOXA 1C6SA 2GIWA 1E8EA 2B10B 2C1UA 1BL9A 2N9YB 3NWVA 1YCCA 1BCCD 1N90A 5KLVD 1F1FA 1KX2A 1CCRA 1GDVA 2JQRA 4P4QB 1PP9D 2C8SA 4MU8A 1MZ4A 2Y0EA 1C6RA 2XTSB 4RSZA 3PLNA 2Y0CA 1QKSA 1N50A 451CA 2FWLA 3ZIYA 2PCCB 1I5TA 2GB8B 351CA 2CXBA 3ZBMA 1IQCA 3PXWA 2N18B 5IY51 5H2FV 2O3JA 1C52A 1I8PA 1GKSA 1BGYD 2CE0A 1HCMA 4EIEA 2BPBB 1KYOD 1BE3D 4GYDA 5GTIV 3O20A 4Y5RA 1CSXA 2L4DA 1OAEA 4WQ8A 3PXSA 1N9CA 4UB8V 1GU2A 1A56A 2LITA 1NU1D 5CIFB 3H1ID 4AAMA 4FANA 3ZOYA 5GTHV 2BH5X 2N9JA 1B7VA 5CIGB 1CTZA 3RLMA 1A2SA 3VNWA 2HV4A 2VHDA 2C1VA 3O5CA 2N9IA 1EB7A 1CXAA 3HQ7A 2QJPB 3SWSA 1F1CA 1YEBA 1VYDA 3CU4A 5TISV 1J3SA 2FYNB 3VRDA 2B12B 3BCCD 2LIRA 4A7PA 2AI5A 1CSUA 1QL3A 1CO6A 1EZVD 1GIWA 2YK3A 3ITKA 4Q5PA 2N3BA 5C9MA 1YFCA 1A8CA 3L70D 1HJ5A 1FOCA 3L73D 1S5LV 4FA5A 1CIGA 1L9BC 3ZCFA 1CTJA 1RAPA 1DW0A 2YQBA 3RMZA 4AX3A 3RN0A 1DVVA 2CA4B 1H33A 1DW3A 1I55A 4WQDA 3TF5A 4FAVA 1H32A 3WFCC 3CWBD 1CNOA 1RZ5A 1YNRA 1YICA 1CHJA 4U3FD 3H1JD 3A0HV 2B4ZA 4FA1A 1DW1A 2MHMA 1U74B 2YCCA 3WU2V 2AIUA 1CTYA 3A9FA 2C9XB 4WQCA 5B66V 5CIBB 4XYDB 1L0LD 5CIDB 2KNCB 2OZ1B 1H32B 1CSVA 1KB9D 1IZL0 2DGEA 4PD4D 3L71D 2BH4X 2CE1A 2QJKB 1HZUA 4EIDA 1FJ0A 1GJQA 2V08A 1NIRA 1SQPD 4J20A 1CORA 1CHHA 2DVHA 4H0JA 1W2LA 5B6QA 1C7MA 1CIFA 3C2CA 4FA9A 2JWAA 3NBTA 2GC4D 4XXLA 1K3GA 1W5CT 2CA3B 1CC5A 4EIFA 1SQXD 5DJQC 1FHBA 1DT1A 1CIEA 3DMIA 2RN0A 1S6VB 1GQ1A 1SQBD 4K3IA 1HJ4A 4UB6V 2QJYB 5DF5A 3SLEA 1LMSA 1QN2A 2N3YA 5KLIB 3SXTA 2BCNB 2I8FA 1FI9A 1H1OA 3CXHD 2A06D 1RZ6A 1ETPA 3TDKA 4O1WA 1L9JC 1CYIA 2ZONG 1KIBA 1NTMD 1WVEC 2QG4A 2V07A 1CRIA 1M6ZA 1ZZHA 1L0ND 3OCDB 3DP5A 1HH7A 4WQAA 5CYTR 1CCHA 1H33B 3X39A 3H1LD 3O1YA 1DW2A 4PWAA 3JBTB 1E2RA 2BLFB 5C0ZA 1H9YA 3WFDC 5KAFV 4O1QA 3VMAA 4KMGA 1DIIC 3ZOWA 3HQ6A 3GW6A 3SVWA 3OA8A 4NFGB 2B0ZB 1CYJA 1HROA 4JCGA 4L3HA 2GC7D 2JTIB 1FI7A 2FYUD 4EDFA 5E79V 3A0BV 4FB1A 5B5EV 1CIHA 1PPJD 3H1HD 4PW9B 4L1QA 3RN1A 1U75B 3MK7B 1I6DA 1NTZD 2C2CA 4IL6V 1CRCA 3CX5W 3FWLA 1YTCA 2AXTV 4RJTA 2ZZS1 1DVHA 1MG2D 2Y0DA 1LC2A 1CYCA 1CRHA 3CXHW 4N0KA 1AKKA 4WQEA 1I8OA 3L75D 1KB0A 4WQBA 4WQ9A 2L91A 1LC1A 3TYIA 1CHIA 4AAOA 3HQ9A 3KHUA 1NMIA 2KS1A 3O0RC 1C2NA 4PJ0V 4WQ7A 1P84D 5TJHA 2D0SA 1HRCA 1M70A 1H9XA 2PCBB 4DY9A 3OA8B 5AURA 2ZXYA 2D0WA 3NBSA 1C6OA 1CRYA 1QL4A 3MK7C 1KX7A 4D6TD 4EICA 3OCDA 2ZOOA 2EXVA 1CEDA 1CXCA 4V2KA 1N15A 3PRJA 3ORVA 1KV9A 1M60A 2YIUB 5KAIV 3L74D 2PACA 1C2RA 1K3HA 3H1KD 1RAQA 1YIQA 3M97X 3WC8A 5CICB 3PXTA 2FRCA 3KZIV 1C75A 1I6EA 2C1DB 2K9JB 2ZBOA 4H0KA 2IBZD 4FA4A 155CA 3PHLA 1ZRTD 1LFMA 4QAOA 1QYZA 3SJLA 1KYOW 1IRWA 1HZVA 4YE1A 3ZOOA 3DR0A 3L72D 5DFSA 2ORLA 1AOQA 2Q3EA 5CIEB 1JDLA 4LJIA 1NMLA 1MG3D 3CYTI 1H31B 2C1DA 1SQQD 3L4MA 1I54A 4GEDB 5DJQB 5EXQA 3WUIA 2OZ1A 3VYMA 1CRJA 2BCCD 1NNOA 1OCDA 1AOFA 1IO3A 1H31A 1CSWA 3WFBC 3WFEC 3GG2A 1CRGA 4L3GA 2RMZA 3HQ8A 1R0QA 1COTA 1YEAA 1HJ3A 1FI3A 4AANA 3PTZA 1DIQC 1LS9A 1NTKD 3TGUD 2N18C 5KKZB 2B11B 2BGVX 1FCDC 4AALA 3L4OA 3CP5A 1IRVA
chains in the Genus database with same CATH superfamily
2I1KA 1SQVD 3V6IA 3PH2B 1XTCC 3AECC 4GKGA 1WEJF 4GT1A 2B10B 1BL9A 3CD6P 1KZUB 2JP3A 1L0NE 2V7QJ 2KLVA 2JKVA 3H1LJ 4BRYB 1CCRA 2MKVA 1DX7A 5B66H 1PP9D 2C8SA 2Y0EA 4OVNF 2FFDB 2XTSB 1EZVE 3PLNA 5AW4B 5AW8B 2K3RA 2FWLA 1L4AC 1H89A 1SVFA 1I5TA 2FYNC 2GB8B 1CW5A 4BXLA 2N18B 4I7ZC 3BATA 2O3JA 1OWAA 1GKSA 2CE0A 1GZLA 1HCMA 5CCHD 5GTIV 1JCDA 1OAEA 4HKZH 2WPQA 2KI7B 3FX0A 1GU2A 4HH2A 1A56A 1JMBA 1LTJC 4IL6E 2A06G 2ZXEB 2MJZA 5CIGB 1EZVI 3AE3C 1A2SA 2FBWC 1IFDA 2O01J 4ZNCA 3HQ7A 1QL2A 2P58A 3OAKA 3AE9C 2RKLA 5L8RJ 3CU4A 1J3SA 3M9HA 1L0NJ 3VRDA 3M0DC 5APSA 2AI5A 1EQ7A 3CCQP 3AEFC 1GIWA 2BCCJ 4B86A 3AEEC 5C9MA 3UIAA 1KFMA 1A8CA 3L73D 1G2CB 4I7ZB 1PL5A 1L9BC 3ZCFA 1AVOA 3R2PA 1UIIA 5APQA 4OH8B 1FDIA 1OVRA 1NU1J 4IFDK 1QX8A 3L73E 1RQVA 3D71A 1RY3A 1RZ5A 1YICA 1FZEA 1CHJA 1JY3O 3M06A 5KJ7D 1KB9E 1N8RQ 1CI6A 3NXSA 4EYYQ 1VF5C 1U74B 1YTZT 2WVRA 1VQMP 2ZT9B 5CIBB 5AW0B 4DT0A 1RE3A 3L74G 2KNCA 2VRSA 1IC2A 4N3YB 3KYQA 2BH4X 1S1CX 3JCUH 1DEEG 3GF7A 4EIDA 1FJ0A 1NIRA 2J58A 2XDJA 1U57A 1M8OB 1LT9C 1HWTC 1C7MA 3CX5I 3C2CA 1VQ5P 1ZP0C 3B5ND 1SQPG 2WT7B 1FZAA 2R3CA 1GK6A 2FFDA 2H8PD 3MZWB 2R32A 2AEFA 2RN0A 2UWJE 1NTMK 1GQ1A 4BWNA 2QA4P 5DF5A 3H1IJ 1FZCB 1NYHA 2IBZG 1FZCA 1QN2A 2E5TA 3EQ2A 5KLIB 1KD1Q 2IPPA 4WBAA 4HYTB 2A06D 1FZCC 4U3FG 3QH9A 2JWDA 4W80A 1GU5A 3OCDB 1SQQG 3DP5A 5CYTR 1CCHA 2JO1A 1H33B 3V2QA 3H1LD 3JBTB 2BLFB 3L70G 4ASWA 1VQLP 3SSUA 2WSCH 4KMGA 3B71A 3HQ6A 3GW6A 1IFNA 1FDMA 1ZW0A 3HD7D 1CYJA 1SQXJ 5EFWB 4JCGA 1PPJG 5E79E 3HE4B 2A45I 2FYUK 1FI7A 5KLVJ 4EDFA 1KYOH 5E79V 3RBXA 5CCHA 1JEKA 4PW9B 1JOCA 4H0LD 1U75B 5CJ4A 1I6DA 1NTZD 3LIDA 1JY3P 2QRXA 3CX5W 2N9BA 2OTJP 3CCVP 3D0WA 2V7QH 3H1KG 3V2NA 5H2FH 1KILE 2AXTV 1MG2D 1BE3E 3I56P 2OTLP 1EDIA 2ZT9C 1FOSE 2XNDH 3AE2C 1USDA 4WQBA 1MKMA 4WQ9A 1KB9H 1KORA 3P8CD 1ZV8A 4D6TG 3S9OA 3KHUA 3L72G 4EIJA 2K9JA 3TK1A 4Y28J 2WPSA 3O0RC 4PJ0V 1OMIA 1Q7YQ 1QVFO 2DW3A 4U3FE 3RK3B 4PJ0E 1YYCA 1HTLC 3H32B 3SWKA 5KAFE 1RE4C 2IBZE 5AURA 2B89A 2ZXYA 3D70A 3NBSA 1C6OA 1IFJA 1EC5A 3BVHA 1NVOA 2XZRA 3R4YA 2KUBA 1J1DB 4V2KA 2W90A 3PRJA 4WB4A 5GTIH 2XV5A 2BASA 3HUSC 1SQQK 2M3EA 1RAQA 2YO2A 3RL0B 1BSHA 3O6QA 3BCCG 3CCEP 1IFMA 2J5UA 1HVVA 1C75A 4H0KA 2IBZD 1NTZK 155CA 1LGHB 5CCGA 1LFMA 4QAOA 1QYZA 3VMYA 1HZVA 3ZOOA 