1SQBD

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqbD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqbD01
1N9CA 1CYIA 1CTYA 2V08A 3NWVA 1L0LD 1LC2A 2C1UA 1HCMA 4WQDA 1IRWA 5DF5A 1CXCA 2JQRA 3WUIA 1C7MA 4Y5RA 4FANA 1A56A 2BCNB 2OZ1B 3CXHD 1KB9D 4EICA 1I6DA 4XXLA 1YIQA 3OA8B 1BL9A 1NMIA 3SWSA 1GQ1A 3ZOXA 2JTIB 4O1QA 1I8PA 5DFSA 1C6SA 1CRHA 4QAOA 2L4DA 1NTKD 4MU8A 5KLVD 2Q3EA 4WQBA 4UB8V 3VMAA 1M70A 2I8FA 2LIRA 2N9JA 1FI3A 1I54A 3CWBD 3O5CA 2FRCA 2RN0A 1DW1A 1CO6A 1KIBA 4PW9B 1GDVA 1KX7A 2V07A 1A8CA 3TGUD 4AALA 1HJ5A 1I5TA 2AI5A 1FI7A 2PCBB 2QJYB 4AX3A 3A0BV 1DW3A 2ZXYA 1K3HA 4N0KA 2C1DA 1GJQA 4O1WA 1CYCA 1W2LA 3X39A 3MK7C 2N3YA 2IBZD 1DW0A 3HQ7A 1C6OA 4Q5PA 3GW6A 1LC1A 2VHDA 3VYMA 3ZCFA 1FI9A 3O20A 1SQQD 1DW2A 4L3HA 3ZBMA 2CA4B 1C6RA 3H1JD 2N18B 1NU1D 2BGVX 1CRJA 1GU2A 1H32B 1CIHA 3ZOWA 1RZ6A 3PLNA 3OCDA 1H32A 2XTSB 3SXTA 1HZUA 2CXBA 1W5CT 1SQVD 3CU4A 1I8OA 3PXWA 3WFDC 4YE1A 3ZOYA 1NIRA 2N9YB 2CA3B 2FYNB 3L74D 2HV4A 4WQCA 4NFGB 3RLMA 4FAVA 4WQ7A 2D0SA 1A2SA 1WVEC 1YFCA 1CYJA 1MZ4A 1CSWA 2B0ZB 5KAIV 1AYGA 5TJHA 1R0QA 2KS1A 2PACA 1CRYA 5CIHB 3NBSA 3TDKA 4L1QA 1N90A 3WFEC 1CHHA 5KLIB 4WQAA 2ZOOA 3GG2A 1C75A 2Y0DA 451CA 5DJQC 1SQBD 5C9MA 2ORLA 3M97X 5B5EV 4P4QB 1EB7A 2BLFB 1DVVA 4IL6V 1YICA 1NTZD 3ORVA 3L70D 5AURA 3HQ8A 5GTHV 2GB8B 1E8EA 1P84D 1CNOA 4H0KA 1YTCA 2GC7D 3DMIA 2YIUB 2B12B 3VRDA 5KAFV 3RN1A 4PWAA 1CHIA 1LS9A 2Y0CA 1CHJA 4K3IA 1CRIA 3L4MA 3DR0A 1S5LV 3CX5W 4AANA 1DVHA 5CIBB 5IY51 1FCDC 1MG2D 4RSZA 3WFCC 155CA 3CP5A 1ETPA 4LJIA 2ZBOA 2C1DB 1L0ND 3HQ9A 1DT1A 4U3FD 2B4ZA 4GYDA 1NTMD 4WQEA 3RN0A 1M6ZA 3L75D 5CYTR 4FB1A 5C0ZA 3ZIYA 1IRVA 1CIFA 1H1OA 2N3BA 1CRCA 1IQCA 3TYIA 1KX2A 4DY9A 3H1ID 3SJLA 1CIGA 2C8SA 3A9FA 3KHUA 4PJ0V 2YQBA 4EIFA 1QKSA 2BCCD 1ZRTD 2FWLA 1GIWA 1I55A 1IZL0 1H9XA 3JBTB 1CCHA 1CTZA 1SQPD 1C2RA 3OCDB 1QYZA 4EIDA 2KNCB 3NBTA 4UB6V 1CRGA 2YCCA 4H0JA 1IO3A 4AAMA 1LMSA 2AXTV 1BE3D 1QL3A 1CSVA 2GC4D 1LFMA 1BCCD 3L73D 2RMZA 4FA4A 4GEDB 2EXVA 1CC5A 1CIEA 3ITKA 3PTZA 1M60A 5CIFB 2K9JB 1YCCA 2YK3A 1YEAA 2C2CA 1CCRA 1PP9D 1PPJD 1S6VB 3CX5D 1RAQA 1B7VA 3SLEA 