1SQBD

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqbD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqbD01
2D0SA 3PXTA 4MU8A 4FA4A 3M97X 2PCBB 5CIHB 1W5CT 3WFBC 1I6EA 1C52A 2VHDA 1KX2A 4UB8V 4WQ8A 1H32A 3HQ8A 1H9XA 3ZBMA 1HZVA 3RN1A 1GJQA 1SQPD 4Y5RA 1CIFA 1CRCA 1N9CA 2AI5A 1DIIC 1LS9A 4RSZA 1QL4A 4EDFA 1M6ZA 2C1VA 3CXHD 3H1HD 1NIRA 2C9XB 3VYMA 1CCHA 1IZL0 4AAMA 2BGVX 1CRYA 1H33A 4Q5PA 4WQAA 4AAOA 1HJ5A 3CX5D 1GIWA 3WU2V 1WEJF 2JWAA 3TGUD 1FI9A 3HQ7A 1HCMA 2N9YB 1HJ4A 2C2CA 1CHIA 2B10B 4AANA 4FAVA 1N15A 4AALA 3DR0A 3H1JD 2BH4X 1DIQC 1YICA 4KMGA 2BH5X 4FA9A 3CWBD 2MTAC 3H1KD 3PH2B 2LITA 2V08A 2C1UA 3WFEC 1I8OA 1H31A 1DT1A 3PHLA 1IRWA 2GC7D 5DJQB 3A9FA 5CYTR 3WUIA 4WQCA 3L73D 3PLNA 3KZIV 2BPBB 4H0KA 2ZONG 1E8EA 3WC8A 1CTZA 1QL3A 2N9IA 1DW2A 3BCCD 1L9BC 4IL6V 1GU2A 2GIWA 1HH7A 3VNWA 4LJIA 4L3GA 3FWLA 1NMIA 2CXBA 2Y0DA 3TDKA 3CXHW 4UB6V 1YFCA 5CIGB 4D6TD 3PTZA 2C1DA 2N3YA 2OZ1B 1CXAA 1QKSA 5CIFB 3VRDA 1SQQD 3TF5A 1H1OA 1GQ1A 1I6DA 1A2SA 1YEBA 5KAIV 3CX5W 3SLEA 1A56A 1I54A 3OCDB 1BCCD 1CRGA 3SWSA 1GDVA 2V07A 1L0LD 5DFSA 5KLIB 1COTA 1E2RA 1I5TA 3SVWA 2FWLA 1DW1A 5B5EV 1CCRA 4P4QB 5E79V 4WQ9A 1I8PA 1F1FA 1ZZHA 1C2RA 3ZOYA 4WQEA 1HJ3A 1CRIA 2FYUD 1QN2A 2L4DA 1KYOD 4PW9B 1CHHA 2ORLA 4YE1A 3PXWA 3L71D 1B7VA 5DF5A 1C6OA 1GKSA 3OA8A 5B66V 1F1CA 1KIBA 2B12B 3L72D 1NTMD 1PP9D 4WQ7A 1NTKD 4EIDA 1LC1A 1MG2D 2B0ZB 1FI3A 3ZOXA 1CNOA 1HRCA 1AOFA 1C2NA 3KHUA 1CIHA 1FHBA 2PACA 1OAEA 4RJTA 3ZCFA 1CSXA 4EIEA 2HV4A 1BL9A 5DJQC 1H32B 1IQCA 5GTIV 1CXCA 3L75D 4O1QA 4PJ0V 1CORA 3NWVA 3L4MA 1I55A 1ETPA 3DP5A 1L0ND 1CSUA 5C0ZA 2I8FA 3ZOWA 2Q3EA 1RAPA 2N18B 4GYDA 4L3HA 3TYIA 3O1YA 1M60A 2MHMA 2QJYB 4XXLA 1DW3A 3O0RC 1CYCA 1IRVA 2GC4D 1H33B 3L74D 4DY9A 1FCDC 2EXVA 2IBZD 2YIUB 1A8CA 1OCDA 1MZ4A 2Y0EA 2ZXYA 3HQ6A 3L70D 1YIQA 4WQBA 1LC2A 5TJHA 3PRJA 1E29A 1C7MA 3RMZA 1SQXD 3NBSA 5KAFV 3ITKA 3L4OA 1CO6A 2A06D 3MK7B 1YTCA 2Y0CA 1C75A 4FA1A 5KKZB 3VMAA 2N3BA 4J20A 1CYIA 1BE3D 1YNRA 3RLMA 1KV9A 1H31B 1LFMA 1NU1D 2YCCA 1YEAA 1FI7A 1S5LV 4JCGA 2YQBA 1CIGA 4L1QA 451CA 1NMLA 1LMSA 2D0WA 3A0BV 1CYJA 3C2CA 4K3IA 1SQVD 2BCNB 1RZ6A 2QG4A 1S6VB 5KLVD 1CIEA 2FRCA 2N9JA 3DMIA 1NTZD 2PCCB 2B4ZA 3CP5A 1N90A 2JQRA 4FA5A 2QJKB 3CU4A 3O5CA 5CICB 2C1DB 3GW6A 5EXQA 3O20A 1CC5A 4EICA 2CE0A 1HROA 2DVHA 1CHJA 1SQBD 2RMZA 2QJPB 4EIFA 3X39A 5AURA 1J3SA 5B6QA 4FB1A 4PWAA 2L91A 4AX3A 2B11B 2DGEA 3ZOOA 2JTIB 3H1ID 2XTSB 5IY51 3CYTI 1M70A 1NNOA 1YCCA 1CEDA 4H0JA 2N18C 5GTHV 2KNCB 2CA3B 4U3FD 155CA 1K3GA 1PPJD 1U74B 3A0HV 3ZIYA 1RZ5A 2CA4B 351CA 1ZRTD 1RAQA 1CSWA 2ZZS1 1P84D 2YK3A 3WFDC 3OA8B 5C9MA 1CTYA 1KB0A 3WFCC 1VYDA 3RN0A 2C8SA 1K3HA 2OZ1A 4XYDB 2BCCD 4V2KA 2LIRA 1QYZA 5TISV 1AYGA 1KYOW 3MK7C 1BGYD 4NFGB 3OCDA 2KS1A 1C6RA 1KB9D 1WVEC 1FJ0A 1DW0A 4GEDB 1W2LA 3H1LD 3NBTA 1N50A 2RN0A 4A7PA 2GB8B 1C6SA 2ZOOA 1CSVA 2CE1A 1IO3A 3SXTA 5CIEB 5H2FV 1L9JC 4WQDA 1AOQA 4O1WA 4PD4D 1CRHA 1H9YA 3JBTB 1JDLA 4QAOA 1DVVA 4FANA 2K9JB 1EZVD 2BLFB 2FYNB 3SJLA 1CRJA 4N0KA 1DVHA 2ZBOA 1HZUA 5CIDB 3PXSA 1MG3D 3GG2A 1CTJA 5CIBB 2O3JA 3HQ9A 1EB7A 2AXTV 1AKKA 2AIUA 1KX7A 1U75B 1R0QA 3ORVA 1FOCA
chains in the Genus database with same CATH superfamily
4MU8A 4FA4A 2ITAA 1OMIA 2ZYGA 1N7SB 2PCBB 5CIHB 1C52A 3O8ZA 1IC2A 2HR3A 4XE5B 2KZJA 4Y5RA 4HJGH 3CXHH 1CRCA 3L72G 2AI5A 4WB4A 1NTMG 1LS9A 3IFMA 3JC22 5AVWB 2C1VA 4N78E 2E76C 5KLVE 2NRGA 1SQPJ 2E43A 3VYMA 1GU4A 1OW8A 4XFJA 1OWAA 1D7MA 3Q5RA 1HJ5A 2AXTE 1GIWA 1LT9A 1FZEA 3BASA 3TGUD 2M3EA 1GW3A 5AVQB 3HQ7A 3G6EP 1KZUB 1HCMA 3MUDC 1QGKB 1PFIA 1JEKA 2ZT9C 3RK2D 1FZFA 2OGUA 1YICA 1H89A 2ZXXA 1SP4A 5M1BA 5AW5B 2YXRB 1RF0A 3H1KD 3B5NB 3WFEC 1I8OA 1SQPE 1H88A 2NPSB 4L74A 1KC8Q 5DJQB 3A9FA 2QM8A 2Y9ZA 3PLNA 3CXHE 2BPBB 1S72P 3P7KA 2RKLA 2FYNC 1KILE 4JYCA 1R5LA 3B8EB 3GMAA 1LT9B 1RE4C 4LJIA 4RKUJ 1JCCA 3FWLA 3TDKA 2C9NY 1NU1G 1L2PA 2R5DA 4D6TD 1L0LG 1JY3O 3P8MC 2N3YA 3CLQA 2Z4EA 1QKSA 5APQA 3VRDA 3P32A 4NPDA 1YEBA 2YO3A 3SLEA 1N7SC 3I56P 3SWSA 2D2CD 5KLIB 1JCDA 4EOTA 1E2RA 2N9BA 3PH0A 2RH0A 1N73B 1EDIA 2E5TA 2KSEA 3AE4C 1C2RA 2QE7H 4WQEA 1MFTA 2ZAEB 1FC2C 1NTMK 3M06A 5APXA 1S4XA 2ZXEB 4NPEA 1KYOD 4PW9B 2ORLA 4YE1A 1VDFA 3HE5A 4JBZA 3L71D 3H1IG 5KAFE 5AW3B 1IFPA 1PGQA 2OARA 2O1JA 4ZMDA 5DJUB 1EDLA 1SLQA 1PP9D 4WQ7A 2VRSA 1PV3A 1Y47A 1KYOI 5CCHA 1CW5A 5GTHH 2B0ZB 1HRCA 3B4SA 3B5NC 1CIHA 1LNQA 4JYBA 1OAEA 4RJTA 2NPSC 3ZCFA 4EIEA 1PIXA 5DJQC 1NTMJ 1IQCA 3AE5C 1QVFO 1T2KD 3L75D 2XV5A 1LWUA 3AE2C 4GDOA 3L74G 1CSUA 1LT9C 2Q3EA 2N18B 4L3HA 3TYIA 1M7LA 4HKZH 2HPCA 3CWBJ 1M60A 2QJYB 4R4MA 5B66E 2KZIA 1OFCX 1X79B 1KTMA 2LXBA 2IBZD 1NU1K 2YIUB 1NTME 1RF0C 1NH4A 1L0LK 1OCDA 1LJ2A 4AUWA 3L70D 1YIQA 3A3YB 4WQBA 1LC2A 2E5YA 3PRJA 4IL6H 3E1IA 5KLIC 1KMIZ 5KAFV 1CO6A 5APUA 5GTHE 3MK7B 3L37A 1YTCA 1EZVG 1N73C 3VMAA 1Q82Q 4J20A 3SFDC 1BE3D 2IBZI 3CWBE 5KJ7D 1KV9A 1OXZA 1YEAA 1NTZG 1CIGA 1M1JA 2WSCH 1AVYA 1HH0A 2E75D 1SQQJ 2E42A 4L73A 4K3IA 2QG4A 5KLVD 3E7KA 3CD6P 5BU8B 1CIEA 1K04A 1L0LJ 1N90A 5B5EH 1N86A 3KXDA 1U7MA 4EI2A 2K37A 4PD4I 4CPGA 2KLVA 3CCSP 5CICB 2IX7C 3P8CE 4EICA 2CE0A 2DVHA 1L4AB 1U7JA 2FKWB 3LIEA 2FXMA 1JY2P 3ZOOA 2A45H 5AVXB 1RY3A 1L0LE 2V7QJ 2HG5D 3ABVC 1LTBC 3K5BA 3U59A 4H0LB 5GTHV 2N18C 4W7ZA 3HD7D 4GKGA 1KILD 3HE4A 3W68A 1K3GA 2QJYC 4C7NA 2YIUC 2K9YA 5CCHC 2K3RA 1N7LA 3WUUA 4H13B 3CXHI 