3L72D 4H13D 2ORLA 2ZVNB 3HD7A 1Q82Q 1GW4A 4UB8H 2W83C 2FXPA 3CI9A 1MG3D 2J59M 3C8VA 3RL0D 4UB6E 4PD4I 1LNQA 1X9VA 3L4MA 3H32A 4GEDB 1LTIC 2QIWA 1GMJA 4WY4D 5KJ7A 4DJGA 4TT3H 2HPCA 2QE7H 2BCCD 1OIPA 1OCDA 1VQOP 1AOFA 1H31A 4GIFA 1VQ7P 5B5EH 1TU3F 1NTKG 3TGUG 1MFZA 4L3GA 1KYOI 1FAVA 4U7JA 1R0QA 2E74D 4H0LC 1FI3A 4AANA 1DIQC 1DD4A 1NTKK 1NTKD 3TGUD 2NPSA 2BGVX 3RK3D 3CP5A 1QL1A 5BVZA 4JQ0D 3WUVA 2MTAC 5CCHC 3E1RA 3RBZA 1SQPK 1IFIA 2E76C 3CX5D 3G9RA 5KLIC 2K1AA 1E8EA 2M0BA 2L5GB 2YKPA 2ZYGA 2XNXA 3TYYA 3G6EP 1JY2O 5KLVD 1SQQE 3L71G 2P7JA 2I1JA 1MV8A 3H1HG 3L35A 1EXJA 1LTGC 1ZR4A 1C6RA 1PGPA 3WUUA 3P8MC 1N50A 3AE5C 451CA 1M1JC 1NTZE 3ZIYA 1CZQA 2ZFCA 4M3LA 2OQQA 1IQCA 1CSBA 2IDBA 3FXDA 5H2FV 2WSEJ 1H88A 1VQ8P 1C52A 1MZ9A 2IFMA 2WSSH 1BGYD 4NPFX 1KYOD 3RK2B 3O20A 2LXCB 3H1IG 3T97B 1NU1G 4WQ8A 2OYHC 4JPZB 4OGQD 3AE8C 3C1LA 5KAIE 4UB8V 3LW5H 2LITA 1QLED 1N86A 2WWWA 2QEXP 2N9JA 1CTZA 3RLMA 3VNWA 2VHDA 1AFOA 5KAFH 3HE5B 5KJ7C 1LWUA 4PJ0H 2N9IA 1EB7A 1CXAA 1N2DC 5APVA 4D6TE 1RF1C 1F1CA 2R44A 2LIRA 4A7PA 1CSUA 3VYIA 2Q6QA 1EZVD 1L4AD 1S3JA 1W2BO 1JTHB 1SFCD 3AE6C 4Q5PA 3II6A 3V2RA 4L75A 1SQXG 3S1KA 1FOCA 1FU1A 2Q9IA 1S5LV 4FA5A 1CTJA 2QVAA 1KMIZ 1OFCX 1RAPA 1YQ4C 1OX3A 3L4FA 2YQBA 3RMZA 1KILA 3RN0A 3Q3DA 3M0AA 1DVVA 1SQVJ 1H33A 3H1HJ 3TF5A 4N78D 3WFCC 2OYIB 1GDTA 1YNRA 2Q3IA 1IZNB 3KZIH 1J2JB 3A0HV 4RO0A 1DW1A 3OJAB 3BCCE 2PGDA 1IFPA 2FKWB 2IFNA 3LW5J 1JUNA 1BCCE 4WY4A 1KB9D 1L2PA 2ITAA 3JC22 2W6AA 1W2LA 1CIFA 1OXZA 3L73J 2FFDC 4FA9A 3VMXA 4GOFA 4KT0J 2JWAA 3FXEA 2GC4D 1A02F 3CCJP 2H7HA 2O01N 3A3YB 3AE4C 4OGQB 1FHBA 5AVQB 1RQUA 3VP8A 2A06E 1NTKJ 3TGUJ 3CCUP 2QJYB 1ZXGA 2WITA 3K5BA 3SXTA 1AVYA 1SQVE 4XFJA 1NU1K 1H1OA 3CWBG 2Q1KA 1N73B 5CMZA 3I55P 1LP1B 1LTTC 1CYIA 2RH0A 2ZONG 1KIBA 1LTBC 1J1EC 2QG4A 3HE4A 1CRIA 4OGQC 2WSCJ 1L0ND 5AVUB 1HH7A 3U1AA 4EOTA 2JR8A 3O1YA 1T8ZA 3RL0C 4LLHA 1SQVG 2IZ0A 4N78E 2LKMA 1H9YA 3VMAA 2R5DA 3AEDC 3IR9A 3JCUE 1P84I 1HGZA 3VMZA 1HROA 3H1LE 1SQBE 2NPSC 2GC7D 2JTIB 1FJPA 2FYUE 3A0BV 1ZR2A 1CIHA 1PPJD 5AVSB 3RN1A 1VQ9P 2IYPA 1LWUC 1JCCA 3FWLA 4RJTA 1NTKE 3TGUE 2ZZS1 1T2KD 4L73A 1DVHA 3VP9A 2Y0DA 1JY2N 1EDLA 1BDCA 4N0KA 3H1JJ 1I8OA 3L75D 1NHLA 2KYVA 1KB0A 3BRTB 3MGNA 3N7NA 3M91A 1P84D 4NPDA 3C9IA 5GTIE 5TJHA 1G2CA 2D0SA 2PCBB 1FDOA 1S2EA 2Y9YA 2NRGA 1OW6A 2D0WA 1CRYA 1RF1B 2QJPC 3GHGA 4N6JA 1FS0E 2EXVA 5B5EE 1CEDA 1CXCA 1AQTA 1RH5B 3ORVA 1KV9A 4WY4C 5KAIV 3L74D 1C2RA 1Y47A 4U3FJ 3RK2C 4AQRD 1BGYJ 2WMMA 3M97X 3BASA 5AW5B 3B5NA 3PXTA 2B87B 4GODA 2W6BA 1SFCA 3H1JE 3W68A 1I6EA 1JB0J 1WMKA 3CCMP 2K9JB 2OGUA 2FYUG 2A45H 3WU2H 3CL3D 3SJLA 2IBZI 3CCRP 1KC8Q 3PJSK 1OW8A 2QJKC 3E7KA 1Z56A 2Q3EA 2YXRB 4LJIA 3L36A 4W7YA 2E75D 2Y9ZA 1NTZJ 3M9QA 1H31B 1GTWA 3L71J 1PPJE 2FYUJ 3HD7B 1SFCB 4ZKPA 2HPCB 2OZ1A 3VYMA 1DIPA 1DD3A 5AVXB 5APWA 3EFFK 4MN4C 1CSWA 4DZOA 3VTPC 3KXDA 1KB9I 2JJLA 1CRGA 2RMZA 2KK7A 1HGVA 1WT6A 3CC4P 4UB6H 2BCCE 1COTA 3A0HE 1NAYA 1SLQA 2HG5D 1VDFA 5AW3B 1JY2P 2NZ2A 1FCDC 2XU6A 4AALA 2E76B 3L72J 2CPSA 1N73C 1FZGA 4PV1C 4GDOA 2YKOA 5CIHB 3ZOXA 1GW3A 2GIWA 3PH0A 1N73A 2C1UA 1IO4A 3NWVA 2ZYDA 2C0WA 1BCCD 1N90A 1FZFA 4R4LA 4WWIA 1JO5A 3H1KE 1M1JA 1GDVA 2JQRA 3V4WA 3HUSA 4P4QB 3D6YA 3H1KJ 1MZ4A 5E79H 4RSZA 4KJMA 1QKSA 2OYHB 1K05A 1DH3A 2PCCB 4XA4A 351CA 2CXBA 3ZBMA 3PXWA 5IY51 1ZOYC 1I8PA 3L70J 1YQ3C 1GD2E 1OVUA 2BPBB 4JYCA 3IFMA 1CSXA 3MP7B 1A02J 3PXSA 5AW2B 3PP5A 1G1JA 2WSEH 5CIFB 4DOJA 4AAMA 3FWNA 3L72E 1EDJA 1X0TA 2CPBA 2BH5X 1B7VA 3CWBJ 3A5TA 3V5BA 1BDDA 1NKNA 3V4QA 1NTMG 1Q86Q 2HV4A 4Y99C 2C1VA 1SQVK 2AXTE 3O8ZA 3O5CA 3HD7C 2HFED 4WVZA 3P8CE 5TISE 3SWFA 1YEBA 5BU5A 1NH4A 5TISV 2FYNB 3Q2YA 1VQNP 2YO3A 1QL3A 1CO6A 2YK3A 1RHZB 2N3BA 5CCGC 3WUTA 1K8AQ 3KDPB 3KZIE 1SQXE 5KAIH 2NPSB 1L0NG 3A2AA 1DW0A 3G71P 2CA4B 4WQDA 3L74J 1H32A 3CWBD 1KQSO 1CNOA 4C7NA 2C0XA 1P84E 2H43A 2YIUC 3KPEA 4U3FD 1SS1A 1GL2B 3H1JD 4IL6H 2B4ZA 1JM0A 4FA1A 2YCCA 3WU2V 1Q90D 2AIUA 1CTYA 4WQCA 1J1EB 3L37A 4XYDB 1L0LD 5CIDB 2OZ1B 1H32B 2WZ7A 2AXCA 1IZL0 2DGEA 3L71D 3F89A 2V4HA 1K9MQ 2C9NY 2CE1A 1HZUA 1PGOA 3CX5H 1GJQA 2V08A 2H89C 3H25A 1SQPD 2PRRA 3L75G 5CHXA 1FC2C 1CHHA 2DVHA 3CXHI 5B6QA 1KILD 1BE3G 1JNMA 3GHGC 2M3BA 2JEEA 3NMDA 1HF9A 4R4MA 1K3GA 2CA3B 1CC5A 4EIFA 1EXIA 2H88C 1DT1A 3DMIA 3IAOA 1S6VB 1SQBD 4K3IA 5GTHH 4L74A 4UB6V 1KQFB 2LXBA 3SLEA 1BE3J 1LMSA 2N3YA 3MUDC 2O1KA 1FI9A 3CXHD 1RZ6A 1ETPA 3TDKA 2B9BA 2AEJA 1BSNA 1NTMD 1WVEC 2V07A 1M6ZA 1ZZHA 1YIJP 1SQPJ 3CC7P 1QVGO 1OVVA 1DW2A 5AVYB 5KAFV 5AW6B 1DIIC 3ZOWA 3L73G 5GTHE 1NWQA 4WY4B 2I8DA 1R5LA 2B0ZB 1Q2NA 4BRYA 1X8YA 4L3HA 1NO4A 3HE5A 2FYUD 1OZHA 1LTJA 1SQBG 1ZLLA 1YBKA 2IX7C 2PFXA 4HJGH 3T97A 4FB1A 2FYZA 1NTZG 4JYBA 2KZIA 3EWKA 5KLVE 4L1QA 1N7LA 2M8RA 3MK7B 1YJNP 2B87A 3HTKA 2KP8A 4IL6V 1VF5B 2WQYC 5AW1B 1GL2C 4PD4H 5CBOA 3SFDC 3F5HA 3MTUE 3USSA 1LC2A 1CYCA 1CRHA 4JBZA 4W7ZA 1PZQA 1AKKA 1AV1A 4JF7A 2E76D 2HLOA 2KZJA 1QGKB 5AVRB 1N7SD 4YTPC 3CXHH 1BGYG 3RK2D 4L76A 1CHIA 3HQ9A 1HH0A 1D7MA 2ZXXA 1NMIA 2KS1A 1RE4A 2FXOA 3TNUA 1C2NA 2SPZA 2M5AB 3B5NB 1VF5D 1JMMA 3GMAA 2LR2A 4DY9A 4UB8E 5K5GB 1W5CE 1M7LA 2E5YA 3MHVA 1EDKA 1VQ4P 2HODB 4EICA 5M1BA 3OCDA 4EI2A 2ZOOA 1UIXA 2W27A 1NJIQ 1N15A 1PP9E 1L4AA 3TSIA 1M56D 1YHQP 1M60A 3RGUA 3B5NC 1SP4A 1K3HA 2OARA 2ZAEB 5DJTB 2Q7CA 5CICB 1GK4A 5AVZB 1VQ6P 