1F1CA 3BCCD 2FYUD 3A0HV 2D0WA 351CA 2BPBB 4KMGA 2BH5X 3TF5A 4L3GA 4V2KA 3WFBC 2BH4X 1K3GA 1CORA 2ZONG 1KYOD 1SQXD 2MTAC 3PXSA 4FA9A 5B6QA 3H1HD 3VNWA 2QG4A 4D6TD 5TISV 2O3JA 1CTJA 1BGYD 1HH7A 3CYTI 2C9XB 5B66V 3HQ6A 5CIEB 1N15A 2OZ1A 1CSXA 1DIQC 1QN2A 1RZ5A 1VYDA 1JDLA 3H1LD 1EZVD 3OA8A 3FWLA 4J20A 1C52A 4A7PA 2B11B 2MHMA 1FJ0A 1N50A 5E79V 1KYOW 4EIEA 3H1KD 5KKZB 2QJKB 3MK7B 2B10B 3CXHW 5CICB 1WEJF 1NNOA 1HJ4A 3L4OA 3SVWA 1NMLA 4EDFA 2AIUA 1OCDA 5GTIV 3PH2B 1AOQA 4WQ8A 1QL4A 2LITA 2GIWA 1H33B 2Y0EA 1H9YA 1AKKA 1L9BC 1YNRA 3PRJA 1H31B 5CIGB 1HRCA 3RMZA 1H33A 3PHLA 2C1VA 1H31A 1F1FA 3L72D 4XYDB 1MG3D 1E29A 2QJPB 3C2CA 4WQ9A 1HZVA 1FOCA 1U74B 3PXTA 2A06D 3L71D 5EXQA 2PCCB 2JWAA 1L9JC 1KB0A 1DIIC 4RJTA 4PD4D 1YEBA 1HROA 2ZZS1 5CIDB 2N18C 3O1YA 1HJ3A 4AAOA 3O0RC 4FA1A 1CXAA 2L91A 1OAEA 2DGEA 1KV9A 3KZIV 1COTA 2DVHA 3DP5A 1FHBA 5H2FV 2CE1A 1GKSA 1RAPA 1I6EA 1U75B 1E2RA 3WC8A 1J3SA 1ZZHA 4FA5A 4JCGA 3ZOOA 2N9IA 1CEDA 5DJQB 1C2NA 1AOFA 3WU2V 1CSUA 2CE0A
chains in the Genus database with same CATH superfamily
2V08A 1HF9A 1L0LD 2YKQA 3AE1C 2IFNA 2C1UA 1KB9H 1VF5C 1JY2P 3L72J 1IRWA 1CXCA 3WUIA 1C7MA 3H25A 2YKPA 3L71E 2BCNB 1E5WA 1ZXGA 1H89A 2AEFA 5KLIC 2OTLP 3MUDC 1HVVA 1LTJB 3SWSA 1PGQA 1LTJA 3ZOXA 3IFMA 4O1QA 1RF0C 1PGPA 1C6SA 3G71P 4H44B 1NTKD 1KILD 5KLVD 1L0LK 2P2UA 4UB8V 3VMAA 1M70A 1PPJG 1FI3A 1VDFA 3O5CA 3OA7A 2FRCA 4AYCA 1CO6A 4GOFA 3CL3D 1L0LG 4AALA 1CI6A 1HJ5A 4LC1A 2QA4P 2QJYB 3SFEC 4OGQC 3U1AA 3BASA 3VMZA 2KI7B 1L0LJ 4N0KA 2C1DA 1YHQP 2B9BA 1KMIZ 1YTZI 1PGOA 1NTKK 5KLVK 1RY3A 1RE4C 1N86A 1Q86Q 5APVA 3TK1A 1KB9E 1C6OA 2Y9YA 2WWWA 1FI9A 5AVWB 3D6ZA 1DW2A 4N78D 1DD3A 1C6RA 4HKZH 1T2KC 3CD6P 1QVGO 2BGVX 2XNDH 1H32B 3ZOWA 1RZ6A 1WMKA 3FX0A 2K9YA 2WMMA 1H32A 2O1JA 2G8YA 2QJPC 1NAFA 1KQSO 2P7JA 1BDDA 3CU4A 1NAYA 1I8OA 1LWUB 5CHXA 3ZOYA 1NIRA 2P10A 4JBZA 2N9YB 1LWUA 1GDTA 4WQCA 1DD4A 1FZCA 1KFNA 4NFGB 1KILA 1T3UA 1XTCC 1FZFA 1WVEC 4I2LC 4CPGA 1CYJA 1LTBC 1QEXA 1FZEA 2B0ZB 1FE6A 1N7SC 1VQPP 1GL2C 5APUA 5L8RJ 1BSNA 3W68A 4WY4B 3M9HA 1U57A 5CIHB 4PV1C 4WY4A 2I1JA 3WFEC 1CHHA 1GD2E 2CPBA 