3D71A 1GK4A 1VYDA 2W6BA 4UB8E 1Y8AA 2WITA 4OGQB 3C8VA 1VQNP 1QYZA 2KUBA 3MK7C 3H1IE 1GL2D 3KZIH 5KJ7A 1N2DC 2K88A 2W27A 2M5AA 3L74J 1FJ0A 2WPRA 5AVUB 3OAKA 3RBZA 1NTZK 2FFDA 1N50A 4C7NB 2RN0A 4A7PA 2GB8B 2ZOOA 2GA1A 4RO0A 1IO3A 1QL1A 2KLUA 1CI6B 2KXPB 1T8ZA 3IN6A 1GU5A 2IFMA 1BCCG 1DVVA 2KP8A 3LW5H 4OWFA 4YXDC 1M8OB 4ZNCA 1USEA 5CIDB 3E1RA 5AW8B 4WY4B 3L74E 3SSUA 1CTJA 2JP3A 5TISE 1L4AC 3CPWO 3NTNA 3CCLP 1AKKA 2AIUA 1R0QA 1R5SA 1FOCA 1FOSF 2MKVA 3RL0D 3B71A 1NTZJ 3V6IA 3KZIE 3M97X 2R44A 4I2LC 2B87B 3WFBC 1I6EA 2A06E 1HJBA 4UB8V 3HQ8A 1K73Q 3ZBMA 1FDIA 3RN1A 4H0LC 2KOGA 4BRYB 2UWJE 1S2EA 1SQBJ 2OTKE 1DIIC 1JB0J 4RSZA 3M0DA 1QL4A 1M6ZA 2LKMA 3M9HA 3AEDC 3H1HD 1GZLA 1NIRA 2G3AA 3CX5H 1CCHA 4H13C 1NTZE 3H1JG 1VQ5P 4Q5PA 1ZR2A 1RF1A 1G1IA 4OGQC 1IJDB 2JWAA 4HH2A 1FI9A 1MUUA 5CCGC 2N9YB 1FAVA 1GL2A 4U3FJ 1CHIA 2IYPA 3N4XA 1HTLC 3CC4P 2HODA 3A0HH 1VF5B 2BH4X 3MGNA 1DIQC 4KMGA 2N1TB 3BATA 3A7OA 4FA9A 2I8DA 3CWBD 3AEEC 2IDBA 3H32B 1A02F 2V08A 4DZOA 2C1UA 2P67A 1H31A 1MFZA 3PHLA 1J2JB 2Q7CA 1IRWA 1FZCB 2XKMA 3KZIV 1LTTC 4H0KA 1E8EA 3WC8A 1CTZA 1CSBA 1QL3A 2J58A 1BGYJ 1VQ4P 1SQXG 1DW2A 1MKMA 5AW2B 1RF1B 1VQ6P 1GU2A 2GIWA 3WUVA 1HH7A 3VYIA 1PPJE 3CX5E 4WY4C 2P2UA 1ZRTE 1G2CA 1OW6A 3CL3D 1YFCA 3P8CD 4EIJA 2H43A 4GOFA 2OZ1B 1KQLA 1YQ4C 1SQQD 2PFXA 1S5LH 1I6DA 1A2SA 1X22A 2OTJP 1ZXGA 3OCDB 2YKOA 1CRGA 2XNDH 1NGMB 2V07A 1L0LD 5DJTB 1COTA 1I5TA 3SVWA 4K35A 3RK3B 1DW1A 3CCEP 3V2PA 3CC7P 2FYZA 2PP6A 1ZW0A 1OZHA 3L4FA 1BCCJ 5C39A 1ZZHA 2WPSA 1H8AA 1CRIA 3TNUA 2KNCA 5AVVB 1RH5B 1NKZB 2Q3IA 1CHHA 4PD4E 1AJYA 1NTKG 1LTIC 1KORA 2WT7B 2C0WA 2B9BA 1GKSA 3HTKB 1YYCA 3OJAB 1LT1A 3OW2O 1QX8A 1EQ7A 3QWOC 2P58A 4DT0A 2AEJA 5AVSB 1BCCE 1VF5C 1S5LE 1J1DB 2N1TC 3GHGA 3KHUA 4GIFA 3M9QA 3A0BE 2OYOA 1HBWA 3G4SP 1LTSC 2PACA 1CSXA 3TNUB 4TLFA 2JEEA 1FZCC 1YJNP 1CXCA 5AVZB 2YMYA 1CORA 1EXJA 3U1CA 3L4MA 2YMKA 1RF1C 3ZOWA 3H1JJ 2O01H 4N3YB 1YHQP 2K9JA 4ZKUA 2MHMA 2FXPA 2WSSH 3V4WA 1IRVA 2GC4D 1KN7A 3L74D 1FCDC 2EXVA 3H1LG 2Y0EA 2W6AA 3L73J 2ZXYA 1FS0E 2O01J 4N6JA 1PZQA 1C7MA 3RMZA 1BSNA 1SVFA 3BCCJ 3KYQA 1X9VA 1SFCD 1VQKP 2XDJA 5CMZA 3RK3C 3H1JE 5K5GB 2A06D 2WWWA 2QSIA 4FA1A 3ZDMA 1IK7A 1IZNB 4OVNF 1IFMA 2PGDA 2OYHA 2DW3A 1LFMA 1YJ9P 3S1KA 1S5LV 4JCGA 2K1AA 2YQBA 3BVHA 451CA 1NMLA 2H8PD 2V4HA 3EWKA 4H44B 5KAIH 3A0BV 5APVA 3L73E 1FE6A 1OW7A 3VMZA 1SQVD 1S6VB 3Q2YA 1AQTA 2N9JA 1NTZD 3BCCE 2B4ZA 3V2RA 4FA5A 1NTKK 1ZLLA 2QJKB 3CU4A 1Z56A 4Y28J 1EZVI 3GW6A 1YQ3C 1J1DC 1CC5A 1SQBD 2RMZA 2WZ7A 2YO2A 4EIFA 5AURA 1S3JA 2OYHB 1E5WA 2A45G 2P1JA 1ZR4A 4PWAA 2JO1A 4AX3A 2HLOA 2DGEA 1RE3A 5CBNA 2WQYC 4LGDE 1JY2O 3HRNA 1LP1A 2BEZF 2QM7A 1YITP 2QIWA 1PGOA 5L8RJ 3CCRP 3CI9A 3AE6C 3L72J 1NTKJ 4AYCA 4U3FD 3WU2H 3CC2P 4Z1MH 1P84H 1PPJD 3ZIYA 2IYOA 3IR9A 1RZ5A 2BEQD 1NYHA 3AE9C 4W7YA 4EYYQ 1ZRTD 1RAQA 3HE5B 3H1KG 1CSWA 1ZMEC 5CHXA 3Q1MA 3JCUH 1MV8A 5C9MA 5CJ0A 4PJ0H 3WFCC 2R32A 2W6JH 3LIDA 3RK2B 1K3HA 4XYDB 1SFCA 4C46A 4WBAA 3L72E 1KYOW 1K9MQ 1KFNA 1KB9H 3CX5I 1BGYD 1NTKE 2KS1A 1FOSE 1JM0A 2G8YA 3WMM0 3AE8C 2CK3H 3G71P 1W5CE 4B86A 1W2LA 4PV1D 4H44C 2WPVB 3RL0g 1C6SA 1LWUB 2M8RA 4UB6H 2B88A 4YXWH 3R4YA 1W2BO 1M1KQ 3F5HA 4WQDA 3WU2E 1VQ8P 4O1WA 4PD4D 1H9YA 4QAOA 1JDLA 1P84E 2HPCB 4FANA 2QJKC 2B89A 5CJ4A 2ZVOB 4N78D 1HZUA 3QH9A 1NU1J 3TK1A 1T3JA 1UIXA 3EQ2A 5CIBB 5E79H 4IFDK 2OYHC 5APWA 3O6QA 1KX7A 1NAYA 3GF7A 3C9IA 2D2CB 2WSCJ 2D0SA 1URQD 1W5CT 3MTUE 3L71G 2I1JA 4IL6E 4WQ8A 1H32A 1NU1E 1M1JB 1SQPD 2OYIA 1CIFA 4HB1A 1PP9G 3AEAC 5AW6B 4EDFA 2JR8A 3CXHD 1GD2E 1NJIQ 1KV4A 3W67A 3H1IJ 1AVOA 1CRYA 3O6QB 1H33A 3RK2C 1S5LX 4WQAA 4AAOA 4M3LA 1HJ0A 3L75G 3CCUP 2E76D 3WU2V 4NPFX 1WEJF 2GUSA 5B5EE 1AQ5A 5GTIH 5E79E 2B10B 4AANA 1JY3N 3DR0A 3H1JD 3T97A 2JWDA 1KQSO 2ZVNB 4I1LA 4K3AA 2LITA 2ZT9D 1S1CX 1YTZI 1DT1A 1LWUC 2KI7B 4C7RA 2H89C 2GC7D 1NOHA 1QL2A 5CYTR 3WUIA 4WQCA 3L73D 3L70G 3H1KJ 3HE4B 1KD1Q 1PGJA 2N9IA 3BCCD 1L9BC 4IL6V 3CCQP 4U7JA 3VNWA 4YTPC 1N8RQ 4L3GA 1NMIA 1BE3G 2Y0DA 4JQ0D 2Z5IA 3MHVA 1NKNA 2M3BA 2XNXA 3CXHW 1RQVA 4UB6V 2P10A 5CIGB 3T97B 3PTZA 2C1DA 1LTJA 2D2CC 1DIPA 5GTIE 3TF5A 1H1OA 1URQA 4I6MC 4IOIH 3H1KE 1A56A 2Q5UA 3HUSA 1GDVA 4QMAA 3CCMP 3A2AA 2M5AB 3LW5J 5B5EV 2FYUG 4HYTB 5AW9B 2P7JA 5E79V 1M1JC 2FY8A 1X0TA 1N7SD 2E75B 1KQFB 1I8PA 2FFDB 3A5TA 1ZN5A 1YBKA 1K05A 1KYOH 4GT1A 3OA7A 1Q81Q 3F89A 1QN2A 1FBMA 3HD7A 1KILA 4IFFA 2ZFCA 1DH3A 4W80A 2NZ2A 3PXWA 1LTJB 5BU5A 3VP8A 2GUVA 1EZVE 1TU3F 5AW7B 1EXIA 5DF5A 2W8ZA 2OQQA 3OA8A 1DEEG 5AVYB 3KQGA 1F1CA 3HUSB 2Y9YA 3EFGA 3JSVC 3V4QA 1XTGB 1KIBA 2B12B 1QVGO 3L72D 1IFJA 5EFWB 1NTMD 1NTKD 1LC1A 1JTHA 2FBWC 1T2KC 2KB7P 3MUDA 1OIPA 1GW4A 3S4RA 1FI3A 1GDTA 1CNOA 4L75A 3CCVP 3VP9A 1L0NG 2H7HA 1FHBA 4LLHA 3FGAD 1PP9J 5GTIV 3HD7B 1KILB 3B5ND 1QLED 1ETPA 3DP5A 2NPSD 3UIAA 2I8FA 3BRVB 4GYDA 3AEFC 3D0WA 3H6PA 1DW3A 3O0RC 2BASA 4DY9A 1RE4A 3VTPC 1PP9E 1MZ4A 1IFDA 3HQ6A 1NHLA 2O1KA 1GL2B 1P84I 5KJ7C 1E29A 2HODB 2J59M 3SFEC 1C75A 5KKZB 1N7SA 2E75C 3L70J 2FYUK 1YNRA 2FFDC 1H31B 3A0HE 3Q3DA 1NU1D 1FI7A 3RGUA 5KTBA 1KB9I 2D0WA 2R3SA 1CYJA 1BE3J 4L76A 2SPZA 1RZ6A 1LTJC 2WTYA 1EC5A 2C0XA 2FRCA 2AXTH 2PCCB 3N7NA 1URQC 2FXOA 1G2CB 3HUSC 1Q86Q 4BWNA 4DCKA 3L70E 4ASVA 2KK7A 1OVVA 5EXQA 1HROA 1CHJA 1KFMA 3RL0B 2QJPB 3MZWB 1VQLP 1CZQA 2FYUJ 4IL6X 1EDJA 1J3SA 1BE3E 3H1HG 1L0NK 2B11B 2C9LY 