2KIKA 2C1DB 3U59A 1P84H 3AE1C 3EFGA 3A7OA 4IOIH 4FA4A 1LTJB 1L4AB 2Z5IA 1X22A 3DR0A 2P1JA 3JSVC 4OWFA 1N7SB 1L0LJ 1ZRTE 2OTKE 1GU4A 3CYTI 2K37A 2B88A 2FXMA 3H1LG 1I54A 5DJQB 5EXQA 1NAFA 3AEGC 2QM8A 3AEAC 2WSFJ 1NNOA 3L75E 2YNYA 1LP1A 3A0BH 1RF1A 3L75J 1PP9J 1L0LG 2N1TA 5TISH 3HQ8A 4H13B 1AJYA 1YITP 1KN7A 1YEAA 1LJ2A 1HJ3A 2O01H 3PTZA 4DCKA 1SQBJ 2N1TD 3HTKB 1JY3N 4CPGA 3Q5PA 5KKZB 1LT9A 3SWYA 1GL2D 1IRVA 1M90Q 2W8ZA 2QSIA 1VQKP 1M1JB 1S5LX 1VL2A 1E29A 1AYGA 2KXPB 2ZT9D 1KYOE 1RF0A 1S9KE 3IN6A 1C6SA 1KQLA 2HR3A 3CMEP 3Q5SA 2N9YB 1YCCA 5KTBA 5BU8B 1F1FA 4Y99B 1KX2A 1FOSF 4RKUJ 1YJWP 1AQ5A 1KQGB 3M9BA 2HODA 2POHA 1U7MA 1EZVG 3H6PA 1NGMB 2W6JH 4MU8A 4LC1A 2Y0CA 1RE3C 2E74C 1LT9B 1J1DC 1S5LE 1USEA 2GUVA 1R5SA 1SFCC 5AVWB 2BEQD 1AA0A 3AEBC 3S4RA 3IF4A 2XKMA 5KKZC 3CWBE 5CCGD 1KILB 1PV3A 4EIEA 1FJKA 1BE3D 4GYDA 1WRGA 4Y5RA 2L4DA 1N9CA 4K35A 2E42A 4KHXA 4GOEA 1NU1D 3H1ID 1NKZB 3MIWA 4FANA 4C46A 3ZOYA 5GTHV 1HUCA 2KSJA 1BCCJ 2OYOA 4IFFA 1NTME 5APYA 1L0LE 2QJPB 3SWSA 2IYOA 1VYDA 1U7JA 5CJ0A 4D6TJ 1YTZI 2B12B 3BCCD 5DJUB 1YJ9P 5AW9B 1Y8AA 3ITKA 4HB1A 1E79H 3M0DA 1X79B 1YFCA 1KILC 3U1CA 3L70D 1HJ5A 3W67A 1T3UA 1URQA 1CIGA 1GL2A 4AX3A 2YMKA 1DW3A 1I55A 2WT7A 1HBWA 2GUSA 4FAVA 1E5WA 4ASVA 3NFQA 3E1IA 1T3JA 1IJDB 3BRVB 1L0NK 2MHMA 1CI6B 3A9FA 2C9XB 1PP9G 1S4XA 5B66V 4QMAA 5APXA 4C7NB 1G1IA 1PIXA 1LTSC 2KNCB 2OYIA 3BCCJ 5B66E 5AVTB 1CSVA 3G4SP 4PD4D 2KSEA 1SQQJ 2QJKB 2Z4EA 3CLQA 4O9BA 2IZ1A 3GF3A 4J20A 1CORA 1Y9BA 2BCCG 2G8YA 1S5LH 4H0JA 3L74E 3CC2P 3NBTA 2R5BA 3RL0g 2D2CD 1PFIA 4XXLA 5CBNA 1W5CT 1SQXD 3ZDMA 5DJQC 1JTHA 4H0LB 1CIEA 1MFTA 1FBMA 1HJ0A 2PAJA 3CMAP 1HJ4A 1W2EA 2YKQA 4Z1MH 2BCNB 2I8FA 4PV1B 2P10A 2OYHA 4AYCA 1KTMA 2ZVOB 2ZYAA 4O1WA 2QJYC 1L9JC 3MUDA 1T6AA 3KQGA 4ZMDA 3D6ZA 2GA1A 4NPEA 4AUWA 2O1JA 2WPRA 3Q5RA 4K3AA 4WQAA 2E75C 3X39A 1N7SC 2C9LY 5AW7B 4PWAA 3GLMA 1PGQA 1E2RA 5C0ZA 3HUSB 3WFDC 4O1QA 3QWOC 3HRNA 2P2UA 2D2CC 3SVWA 4H44D 3CCSP 1KFNA 3OA8A 4NFGB 3N4XA 3CX5E 3CCLP 5H2FE 3P7KA 2R3SA 5APTA 4H44B 4I2LC 3B8EB 5B5EV 1LT1A 1KV4A 3H1JG 3H1HD 1XTGB 4TLFA 1H0TB 5C39A 2E43A 2C2CA 1CRCA 2N1TC 3G3ZA 1LTAC 3O6QB 5APUA 1K04A 1YTCA 3RK3C 3OW2O 2N1TB 1BGYE 4XE5B 3CXHW 3AE7C 4PV1D 4WQEA 1HJBA 3MD0A 1M1KQ 3LIEA 2M5AA 2L91A 2AEMA 1LC1A 1SQXK 1H0TA 3TYIA 1OW7A 2KS1B 2Z5HA 4AAOA 2BEZF 2KLUA 3Q1MA 2D2CB 4C7RA 4WQ7A 2OYIC 1NOHA 4LGDE 1NU1E 4I1LA 1HRCA 1M70A 1H9XA 3V2PA 3OA8B 4IFMA 2E75B 1FE6A 1URQD 3L71E 2CK3H 1QEXA 1H8AA 1SQPE 2QM7A 1ZMEC 1QL4A 3MK7C 1KX7A 2K88A 4D6TD 2AXTH 2WSFH 2K9YA 1FZBA 4IL6X 3A0BE 3CPWO 4I6MC 3B4SA 2YIUB 2PACA 3H1KD 2JDIH 1NTMJ 3WMM0 2KOGA 2P67A 3FGAD 1YIQA 3WC8A 1ZN5A 1K73Q 3OA7A 1S9KD 2FRCA 3KZIV 2HYNA 2A45G 2ZBOA 1YI2P 5KLVK 3PHLA 1ZRTD 2YXQB 1KYOW 1IRWA 4YE1A 1URQC 3ABVC 1N7SA 2Q5UA 3H1IE 2WPVB 5DFSA 1AOQA 2PP6A 2G3AA 1BCCG 5CIEB 4PD4E 5KLVG 1JDLA 4YPCA 1R8EA 1NMLA 1LWUB 3P32A 1IK9A 3H1HE 2C1DA 1SQQD 3WU2E 3WUIA 1M57D 5AVVB 1VPCA 1CRJA 4H44C 4YXDC 2E74B 2KB7P 3VN0A 3TNUB 4YXWH 1DEBA 2YMYA 1IO3A 3GHGB 2NPSD 3WFBC 3WFEC 3GG2A 2WTYA 2GM4A 1SQBK 3L70E 3RK3E 3NTNA 3SFEC 1LS9A 1S72P 1IK7A 2FY8A 1MUUA 2N18C 3A0HH 3CXHE 2B11B 1VQPP 3I5CA 2ZJSE 1L0LK 1RF0C 3L4OA 1PGJA 1Q81Q 1T2KC 1URQB 4H13C 3VOPA 4RESB 4ZKUA
chains in the Genus database with same CATH topology
2MTAC 1SQVD 1E29A 1AYGA 3PH2B 3CX5D 5CIHB 1WEJF 3ZOXA 1C6SA 2GIWA 1E8EA 2B10B 2C1UA 1BL9A 2N9YB 3NWVA 1YCCA 1BCCD 1N90A 5KLVD 1F1FA 1KX2A 1CCRA 1GDVA 2JQRA 4P4QB 1PP9D 2C8SA 4MU8A 1MZ4A 2Y0EA 1C6RA 2XTSB 4RSZA 3PLNA 2Y0CA 1QKSA 1N50A 451CA 2FWLA 3ZIYA 2PCCB 1I5TA 2GB8B 351CA 2CXBA 3ZBMA 1IQCA 3PXWA 2N18B 5IY51 5H2FV 2O3JA 1C52A 1I8PA 1GKSA 1BGYD 2CE0A 1HCMA 4EIEA 2BPBB 1KYOD 1BE3D 4GYDA 5GTIV 3O20A 4Y5RA 1CSXA 2L4DA 1OAEA 4WQ8A 3PXSA 1N9CA 4UB8V 1GU2A 1A56A 2LITA 1NU1D 5CIFB 3H1ID 4AAMA 4FANA 3ZOYA 5GTHV 2BH5X 2N9JA 1B7VA 5CIGB 1CTZA 3RLMA 1A2SA 3VNWA 2HV4A 2VHDA 2C1VA 3O5CA 2N9IA 1EB7A 1CXAA 3HQ7A 2QJPB 3SWSA 1F1CA 1YEBA 1VYDA 3CU4A 5TISV 1J3SA 2FYNB 3VRDA 2B12B 3BCCD 2LIRA 4A7PA 2AI5A 1CSUA 1QL3A 1CO6A 1EZVD 1GIWA 2YK3A 3ITKA 4Q5PA 2N3BA 5C9MA 1YFCA 1A8CA 3L70D 1HJ5A 1FOCA 3L73D 1S5LV 4FA5A 1CIGA 1L9BC 3ZCFA 1CTJA 1RAPA 1DW0A 2YQBA 3RMZA 4AX3A 3RN0A 1DVVA 2CA4B 1H33A 1DW3A 1I55A 4WQDA 3TF5A 4FAVA 1H32A 3WFCC 3CWBD 1CNOA 1RZ5A 1YNRA 1YICA 1CHJA 4U3FD 3H1JD 3A0HV 2B4ZA 4FA1A 1DW1A 2MHMA 1U74B 2YCCA 3WU2V 2AIUA 1CTYA 3A9FA 2C9XB 4WQCA 5B66V 5CIBB 4XYDB 1L0LD 5CIDB 2KNCB 2OZ1B 1H32B 1CSVA 1KB9D 1IZL0 2DGEA 4PD4D 3L71D 2BH4X 2CE1A 2QJKB 1HZUA 4EIDA 1FJ0A 1GJQA 2V08A 1NIRA 1SQPD 4J20A 1CORA 1CHHA 2DVHA 4H0JA 1W2LA 5B6QA 1C7MA 1CIFA 3C2CA 4FA9A 2JWAA 3NBTA 2GC4D 4XXLA 1K3GA 1W5CT 2CA3B 1CC5A 4EIFA 1SQXD 5DJQC 1FHBA 1DT1A 1CIEA 3DMIA 2RN0A 1S6VB 1GQ1A 1SQBD 4K3IA 1HJ4A 4UB6V 2QJYB 5DF5A 3SLEA 1LMSA 1QN2A 2N3YA 5KLIB 3SXTA 2BCNB 2I8FA 1FI9A 1H1OA 3CXHD 2A06D 1RZ6A 1ETPA 3TDKA 4O1WA 1L9JC 1CYIA 2ZONG 1KIBA 1NTMD 1WVEC 2QG4A 2V07A 1CRIA 1M6ZA 1ZZHA 1L0ND 3OCDB 3DP5A 1HH7A 4WQAA 5CYTR 1CCHA 1H33B 3X39A 3H1LD 3O1YA 1DW2A 4PWAA 3JBTB 1E2RA 2BLFB 5C0ZA 1H9YA 3WFDC 5KAFV 4O1QA 3VMAA 4KMGA 1DIIC 3ZOWA 3HQ6A 3GW6A 3SVWA 3OA8A 4NFGB 2B0ZB 1CYJA 1HROA 4JCGA 4L3HA 2GC7D 2JTIB 1FI7A 2FYUD 4EDFA 5E79V 3A0BV 4FB1A 5B5EV 1CIHA 1PPJD 3H1HD 4PW9B 4L1QA 3RN1A 1U75B 3MK7B 1I6DA 1NTZD 2C2CA 4IL6V 