2ITAA 451CA 1VQNP 4XE5B 2ORLA 3M97X 2YO3A 1OMIA 1S2EA 3AEFC 5AURA 3HQ8A 4ZKPA 2E76B 1E8EA 4H0KA 2Q7CA 3DMIA 3VRDA 3RN1A 1VQ6P 1CHIA 1ZMEC 4OWFA 2Q9IA 1LTJC 4IL6H 3EFFK 1LTGC 1CHJA 2C0WA 1JUNA 3L4MA 4BRYA 4DJGA 4LLHA 1DVHA 5CIBB 5IY51 2QM7A 4RSZA 1ETPA 2FFDB 4H44C 1L0ND 5BVZA 1W2EA 4GYDA 2KUBA 2FFDA 2AEJA 3V4QA 4FB1A 2WPRA 1KQLA 1S5LH 1R5LA 2C0XA 5DJUB 3SJLA 2O01H 1ZP0C 1J1DB 3KHUA 3UIAA 3M0AA 3BCCE 2IZ0A 4PJ0V 3IN6A 1A02J 2L5GB 2QJYC 4C7RA 2JKVA 2KOGA 1ZRTD 2FWLA 3P8MC 3CCJP 1KYOE 3G3ZA 2WT7B 1SQPD 1C2RA 3R2PA 3P32A 3CWBG 1L0NK 1OVUA 3B8EB 4UB6V 4Y28J 3CWBJ 1CRGA 2XZRA 4H0JA 2ZT9B 3LW5J 2M5AB 5AVZB 3NTNA 3GF7A 2M5AA 2W8ZA 2AXTV 1FDIA 1QL3A 5GTHE 1JB0J 3P8CE 1LFMA 1BCCD 3CCLP 1NU1K 2IBZG 4GEDB 2V7QJ 1CC5A 3AE4C 1SQPK 3Q3DA 3BVHA 1S9KD 2ZYDA 5AW4B 3PTZA 1J1EC 1S5LE 1PP9D 3CX5D 1RAQA 1NU1G 2OTKE 1SQPG 3RK3D 1G1JA 1EXJA 1NHLA 4L3GA 1NU1J 4KJMA 1H8AA 2BH4X 1SQPJ 1MFTA 2JO1A 2GUVA 2WSEJ 3H1HD 3SWFA 4WY4C 4ZNCA 1IK7A 1L4AB 2QG4A 4WBAA 2O3JA 5TISV 3A0HH 2FXMA 3L74G 1VQ5P 1YQ3C 3VOPA 1R8EA 3HQ6A 4C7NB 2OZ1A 1VQOP 1VYDA 3L74J 4C7NA 4ZKUA 1N2DC 3M91A 3S4RA 1BE3E 2NPSB 1N73B 2CPSA 2NPSA 1N50A 3JSVC 1PP9G 1N73A 1KYOW 1M1JB 3T97B 3I56P 3VP8A 3V6IA 5KKZB 1KD1Q 5CBNA 3T97A 1T6AA 2GA1A 2B10B 1PP9J 5CICB 1JY3P 1OW7A 4EDFA 3RL0B 1NTZG 1HJBA 1AOQA 2LITA 1H33B 3JCUH 1H9YA 2N1TD 1SQXE 3V4WA 1NTZJ 1YNRA 3RBXA 3RMZA 1H33A 3CCUP 2DW3A 3CXHI 2ZYAA 3HTKA 1E29A 3C2CA 1BGYE 4PD4H 4BXLA 3PXTA 1T3JA 3L71D 5EXQA 1YJNP 1S3JA 1FDOA 4RJTA 3KYQA 2ZYGA 4U3FG 3O1YA 1JY3O 3L36A 1FAVA 2L91A 1OAEA 1LTAC 1Y9BA 3WUUA 1ZLLA 4U3FJ 4UB6H 3F5HA 2DVHA 3CWBE 1QVFO 4ASVA 3TSIA 2E75B 1U75B 3A2AA 3HE5B 3WC8A 1ZZHA 2BEZF 3HE5A 3KZIH 5DJQB 5H2FH 5KJ7D 1AOFA 1FU1A 1IFMA 1N9CA 3ZDMA 5DJTB 3CCVP 1LC2A 2HR3A 3FGAD 5E79E 3HD7B 3CXHH 4IFDK 1HCMA 2PGDA 2IBZE 2JQRA 3HD7A 3CC2P 2A06E 3WU2H 1HWTC 1SP4A 1SQQE 1KB9D 1Q90D 4XXLA 5CCGD 2N1TA 1GK4A 4PD4E 1ZOYC 3A0BE 3O6QB 1NMIA 3O6QA 2JTIB 2WSFJ 1I8PA 1USDA 1IFDA 5TISH 2L4DA 1L4AC 3K5BA 1M90Q 3AEEC 2I8FA 5AVTB 3V5BA 2N9JA 3C8VA 1T8ZA 3MD0A 1I54A 2P1JA 2Z4EA 1KTMA 3AE2C 1KIBA 4L76A 5C39A 2JR8A 2V07A 