3H1ID 4WVZA 3HD7C 1KILC 1VQ7P 2CPSA 3B5NA 3CMEP 3MP7B 2NPSA 1VL2A 1YCCA 3M0DC 3M9BA 2KNCB 3SWYA 4TT3H 2FYUE 1G1JA 3A0HV 1VPCA 2Z5HA 2YXQB 2CA4B 351CA 3CWBG 2BCCG 4ZKPA 1SQXK 1SS1A 1ZV8A 2IZ0A 2A45I 5APSA 1NO4A 3EFFK 1GL2C 1KB0A 3L35A 2L5GB 3RN0A 2C8SA 1JUNA 1H0TA 4DOJA 1L0NJ 5CCHD 2LIRA 1AYGA 1RHZB 3MD0A 3FXDA 4NFGB 5KKZC 3GHGB 1C6RA 3KPEA 1GTWA 2M0BA 1WVEC 3AEBC 3V2NA 1LGHB 1N73A 4GEDB 5AW0B 5AVTB 1JO5A 3VOPA 1CSVA 1NAFA 1E79H 1SQQG 3USSA 2XU6A 2PAJA 1L9JC 5KAFH 1SQXJ 1AOQA 1L0NE 1DX7A 1BDDA 2K9JB 1EZVD 2BLFB 3SJLA 1YIJP 1CRJA 1H0TB 2ZBOA 2E74D 1XTCC 1IFNA 1EDKA 4OH8B 2Q9IA 2IZ1A 3RL0C 2QJPC 3FWNA 3VMYA 2O3JA 2YNYA 3HQ9A 2AXTV 2KIKA 2WPQA 1J1EB 1YTZT 1W2EA 2O01N 3PXTA 1L4AD 1SQXE 3AEGC 2QA4P 1YJWP 1VQOP 2VHDA 1KX2A 1H9XA 1HZVA 1WT6A 1GJQA 1USDA 2R5BA 2OTLP 3RK3E 1PL5A 1N9CA 3M91A 5B66H 1FJPA 1GMJA 4DJGA 4H0LD 1AV1A 3TGUG 2KSJA 4XA4A 2C9XB 4AAMA 1IZL0 2PRRA 5KAIE 2BGVX 3CX5D 2LXCB 4ASWA 1FJKA 3H1HJ 4H13D 3MIWA 3GHGC 1HJ4A 2C2CA 4WWIA 3AE1C 1MZ9A 1IFIA 4FAVA 1N15A 4AALA 2HFED 4OGQD 2AEMA 2BH5X 1Q7YQ 5CCGD 2MTAC 3PH2B 4JF7A 1LP1B 2H88C 2YKQA 4GOEA 2XZRA 1R8EA 1Q2NA 2I1KA 2HYNA 3VN0A 2BCCJ 3FXEA 1SQQK 2ZONG 1FU1A 3GLMA 3H1HE 1DD3A 1RQUA 4D6TG 1T3UA 1FZGA 2A06G 5CBOA 3M0AA 1NWQA 2CXBA 3BRTB 4JPZB 1S9KE 3R2PA 1JY3P 3H1LJ 3Q5PA 1T6AA 2WSEH 1J1EC 1A02J 3IF4A 4GODA 4WY4D 1CXAA 1BSHA 1SFCB 5CIFB 3GF3A 1L4AA 1GQ1A 5KAIV 3CX5W 1SQVG 2BCCE 3JCUE 4PJ0E 1I54A 1BCCD 2KS1B 3AECC 2AEFA 5APTA 5DFSA 3NFQA 2JKVA 4KHXA 1HGVA 2FWLA 5AW1B 2ZJSE 1CCRA 4P4QB 1UIIA 1KB9E 1ZP0C 1YI2P 2WSEJ 1IO4A 4WQ9A 1HUCA 1F1FA 1PGPA 2E74B 3PJSK 4R4LA 3U1AA 3ZOYA 2W90A 3H1LE 5BVZA 1HJ3A 1SQBG 2FYUD 1M56D 2L4DA 1M90Q 2JJLA 2V7QH 2R3CA 4UB6E 4UB8H 1B7VA 1M57D 3I5CA 1FZAA 5AW4B 1C6OA 5B66V 1SQQE 1HF9A 4BXLA 3PP5A 3C1LA 4U3FG 4EIDA 1JOCA 3CMAP 4KJMA 5CCGA 1MG2D 1RE3C 3S9OA 3ZOXA 1PPJG 1AOFA 1C2NA 3TSIA 3TYYA 1U57A 3V5BA 1VF5D 2HV4A 1BL9A 1H32B 2N1TD 2MJZA 1WRGA 2GM4A 3SWFA 4I7ZB 3TGUJ 4O1QA 4PJ0V 2OYIB 3NWVA 3NMDA 4RESB 1I55A 2KYVA 1L0ND 5C0ZA 1KQGB 2IBZG 1CI6A 1RAPA 1FZBA 1BGYG 3AE7C 1K8AQ 3O1YA 2WMMA 5TISH 1OVUA 4XXLA 1CYCA 1H33B 4Y99B 4WY4A 1A8CA 1SFCC 1X8YA 1VQMP 3D6ZA 1DD4A 3IAOA 2JDIH 3TGUE 2WSFH 5TJHA 1VQ9P 2QRXA 1SQVK 1SQXD 3NBSA 3ITKA 1JMMA 3L4OA 2ZYDA 5H2FH 2Y0CA 3Q5SA 2POHA 2N3BA 2B87A 4PV1B 1CYIA 3RLMA 2E74C 5KLVG 3V2QA 2YCCA 3KDPB 3VMXA 4D6TJ 3RK3D 2Q1KA 4BRYA 4L1QA 1FDMA 1JY2N 2WSFJ 1LMSA 1SQBK 3C2CA 1BDCA 2BCNB 2IFNA 3DMIA 1VQPP 3CP5A 1JMBA 2JQRA 1JNMA 1OX3A 1AA0A 1HVVA 1WMKA 1SQVJ 1AFOA 3O5CA 2C1DB 1SQPG 3O20A 4D6TE 3H25A 1URQB 3X39A 2WVRA 1HGZA 3WUTA 3G3ZA 5B6QA 4FB1A 5APYA 2L91A 2N1TA 3II6A 5H2FE 3L71J 4KT0J 3H32A 2JTIB 4IFMA 2XTSB 4I7ZC 2OYIC 1GK6A 5IY51 3CYTI 1M70A 1NNOA 1FZCA 1SQVE 3RBXA 2IPPA 3CCJP 1CEDA 3SWKA 4H0JA 1Q90D 2CA3B 155CA 4MN4C 2ZYAA 3NXSA 1U74B 4YPCA 4Y99C 1KYOE 2E76B 2ZZS1 1S9KD 1FDOA 1P84D 3D6YA 1NVOA 3L71E 2YK3A 5AVRB 2LR2A 3I55P 3WFDC 3L75J 3OA8B 3FX0A 1SQBE 1CTYA 2QVAA 1IK9A 3L73G 2OZ1A 2BCCD 4V2KA 3D70A 5TISV 4O9BA 1JTHB 2QEXP 4LC1A 1QEXA 3BCCG 3OCDA 4PV1C 2ZT9B 1OVRA 1KB9D 1DW0A 5KLVK 1DEBA 3H1LD 4U3FE 3NBTA 3L75E 4PD4H 2CE1A 3SXTA 5CIEB 5H2FV 1Y9BA 1LTAC 2Q6QA 2YKPA 3AE3C 4H44D 1CRHA 3JBTB 2W83C 2FYNB 4N0KA 2CPBA 1DVHA 2AXCA 2WT7A 2J5UA 3PXSA 1MG3D 3GG2A 3HTKA 2IBZE 4AQRD 1LTGC 1SQPK 3A0BH 1BGYE 1EB7A 1HWTC 1U75B 3ORVA 5KLVJ 3L36A 1ZOYC 3G9RA
chains in the Genus database with same CATH topology
2D0SA 3PXTA 4MU8A 4FA4A 3M97X 2PCBB 5CIHB 1W5CT 3WFBC 1I6EA 1C52A 2VHDA 1KX2A 4UB8V 4WQ8A 1H32A 3HQ8A 1H9XA 3ZBMA 1HZVA 3RN1A 1GJQA 1SQPD 4Y5RA 1CIFA 1CRCA 1N9CA 2AI5A 1DIIC 1LS9A 4RSZA 1QL4A 4EDFA 1M6ZA 2C1VA 3CXHD 3H1HD 1NIRA 2C9XB 3VYMA 1CCHA 1IZL0 4AAMA 2BGVX 1CRYA 1H33A 4Q5PA 4WQAA 4AAOA 1HJ5A 3CX5D 1GIWA 3WU2V 1WEJF 2JWAA 3TGUD 1FI9A 3HQ7A 1HCMA 2N9YB 1HJ4A 2C2CA 1CHIA 2B10B 4AANA 4FAVA 1N15A 4AALA 3DR0A 3H1JD 2BH4X 1DIQC 1YICA 4KMGA 2BH5X 4FA9A 3CWBD 2MTAC 3H1KD 3PH2B 2LITA 2V08A 2C1UA 3WFEC 1I8OA 1H31A 1DT1A 3PHLA 1IRWA 2GC7D 5DJQB 3A9FA 5CYTR 3WUIA 4WQCA 3L73D 3PLNA 3KZIV 2BPBB 4H0KA 2ZONG 1E8EA 3WC8A 1CTZA 1QL3A 2N9IA 1DW2A 3BCCD 1L9BC 4IL6V 1GU2A 2GIWA 1HH7A 3VNWA 4LJIA 4L3GA 3FWLA 1NMIA 2CXBA 2Y0DA 3TDKA 3CXHW 4UB6V 1YFCA 5CIGB 4D6TD 3PTZA 2C1DA 2N3YA 2OZ1B 1CXAA 1QKSA 5CIFB 3VRDA 1SQQD 3TF5A 1H1OA 1GQ1A 1I6DA 1A2SA 1YEBA 5KAIV 3CX5W 3SLEA 1A56A 1I54A 3OCDB 1BCCD 1CRGA 3SWSA 1GDVA 2V07A 1L0LD 5DFSA 5KLIB 1COTA 1E2RA 1I5TA 3SVWA 2FWLA 1DW1A 5B5EV 1CCRA 4P4QB 5E79V 4WQ9A 1I8PA 1F1FA 1ZZHA 1C2RA 3ZOYA 4WQEA 1HJ3A 1CRIA 2FYUD 1QN2A 2L4DA 1KYOD 4PW9B 1CHHA 2ORLA 4YE1A 3PXWA 3L71D 1B7VA 5DF5A 1C6OA 1GKSA 3OA8A 5B66V 1F1CA 1KIBA 2B12B 3L72D 1NTMD 1PP9D 4WQ7A 1NTKD 4EIDA 1LC1A 1MG2D 2B0ZB 1FI3A 3ZOXA 1CNOA 1HRCA 1AOFA 1C2NA 3KHUA 1CIHA 1FHBA 2PACA 1OAEA 4RJTA 3ZCFA 1CSXA 4EIEA 2HV4A 1BL9A 5DJQC 1H32B 1IQCA 5GTIV 1CXCA 3L75D 4O1QA 4PJ0V 1CORA 3NWVA 3L4MA 1I55A 1ETPA 3DP5A 1L0ND 1CSUA 5C0ZA 2I8FA 3ZOWA 2Q3EA 1RAPA 2N18B 4GYDA 4L3HA 3TYIA 3O1YA 1M60A 2MHMA 2QJYB 4XXLA 1DW3A 3O0RC 1CYCA 1IRVA 2GC4D 1H33B 3L74D 4DY9A 1FCDC 2EXVA 2IBZD 2YIUB 1A8CA 1OCDA 1MZ4A 2Y0EA 2ZXYA 3HQ6A 3L70D 1YIQA 4WQBA 1LC2A 5TJHA 3PRJA 1E29A 1C7MA 3RMZA 1SQXD 3NBSA 5KAFV 3ITKA 3L4OA 1CO6A 2A06D 3MK7B 1YTCA 2Y0CA 1C75A 4FA1A 5KKZB 3VMAA 2N3BA 4J20A 1CYIA 1BE3D 1YNRA 3RLMA 1KV9A 1H31B 1LFMA 