1CRCA 3CX5W 3FWLA 1YTCA 2AXTV 4RJTA 2ZZS1 1DVHA 1MG2D 2Y0DA 1LC2A 1CYCA 1CRHA 3CXHW 4N0KA 1AKKA 4WQEA 1I8OA 3L75D 1KB0A 4WQBA 4WQ9A 2L91A 1LC1A 3TYIA 1CHIA 4AAOA 3HQ9A 3KHUA 1NMIA 2KS1A 3O0RC 1C2NA 4PJ0V 4WQ7A 1P84D 5TJHA 2D0SA 1HRCA 1M70A 1H9XA 2PCBB 4DY9A 3OA8B 5AURA 2ZXYA 2D0WA 3NBSA 1C6OA 1CRYA 1QL4A 3MK7C 1KX7A 4D6TD 4EICA 3OCDA 2ZOOA 2EXVA 1CEDA 1CXCA 4V2KA 1N15A 3PRJA 3ORVA 1KV9A 1M60A 2YIUB 5KAIV 3L74D 2PACA 1C2RA 1K3HA 3H1KD 1RAQA 1YIQA 3M97X 3WC8A 5CICB 3PXTA 2FRCA 3KZIV 1C75A 1I6EA 2C1DB 2K9JB 2ZBOA 4H0KA 2IBZD 4FA4A 155CA 3PHLA 1ZRTD 1LFMA 4QAOA 1QYZA 3SJLA 1KYOW 1IRWA 1HZVA 4YE1A 3ZOOA 3DR0A 3L72D 5DFSA 2ORLA 1AOQA 2Q3EA 5CIEB 1JDLA 4LJIA 1NMLA 1MG3D 3CYTI 1H31B 2C1DA 1SQQD 3L4MA 1I54A 4GEDB 5DJQB 5EXQA 3WUIA 2OZ1A 3VYMA 1CRJA 2BCCD 1NNOA 1OCDA 1AOFA 1IO3A 1H31A 1CSWA 3WFBC 3WFEC 3GG2A 1CRGA 4L3GA 2RMZA 3HQ8A 1R0QA 1COTA 1YEAA 1HJ3A 1FI3A 4AANA 3PTZA 1DIQC 1LS9A 1NTKD 3TGUD 2N18C 5KKZB 2B11B 2BGVX 1FCDC 4AALA 3L4OA 3CP5A 1IRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTA C;  1SQV D;  1E29 A;  1AYG A;  3PH2 B;  3CX5 D;  5CIH B;  1WEJ F;  3ZOX A;  1C6S A;  2GIW A;  1E8E A;  2B10 B;  2C1U A;  1BL9 A;  2N9Y B;  3NWV A;  1YCC A;  1BCC D;  1N90 A;  5KLV D;  1F1F A;  1KX2 A;  1CCR A;  1GDV A;  2JQR A;  4P4Q B;  1PP9 D;  2C8S A;  4MU8 A;  1MZ4 A;  2Y0E A;  1C6R A;  2XTS B;  4RSZ A;  3PLN A;  2Y0C A;  1QKS A;  1N50 A;  451C A;  2FWL A;  3ZIY A;  2PCC B;  1I5T A;  2GB8 B;  351C A;  2CXB A;  3ZBM A;  1IQC A;  3PXW A;  2N18 B;  5IY5 1;  5H2F V;  2O3J A;  1C52 A;  1I8P A;  1GKS A;  1BGY D;  2CE0 A;  1HCM A;  4EIE A;  2BPB B;  1KYO D;  1BE3 D;  4GYD A;  5GTI V;  3O20 A;  4Y5R A;  1CSX A;  2L4D A;  1OAE A;  4WQ8 A;  3PXS A;  1N9C A;  4UB8 V;  1GU2 A;  1A56 A;  2LIT A;  1NU1 D;  5CIF B;  3H1I D;  4AAM A;  4FAN A;  3ZOY A;  5GTH V;  2BH5 X;  2N9J A;  1B7V A;  5CIG B;  1CTZ A;  3RLM A;  1A2S A;  3VNW A;  2HV4 A;  2VHD A;  2C1V A;  3O5C A;  2N9I A;  1EB7 A;  1CXA A;  3HQ7 A;  2QJP B;  3SWS A;  1F1C A;  1YEB A;  1VYD A;  3CU4 A;  5TIS V;  1J3S A;  2FYN B;  3VRD A;  2B12 B;  3BCC D;  2LIR A;  4A7P A;  2AI5 A;  1CSU A;  1QL3 A;  1CO6 A;  1EZV D;  1GIW A;  2YK3 A;  3ITK A;  4Q5P A;  2N3B A;  5C9M A;  1YFC A;  1A8C A;  3L70 D;  1HJ5 A;  1FOC A;  3L73 D;  1S5L V;  4FA5 A;  1CIG A;  1L9B C;  3ZCF A;  1CTJ A;  1RAP A;  1DW0 A;  2YQB A;  3RMZ A;  4AX3 A;  3RN0 A;  1DVV A;  2CA4 B;  1H33 A;  1DW3 A;  1I55 A;  4WQD A;  3TF5 A;  4FAV A;  1H32 A;  3WFC C;  3CWB D;  1CNO A;  1RZ5 A;  1YNR A;  1YIC A;  1CHJ A;  4U3F D;  3H1J D;  3A0H V;  2B4Z A;  4FA1 A;  1DW1 A;  2MHM A;  1U74 B;  2YCC A;  3WU2 V;  2AIU A;  1CTY A;  3A9F A;  2C9X B;  4WQC A;  5B66 V;  5CIB B;  4XYD B;  1L0L D;  5CID B;  2KNC B;  2OZ1 B;  1H32 B;  1CSV A;  1KB9 D;  1IZL 0;  2DGE A;  4PD4 D;  3L71 D;  2BH4 X;  2CE1 A;  2QJK B;  1HZU A;  4EID A;  1FJ0 A;  1GJQ A;  2V08 A;  1NIR A;  1SQP D;  4J20 A;  1COR A;  1CHH A;  2DVH A;  4H0J A;  1W2L A;  5B6Q A;  1C7M A;  1CIF A;  3C2C A;  4FA9 A;  2JWA A;  3NBT A;  2GC4 D;  4XXL A;  1K3G A;  1W5C T;  2CA3 B;  1CC5 A;  4EIF A;  1SQX D;  5DJQ C;  1FHB A;  1DT1 A;  1CIE A;  3DMI A;  2RN0 A;  1S6V B;  1GQ1 A;  1SQB D;  4K3I A;  1HJ4 A;  4UB6 V;  2QJY B;  5DF5 A;  3SLE A;  1LMS A;  1QN2 A;  2N3Y A;  5KLI B;  3SXT A;  2BCN B;  2I8F A;  1FI9 A;  1H1O A;  3CXH D;  2A06 D;  1RZ6 A;  1ETP A;  3TDK A;  4O1W A;  1L9J C;  1CYI A;  2ZON G;  1KIB A;  1NTM D;  1WVE C;  2QG4 A;  2V07 A;  1CRI A;  1M6Z A;  1ZZH A;  1L0N D;  3OCD B;  3DP5 A;  1HH7 A;  4WQA A;  5CYT R;  1CCH A;  1H33 B;  3X39 A;  3H1L D;  3O1Y A;  1DW2 A;  4PWA A;  3JBT B;  1E2R A;  2BLF B;  5C0Z A;  1H9Y A;  3WFD C;  5KAF V;  4O1Q A;  3VMA A;  4KMG A;  1DII C;  3ZOW A;  3HQ6 A;  3GW6 A;  3SVW A;  3OA8 A;  4NFG B;  2B0Z B;  1CYJ A;  1HRO A;  4JCG A;  4L3H A;  2GC7 D;  2JTI B;  1FI7 A;  2FYU D;  4EDF A;  5E79 V;  3A0B V;  4FB1 A;  5B5E V;  1CIH A;  1PPJ D;  3H1H D;  4PW9 B;  4L1Q A;  3RN1 A;  1U75 B;  3MK7 B;  1I6D A;  1NTZ D;  2C2C A;  4IL6 V;  1CRC A;  3CX5 W;  3FWL A;  1YTC A;  2AXT V;  4RJT A;  2ZZS 1;  1DVH A;  1MG2 D;  2Y0D A;  1LC2 A;  1CYC A;  1CRH A;  3CXH W;  4N0K A;  1AKK A;  4WQE A;  1I8O A;  3L75 D;  1KB0 A;  4WQB A;  4WQ9 A;  2L91 A;  1LC1 A;  3TYI A;  1CHI A;  4AAO A;  3HQ9 A;  3KHU A;  1NMI A;  2KS1 A;  3O0R C;  1C2N A;  4PJ0 V;  4WQ7 A;  1P84 D;  5TJH A;  2D0S A;  1HRC A;  1M70 A;  1H9X A;  2PCB B;  4DY9 A;  3OA8 B;  5AUR A;  2ZXY A;  2D0W A;  3NBS A;  1C6O A;  1CRY A;  1QL4 A;  3MK7 C;  1KX7 A;  4D6T D;  4EIC A;  3OCD A;  2ZOO A;  2EXV A;  1CED A;  1CXC A;  4V2K A;  1N15 A;  3PRJ A;  3ORV A;  1KV9 A;  1M60 A;  2YIU B;  5KAI V;  3L74 D;  2PAC A;  1C2R A;  1K3H A;  3H1K D;  1RAQ A;  1YIQ A;  3M97 X;  3WC8 A;  5CIC B;  3PXT A;  2FRC A;  3KZI V;  1C75 A;  1I6E A;  2C1D B;  2K9J B;  2ZBO A;  4H0K A;  2IBZ D;  4FA4 A;  155C A;  3PHL A;  1ZRT D;  1LFM A;  4QAO A;  1QYZ A;  3SJL A;  1KYO W;  1IRW A;  1HZV A;  4YE1 A;  3ZOO A;  3DR0 A;  3L72 D;  5DFS A;  2ORL A;  1AOQ A;  2Q3E A;  5CIE B;  1JDL A;  4LJI A;  1NML A;  1MG3 D;  3CYT I;  1H31 B;  2C1D A;  1SQQ D;  3L4M A;  1I54 A;  4GED B;  5DJQ B;  5EXQ A;  3WUI A;  2OZ1 A;  3VYM A;  1CRJ A;  2BCC D;  1NNO A;  1OCD A;  1AOF A;  1IO3 A;  1H31 A;  1CSW A;  3WFB C;  3WFE C;  3GG2 A;  1CRG A;  4L3G A;  2RMZ A;  3HQ8 A;  1R0Q A;  1COT A;  1YEA A;  1HJ3 A;  1FI3 A;  4AAN A;  3PTZ A;  1DIQ C;  1LS9 A;  1NTK D;  3TGU D;  2N18 C;  5KKZ B;  2B11 B;  2BGV X;  1FCD C;  4AAL A;  3L4O A;  3CP5 A;  1IRV A; 