1SLQA 1A8CA 3M9BA 1N73C 2D2CD 2YXRB 3CCEP 2ZXYA 1K3HA 1JO5A 1H88A 4JPZB 1M1JC 1GJQA 4O1WA 5KKZC 4GT1A 1M57D 1CYCA 1W2LA 1OIPA 4TLFA 4EI2A 1NJIQ 3NFQA 1DW0A 3HQ7A 1KB9I 3H1LG 3VYMA 3RL0C 3O20A 3USSA 1VQLP 2NZ2A 2KZIA 1EDLA 3H1JD 3H1LJ 3WU2E 3SSUA 1NTZE 1JCCA 1CRJA 3B5NB 1KQFB 3EFGA 4OVNF 4EIJA 5KAIE 4H0LD 3H1KG 1P84E 2QE7H 3B5NA 2POHA 2OYIC 3SXTA 3AE7C 1W5CT 3H1KJ 4N3YB 1WRGA 4YE1A 1NO4A 3A5TA 3TGUE 5B5EE 3A3YB 3HE4B 3MZWB 4HB1A 4WQ7A 3HE4A 4U3FE 1LNQA 3FXEA 3L75E 2WZ7A 5KAFE 3C9IA 1KFMA 2H43A 3NBSA 2Q3IA 3H1JG 1OW6A 3S9OA 4W7ZA 4WQAA 3GG2A 1C75A 2WPQA 2CK3H 5DJQC 4YPCA 3Q5PA 1G2CB 3H1JJ 2O1KA 2IX7C 2R3CA 1G2CA 2KIKA 1DVVA 4IL6V 3HD7C 2UWJE 2ZVOB 3M06A 1FBMA 5GTHV 5CJ0A 3CMEP 1MZ9A 4OH8B 3B4SA 1SQVE 2YIUB 1LTTC 3G9RA 4PWAA 5APWA 3H32B 2Y0CA 3E1RA 1JMMA 4ZMDA 4K3IA 1JY2O 3DR0A 1S5LV 3CX5W 3H32A 1CI6B 1VQ7P 1FCDC 1MG2D 1M7LA 3AEDC 2C1DB 3HQ9A 3G4SP 4WQEA 3RN0A 1BSHA 5CYTR 5C0ZA 3C1LA 2N3BA 3TYIA 1IQCA 1EQ7A 1KX2A 2ZXXA 1GW3A 3H1ID 1EXIA 5APQA 1SFCD 4R4LA 3A9FA 2FYUE 1X8YA 4IFFA 4EIFA 1QKSA 1GTWA 1SQBE 2BCCD 5CCHD 2R5DA 2R5BA 1I55A 1NTKG 2WSCJ 1KYOI 5KLVG 4IL6X 3L70E 1S4XA 3U59A 1NTKJ 1IO4A 4D6TE 3GLMA 4EIDA 5KLVJ 1JEKA 2KLVA 2VRSA 4WB4A 5APSA 4AQRD 1VQ8P 4GODA 3H1LE 1EZVE 1FZCB 1JM0A 1M56D 1KILB 3B5NC 1Y8AA 5AVRB 1GW4A 1BE3D 1TU3F 1E79H 1NTME 2WVRA 1CSVA 1RQUA 3L73D 2P58A 4L74A 2EXVA 2FBWC 2YKOA 1CIEA 1JY2N 5CIFB 4Y99B 1Q82Q 2OTJP 2YK3A 1CCRA 1HH0A 3KPEA 1YTZT 3OJAB 5AVSB 2YMKA 2LKMA 1KYOH 1FZAA 2A45I 3A0HV 2Q5UA 2O01J 2BPBB 1FOSE 2WSSH 1K3GA 2YXQB 1RE3A 1SQXD 3L72E 5B6QA 3JC22 2E74D 4B86A 2IDBA 1CTJA 1BGYD 1GZLA 5CCHA 1PL5A 1NWQA 1CSXA 4BRYB 4AUWA 4WWIA 1VQMP 5GTIE 1QN2A 1RZ5A 3OA8A 2OYHA 1KC8Q 1AA0A 5GTHH 4A7PA 1S72P 2JJLA 5M1BA 2Z5IA 1FJ0A 2YIUC 1ZR4A 2QEXP 5E79V 3MGNA 1SQXK 2C9NY 1VQKP 5CJ4A 1K73Q 3MK7B 1PPJE 3LIDA 2IFMA 2A45H 1AVYA 1HJ4A 3SVWA 3V2NA 2KP8A 2O01N 1Y47A 4C46A 3PH2B 1L0LE 3W67A 1AKKA 2C1VA 2GUSA 1OFCX 1MG3D 4QMAA 1HZVA 2JP3A 1FOCA 4JF7A 2A06D 5CBOA 1EDJA 2FXPA 1URQD 1L9JC 2W6JH 1K9MQ 1M8OB 4PD4D 1L0NG 2IPPA 1HROA 4IFMA 3GHGB 2AEMA 1HJ3A 4AAOA 1WT6A 4LGDE 3GHGA 1NTKE 