1NU1D 2YCCA 1YEAA 1FI7A 1S5LV 4JCGA 2YQBA 1CIGA 4L1QA 451CA 1NMLA 1LMSA 2D0WA 3A0BV 1CYJA 3C2CA 4K3IA 1SQVD 2BCNB 1RZ6A 2QG4A 1S6VB 5KLVD 1CIEA 2FRCA 2N9JA 3DMIA 1NTZD 2PCCB 2B4ZA 3CP5A 1N90A 2JQRA 4FA5A 2QJKB 3CU4A 3O5CA 5CICB 2C1DB 3GW6A 5EXQA 3O20A 1CC5A 4EICA 2CE0A 1HROA 2DVHA 1CHJA 1SQBD 2RMZA 2QJPB 4EIFA 3X39A 5AURA 1J3SA 5B6QA 4FB1A 4PWAA 2L91A 4AX3A 2B11B 2DGEA 3ZOOA 2JTIB 3H1ID 2XTSB 5IY51 3CYTI 1M70A 1NNOA 1YCCA 1CEDA 4H0JA 2N18C 5GTHV 2KNCB 2CA3B 4U3FD 155CA 1K3GA 1PPJD 1U74B 3A0HV 3ZIYA 1RZ5A 2CA4B 351CA 1ZRTD 1RAQA 1CSWA 2ZZS1 1P84D 2YK3A 3WFDC 3OA8B 5C9MA 1CTYA 1KB0A 3WFCC 1VYDA 3RN0A 2C8SA 1K3HA 2OZ1A 4XYDB 2BCCD 4V2KA 2LIRA 1QYZA 5TISV 1AYGA 1KYOW 3MK7C 1BGYD 4NFGB 3OCDA 2KS1A 1C6RA 1KB9D 1WVEC 1FJ0A 1DW0A 4GEDB 1W2LA 3H1LD 3NBTA 1N50A 2RN0A 4A7PA 2GB8B 1C6SA 2ZOOA 1CSVA 2CE1A 1IO3A 3SXTA 5CIEB 5H2FV 1L9JC 4WQDA 1AOQA 4O1WA 4PD4D 1CRHA 1H9YA 3JBTB 1JDLA 4QAOA 1DVVA 4FANA 2K9JB 1EZVD 2BLFB 2FYNB 3SJLA 1CRJA 4N0KA 1DVHA 2ZBOA 1HZUA 5CIDB 3PXSA 1MG3D 3GG2A 1CTJA 5CIBB 2O3JA 3HQ9A 1EB7A 2AXTV 1AKKA 2AIUA 1KX7A 1U75B 1R0QA 3ORVA 1FOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0S A;  3PXT A;  4MU8 A;  4FA4 A;  3M97 X;  2PCB B;  5CIH B;  1W5C T;  3WFB C;  1I6E A;  1C52 A;  2VHD A;  1KX2 A;  4UB8 V;  4WQ8 A;  1H32 A;  3HQ8 A;  1H9X A;  3ZBM A;  1HZV A;  3RN1 A;  1GJQ A;  1SQP D;  4Y5R A;  1CIF A;  1CRC A;  1N9C A;  2AI5 A;  1DII C;  1LS9 A;  4RSZ A;  1QL4 A;  4EDF A;  1M6Z A;  2C1V A;  3CXH D;  3H1H D;  1NIR A;  2C9X B;  3VYM A;  1CCH A;  1IZL 0;  4AAM A;  2BGV X;  1CRY A;  1H33 A;  4Q5P A;  4WQA A;  4AAO A;  1HJ5 A;  3CX5 D;  1GIW A;  3WU2 V;  1WEJ F;  2JWA A;  3TGU D;  1FI9 A;  3HQ7 A;  1HCM A;  2N9Y B;  1HJ4 A;  2C2C A;  1CHI A;  2B10 B;  4AAN A;  4FAV A;  1N15 A;  4AAL A;  3DR0 A;  3H1J D;  2BH4 X;  1DIQ C;  1YIC A;  4KMG A;  2BH5 X;  4FA9 A;  3CWB D;  2MTA C;  3H1K D;  3PH2 B;  2LIT A;  2V08 A;  2C1U A;  3WFE C;  1I8O A;  1H31 A;  1DT1 A;  3PHL A;  1IRW A;  2GC7 D;  5DJQ B;  3A9F A;  5CYT R;  3WUI A;  4WQC A;  3L73 D;  3PLN A;  3KZI V;  2BPB B;  4H0K A;  2ZON G;  1E8E A;  3WC8 A;  1CTZ A;  1QL3 A;  2N9I A;  1DW2 A;  3BCC D;  1L9B C;  4IL6 V;  1GU2 A;  2GIW A;  1HH7 A;  3VNW A;  4LJI A;  4L3G A;  3FWL A;  1NMI A;  2CXB A;  2Y0D A;  3TDK A;  3CXH W;  4UB6 V;  1YFC A;  5CIG B;  4D6T D;  3PTZ A;  2C1D A;  2N3Y A;  2OZ1 B;  1CXA A;  1QKS A;  5CIF B;  3VRD A;  1SQQ D;  3TF5 A;  1H1O A;  1GQ1 A;  1I6D A;  1A2S A;  1YEB A;  5KAI V;  3CX5 W;  3SLE A;  1A56 A;  1I54 A;  3OCD B;  1BCC D;  1CRG A;  3SWS A;  1GDV A;  2V07 A;  1L0L D;  5DFS A;  5KLI B;  1COT A;  1E2R A;  1I5T A;  3SVW A;  2FWL A;  1DW1 A;  5B5E V;  1CCR A;  4P4Q B;  5E79 V;  4WQ9 A;  1I8P A;  1F1F A;  1ZZH A;  1C2R A;  3ZOY A;  4WQE A;  1HJ3 A;  1CRI A;  2FYU D;  1QN2 A;  2L4D A;  1KYO D;  4PW9 B;  1CHH A;  2ORL A;  4YE1 A;  3PXW A;  3L71 D;  1B7V A;  5DF5 A;  1C6O A;  1GKS A;  3OA8 A;  5B66 V;  1F1C A;  1KIB A;  2B12 B;  3L72 D;  1NTM D;  1PP9 D;  4WQ7 A;  1NTK D;  4EID A;  1LC1 A;  1MG2 D;  2B0Z B;  1FI3 A;  3ZOX A;  1CNO A;  1HRC A;  1AOF A;  1C2N A;  3KHU A;  1CIH A;  1FHB A;  2PAC A;  1OAE A;  4RJT A;  3ZCF A;  1CSX A;  4EIE A;  2HV4 A;  1BL9 A;  5DJQ C;  1H32 B;  1IQC A;  5GTI V;  1CXC A;  3L75 D;  4O1Q A;  4PJ0 V;  1COR A;  3NWV A;  3L4M A;  1I55 A;  1ETP A;  3DP5 A;  1L0N D;  1CSU A;  5C0Z A;  2I8F A;  3ZOW A;  2Q3E A;  1RAP A;  2N18 B;  4GYD A;  4L3H A;  3TYI A;  3O1Y A;  1M60 A;  2MHM A;  2QJY B;  4XXL A;  1DW3 A;  3O0R C;  1CYC A;  1IRV A;  2GC4 D;  1H33 B;  3L74 D;  4DY9 A;  1FCD C;  2EXV A;  2IBZ D;  2YIU B;  1A8C A;  1OCD A;  1MZ4 A;  2Y0E A;  2ZXY A;  3HQ6 A;  3L70 D;  1YIQ A;  4WQB A;  1LC2 A;  5TJH A;  3PRJ A;  1E29 A;  1C7M A;  3RMZ A;  1SQX D;  3NBS A;  5KAF V;  3ITK A;  3L4O A;  1CO6 A;  2A06 D;  3MK7 B;  1YTC A;  2Y0C A;  1C75 A;  4FA1 A;  5KKZ B;  3VMA A;  2N3B A;  4J20 A;  1CYI A;  1BE3 D;  1YNR A;  3RLM A;  1KV9 A;  1H31 B;  1LFM A;  1NU1 D;  2YCC A;  1YEA A;  1FI7 A;  1S5L V;  4JCG A;  2YQB A;  1CIG A;  4L1Q A;  451C A;  1NML A;  1LMS A;  2D0W A;  3A0B V;  1CYJ A;  3C2C A;  4K3I A;  1SQV D;  2BCN B;  1RZ6 A;  2QG4 A;  1S6V B;  5KLV D;  1CIE A;  2FRC A;  2N9J A;  3DMI A;  1NTZ D;  2PCC B;  2B4Z A;  3CP5 A;  1N90 A;  2JQR A;  4FA5 A;  2QJK B;  3CU4 A;  3O5C A;  5CIC B;  2C1D B;  3GW6 A;  5EXQ A;  3O20 A;  1CC5 A;  4EIC A;  2CE0 A;  1HRO A;  2DVH A;  1CHJ A;  1SQB D;  2RMZ A;  2QJP B;  4EIF A;  3X39 A;  5AUR A;  1J3S A;  5B6Q A;  4FB1 A;  4PWA A;  2L91 A;  4AX3 A;  2B11 B;  2DGE A;  3ZOO A;  2JTI B;  3H1I D;  2XTS B;  5IY5 1;  3CYT I;  1M70 A;  1NNO A;  1YCC A;  1CED A;  4H0J A;  2N18 C;  5GTH V;  2KNC B;  2CA3 B;  4U3F D;  155C A;  1K3G A;  1PPJ D;  1U74 B;  3A0H V;  3ZIY A;  1RZ5 A;  2CA4 B;  351C A;  1ZRT D;  1RAQ A;  1CSW A;  2ZZS 1;  1P84 D;  2YK3 A;  3WFD C;  3OA8 B;  5C9M A;  1CTY A;  1KB0 A;  3WFC C;  1VYD A;  3RN0 A;  2C8S A;  1K3H A;  2OZ1 A;  4XYD B;  2BCC D;  4V2K A;  2LIR A;  1QYZ A;  5TIS V;  1AYG A;  1KYO W;  3MK7 C;  1BGY D;  4NFG B;  3OCD A;  2KS1 A;  1C6R A;  1KB9 D;  1WVE C;  1FJ0 A;  1DW0 A;  4GED B;  1W2L A;  3H1L D;  3NBT A;  1N50 A;  2RN0 A;  4A7P A;  2GB8 B;  1C6S A;  2ZOO A;  1CSV A;  2CE1 A;  1IO3 A;  3SXT A;  5CIE B;  5H2F V;  1L9J C;  4WQD A;  1AOQ A;  4O1W A;  4PD4 D;  1CRH A;  1H9Y A;  3JBT B;  1JDL A;  4QAO A;  1DVV A;  4FAN A;  2K9J B;  1EZV D;  2BLF B;  2FYN B;  3SJL A;  1CRJ A;  4N0K A;  1DVH A;  2ZBO A;  1HZU A;  5CID B;  3PXS A;  1MG3 D;  3GG2 A;  1CTJ A;  5CIB B;  2O3J A;  3HQ9 A;  1EB7 A;  2AXT V;  1AKK A;  2AIU A;  1KX7 A;  1U75 B;  1R0Q A;  3ORV A;  1FOC A; 