#chains in the Genus database with same CATH topology
 2I1K A;  1SQV D;  3V6I A;  3PH2 B;  1XTC C;  3AEC C;  4GKG A;  1WEJ F;  4GT1 A;  2B10 B;  1BL9 A;  3CD6 P;  1KZU B;  2JP3 A;  1L0N E;  2V7Q J;  2KLV A;  2JKV A;  3H1L J;  4BRY B;  1CCR A;  2MKV A;  1DX7 A;  5B66 H;  1PP9 D;  2C8S A;  2Y0E A;  4OVN F;  2FFD B;  2XTS B;  1EZV E;  3PLN A;  5AW4 B;  5AW8 B;  2K3R A;  2FWL A;  1L4A C;  1H89 A;  1SVF A;  1I5T A;  2FYN C;  2GB8 B;  1CW5 A;  4BXL A;  2N18 B;  4I7Z C;  3BAT A;  2O3J A;  1OWA A;  1GKS A;  2CE0 A;  1GZL A;  1HCM A;  5CCH D;  5GTI V;  1JCD A;  1OAE A;  4HKZ H;  2WPQ A;  2KI7 B;  3FX0 A;  1GU2 A;  4HH2 A;  1A56 A;  1JMB A;  1LTJ C;  4IL6 E;  2A06 G;  2ZXE B;  2MJZ A;  5CIG B;  1EZV I;  3AE3 C;  1A2S A;  2FBW C;  1IFD A;  2O01 J;  4ZNC A;  3HQ7 A;  1QL2 A;  2P58 A;  3OAK A;  3AE9 C;  2RKL A;  5L8R J;  3CU4 A;  1J3S A;  3M9H A;  1L0N J;  3VRD A;  3M0D C;  5APS A;  2AI5 A;  1EQ7 A;  3CCQ P;  3AEF C;  1GIW A;  2BCC J;  4B86 A;  3AEE C;  5C9M A;  3UIA A;  1KFM A;  1A8C A;  3L73 D;  1G2C B;  4I7Z B;  1PL5 A;  1L9B C;  3ZCF A;  1AVO A;  3R2P A;  1UII A;  5APQ A;  4OH8 B;  1FDI A;  1OVR A;  1NU1 J;  4IFD K;  1QX8 A;  3L73 E;  1RQV A;  3D71 A;  1RY3 A;  1RZ5 A;  1YIC A;  1FZE A;  1CHJ A;  1JY3 O;  3M06 A;  5KJ7 D;  1KB9 E;  1N8R Q;  1CI6 A;  3NXS A;  4EYY Q;  1VF5 C;  1U74 B;  1YTZ T;  2WVR A;  1VQM P;  2ZT9 B;  5CIB B;  5AW0 B;  4DT0 A;  1RE3 A;  3L74 G;  2KNC A;  2VRS A;  1IC2 A;  4N3Y B;  3KYQ A;  2BH4 X;  1S1C X;  3JCU H;  1DEE G;  3GF7 A;  4EID A;  1FJ0 A;  1NIR A;  2J58 A;  2XDJ A;  1U57 A;  1M8O B;  1LT9 C;  1HWT C;  1C7M A;  3CX5 I;  3C2C A;  1VQ5 P;  1ZP0 C;  3B5N D;  1SQP G;  2WT7 B;  1FZA A;  2R3C A;  1GK6 A;  2FFD A;  2H8P D;  3MZW B;  2R32 A;  2AEF A;  2RN0 A;  2UWJ E;  1NTM K;  1GQ1 A;  4BWN A;  2QA4 P;  5DF5 A;  3H1I J;  1FZC B;  1NYH A;  2IBZ G;  1FZC A;  1QN2 A;  2E5T A;  3EQ2 A;  5KLI B;  1KD1 Q;  2IPP A;  4WBA A;  4HYT B;  2A06 D;  1FZC C;  4U3F G;  3QH9 A;  2JWD A;  4W80 A;  1GU5 A;  3OCD B;  1SQQ G;  3DP5 A;  5CYT R;  1CCH A;  2JO1 A;  1H33 B;  3V2Q A;  3H1L D;  3JBT B;  2BLF B;  3L70 G;  4ASW A;  1VQL P;  3SSU A;  2WSC H;  4KMG A;  3B71 A;  3HQ6 A;  3GW6 A;  1IFN A;  1FDM A;  1ZW0 A;  3HD7 D;  1CYJ A;  1SQX J;  5EFW B;  4JCG A;  1PPJ G;  5E79 E;  3HE4 B;  2A45 I;  2FYU K;  1FI7 A;  5KLV J;  4EDF A;  1KYO H;  5E79 V;  3RBX A;  5CCH A;  1JEK A;  4PW9 B;  1JOC A;  4H0L D;  1U75 B;  5CJ4 A;  1I6D A;  1NTZ D;  3LID A;  1JY3 P;  2QRX A;  3CX5 W;  2N9B A;  2OTJ P;  3CCV P;  3D0W A;  2V7Q H;  3H1K G;  3V2N A;  5H2F H;  1KIL E;  2AXT V;  1MG2 D;  1BE3 E;  3I56 P;  2OTL P;  1EDI A;  2ZT9 C;  1FOS E;  2XND H;  3AE2 C;  1USD A;  4WQB A;  1MKM A;  4WQ9 A;  1KB9 H;  1KOR A;  3P8C D;  1ZV8 A;  4D6T G;  3S9O A;  3KHU A;  3L72 G;  4EIJ A;  2K9J A;  3TK1 A;  4Y28 J;  2WPS A;  3O0R C;  4PJ0 V;  1OMI A;  1Q7Y Q;  1QVF O;  2DW3 A;  4U3F E;  3RK3 B;  4PJ0 E;  1YYC A;  1HTL C;  3H32 B;  3SWK A;  5KAF E;  1RE4 C;  2IBZ E;  5AUR A;  2B89 A;  2ZXY A;  3D70 A;  3NBS A;  1C6O A;  1IFJ A;  1EC5 A;  3BVH A;  1NVO A;  2XZR A;  3R4Y A;  2KUB A;  1J1D B;  4V2K A;  2W90 A;  3PRJ A;  4WB4 A;  5GTI H;  2XV5 A;  2BAS A;  3HUS C;  1SQQ K;  2M3E A;  1RAQ A;  2YO2 A;  3RL0 B;  1BSH A;  3O6Q A;  3BCC G;  3CCE P;  1IFM A;  2J5U A;  1HVV A;  1C75 A;  4H0K A;  2IBZ D;  1NTZ K;  155C A;  1LGH B;  5CCG A;  1LFM A;  4QAO A;  1QYZ A;  3VMY A;  1HZV A;  3ZOO A;  3L72 D;  4H13 D;  2ORL A;  2ZVN B;  3HD7 A;  1Q82 Q;  1GW4 A;  4UB8 H;  2W83 C;  2FXP A;  3CI9 A;  1MG3 D;  2J59 M;  3C8V A;  3RL0 D;  4UB6 E;  4PD4 I;  1LNQ A;  1X9V A;  3L4M A;  3H32 A;  4GED B;  1LTI C;  2QIW A;  1GMJ A;  4WY4 D;  5KJ7 A;  4DJG A;  4TT3 H;  2HPC A;  2QE7 H;  2BCC D;  1OIP A;  1OCD A;  1VQO P;  1AOF A;  1H31 A;  4GIF A;  1VQ7 P;  5B5E H;  1TU3 F;  1NTK G;  3TGU G;  1MFZ A;  4L3G A;  1KYO I;  1FAV A;  4U7J A;  1R0Q A;  2E74 D;  4H0L C;  1FI3 A;  4AAN A;  1DIQ C;  1DD4 A;  1NTK K;  1NTK D;  3TGU D;  2NPS A;  2BGV X;  3RK3 D;  3CP5 A;  1QL1 A;  5BVZ A;  4JQ0 D;  3WUV A;  2MTA C;  5CCH C;  3E1R A;  3RBZ A;  1SQP K;  1IFI A;  2E76 C;  3CX5 D;  3G9R A;  5KLI C;  2K1A A;  1E8E A;  2M0B A;  2L5G B;  2YKP A;  2ZYG A;  2XNX A;  3TYY A;  3G6E P;  1JY2 O;  5KLV D;  1SQQ E;  3L71 G;  2P7J A;  2I1J A;  1MV8 A;  3H1H G;  3L35 A;  1EXJ A;  1LTG C;  1ZR4 A;  1C6R A;  1PGP A;  3WUU A;  3P8M C;  1N50 A;  3AE5 C;  451C A;  1M1J C;  1NTZ E;  3ZIY A;  1CZQ A;  2ZFC A;  4M3L A;  2OQQ A;  1IQC A;  1CSB A;  2IDB A;  3FXD A;  5H2F V;  2WSE J;  1H88 A;  1VQ8 P;  1C52 A;  1MZ9 A;  2IFM A;  2WSS H;  1BGY D;  4NPF X;  1KYO D;  3RK2 B;  3O20 A;  2LXC B;  3H1I G;  3T97 B;  1NU1 G;  4WQ8 A;  2OYH C;  4JPZ B;  4OGQ D;  3AE8 C;  3C1L A;  5KAI E;  4UB8 V;  3LW5 H;  2LIT A;  1QLE D;  1N86 A;  2WWW A;  2QEX P;  2N9J A;  1CTZ A;  3RLM A;  3VNW A;  2VHD A;  1AFO A;  5KAF H;  3HE5 B;  5KJ7 C;  1LWU A;  4PJ0 H;  2N9I A;  1EB7 A;  1CXA A;  1N2D C;  5APV A;  