1KILE 5KLVE 3GF3A 2DGEA 2P67A 1L0NJ 5AW0B 2QRXA 3KZIV 1X79B 5AVYB 1AJYA 5H2FV 3CCSP 1LWUC 2WITA 1FZCC 3AEBC 3RL0g 3M9QA 1J3SA 1KILC 2MJZA 4GDOA 4JCGA 1Z56A 3Q5RA 1G1IA 1DX7A 3WU2V 3NWVA 4UB8E 4L73A 3RK2D 4H13D 4WQDA 2KB7P 3CI9A 2IBZI 1VQ4P 5DF5A 1NOHA 4Y99C 3VYIA 2Q1KA 4FANA 3L4FA 2OZ1B 3CXHD 1KN7A 4N78E 3I55P 1YIQA 4PD4I 2E5TA 1QLED 1PIXA 1BCCG 5K5GB 5DFSA 1CRHA 2PP6A 4QAOA 1U7MA 1HJ0A 2BASA 2E76C 3LW5H 2WPSA 4WQBA 1BCCJ 5KTBA 2LIRA 1YYCA 2RN0A 3PH0A 1DW1A 3N7NA 2XV5A 1YBKA 3TGUD 2V7QH 1VF5D 1I5TA 2AI5A 1HUCA 1PGJA 2FFDC 5E79H 3H1HG 1DEBA 1A02F 3CCQP 1CW5A 1D7MA 2R44A 3X39A 3H1HJ 4MN4C 1OW8A 1ZW0A 3HTKB 3MK7C 2BEQD 3RK3B 2N3YA 2W83C 2RKLA 2QVAA 1HGVA 1J1DC 2PRRA 3A0BH 3GW6A 4Z1MH 1LC1A 1NH4A 4YTPC 3ZBMA 1GU5A 2CA4B 2AXCA 2J59M 2N18B 1KORA 3CMAP 1GU2A 1CIHA 1P84I 1YJWP 1K04A 5AVQB 1LT9A 3IAOA 2PFXA 2KSEA 1IFIA 2M0BA 3PLNA 3OCDA 1SS1A 2XTSB 2CXBA 1SQVD 2KYVA 3PXWA 3IF4A 3WFDC 4OGQD 2ZT9C 3MIWA 2C9LY 2HV4A 3GHGC 4FAVA 3BRVB 1UIXA 2D0SA 1IK9A 4KT0J 2NRGA 1KZUB 5AW3B 3CCMP 1MZ4A 1CSWA 2QM8A 4KHXA 1AYGA 2KS1B 3L71G 1KQGB 1NYHA 1T2KD 2KS1A 2PACA 1JOCA 2B89A 1RQVA 3TDKA 1N90A 3L71J 3PJSK 2N1TB 5KLIB 2Y0DA 1N8RQ 3AE3C 1L2PA 5KAIH 1SQBD 2H89C 1NU1E 1P84H 2HFED 4P4QB 1SQPE 1EB7A 1YICA 3ORVA 3BRTB 2GM4A 3L70D 4XA4A 1YITP 1YIJP 2JWDA 3VN0A 1BDCA 1CNOA 2GC7D 2B12B 2LR2A 5B5EH 3E1IA 5APTA 3L74E 4HYTB 1JY3N 1N7SD 1GL2D 155CA 1SVFA 2NPSC 2J58A 4LJIA 5KAFH 3B71A 4PV1D 3SFDC 3V2QA 2B4ZA 1NTMD 3V2RA 3G6EP 3ZIYA 3H6PA 1H1OA 3AE9C 4GOEA 3QWOC 1PP9E 3CX5E 2C8SA 2K3RA 1IC2A 5KJ7A 2AXTE 3F89A 3E7KA 2FKWB 4DZOA 3CPWO 2IYPA 2W6AA 1AQ5A 1DEEG 3JBTB 3N4XA 1CCHA 4W7YA 4NPFX 1VQ9P 1CSBA 3AE6C 3CLQA 1CTZA 5EFWB 1X9VA 1QYZA 1NTMK 2XNXA 1QL2A 1H0TA 5CCGA 2WTYA 1UIIA 2LXBA 4H44D 1LTSC 2WSFH 1VPCA 2WQYC 1IO3A 1EZVI 3HRNA 2MKVA 4AAMA 3L37A 2B87B 1LP1A 2B87A 2RMZA 2YNYA 2R3SA 4FA4A 2W6BA 1EDKA 2FY8A 2E75C 4I6MC 1X0TA 1OXZA 2K9JB 3WUVA 2D2CB 3VTPC 2C2CA 1FS0E 1PPJD 2OYOA 2K9JA 3SLEA 2M8RA 1F1CA 3BCCD 2D0WA 4KMGA 1PV3A 3TF5A 2FXOA 3WFBC 2H8PD 1KYOD 2M3BA 3OAKA 3M0DA 3BATA 3VNWA 2I1KA 2SPZA 3CYTI 2N1TC 3L35A 2XDJA 5CIEB 