#chains in the Genus database with same CATH topology
 4MU8 A;  4FA4 A;  2ITA A;  1OMI A;  2ZYG A;  1N7S B;  2PCB B;  5CIH B;  1C52 A;  3O8Z A;  1IC2 A;  2HR3 A;  4XE5 B;  2KZJ A;  4Y5R A;  4HJG H;  3CXH H;  1CRC A;  3L72 G;  2AI5 A;  4WB4 A;  1NTM G;  1LS9 A;  3IFM A;  3JC2 2;  5AVW B;  2C1V A;  4N78 E;  2E76 C;  5KLV E;  2NRG A;  1SQP J;  2E43 A;  3VYM A;  1GU4 A;  1OW8 A;  4XFJ A;  1OWA A;  1D7M A;  3Q5R A;  1HJ5 A;  2AXT E;  1GIW A;  1LT9 A;  1FZE A;  3BAS A;  3TGU D;  2M3E A;  1GW3 A;  5AVQ B;  3HQ7 A;  3G6E P;  1KZU B;  1HCM A;  3MUD C;  1QGK B;  1PFI A;  1JEK A;  2ZT9 C;  3RK2 D;  1FZF A;  2OGU A;  1YIC A;  1H89 A;  2ZXX A;  1SP4 A;  5M1B A;  5AW5 B;  2YXR B;  1RF0 A;  3H1K D;  3B5N B;  3WFE C;  1I8O A;  1SQP E;  1H88 A;  2NPS B;  4L74 A;  1KC8 Q;  5DJQ B;  3A9F A;  2QM8 A;  2Y9Z A;  3PLN A;  3CXH E;  2BPB B;  1S72 P;  3P7K A;  2RKL A;  2FYN C;  1KIL E;  4JYC A;  1R5L A;  3B8E B;  3GMA A;  1LT9 B;  1RE4 C;  4LJI A;  4RKU J;  1JCC A;  3FWL A;  3TDK A;  2C9N Y;  1NU1 G;  1L2P A;  2R5D A;  4D6T D;  1L0L G;  1JY3 O;  3P8M C;  2N3Y A;  3CLQ A;  2Z4E A;  1QKS A;  5APQ A;  3VRD A;  3P32 A;  4NPD A;  1YEB A;  2YO3 A;  3SLE A;  1N7S C;  3I56 P;  3SWS A;  2D2C D;  5KLI B;  1JCD A;  4EOT A;  1E2R A;  2N9B A;  3PH0 A;  2RH0 A;  1N73 B;  1EDI A;  2E5T A;  2KSE A;  3AE4 C;  1C2R A;  2QE7 H;  4WQE A;  1MFT A;  2ZAE B;  1FC2 C;  1NTM K;  3M06 A;  5APX A;  1S4X A;  2ZXE B;  4NPE A;  1KYO D;  4PW9 B;  2ORL A;  4YE1 A;  1VDF A;  3HE5 A;  4JBZ A;  3L71 D;  3H1I G;  5KAF E;  5AW3 B;  1IFP A;  1PGQ A;  2OAR A;  2O1J A;  4ZMD A;  5DJU B;  1EDL A;  1SLQ A;  1PP9 D;  4WQ7 A;  2VRS A;  1PV3 A;  1Y47 A;  1KYO I;  5CCH A;  1CW5 A;  5GTH H;  2B0Z B;  1HRC A;  3B4S A;  3B5N C;  1CIH A;  1LNQ A;  4JYB A;  1OAE A;  4RJT A;  2NPS C;  3ZCF A;  4EIE A;  1PIX A;  5DJQ C;  1NTM J;  1IQC A;  3AE5 C;  1QVF O;  1T2K D;  3L75 D;  2XV5 A;  1LWU A;  3AE2 C;  4GDO A;  3L74 G;  1CSU A;  1LT9 C;  2Q3E A;  2N18 B;  4L3H A;  3TYI A;  1M7L A;  4HKZ H;  2HPC A;  3CWB J;  1M60 A;  2QJY B;  4R4M A;  5B66 E;  2KZI A;  1OFC X;  1X79 B;  1KTM A;  2LXB A;  2IBZ D;  1NU1 K;  2YIU B;  1NTM E;  1RF0 C;  1NH4 A;  1L0L K;  1OCD A;  1LJ2 A;  4AUW A;  3L70 D;  1YIQ A;  3A3Y B;  4WQB A;  1LC2 A;  2E5Y A;  3PRJ A;  4IL6 H;  3E1I A;  5KLI C;  1KMI Z;  5KAF V;  1CO6 A;  5APU A;  5GTH E;  3MK7 B;  3L37 A;  1YTC A;  1EZV G;  1N73 C;  3VMA A;  1Q82 Q;  4J20 A;  3SFD C;  1BE3 D;  2IBZ I;  3CWB E;  5KJ7 D;  1KV9 A;  1OXZ A;  1YEA A;  1NTZ G;  1CIG A;  1M1J A;  2WSC H;  1AVY A;  1HH0 A;  2E75 D;  1SQQ J;  2E42 A;  4L73 A;  4K3I A;  2QG4 A;  5KLV D;  3E7K A;  3CD6 P;  5BU8 B;  1CIE A;  1K04 A;  1L0L J;  1N90 A;  5B5E H;  1N86 A;  3KXD A;  1U7M A;  4EI2 A;  2K37 A;  4PD4 I;  4CPG A;  2KLV A;  3CCS P;  5CIC B;  2IX7 C;  3P8C E;  4EIC A;  2CE0 A;  2DVH A;  1L4A B;  1U7J A;  2FKW B;  3LIE A;  2FXM A;  1JY2 P;  3ZOO A;  2A45 H;  5AVX B;  1RY3 A;  1L0L E;  2V7Q J;  2HG5 D;  3ABV C;  1LTB C;  3K5B A;  3U59 A;  4H0L B;  5GTH V;  2N18 C;  4W7Z A;  3HD7 D;  4GKG A;  1KIL D;  3HE4 A;  3W68 A;  1K3G A;  2QJY C;  4C7N A;  2YIU C;  2K9Y A;  5CCH C;  2K3R A;  1N7L A;  3WUU A;  4H13 B;  3CXH I;  3D71 A;  1GK4 A;  1VYD A;  2W6B A;  4UB8 E;  1Y8A A;  2WIT A;  4OGQ B;  3C8V A;  1VQN P;  1QYZ A;  2KUB A;  3MK7 C;  3H1I E;  1GL2 D;  3KZI H;  5KJ7 A;  1N2D C;  2K88 A;  2W27 A;  2M5A A;  3L74 J;  1FJ0 A;  2WPR A;  5AVU B;  3OAK A;  3RBZ A;  1NTZ K;  2FFD A;  1N50 A;  4C7N B;  2RN0 A;  4A7P A;  2GB8 B;  2ZOO A;  2GA1 A;  4RO0 A;  1IO3 A;  1QL1 A;  2KLU A;  1CI6 B;  2KXP B;  1T8Z A;  3IN6 A;  1GU5 A;  2IFM A;  1BCC G;  1DVV A;  2KP8 A;  3LW5 H;  4OWF A;  4YXD C;  1M8O B;  4ZNC A;  1USE A;  5CID B;  3E1R A;  5AW8 B;  4WY4 B;  3L74 E;  3SSU A;  1CTJ A;  2JP3 A;  5TIS E;  1L4A C;  3CPW O;  3NTN A;  3CCL P;  1AKK A;  2AIU A;  1R0Q A;  1R5S A;  1FOC A;  1FOS F;  2MKV A;  3RL0 D;  3B71 A;  1NTZ J;  3V6I A;  3KZI E;  3M97 X;  2R44 A;  4I2L C;  2B87 B;  3WFB C;  1I6E A;  2A06 E;  1HJB A;  4UB8 V;  3HQ8 A;  1K73 Q;  3ZBM A;  1FDI A;  3RN1 A;  4H0L C;  2KOG A;  4BRY B;  2UWJ E;  1S2E A;  1SQB J;  2OTK E;  1DII C;  1JB0 J;  4RSZ A;  3M0D A;  1QL4 A;  1M6Z A;  2LKM A;  3M9H A;  3AED C;  3H1H D;  1GZL A;  1NIR A;  2G3A A;  3CX5 H;  1CCH A;  4H13 C;  1NTZ E;  3H1J G;  1VQ5 P;  4Q5P A;  1ZR2 A;  1RF1 A;  1G1I A;  4OGQ C;  1IJD B;  2JWA A;  4HH2 A;  1FI9 A;  1MUU A;  5CCG C;  2N9Y B;  1FAV A;  1GL2 A;  4U3F J;  1CHI A;  2IYP A;  3N4X A;  1HTL C;  3CC4 P;  2HOD A;  3A0H H;  1VF5 B;  2BH4 X;  3MGN A;  1DIQ C;  4KMG A;  2N1T B;  3BAT A;  3A7O A;  4FA9 A;  2I8D A;  3CWB D;  3AEE C;  2IDB A;  3H32 B;  1A02 F;  2V08 A;  4DZO A;  2C1U A;  2P67 A;  1H31 A;  1MFZ A;  3PHL A;  1J2J B;  2Q7C A;  1IRW A;  1FZC B;  2XKM A;  3KZI V;  1LTT C;  4H0K A;  1E8E A;  3WC8 A;  1CTZ A;  1CSB A;  1QL3 A;  2J58 A;  1BGY J;  1VQ4 P;  