4D6T E;  1RF1 C;  1F1C A;  2R44 A;  2LIR A;  4A7P A;  1CSU A;  3VYI A;  2Q6Q A;  1EZV D;  1L4A D;  1S3J A;  1W2B O;  1JTH B;  1SFC D;  3AE6 C;  4Q5P A;  3II6 A;  3V2R A;  4L75 A;  1SQX G;  3S1K A;  1FOC A;  1FU1 A;  2Q9I A;  1S5L V;  4FA5 A;  1CTJ A;  2QVA A;  1KMI Z;  1OFC X;  1RAP A;  1YQ4 C;  1OX3 A;  3L4F A;  2YQB A;  3RMZ A;  1KIL A;  3RN0 A;  3Q3D A;  3M0A A;  1DVV A;  1SQV J;  1H33 A;  3H1H J;  3TF5 A;  4N78 D;  3WFC C;  2OYI B;  1GDT A;  1YNR A;  2Q3I A;  1IZN B;  3KZI H;  1J2J B;  3A0H V;  4RO0 A;  1DW1 A;  3OJA B;  3BCC E;  2PGD A;  1IFP A;  2FKW B;  2IFN A;  3LW5 J;  1JUN A;  1BCC E;  4WY4 A;  1KB9 D;  1L2P A;  2ITA A;  3JC2 2;  2W6A A;  1W2L A;  1CIF A;  1OXZ A;  3L73 J;  2FFD C;  4FA9 A;  3VMX A;  4GOF A;  4KT0 J;  2JWA A;  3FXE A;  2GC4 D;  1A02 F;  3CCJ P;  2H7H A;  2O01 N;  3A3Y B;  3AE4 C;  4OGQ B;  1FHB A;  5AVQ B;  1RQU A;  3VP8 A;  2A06 E;  1NTK J;  3TGU J;  3CCU P;  2QJY B;  1ZXG A;  2WIT A;  3K5B A;  3SXT A;  1AVY A;  1SQV E;  4XFJ A;  1NU1 K;  1H1O A;  3CWB G;  2Q1K A;  1N73 B;  5CMZ A;  3I55 P;  1LP1 B;  1LTT C;  1CYI A;  2RH0 A;  2ZON G;  1KIB A;  1LTB C;  1J1E C;  2QG4 A;  3HE4 A;  1CRI A;  4OGQ C;  2WSC J;  1L0N D;  5AVU B;  1HH7 A;  3U1A A;  4EOT A;  2JR8 A;  3O1Y A;  1T8Z A;  3RL0 C;  4LLH A;  1SQV G;  2IZ0 A;  4N78 E;  2LKM A;  1H9Y A;  3VMA A;  2R5D A;  3AED C;  3IR9 A;  3JCU E;  1P84 I;  1HGZ A;  3VMZ A;  1HRO A;  3H1L E;  1SQB E;  2NPS C;  2GC7 D;  2JTI B;  1FJP A;  2FYU E;  3A0B V;  1ZR2 A;  1CIH A;  1PPJ D;  5AVS B;  3RN1 A;  1VQ9 P;  2IYP A;  1LWU C;  1JCC A;  3FWL A;  4RJT A;  1NTK E;  3TGU E;  2ZZS 1;  1T2K D;  4L73 A;  1DVH A;  3VP9 A;  2Y0D A;  1JY2 N;  1EDL A;  1BDC A;  4N0K A;  3H1J J;  1I8O A;  3L75 D;  1NHL A;  2KYV A;  1KB0 A;  3BRT B;  3MGN A;  3N7N A;  3M91 A;  1P84 D;  4NPD A;  3C9I A;  5GTI E;  5TJH A;  1G2C A;  2D0S A;  2PCB B;  1FDO A;  1S2E A;  2Y9Y A;  2NRG A;  1OW6 A;  2D0W A;  1CRY A;  1RF1 B;  2QJP C;  3GHG A;  4N6J A;  1FS0 E;  2EXV A;  5B5E E;  1CED A;  1CXC A;  1AQT A;  1RH5 B;  3ORV A;  1KV9 A;  4WY4 C;  5KAI V;  3L74 D;  1C2R A;  1Y47 A;  4U3F J;  3RK2 C;  4AQR D;  1BGY J;  2WMM A;  3M97 X;  3BAS A;  5AW5 B;  3B5N A;  3PXT A;  2B87 B;  4GOD A;  2W6B A;  1SFC A;  3H1J E;  3W68 A;  1I6E A;  1JB0 J;  1WMK A;  3CCM P;  2K9J B;  2OGU A;  2FYU G;  2A45 H;  3WU2 H;  3CL3 D;  3SJL A;  2IBZ I;  3CCR P;  1KC8 Q;  3PJS K;  1OW8 A;  2QJK C;  3E7K A;  1Z56 A;  2Q3E A;  2YXR B;  4LJI A;  3L36 A;  4W7Y A;  2E75 D;  2Y9Z A;  1NTZ J;  3M9Q A;  1H31 B;  1GTW A;  3L71 J;  1PPJ E;  2FYU J;  3HD7 B;  1SFC B;  4ZKP A;  2HPC B;  2OZ1 A;  3VYM A;  1DIP A;  1DD3 A;  5AVX B;  5APW A;  3EFF K;  4MN4 C;  1CSW A;  4DZO A;  3VTP C;  3KXD A;  1KB9 I;  2JJL A;  1CRG A;  2RMZ A;  2KK7 A;  1HGV A;  1WT6 A;  3CC4 P;  4UB6 H;  2BCC E;  1COT A;  3A0H E;  1NAY A;  1SLQ A;  2HG5 D;  1VDF A;  5AW3 B;  1JY2 P;  2NZ2 A;  1FCD C;  2XU6 A;  4AAL A;  2E76 B;  3L72 J;  2CPS A;  1N73 C;  1FZG A;  4PV1 C;  4GDO A;  2YKO A;  5CIH B;  3ZOX A;  1GW3 A;  2GIW A;  3PH0 A;  1N73 A;  2C1U A;  1IO4 A;  3NWV A;  2ZYD A;  2C0W A;  1BCC D;  1N90 A;  1FZF A;  4R4L A;  4WWI A;  1JO5 A;  3H1K E;  1M1J A;  1GDV A;  2JQR A;  3V4W A;  3HUS A;  4P4Q B;  3D6Y A;  3H1K J;  1MZ4 A;  5E79 H;  4RSZ A;  4KJM A;  1QKS A;  2OYH B;  1K05 A;  1DH3 A;  2PCC B;  4XA4 A;  351C A;  2CXB A;  3ZBM A;  3PXW A;  5IY5 1;  1ZOY C;  1I8P A;  3L70 J;  1YQ3 C;  1GD2 E;  1OVU A;  2BPB B;  4JYC A;  3IFM A;  1CSX A;  3MP7 B;  1A02 J;  3PXS A;  5AW2 B;  3PP5 A;  1G1J A;  2WSE H;  5CIF B;  4DOJ A;  4AAM A;  3FWN A;  3L72 E;  1EDJ A;  1X0T A;  2CPB A;  2BH5 X;  1B7V A;  3CWB J;  3A5T A;  3V5B A;  1BDD A;  1NKN A;  3V4Q A;  1NTM G;  1Q86 Q;  2HV4 A;  4Y99 C;  2C1V A;  1SQV K;  2AXT E;  3O8Z A;  3O5C A;  3HD7 C;  2HFE D;  4WVZ A;  3P8C E;  5TIS E;  3SWF A;  1YEB A;  5BU5 A;  1NH4 A;  5TIS V;  2FYN B;  3Q2Y A;  1VQN P;  2YO3 A;  1QL3 A;  1CO6 A;  2YK3 A;  1RHZ B;  2N3B A;  5CCG C;  3WUT A;  1K8A Q;  3KDP B;  3KZI E;  1SQX E;  5KAI H;  2NPS B;  1L0N G;  3A2A A;  1DW0 A;  3G71 P;  2CA4 B;  4WQD A;  3L74 J;  1H32 A;  3CWB D;  1KQS O;  1CNO A;  4C7N A;  2C0X A;  1P84 E;  2H43 A;  2YIU C;  3KPE A;  4U3F D;  1SS1 A;  1GL2 B;  3H1J D;  4IL6 H;  2B4Z A;  1JM0 A;  4FA1 A;  2YCC A;  3WU2 V;  1Q90 D;  2AIU A;  1CTY A;  4WQC A;  1J1E B;  3L37 A;  4XYD B;  1L0L D;  5CID B;  2OZ1 B;  1H32 B;  2WZ7 A;  2AXC A;  1IZL 0;  2DGE A;  3L71 D;  3F89 A;  2V4H A;  1K9M Q;  2C9N Y;  2CE1 A;  1HZU A;  1PGO A;  3CX5 H;  1GJQ A;  2V08 A;  2H89 C;  3H25 A;  1SQP D;  2PRR A;  3L75 G;  5CHX A;  1FC2 C;  1CHH A;  2DVH A;  3CXH I;  5B6Q A;  1KIL D;  1BE3 G;  1JNM A;  3GHG C;  2M3B A;  2JEE A;  3NMD A;  1HF9 A;  4R4M A;  1K3G A;  2CA3 B;  1CC5 A;  4EIF A;  1EXI A;  2H88 C;  1DT1 A;  3DMI A;  3IAO A;  1S6V B;  1SQB D;  4K3I A;  5GTH H;  4L74 A;  4UB6 V;  1KQF B;  2LXB A;  3SLE A;  1BE3 J;  1LMS A;  2N3Y A;  3MUD C;  2O1K A;  1FI9 A;  3CXH D;  1RZ6 A;  1ETP A;  3TDK A;  2B9B A;  2AEJ A;  1BSN A;  1NTM D;  1WVE C;  2V07 A;  1M6Z A;  1ZZH A;  1YIJ P;  1SQP J;  3CC7 P;  1QVG O;  1OVV A;  1DW2 A;  5AVY B;  5KAF V;  5AW6 B;  1DII C;  3ZOW A;  3L73 G;  5GTH E;  1NWQ A;  4WY4 B;  2I8D A;  1R5L A;  2B0Z B;  