1DIQC 4H0LB 1JDLA 1C52A 1KV4A 1OX3A 2KLUA 3R4YA 1W5CE 2JDIH 5AW1B 2HODB 1FC2C 5B66H 4WVZA 3EQ2A 2HODA 2Z5HA 3P8CD 2QJKB 3BCCG 1USEA 5AW5B 2J5UA 3CXHW 1MV8A 1WEJF 1NNOA 4ASWA 3L4OA 3BCCJ 3S1KA 3V2PA 4WY4D 2AIUA 4WQ8A 1QL4A 3CC4P 1L9BC 1H31B 5CIGB 1IFPA 1OVRA 1H31A 1F1FA 2QIWA 2I8DA 5KJ7C 4IOIH 5GTIH 4DT0A 1Q7YQ 2PCCB 2E76D 4U7JA 4GIFA 1QX8A 2V4HA 1DIIC 1YEBA 1S5LX 2ZZS1 1N7LA 4JYBA 5CMZA 3O0RC 4FA1A 1FJKA 5CCGC 3D6YA 1IZNB 3H1IG 1FHBA 3FWNA 3H1KE 1GKSA 1PFIA 5B66E 3VMYA 3H1IJ 1FOSF 2BCCG 1J1EB 2A45G 3QH9A 4FA5A 4DOJA 2BCCJ 1CEDA 1C2NA 2CE0A 1CYIA 1CTYA 1SFCB 2M3EA 1M1KQ 1RHZB 1XTGB 1SFCA 3AEAC 2K37A 2D2CC 4Y5RA 4BWNA 2WSCH 3VP9A 1A56A 4EICA 1I6DA 2E42A 3EWKA 1LTIC 3ABVC 1BE3G 3H1JE 3OA8B 3AEGC 1BL9A 2OYHB 1GQ1A 3Q5SA 1RF1B 3L73G 3M0DC 2IYOA 1BE3J 5AVVB 2ZT9D 4K35A 2E43A 3MTUE 1RF1A 4MU8A 2Q3EA 3Q1MA 3L73J 1R5SA 4YXDC 1CZQA 3CWBD 1JMBA 5APYA 4H0LC 2KK7A 4PW9B 1GDVA 1KX7A 4RESB 1QGKB 1FI7A 1SQXG 2PCBB 4UB8H 4AX3A 3A0BV 4I7ZB 1DW3A 1IFNA 4O9BA 2N9BA 1BGYG 2R32A 1SQXJ 3NMDA 2QJKC 1ZN5A 3AE5C 5AVXB 2IBZD 1BGYJ 3AECC 1AFOA 5AW9B 4Q5PA 2YMYA 2VHDA 2HLOA 3ZCFA 1L4AD 1SQQD 4L3HA 1NGMB 2E74B 1NU1D 4NPDA 1Q2NA 3HUSB 2WT7A 3KDPB 2OQQA 3KXDA 2KXPB 3HUSA 3I5CA 1HZUA 2IZ1A 2NPSD 4YXWH 4XFJA 2CA3B 5BU8B 2FYNB 3L74D 3U1CA 4IL6E 3RLMA 1SQQK 2B88A 1A2SA 1YFCA 1X22A 1DIPA 2YO2A 3RL0D 5KAIV 3D70A 5TJHA 3H1IE 2A06G 1SQQG 1W2BO 3OW2O 1R0QA 1CRYA 4L1QA 3A7OA 1OWAA 2BCCE 1SQQJ 4RO0A 2ZOOA 5C9MA 3FXDA 1RE3C 5B5EV 1SFCC 3TNUB 2BLFB 1NTZD 2RH0A 3TNUA 1URQB 1EDIA 4W80A 2GB8B 1P84D 1FZGA 5CCHC 1YTCA 1L4AA 4GKGA 1URQA 4EOTA 5KAFV 1LS9A 2HG5D 5BU5A 4AANA 1HTLC 1CRIA 5APXA 2OYHC 5AW6B 1RF1C 2ZFCA 1Q81Q 3MP7B 2E75D 3WFCC 3CP5A 2ZBOA 2LXCB 3L73E 3KQGA 1DT1A 2Q6QA 4U3FD 1K05A 2KZJA 1M6ZA 3L75D 1NTZK 1IRVA 1CIFA 1CRCA 1M1JA 3RGUA 4DY9A 3CX5I 3Q2YA 4K3AA 1CIGA 1YJ9P 1YQ4C 3HD7D 1ZV8A 2YQBA 1K8AQ 4NPEA 2G3AA 3RK2B 4H13B 1GIWA 2XU6A 4I7ZC 1IZL0 2WSEH 1H9XA 4M3LA 1PZQA 5AW8B 1LT9B 3OCDB 2QSIA 4L75A 4PJ0H 2OYIB 1FZBA 1S1CX 2K1AA 2KNCB 3NBTA 1IFJA 2OYIA 2FYZA 2KNCA 1NKNA 3TGUG 2YCCA 3A0HE 3SWKA 3AE8C 1JNMA 1NKZB 2E74C 3WMM0 