1SQX G;  1DW2 A;  1MKM A;  5AW2 B;  1RF1 B;  1VQ6 P;  1GU2 A;  2GIW A;  3WUV A;  1HH7 A;  3VYI A;  1PPJ E;  3CX5 E;  4WY4 C;  2P2U A;  1ZRT E;  1G2C A;  1OW6 A;  3CL3 D;  1YFC A;  3P8C D;  4EIJ A;  2H43 A;  4GOF A;  2OZ1 B;  1KQL A;  1YQ4 C;  1SQQ D;  2PFX A;  1S5L H;  1I6D A;  1A2S A;  1X22 A;  2OTJ P;  1ZXG A;  3OCD B;  2YKO A;  1CRG A;  2XND H;  1NGM B;  2V07 A;  1L0L D;  5DJT B;  1COT A;  1I5T A;  3SVW A;  4K35 A;  3RK3 B;  1DW1 A;  3CCE P;  3V2P A;  3CC7 P;  2FYZ A;  2PP6 A;  1ZW0 A;  1OZH A;  3L4F A;  1BCC J;  5C39 A;  1ZZH A;  2WPS A;  1H8A A;  1CRI A;  3TNU A;  2KNC A;  5AVV B;  1RH5 B;  1NKZ B;  2Q3I A;  1CHH A;  4PD4 E;  1AJY A;  1NTK G;  1LTI C;  1KOR A;  2WT7 B;  2C0W A;  2B9B A;  1GKS A;  3HTK B;  1YYC A;  3OJA B;  1LT1 A;  3OW2 O;  1QX8 A;  1EQ7 A;  3QWO C;  2P58 A;  4DT0 A;  2AEJ A;  5AVS B;  1BCC E;  1VF5 C;  1S5L E;  1J1D B;  2N1T C;  3GHG A;  3KHU A;  4GIF A;  3M9Q A;  3A0B E;  2OYO A;  1HBW A;  3G4S P;  1LTS C;  2PAC A;  1CSX A;  3TNU B;  4TLF A;  2JEE A;  1FZC C;  1YJN P;  1CXC A;  5AVZ B;  2YMY A;  1COR A;  1EXJ A;  3U1C A;  3L4M A;  2YMK A;  1RF1 C;  3ZOW A;  3H1J J;  2O01 H;  4N3Y B;  1YHQ P;  2K9J A;  4ZKU A;  2MHM A;  2FXP A;  2WSS H;  3V4W A;  1IRV A;  2GC4 D;  1KN7 A;  3L74 D;  1FCD C;  2EXV A;  3H1L G;  2Y0E A;  2W6A A;  3L73 J;  2ZXY A;  1FS0 E;  2O01 J;  4N6J A;  1PZQ A;  1C7M A;  3RMZ A;  1BSN A;  1SVF A;  3BCC J;  3KYQ A;  1X9V A;  1SFC D;  1VQK P;  2XDJ A;  5CMZ A;  3RK3 C;  3H1J E;  5K5G B;  2A06 D;  2WWW A;  2QSI A;  4FA1 A;  3ZDM A;  1IK7 A;  1IZN B;  4OVN F;  1IFM A;  2PGD A;  2OYH A;  2DW3 A;  1LFM A;  1YJ9 P;  3S1K A;  1S5L V;  4JCG A;  2K1A A;  2YQB A;  3BVH A;  451C A;  1NML A;  2H8P D;  2V4H A;  3EWK A;  4H44 B;  5KAI H;  3A0B V;  5APV A;  3L73 E;  1FE6 A;  1OW7 A;  3VMZ A;  1SQV D;  1S6V B;  3Q2Y A;  1AQT A;  2N9J A;  1NTZ D;  3BCC E;  2B4Z A;  3V2R A;  4FA5 A;  1NTK K;  1ZLL A;  2QJK B;  3CU4 A;  1Z56 A;  4Y28 J;  1EZV I;  3GW6 A;  1YQ3 C;  1J1D C;  1CC5 A;  1SQB D;  2RMZ A;  2WZ7 A;  2YO2 A;  4EIF A;  5AUR A;  1S3J A;  2OYH B;  1E5W A;  2A45 G;  2P1J A;  1ZR4 A;  4PWA A;  2JO1 A;  4AX3 A;  2HLO A;  2DGE A;  1RE3 A;  5CBN A;  2WQY C;  4LGD E;  1JY2 O;  3HRN A;  1LP1 A;  2BEZ F;  2QM7 A;  1YIT P;  2QIW A;  1PGO A;  5L8R J;  3CCR P;  3CI9 A;  3AE6 C;  3L72 J;  1NTK J;  4AYC A;  4U3F D;  3WU2 H;  3CC2 P;  4Z1M H;  1P84 H;  1PPJ D;  3ZIY A;  2IYO A;  3IR9 A;  1RZ5 A;  2BEQ D;  1NYH A;  3AE9 C;  4W7Y A;  4EYY Q;  1ZRT D;  1RAQ A;  3HE5 B;  3H1K G;  1CSW A;  1ZME C;  5CHX A;  3Q1M A;  3JCU H;  1MV8 A;  5C9M A;  5CJ0 A;  4PJ0 H;  3WFC C;  2R32 A;  2W6J H;  3LID A;  3RK2 B;  1K3H A;  4XYD B;  1SFC A;  4C46 A;  4WBA A;  3L72 E;  1KYO W;  1K9M Q;  1KFN A;  1KB9 H;  3CX5 I;  1BGY D;  1NTK E;  2KS1 A;  1FOS E;  1JM0 A;  2G8Y A;  3WMM 0;  3AE8 C;  2CK3 H;  3G71 P;  1W5C E;  4B86 A;  1W2L A;  4PV1 D;  4H44 C;  2WPV B;  3RL0 g;  1C6S A;  1LWU B;  2M8R A;  4UB6 H;  2B88 A;  4YXW H;  3R4Y A;  1W2B O;  1M1K Q;  3F5H A;  4WQD A;  3WU2 E;  1VQ8 P;  4O1W A;  4PD4 D;  1H9Y A;  4QAO A;  1JDL A;  1P84 E;  2HPC B;  4FAN A;  2QJK C;  2B89 A;  5CJ4 A;  2ZVO B;  4N78 D;  1HZU A;  3QH9 A;  1NU1 J;  3TK1 A;  1T3J A;  1UIX A;  3EQ2 A;  5CIB B;  5E79 H;  4IFD K;  2OYH C;  5APW A;  3O6Q A;  1KX7 A;  1NAY A;  3GF7 A;  3C9I A;  2D2C B;  2WSC J;  2D0S A;  1URQ D;  1W5C T;  3MTU E;  3L71 G;  2I1J A;  4IL6 E;  4WQ8 A;  1H32 A;  1NU1 E;  1M1J B;  1SQP D;  2OYI A;  1CIF A;  4HB1 A;  1PP9 G;  3AEA C;  5AW6 B;  4EDF A;  2JR8 A;  3CXH D;  1GD2 E;  1NJI Q;  1KV4 A;  3W67 A;  3H1I J;  1AVO A;  1CRY A;  3O6Q B;  1H33 A;  3RK2 C;  1S5L X;  4WQA A;  4AAO A;  4M3L A;  1HJ0 A;  3L75 G;  3CCU P;  2E76 D;  3WU2 V;  4NPF X;  1WEJ F;  2GUS A;  5B5E E;  1AQ5 A;  5GTI H;  5E79 E;  2B10 B;  4AAN A;  1JY3 N;  3DR0 A;  3H1J D;  3T97 A;  2JWD A;  1KQS O;  2ZVN B;  4I1L A;  4K3A A;  2LIT A;  2ZT9 D;  1S1C X;  1YTZ I;  1DT1 A;  1LWU C;  2KI7 B;  4C7R A;  2H89 C;  2GC7 D;  1NOH A;  1QL2 A;  5CYT R;  3WUI A;  4WQC A;  3L73 D;  3L70 G;  3H1K J;  3HE4 B;  1KD1 Q;  1PGJ A;  2N9I A;  3BCC D;  1L9B C;  4IL6 V;  3CCQ P;  4U7J A;  3VNW A;  4YTP C;  1N8R Q;  4L3G A;  1NMI A;  1BE3 G;  2Y0D A;  4JQ0 D;  2Z5I A;  3MHV A;  1NKN A;  2M3B A;  2XNX A;  3CXH W;  1RQV A;  4UB6 V;  2P10 A;  5CIG B;  3T97 B;  3PTZ A;  2C1D A;  1LTJ A;  2D2C C;  1DIP A;  5GTI E;  3TF5 A;  1H1O A;  1URQ A;  4I6M C;  4IOI H;  3H1K E;  1A56 A;  2Q5U A;  3HUS A;  1GDV A;  4QMA A;  3CCM P;  3A2A A;  2M5A B;  3LW5 J;  5B5E V;  2FYU G;  4HYT B;  5AW9 B;  2P7J A;  5E79 V;  1M1J C;  2FY8 A;  1X0T A;  1N7S D;  2E75 B;  1KQF B;  1I8P A;  2FFD B;  3A5T A;  1ZN5 A;  1YBK A;  1K05 A;  1KYO H;  4GT1 A;  3OA7 A;  1Q81 Q;  3F89 A;  1QN2 A;  1FBM A;  3HD7 A;  1KIL A;  4IFF A;  2ZFC A;  1DH3 A;  4W80 A;  2NZ2 A;  3PXW A;  1LTJ B;  5BU5 A;  3VP8 A;  2GUV A;  1EZV E;  1TU3 F;  5AW7 B;  1EXI A;  5DF5 A;  2W8Z A;  2OQQ A;  3OA8 A;  1DEE G;  5AVY B;  3KQG A;  1F1C A;  3HUS B;  2Y9Y A;  3EFG A;  3JSV C;  3V4Q A;  1XTG B;  1KIB A;  2B12 B;  1QVG O;  3L72 D;  1IFJ A;  5EFW B;  1NTM D;  1NTK D;  1LC1 A;  1JTH A;  2FBW C;  1T2K C;  2KB7 P;  3MUD A;  1OIP A;  1GW4 A;  3S4R A;  1FI3 A;  1GDT A;  1CNO A;  4L75 A;  3CCV P;  3VP9 A;  