1Q2N A;  4BRY A;  1X8Y A;  4L3H A;  1NO4 A;  3HE5 A;  2FYU D;  1OZH A;  1LTJ A;  1SQB G;  1ZLL A;  1YBK A;  2IX7 C;  2PFX A;  4HJG H;  3T97 A;  4FB1 A;  2FYZ A;  1NTZ G;  4JYB A;  2KZI A;  3EWK A;  5KLV E;  4L1Q A;  1N7L A;  2M8R A;  3MK7 B;  1YJN P;  2B87 A;  3HTK A;  2KP8 A;  4IL6 V;  1VF5 B;  2WQY C;  5AW1 B;  1GL2 C;  4PD4 H;  5CBO A;  3SFD C;  3F5H A;  3MTU E;  3USS A;  1LC2 A;  1CYC A;  1CRH A;  4JBZ A;  4W7Z A;  1PZQ A;  1AKK A;  1AV1 A;  4JF7 A;  2E76 D;  2HLO A;  2KZJ A;  1QGK B;  5AVR B;  1N7S D;  4YTP C;  3CXH H;  1BGY G;  3RK2 D;  4L76 A;  1CHI A;  3HQ9 A;  1HH0 A;  1D7M A;  2ZXX A;  1NMI A;  2KS1 A;  1RE4 A;  2FXO A;  3TNU A;  1C2N A;  2SPZ A;  2M5A B;  3B5N B;  1VF5 D;  1JMM A;  3GMA A;  2LR2 A;  4DY9 A;  4UB8 E;  5K5G B;  1W5C E;  1M7L A;  2E5Y A;  3MHV A;  1EDK A;  1VQ4 P;  2HOD B;  4EIC A;  5M1B A;  3OCD A;  4EI2 A;  2ZOO A;  1UIX A;  2W27 A;  1NJI Q;  1N15 A;  1PP9 E;  1L4A A;  3TSI A;  1M56 D;  1YHQ P;  1M60 A;  3RGU A;  3B5N C;  1SP4 A;  1K3H A;  2OAR A;  2ZAE B;  5DJT B;  2Q7C A;  5CIC B;  1GK4 A;  5AVZ B;  1VQ6 P;  2KIK A;  2C1D B;  3U59 A;  1P84 H;  3AE1 C;  3EFG A;  3A7O A;  4IOI H;  4FA4 A;  1LTJ B;  1L4A B;  2Z5I A;  1X22 A;  3DR0 A;  2P1J A;  3JSV C;  4OWF A;  1N7S B;  1L0L J;  1ZRT E;  2OTK E;  1GU4 A;  3CYT I;  2K37 A;  2B88 A;  2FXM A;  3H1L G;  1I54 A;  5DJQ B;  5EXQ A;  1NAF A;  3AEG C;  2QM8 A;  3AEA C;  2WSF J;  1NNO A;  3L75 E;  2YNY A;  1LP1 A;  3A0B H;  1RF1 A;  3L75 J;  1PP9 J;  1L0L G;  2N1T A;  5TIS H;  3HQ8 A;  4H13 B;  1AJY A;  1YIT P;  1KN7 A;  1YEA A;  1LJ2 A;  1HJ3 A;  2O01 H;  3PTZ A;  4DCK A;  1SQB J;  2N1T D;  3HTK B;  1JY3 N;  4CPG A;  3Q5P A;  5KKZ B;  1LT9 A;  3SWY A;  1GL2 D;  1IRV A;  1M90 Q;  2W8Z A;  2QSI A;  1VQK P;  1M1J B;  1S5L X;  1VL2 A;  1E29 A;  1AYG A;  2KXP B;  2ZT9 D;  1KYO E;  1RF0 A;  1S9K E;  3IN6 A;  1C6S A;  1KQL A;  2HR3 A;  3CME P;  3Q5S A;  2N9Y B;  1YCC A;  5KTB A;  5BU8 B;  1F1F A;  4Y99 B;  1KX2 A;  1FOS F;  4RKU J;  1YJW P;  1AQ5 A;  1KQG B;  3M9B A;  2HOD A;  2POH A;  1U7M A;  1EZV G;  3H6P A;  1NGM B;  2W6J H;  4MU8 A;  4LC1 A;  2Y0C A;  1RE3 C;  2E74 C;  1LT9 B;  1J1D C;  1S5L E;  1USE A;  2GUV A;  1R5S A;  1SFC C;  5AVW B;  2BEQ D;  1AA0 A;  3AEB C;  3S4R A;  3IF4 A;  2XKM A;  5KKZ C;  3CWB E;  5CCG D;  1KIL B;  1PV3 A;  4EIE A;  1FJK A;  1BE3 D;  4GYD A;  1WRG A;  4Y5R A;  2L4D A;  1N9C A;  4K35 A;  2E42 A;  4KHX A;  4GOE A;  1NU1 D;  3H1I D;  1NKZ B;  3MIW A;  4FAN A;  4C46 A;  3ZOY A;  5GTH V;  1HUC A;  2KSJ A;  1BCC J;  2OYO A;  4IFF A;  1NTM E;  5APY A;  1L0L E;  2QJP B;  3SWS A;  2IYO A;  1VYD A;  1U7J A;  5CJ0 A;  4D6T J;  1YTZ I;  2B12 B;  3BCC D;  5DJU B;  1YJ9 P;  5AW9 B;  1Y8A A;  3ITK A;  4HB1 A;  1E79 H;  3M0D A;  1X79 B;  1YFC A;  1KIL C;  3U1C A;  3L70 D;  1HJ5 A;  3W67 A;  1T3U A;  1URQ A;  1CIG A;  1GL2 A;  4AX3 A;  2YMK A;  1DW3 A;  1I55 A;  2WT7 A;  1HBW A;  2GUS A;  4FAV A;  1E5W A;  4ASV A;  3NFQ A;  3E1I A;  1T3J A;  1IJD B;  3BRV B;  1L0N K;  2MHM A;  1CI6 B;  3A9F A;  2C9X B;  1PP9 G;  1S4X A;  5B66 V;  4QMA A;  5APX A;  4C7N B;  1G1I A;  1PIX A;  1LTS C;  2KNC B;  2OYI A;  3BCC J;  5B66 E;  5AVT B;  1CSV A;  3G4S P;  4PD4 D;  2KSE A;  1SQQ J;  2QJK B;  2Z4E A;  3CLQ A;  4O9B A;  2IZ1 A;  3GF3 A;  4J20 A;  1COR A;  1Y9B A;  2BCC G;  2G8Y A;  1S5L H;  4H0J A;  3L74 E;  3CC2 P;  3NBT A;  2R5B A;  3RL0 g;  2D2C D;  1PFI A;  4XXL A;  5CBN A;  1W5C T;  1SQX D;  3ZDM A;  5DJQ C;  1JTH A;  4H0L B;  1CIE A;  1MFT A;  1FBM A;  1HJ0 A;  2PAJ A;  3CMA P;  1HJ4 A;  1W2E A;  2YKQ A;  4Z1M H;  2BCN B;  2I8F A;  4PV1 B;  2P10 A;  2OYH A;  4AYC A;  1KTM A;  2ZVO B;  2ZYA A;  4O1W A;  2QJY C;  1L9J C;  3MUD A;  1T6A A;  3KQG A;  4ZMD A;  3D6Z A;  2GA1 A;  4NPE A;  4AUW A;  2O1J A;  2WPR A;  3Q5R A;  4K3A A;  4WQA A;  2E75 C;  3X39 A;  1N7S C;  2C9L Y;  5AW7 B;  4PWA A;  3GLM A;  1PGQ A;  1E2R A;  5C0Z A;  3HUS B;  3WFD C;  4O1Q A;  3QWO C;  3HRN A;  2P2U A;  2D2C C;  3SVW A;  4H44 D;  3CCS P;  1KFN A;  3OA8 A;  4NFG B;  3N4X A;  3CX5 E;  3CCL P;  5H2F E;  3P7K A;  2R3S A;  5APT A;  4H44 B;  4I2L C;  3B8E B;  5B5E V;  1LT1 A;  1KV4 A;  3H1J G;  3H1H D;  1XTG B;  4TLF A;  1H0T B;  5C39 A;  2E43 A;  2C2C A;  1CRC A;  2N1T C;  3G3Z A;  1LTA C;  3O6Q B;  5APU A;  1K04 A;  1YTC A;  3RK3 C;  3OW2 O;  2N1T B;  1BGY E;  4XE5 B;  3CXH W;  3AE7 C;  4PV1 D;  4WQE A;  1HJB A;  3MD0 A;  1M1K Q;  3LIE A;  2M5A A;  2L91 A;  2AEM A;  1LC1 A;  1SQX K;  1H0T A;  3TYI A;  1OW7 A;  2KS1 B;  2Z5H A;  4AAO A;  2BEZ F;  2KLU A;  3Q1M A;  2D2C B;  4C7R A;  4WQ7 A;  2OYI C;  1NOH A;  4LGD E;  1NU1 E;  4I1L A;  1HRC A;  1M70 A;  1H9X A;  3V2P A;  3OA8 B;  4IFM A;  2E75 B;  1FE6 A;  1URQ D;  3L71 E;  2CK3 H;  1QEX A;  1H8A A;  1SQP E;  2QM7 A;  1ZME C;  1QL4 A;  3MK7 C;  1KX7 A;  2K88 A;  4D6T D;  2AXT H;  2WSF H;  2K9Y A;  1FZB A;  4IL6 X;  3A0B E;  3CPW O;  4I6M C;  3B4S A;  2YIU B;  2PAC A;  3H1K D;  2JDI H;  1NTM J;  3WMM 0;  2KOG A;  2P67 A;  3FGA D;  1YIQ A;  3WC8 A;  1ZN5 A;  1K73 Q;  3OA7 A;  1S9K D;  2FRC A;  3KZI V;  2HYN A;  2A45 G;  2ZBO A;  1YI2 P;  5KLV K;  3PHL A;  1ZRT D;  2YXQ B;  1KYO W;  1IRW A;  4YE1 A;  1URQ C;  3ABV C;  1N7S A;  2Q5U A;  3H1I E;  2WPV B;  5DFS A;  1AOQ A;  2PP6 A;  2G3A A;  1BCC G;  5CIE B;  4PD4 E;  5KLV G;  1JDL A;  4YPC A;  1R8E A;  1NML A;  1LWU B;  3P32 A;  1IK9 A;  3H1H E;  2C1D A;  1SQQ D;  3WU2 E;  3WUI A;  1M57 D;  5AVV B;  1VPC A;  1CRJ A;  4H44 C;  4YXD C;  2E74 B;  2KB7 P;  3VN0 A;  3TNU B;  4YXW H;  1DEB A;  2YMY A;  1IO3 A;  3GHG B;  2NPS D;  3WFB C;  3WFE C;  3GG2 A;  2WTY A;  2GM4 A;  1SQB K;  3L70 E;  3RK3 E;  3NTN A;  3SFE C;  1LS9 A;  1S72 P;  1IK7 A;  2FY8 A;  1MUU A;  2N18 C;  3A0H H;  3CXH E;  2B11 B;  1VQP P;  3I5C A;  2ZJS E;  1L0L K;  1RF0 C;  3L4O A;  1PGJ A;  1Q81 Q;  1T2K C;  1URQ B;  4H13 C;  3VOP A;  4RES B;  4ZKU A; 