3L75G 3TGUJ 5AVUB 1LMSA 1LGHB 3HUSC 5AW2B 1L0NE 2KSJA 3L75J 2GC4D 1J2JB 3TYYA 3D71A 3II6A 1FJPA 3CX5H 3D0WA 3PP5A 1ZR2A 1VF5B 3ITKA 2AXTH 4JQ0D 1M60A 2FYNC 1YCCA 1YEAA 2E5YA 1S6VB 1SQVK 1B7VA 3SWYA 1MKMA 2FYUD 1ZRTE 351CA 3WUTA 2BH5X 1VL2A 3MUDA 4V2KA 3VMXA 1HBWA 2W27A 1SQVG 1CORA 2ZONG 2HYNA 4HJGH 2MTAC 3PXSA 2XKMA 4FA9A 1RF0A 3JCUE 1U7JA 2ZXEB 3P7KA 1DH3A 3B5ND 4D6TD 2ZJSE 1SQVJ 2W90A 1MUUA 1HH7A 4I1LA 2C9XB 5B66V 4PJ0E 1N15A 1EC5A 1MFZA 3CC7P 1GU4A 1OVVA 3H1LD 1EZVD 3FWLA 4J20A 2FYUK 2B11B 4EYYQ 1URQC 4OGQB 2H88C 1HGZA 1SQBK 1BCCE 4N6JA 2MHMA 2OGUA 1AV1A 2ZAEB 1S9KE 1IJDB 4EIEA 3H1KD 1LJ2A 4UB6E 2FYUG 2PAJA 2HPCB 3LIEA 2OARA 5AW7B 1SQBG 2ZVNB 2Y9ZA 4JYCA 2HPCA 1GK6A 1RE4A 2FYUJ 1NMLA 3CCRP 3RK3E 1QL1A 1OCDA 5GTIV 3L70G 1SQBJ 3KZIE 4D6TG 2GIWA 2Y0EA 2K88A 3PRJA 5H2FE 1HRCA 3L70J 3H1HE 3PHLA 1JCDA 3L72D 4XYDB 1LT1A 3RK3C 4RKUJ 4D6TJ 1H0TB 1NVOA 2QJPB 1RH5B 3CXHE 4WQ9A 1EZVG 4R4MA 1AQTA 1U74B 4DCKA 2JWAA 1YI2P 1KB0A 3IR9A 4H13C 3RK2C 4TT3H 5CIDB 1GMJA 1NTMG 2N18C 3GMAA 1LT9C 1LP1B 1CXAA 1KV9A 3MHVA 3NXSA 1NTMJ 3RBZA 1COTA 3DP5A 1OZHA 1AVOA 5TISE 2CE1A 1JTHB 1RAPA 1I6EA 1N7SB 1GL2B 1JTHA 1E2RA 2JEEA 1N7SA 1GL2A 4PV1B 2WPVB 2H7HA 3ZOOA 2N9IA 4HH2A 3L72G 1CSUA 1FDMA 3O8ZA
chains in the Genus database with same CATH topology
1N9CA 1CYIA 1CTYA 2V08A 3NWVA 1L0LD 1LC2A 2C1UA 1HCMA 4WQDA 1IRWA 5DF5A 1CXCA 2JQRA 3WUIA 1C7MA 4Y5RA 4FANA 1A56A 2BCNB 2OZ1B 3CXHD 1KB9D 4EICA 1I6DA 4XXLA 1YIQA 3OA8B 1BL9A 1NMIA 3SWSA 1GQ1A 3ZOXA 2JTIB 4O1QA 1I8PA 5DFSA 1C6SA 1CRHA 4QAOA 2L4DA 1NTKD 4MU8A 5KLVD 2Q3EA 4WQBA 4UB8V 3VMAA 1M70A 2I8FA 2LIRA 2N9JA 1FI3A 1I54A 3CWBD 3O5CA 2FRCA 2RN0A 1DW1A 1CO6A 1KIBA 4PW9B 1GDVA 1KX7A 2V07A 1A8CA 3TGUD 4AALA 1HJ5A 1I5TA 2AI5A 1FI7A 2PCBB 2QJYB 4AX3A 3A0BV 1DW3A 2ZXYA 1K3HA 4N0KA 2C1DA 1GJQA 4O1WA 1CYCA 1W2LA 3X39A 3MK7C 2N3YA 2IBZD 1DW0A 3HQ7A 1C6OA 4Q5PA 3GW6A 1LC1A 2VHDA 3VYMA 3ZCFA 1FI9A 3O20A 1SQQD 1DW2A 4L3HA 3ZBMA 2CA4B 1C6RA 3H1JD 2N18B 1NU1D 2BGVX 1CRJA 1GU2A 1H32B 1CIHA 3ZOWA 1RZ6A 3PLNA 3OCDA 1H32A 2XTSB 3SXTA 1HZUA 2CXBA 1W5CT 1SQVD 3CU4A 1I8OA 3PXWA 3WFDC 