1L0N G;  2H7H A;  1FHB A;  4LLH A;  3FGA D;  1PP9 J;  5GTI V;  3HD7 B;  1KIL B;  3B5N D;  1QLE D;  1ETP A;  3DP5 A;  2NPS D;  3UIA A;  2I8F A;  3BRV B;  4GYD A;  3AEF C;  3D0W A;  3H6P A;  1DW3 A;  3O0R C;  2BAS A;  4DY9 A;  1RE4 A;  3VTP C;  1PP9 E;  1MZ4 A;  1IFD A;  3HQ6 A;  1NHL A;  2O1K A;  1GL2 B;  1P84 I;  5KJ7 C;  1E29 A;  2HOD B;  2J59 M;  3SFE C;  1C75 A;  5KKZ B;  1N7S A;  2E75 C;  3L70 J;  2FYU K;  1YNR A;  2FFD C;  1H31 B;  3A0H E;  3Q3D A;  1NU1 D;  1FI7 A;  3RGU A;  5KTB A;  1KB9 I;  2D0W A;  2R3S A;  1CYJ A;  1BE3 J;  4L76 A;  2SPZ A;  1RZ6 A;  1LTJ C;  2WTY A;  1EC5 A;  2C0X A;  2FRC A;  2AXT H;  2PCC B;  3N7N A;  1URQ C;  2FXO A;  1G2C B;  3HUS C;  1Q86 Q;  4BWN A;  4DCK A;  3L70 E;  4ASV A;  2KK7 A;  1OVV A;  5EXQ A;  1HRO A;  1CHJ A;  1KFM A;  3RL0 B;  2QJP B;  3MZW B;  1VQL P;  1CZQ A;  2FYU J;  4IL6 X;  1EDJ A;  1J3S A;  1BE3 E;  3H1H G;  1L0N K;  2B11 B;  2C9L Y;  3H1I D;  4WVZ A;  3HD7 C;  1KIL C;  1VQ7 P;  2CPS A;  3B5N A;  3CME P;  3MP7 B;  2NPS A;  1VL2 A;  1YCC A;  3M0D C;  3M9B A;  2KNC B;  3SWY A;  4TT3 H;  2FYU E;  1G1J A;  3A0H V;  1VPC A;  2Z5H A;  2YXQ B;  2CA4 B;  351C A;  3CWB G;  2BCC G;  4ZKP A;  1SQX K;  1SS1 A;  1ZV8 A;  2IZ0 A;  2A45 I;  5APS A;  1NO4 A;  3EFF K;  1GL2 C;  1KB0 A;  3L35 A;  2L5G B;  3RN0 A;  2C8S A;  1JUN A;  1H0T A;  4DOJ A;  1L0N J;  5CCH D;  2LIR A;  1AYG A;  1RHZ B;  3MD0 A;  3FXD A;  4NFG B;  5KKZ C;  3GHG B;  1C6R A;  3KPE A;  1GTW A;  2M0B A;  1WVE C;  3AEB C;  3V2N A;  1LGH B;  1N73 A;  4GED B;  5AW0 B;  5AVT B;  1JO5 A;  3VOP A;  1CSV A;  1NAF A;  1E79 H;  1SQQ G;  3USS A;  2XU6 A;  2PAJ A;  1L9J C;  5KAF H;  1SQX J;  1AOQ A;  1L0N E;  1DX7 A;  1BDD A;  2K9J B;  1EZV D;  2BLF B;  3SJL A;  1YIJ P;  1CRJ A;  1H0T B;  2ZBO A;  2E74 D;  1XTC C;  1IFN A;  1EDK A;  4OH8 B;  2Q9I A;  2IZ1 A;  3RL0 C;  2QJP C;  3FWN A;  3VMY A;  2O3J A;  2YNY A;  3HQ9 A;  2AXT V;  2KIK A;  2WPQ A;  1J1E B;  1YTZ T;  1W2E A;  2O01 N;  3PXT A;  1L4A D;  1SQX E;  3AEG C;  2QA4 P;  1YJW P;  1VQO P;  2VHD A;  1KX2 A;  1H9X A;  1HZV A;  1WT6 A;  1GJQ A;  1USD A;  2R5B A;  2OTL P;  3RK3 E;  1PL5 A;  1N9C A;  3M91 A;  5B66 H;  1FJP A;  1GMJ A;  4DJG A;  4H0L D;  1AV1 A;  3TGU G;  2KSJ A;  4XA4 A;  2C9X B;  4AAM A;  1IZL 0;  2PRR A;  5KAI E;  2BGV X;  3CX5 D;  2LXC B;  4ASW A;  1FJK A;  3H1H J;  4H13 D;  3MIW A;  3GHG C;  1HJ4 A;  2C2C A;  4WWI A;  3AE1 C;  1MZ9 A;  1IFI A;  4FAV A;  1N15 A;  4AAL A;  2HFE D;  4OGQ D;  2AEM A;  2BH5 X;  1Q7Y Q;  5CCG D;  2MTA C;  3PH2 B;  4JF7 A;  1LP1 B;  2H88 C;  2YKQ A;  4GOE A;  2XZR A;  1R8E A;  1Q2N A;  2I1K A;  2HYN A;  3VN0 A;  2BCC J;  3FXE A;  1SQQ K;  2ZON G;  1FU1 A;  3GLM A;  3H1H E;  1DD3 A;  1RQU A;  4D6T G;  1T3U A;  1FZG A;  2A06 G;  5CBO A;  3M0A A;  1NWQ A;  2CXB A;  3BRT B;  4JPZ B;  1S9K E;  3R2P A;  1JY3 P;  3H1L J;  3Q5P A;  1T6A A;  2WSE H;  1J1E C;  1A02 J;  3IF4 A;  4GOD A;  4WY4 D;  1CXA A;  1BSH A;  1SFC B;  5CIF B;  3GF3 A;  1L4A A;  1GQ1 A;  5KAI V;  3CX5 W;  1SQV G;  2BCC E;  3JCU E;  4PJ0 E;  1I54 A;  1BCC D;  2KS1 B;  3AEC C;  2AEF A;  5APT A;  5DFS A;  3NFQ A;  2JKV A;  4KHX A;  1HGV A;  2FWL A;  5AW1 B;  2ZJS E;  1CCR A;  4P4Q B;  1UII A;  1KB9 E;  1ZP0 C;  1YI2 P;  2WSE J;  1IO4 A;  4WQ9 A;  1HUC A;  1F1F A;  1PGP A;  2E74 B;  3PJS K;  4R4L A;  3U1A A;  3ZOY A;  2W90 A;  3H1L E;  5BVZ A;  1HJ3 A;  1SQB G;  2FYU D;  1M56 D;  2L4D A;  1M90 Q;  2JJL A;  2V7Q H;  2R3C A;  4UB6 E;  4UB8 H;  1B7V A;  1M57 D;  3I5C A;  1FZA A;  5AW4 B;  1C6O A;  5B66 V;  1SQQ E;  1HF9 A;  4BXL A;  3PP5 A;  3C1L A;  4U3F G;  4EID A;  1JOC A;  3CMA P;  4KJM A;  5CCG A;  1MG2 D;  1RE3 C;  3S9O A;  3ZOX A;  1PPJ G;  1AOF A;  1C2N A;  3TSI A;  3TYY A;  1U57 A;  3V5B A;  1VF5 D;  2HV4 A;  1BL9 A;  1H32 B;  2N1T D;  2MJZ A;  1WRG A;  2GM4 A;  3SWF A;  4I7Z B;  3TGU J;  4O1Q A;  4PJ0 V;  2OYI B;  3NWV A;  3NMD A;  4RES B;  1I55 A;  2KYV A;  1L0N D;  5C0Z A;  1KQG B;  2IBZ G;  1CI6 A;  1RAP A;  1FZB A;  1BGY G;  3AE7 C;  1K8A Q;  3O1Y A;  2WMM A;  5TIS H;  1OVU A;  4XXL A;  1CYC A;  1H33 B;  4Y99 B;  4WY4 A;  1A8C A;  1SFC C;  1X8Y A;  1VQM P;  3D6Z A;  1DD4 A;  3IAO A;  2JDI H;  3TGU E;  2WSF H;  5TJH A;  1VQ9 P;  2QRX A;  1SQV K;  1SQX D;  3NBS A;  3ITK A;  1JMM A;  3L4O A;  2ZYD A;  5H2F H;  2Y0C A;  3Q5S A;  2POH A;  2N3B A;  2B87 A;  4PV1 B;  1CYI A;  3RLM A;  2E74 C;  5KLV G;  3V2Q A;  2YCC A;  3KDP B;  3VMX A;  4D6T J;  3RK3 D;  2Q1K A;  4BRY A;  4L1Q A;  1FDM A;  1JY2 N;  2WSF J;  1LMS A;  1SQB K;  3C2C A;  1BDC A;  2BCN B;  2IFN A;  3DMI A;  1VQP P;  3CP5 A;  1JMB A;  2JQR A;  1JNM A;  1OX3 A;  1AA0 A;  1HVV A;  1WMK A;  1SQV J;  1AFO A;  3O5C A;  2C1D B;  1SQP G;  3O20 A;  4D6T E;  3H25 A;  1URQ B;  3X39 A;  2WVR A;  1HGZ A;  3WUT A;  3G3Z A;  5B6Q A;  4FB1 A;  5APY A;  2L91 A;  2N1T A;  3II6 A;  5H2F E;  3L71 J;  4KT0 J;  3H32 A;  2JTI B;  4IFM A;  2XTS B;  4I7Z C;  2OYI C;  1GK6 A;  5IY5 1;  3CYT I;  1M70 A;  1NNO A;  1FZC A;  1SQV E;  3RBX A;  2IPP A;  3CCJ P;  1CED A;  3SWK A;  4H0J A;  1Q90 D;  2CA3 B;  155C A;  4MN4 C;  2ZYA A;  3NXS A;  1U74 B;  4YPC A;  4Y99 C;  1KYO E;  2E76 B;  2ZZS 1;  1S9K D;  1FDO A;  1P84 D;  3D6Y A;  1NVO A;  3L71 E;  2YK3 A;  5AVR B;  2LR2 A;  3I55 P;  3WFD C;  3L75 J;  3OA8 B;  3FX0 A;  1SQB E;  1CTY A;  2QVA A;  1IK9 A;  3L73 G;  2OZ1 A;  2BCC D;  4V2K A;  3D70 A;  5TIS V;  4O9B A;  1JTH B;  2QEX P;  4LC1 A;  1QEX A;  3BCC G;  3OCD A;  4PV1 C;  2ZT9 B;  1OVR A;  1KB9 D;  1DW0 A;  5KLV K;  1DEB A;  3H1L D;  4U3F E;  3NBT A;  3L75 E;  4PD4 H;  2CE1 A;  3SXT A;  5CIE B;  5H2F V;  1Y9B A;  1LTA C;  2Q6Q A;  2YKP A;  3AE3 C;  4H44 D;  1CRH A;  3JBT B;  2W83 C;  2FYN B;  4N0K A;  2CPB A;  1DVH A;  2AXC A;  2WT7 A;  2J5U A;  3PXS A;  1MG3 D;  3GG2 A;  3HTK A;  2IBZ E;  4AQR D;  1LTG C;  1SQP K;  3A0B H;  1BGY E;  1EB7 A;  1HWT C;  1U75 B;  3ORV A;  5KLV J;  3L36 A;  1ZOY C;  3G9R A; 