#chains in the Genus database with same CATH homology
 2MTA C;  1SQV D;  1E29 A;  1AYG A;  3PH2 B;  3CX5 D;  5CIH B;  1WEJ F;  3ZOX A;  1C6S A;  2GIW A;  1E8E A;  2B10 B;  2C1U A;  1BL9 A;  2N9Y B;  3NWV A;  1YCC A;  1BCC D;  1N90 A;  5KLV D;  1F1F A;  1KX2 A;  1CCR A;  1GDV A;  2JQR A;  4P4Q B;  1PP9 D;  2C8S A;  4MU8 A;  1MZ4 A;  2Y0E A;  1C6R A;  2XTS B;  4RSZ A;  3PLN A;  2Y0C A;  1QKS A;  1N50 A;  451C A;  2FWL A;  3ZIY A;  2PCC B;  1I5T A;  2GB8 B;  351C A;  2CXB A;  3ZBM A;  1IQC A;  3PXW A;  2N18 B;  5IY5 1;  5H2F V;  2O3J A;  1C52 A;  1I8P A;  1GKS A;  1BGY D;  2CE0 A;  1HCM A;  4EIE A;  2BPB B;  1KYO D;  1BE3 D;  4GYD A;  5GTI V;  3O20 A;  4Y5R A;  1CSX A;  2L4D A;  1OAE A;  4WQ8 A;  3PXS A;  1N9C A;  4UB8 V;  1GU2 A;  1A56 A;  2LIT A;  1NU1 D;  5CIF B;  3H1I D;  4AAM A;  4FAN A;  3ZOY A;  5GTH V;  2BH5 X;  2N9J A;  1B7V A;  5CIG B;  1CTZ A;  3RLM A;  1A2S A;  3VNW A;  2HV4 A;  2VHD A;  2C1V A;  3O5C A;  2N9I A;  1EB7 A;  1CXA A;  3HQ7 A;  2QJP B;  3SWS A;  1F1C A;  1YEB A;  1VYD A;  3CU4 A;  5TIS V;  1J3S A;  2FYN B;  3VRD A;  2B12 B;  3BCC D;  2LIR A;  4A7P A;  2AI5 A;  1CSU A;  1QL3 A;  1CO6 A;  1EZV D;  1GIW A;  2YK3 A;  3ITK A;  4Q5P A;  2N3B A;  5C9M A;  1YFC A;  1A8C A;  3L70 D;  1HJ5 A;  1FOC A;  3L73 D;  1S5L V;  4FA5 A;  1CIG A;  1L9B C;  3ZCF A;  1CTJ A;  1RAP A;  1DW0 A;  2YQB A;  3RMZ A;  4AX3 A;  3RN0 A;  1DVV A;  2CA4 B;  1H33 A;  1DW3 A;  1I55 A;  4WQD A;  3TF5 A;  4FAV A;  1H32 A;  3WFC C;  3CWB D;  1CNO A;  1RZ5 A;  1YNR A;  1YIC A;  1CHJ A;  4U3F D;  3H1J D;  3A0H V;  2B4Z A;  4FA1 A;  1DW1 A;  2MHM A;  1U74 B;  2YCC A;  3WU2 V;  2AIU A;  1CTY A;  3A9F A;  2C9X B;  4WQC A;  5B66 V;  5CIB B;  4XYD B;  1L0L D;  5CID B;  2KNC B;  2OZ1 B;  1H32 B;  1CSV A;  1KB9 D;  1IZL 0;  2DGE A;  4PD4 D;  3L71 D;  2BH4 X;  2CE1 A;  2QJK B;  1HZU A;  4EID A;  1FJ0 A;  1GJQ A;  2V08 A;  1NIR A;  1SQP D;  4J20 A;  1COR A;  1CHH A;  2DVH A;  4H0J A;  1W2L A;  5B6Q A;  1C7M A;  1CIF A;  3C2C A;  4FA9 A;  2JWA A;  3NBT A;  2GC4 D;  4XXL A;  1K3G A;  1W5C T;  2CA3 B;  1CC5 A;  4EIF A;  1SQX D;  5DJQ C;  1FHB A;  1DT1 A;  1CIE A;  3DMI A;  2RN0 A;  1S6V B;  1GQ1 A;  1SQB D;  4K3I A;  1HJ4 A;  4UB6 V;  2QJY B;  5DF5 A;  3SLE A;  1LMS A;  1QN2 A;  2N3Y A;  5KLI B;  3SXT A;  2BCN B;  2I8F A;  1FI9 A;  1H1O A;  3CXH D;  2A06 D;  1RZ6 A;  1ETP A;  3TDK A;  4O1W A;  1L9J C;  1CYI A;  2ZON G;  1KIB A;  1NTM D;  1WVE C;  2QG4 A;  2V07 A;  1CRI A;  1M6Z A;  1ZZH A;  1L0N D;  3OCD B;  3DP5 A;  1HH7 A;  4WQA A;  5CYT R;  1CCH A;  1H33 B;  3X39 A;  3H1L D;  3O1Y A;  1DW2 A;  4PWA A;  3JBT B;  1E2R A;  2BLF B;  5C0Z A;  1H9Y A;  3WFD C;  5KAF V;  4O1Q A;  3VMA A;  4KMG A;  1DII C;  3ZOW A;  3HQ6 A;  3GW6 A;  3SVW A;  3OA8 A;  4NFG B;  2B0Z B;  1CYJ A;  1HRO A;  4JCG A;  4L3H A;  2GC7 D;  2JTI B;  1FI7 A;  2FYU D;  4EDF A;  5E79 V;  3A0B V;  4FB1 A;  5B5E V;  1CIH A;  1PPJ D;  3H1H D;  4PW9 B;  4L1Q A;  3RN1 A;  1U75 B;  3MK7 B;  1I6D A;  1NTZ D;  2C2C A;  4IL6 V;  1CRC A;  3CX5 W;  3FWL A;  1YTC A;  2AXT V;  4RJT A;  2ZZS 1;  1DVH A;  1MG2 D;  2Y0D A;  1LC2 A;  1CYC A;  1CRH A;  3CXH W;  4N0K A;  1AKK A;  4WQE A;  1I8O A;  3L75 D;  1KB0 A;  4WQB A;  4WQ9 A;  2L91 A;  1LC1 A;  3TYI A;  1CHI A;  4AAO A;  3HQ9 A;  3KHU A;  1NMI A;  2KS1 A;  3O0R C;  1C2N A;  4PJ0 V;  4WQ7 A;  1P84 D;  5TJH A;  2D0S A;  1HRC A;  1M70 A;  1H9X A;  2PCB B;  4DY9 A;  3OA8 B;  5AUR A;  2ZXY A;  2D0W A;  3NBS A;  1C6O A;  1CRY A;  1QL4 A;  3MK7 C;  1KX7 A;  4D6T D;  4EIC A;  3OCD A;  2ZOO A;  2EXV A;  1CED A;  1CXC A;  4V2K A;  1N15 A;  3PRJ A;  3ORV A;  1KV9 A;  1M60 A;  2YIU B;  5KAI V;  3L74 D;  2PAC A;  1C2R A;  1K3H A;  3H1K D;  1RAQ A;  1YIQ A;  3M97 X;  3WC8 A;  5CIC B;  3PXT A;  2FRC A;  3KZI V;  1C75 A;  1I6E A;  2C1D B;  2K9J B;  2ZBO A;  4H0K A;  2IBZ D;  4FA4 A;  155C A;  3PHL A;  1ZRT D;  1LFM A;  4QAO A;  1QYZ A;  3SJL A;  1KYO W;  1IRW A;  1HZV A;  4YE1 A;  3ZOO A;  3DR0 A;  3L72 D;  5DFS A;  2ORL A;  1AOQ A;  2Q3E A;  5CIE B;  1JDL A;  4LJI A;  1NML A;  1MG3 D;  3CYT I;  1H31 B;  2C1D A;  1SQQ D;  3L4M A;  1I54 A;  4GED B;  5DJQ B;  5EXQ A;  3WUI A;  2OZ1 A;  3VYM A;  1CRJ A;  2BCC D;  1NNO A;  1OCD A;  1AOF A;  1IO3 A;  1H31 A;  1CSW A;  3WFB C;  3WFE C;  3GG2 A;  1CRG A;  4L3G A;  2RMZ A;  3HQ8 A;  1R0Q A;  1COT A;  1YEA A;  1HJ3 A;  1FI3 A;  4AAN A;  3PTZ A;  1DIQ C;  1LS9 A;  1NTK D;  3TGU D;  2N18 C;  5KKZ B;  2B11 B;  2BGV X;  1FCD C;  4AAL A;  3L4O A;  3CP5 A;  1IRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...