#chains in the Genus database with same CATH homology
 2D0S A;  3PXT A;  4MU8 A;  4FA4 A;  3M97 X;  2PCB B;  5CIH B;  1W5C T;  3WFB C;  1I6E A;  1C52 A;  2VHD A;  1KX2 A;  4UB8 V;  4WQ8 A;  1H32 A;  3HQ8 A;  1H9X A;  3ZBM A;  1HZV A;  3RN1 A;  1GJQ A;  1SQP D;  4Y5R A;  1CIF A;  1CRC A;  1N9C A;  2AI5 A;  1DII C;  1LS9 A;  4RSZ A;  1QL4 A;  4EDF A;  1M6Z A;  2C1V A;  3CXH D;  3H1H D;  1NIR A;  2C9X B;  3VYM A;  1CCH A;  1IZL 0;  4AAM A;  2BGV X;  1CRY A;  1H33 A;  4Q5P A;  4WQA A;  4AAO A;  1HJ5 A;  3CX5 D;  1GIW A;  3WU2 V;  1WEJ F;  2JWA A;  3TGU D;  1FI9 A;  3HQ7 A;  1HCM A;  2N9Y B;  1HJ4 A;  2C2C A;  1CHI A;  2B10 B;  4AAN A;  4FAV A;  1N15 A;  4AAL A;  3DR0 A;  3H1J D;  2BH4 X;  1DIQ C;  1YIC A;  4KMG A;  2BH5 X;  4FA9 A;  3CWB D;  2MTA C;  3H1K D;  3PH2 B;  2LIT A;  2V08 A;  2C1U A;  3WFE C;  1I8O A;  1H31 A;  1DT1 A;  3PHL A;  1IRW A;  2GC7 D;  5DJQ B;  3A9F A;  5CYT R;  3WUI A;  4WQC A;  3L73 D;  3PLN A;  3KZI V;  2BPB B;  4H0K A;  2ZON G;  1E8E A;  3WC8 A;  1CTZ A;  1QL3 A;  2N9I A;  1DW2 A;  3BCC D;  1L9B C;  4IL6 V;  1GU2 A;  2GIW A;  1HH7 A;  3VNW A;  4LJI A;  4L3G A;  3FWL A;  1NMI A;  2CXB A;  2Y0D A;  3TDK A;  3CXH W;  4UB6 V;  1YFC A;  5CIG B;  4D6T D;  3PTZ A;  2C1D A;  2N3Y A;  2OZ1 B;  1CXA A;  1QKS A;  5CIF B;  3VRD A;  1SQQ D;  3TF5 A;  1H1O A;  1GQ1 A;  1I6D A;  1A2S A;  1YEB A;  5KAI V;  3CX5 W;  3SLE A;  1A56 A;  1I54 A;  3OCD B;  1BCC D;  1CRG A;  3SWS A;  1GDV A;  2V07 A;  1L0L D;  5DFS A;  5KLI B;  1COT A;  1E2R A;  1I5T A;  3SVW A;  2FWL A;  1DW1 A;  5B5E V;  1CCR A;  4P4Q B;  5E79 V;  4WQ9 A;  1I8P A;  1F1F A;  1ZZH A;  1C2R A;  3ZOY A;  4WQE A;  1HJ3 A;  1CRI A;  2FYU D;  1QN2 A;  2L4D A;  1KYO D;  4PW9 B;  1CHH A;  2ORL A;  4YE1 A;  3PXW A;  3L71 D;  1B7V A;  5DF5 A;  1C6O A;  1GKS A;  3OA8 A;  5B66 V;  1F1C A;  1KIB A;  2B12 B;  3L72 D;  1NTM D;  1PP9 D;  4WQ7 A;  1NTK D;  4EID A;  1LC1 A;  1MG2 D;  2B0Z B;  1FI3 A;  3ZOX A;  1CNO A;  1HRC A;  1AOF A;  1C2N A;  3KHU A;  1CIH A;  1FHB A;  2PAC A;  1OAE A;  4RJT A;  3ZCF A;  1CSX A;  4EIE A;  2HV4 A;  1BL9 A;  5DJQ C;  1H32 B;  1IQC A;  5GTI V;  1CXC A;  3L75 D;  4O1Q A;  4PJ0 V;  1COR A;  3NWV A;  3L4M A;  1I55 A;  1ETP A;  3DP5 A;  1L0N D;  1CSU A;  5C0Z A;  2I8F A;  3ZOW A;  2Q3E A;  1RAP A;  2N18 B;  4GYD A;  4L3H A;  3TYI A;  3O1Y A;  1M60 A;  2MHM A;  2QJY B;  4XXL A;  1DW3 A;  3O0R C;  1CYC A;  1IRV A;  2GC4 D;  1H33 B;  3L74 D;  4DY9 A;  1FCD C;  2EXV A;  2IBZ D;  2YIU B;  1A8C A;  1OCD A;  1MZ4 A;  2Y0E A;  2ZXY A;  3HQ6 A;  3L70 D;  1YIQ A;  4WQB A;  1LC2 A;  5TJH A;  3PRJ A;  1E29 A;  1C7M A;  3RMZ A;  1SQX D;  3NBS A;  5KAF V;  3ITK A;  3L4O A;  1CO6 A;  2A06 D;  3MK7 B;  1YTC A;  2Y0C A;  1C75 A;  4FA1 A;  5KKZ B;  3VMA A;  2N3B A;  4J20 A;  1CYI A;  1BE3 D;  1YNR A;  3RLM A;  1KV9 A;  1H31 B;  1LFM A;  1NU1 D;  2YCC A;  1YEA A;  1FI7 A;  1S5L V;  4JCG A;  2YQB A;  1CIG A;  4L1Q A;  451C A;  1NML A;  1LMS A;  2D0W A;  3A0B V;  1CYJ A;  3C2C A;  4K3I A;  1SQV D;  2BCN B;  1RZ6 A;  2QG4 A;  1S6V B;  5KLV D;  1CIE A;  2FRC A;  2N9J A;  3DMI A;  1NTZ D;  2PCC B;  2B4Z A;  3CP5 A;  1N90 A;  2JQR A;  4FA5 A;  2QJK B;  3CU4 A;  3O5C A;  5CIC B;  2C1D B;  3GW6 A;  5EXQ A;  3O20 A;  1CC5 A;  4EIC A;  2CE0 A;  1HRO A;  2DVH A;  1CHJ A;  1SQB D;  2RMZ A;  2QJP B;  4EIF A;  3X39 A;  5AUR A;  1J3S A;  5B6Q A;  4FB1 A;  4PWA A;  2L91 A;  4AX3 A;  2B11 B;  2DGE A;  3ZOO A;  2JTI B;  3H1I D;  2XTS B;  5IY5 1;  3CYT I;  1M70 A;  1NNO A;  1YCC A;  1CED A;  4H0J A;  2N18 C;  5GTH V;  2KNC B;  2CA3 B;  4U3F D;  155C A;  1K3G A;  1PPJ D;  1U74 B;  3A0H V;  3ZIY A;  1RZ5 A;  2CA4 B;  351C A;  1ZRT D;  1RAQ A;  1CSW A;  2ZZS 1;  1P84 D;  2YK3 A;  3WFD C;  3OA8 B;  5C9M A;  1CTY A;  1KB0 A;  3WFC C;  1VYD A;  3RN0 A;  2C8S A;  1K3H A;  2OZ1 A;  4XYD B;  2BCC D;  4V2K A;  2LIR A;  1QYZ A;  5TIS V;  1AYG A;  1KYO W;  3MK7 C;  1BGY D;  4NFG B;  3OCD A;  2KS1 A;  1C6R A;  1KB9 D;  1WVE C;  1FJ0 A;  1DW0 A;  4GED B;  1W2L A;  3H1L D;  3NBT A;  1N50 A;  2RN0 A;  4A7P A;  2GB8 B;  1C6S A;  2ZOO A;  1CSV A;  2CE1 A;  1IO3 A;  3SXT A;  5CIE B;  5H2F V;  1L9J C;  4WQD A;  1AOQ A;  4O1W A;  4PD4 D;  1CRH A;  1H9Y A;  3JBT B;  1JDL A;  4QAO A;  1DVV A;  4FAN A;  2K9J B;  1EZV D;  2BLF B;  2FYN B;  3SJL A;  1CRJ A;  4N0K A;  1DVH A;  2ZBO A;  1HZU A;  5CID B;  3PXS A;  1MG3 D;  3GG2 A;  1CTJ A;  5CIB B;  2O3J A;  3HQ9 A;  1EB7 A;  2AXT V;  1AKK A;  2AIU A;  1KX7 A;  1U75 B;  1R0Q A;  3ORV A;  1FOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...