4YE1A 3ZOYA 1NIRA 2N9YB 2CA3B 2FYNB 3L74D 2HV4A 4WQCA 4NFGB 3RLMA 4FAVA 4WQ7A 2D0SA 1A2SA 1WVEC 1YFCA 1CYJA 1MZ4A 1CSWA 2B0ZB 5KAIV 1AYGA 5TJHA 1R0QA 2KS1A 2PACA 1CRYA 5CIHB 3NBSA 3TDKA 4L1QA 1N90A 3WFEC 1CHHA 5KLIB 4WQAA 2ZOOA 3GG2A 1C75A 2Y0DA 451CA 5DJQC 1SQBD 5C9MA 2ORLA 3M97X 5B5EV 4P4QB 1EB7A 2BLFB 1DVVA 4IL6V 1YICA 1NTZD 3ORVA 3L70D 5AURA 3HQ8A 5GTHV 2GB8B 1E8EA 1P84D 1CNOA 4H0KA 1YTCA 2GC7D 3DMIA 2YIUB 2B12B 3VRDA 5KAFV 3RN1A 4PWAA 1CHIA 1LS9A 2Y0CA 1CHJA 4K3IA 1CRIA 3L4MA 3DR0A 1S5LV 3CX5W 4AANA 1DVHA 5CIBB 5IY51 1FCDC 1MG2D 4RSZA 3WFCC 155CA 3CP5A 1ETPA 4LJIA 2ZBOA 2C1DB 1L0ND 3HQ9A 1DT1A 4U3FD 2B4ZA 4GYDA 1NTMD 4WQEA 3RN0A 1M6ZA 3L75D 5CYTR 4FB1A 5C0ZA 3ZIYA 1IRVA 1CIFA 1H1OA 2N3BA 1CRCA 1IQCA 3TYIA 1KX2A 4DY9A 3H1ID 3SJLA 1CIGA 2C8SA 3A9FA 3KHUA 4PJ0V 2YQBA 4EIFA 1QKSA 2BCCD 1ZRTD 2FWLA 1GIWA 1I55A 1IZL0 1H9XA 3JBTB 1CCHA 1CTZA 1SQPD 1C2RA 3OCDB 1QYZA 4EIDA 2KNCB 3NBTA 4UB6V 1CRGA 2YCCA 4H0JA 1IO3A 4AAMA 1LMSA 2AXTV 1BE3D 1QL3A 1CSVA 2GC4D 1LFMA 1BCCD 3L73D 2RMZA 4FA4A 4GEDB 2EXVA 1CC5A 1CIEA 3ITKA 3PTZA 1M60A 5CIFB 2K9JB 1YCCA 2YK3A 1YEAA 2C2CA 1CCRA 1PP9D 1PPJD 1S6VB 3CX5D 1RAQA 1B7VA 3SLEA 1F1CA 3BCCD 2FYUD 3A0HV 2D0WA 351CA 2BPBB 4KMGA 2BH5X 3TF5A 4L3GA 4V2KA 3WFBC 2BH4X 1K3GA 1CORA 2ZONG 1KYOD 1SQXD 2MTAC 3PXSA 4FA9A 5B6QA 3H1HD 3VNWA 2QG4A 4D6TD 5TISV 2O3JA 1CTJA 1BGYD 1HH7A 3CYTI 2C9XB 5B66V 3HQ6A 5CIEB 1N15A 2OZ1A 1CSXA 1DIQC 1QN2A 1RZ5A 1VYDA 1JDLA 3H1LD 1EZVD 3OA8A 3FWLA 4J20A 1C52A 4A7PA 2B11B 2MHMA 1FJ0A 1N50A 5E79V 1KYOW 4EIEA 3H1KD 5KKZB 2QJKB 3MK7B 2B10B 3CXHW 5CICB 1WEJF 1NNOA 1HJ4A 3L4OA 3SVWA 1NMLA 4EDFA 2AIUA 1OCDA 5GTIV 3PH2B 1AOQA 4WQ8A 1QL4A 2LITA 2GIWA 1H33B 2Y0EA 1H9YA 1AKKA 1L9BC 1YNRA 3PRJA 1H31B 5CIGB 1HRCA 3RMZA 1H33A 3PHLA 2C1VA 1H31A 1F1FA 3L72D 4XYDB 1MG3D 1E29A 2QJPB 3C2CA 4WQ9A 1HZVA 1FOCA 1U74B 3PXTA 2A06D 3L71D 5EXQA 2PCCB 2JWAA 1L9JC 1KB0A 1DIIC 4RJTA 4PD4D 1YEBA 1HROA 2ZZS1 5CIDB 2N18C 3O1YA 1HJ3A 4AAOA 3O0RC 4FA1A 1CXAA 2L91A 1OAEA 2DGEA 1KV9A 3KZIV 1COTA 2DVHA 3DP5A 1FHBA 5H2FV 2CE1A 1GKSA 1RAPA 1I6EA 1U75B 1E2RA 3WC8A 1J3SA 1ZZHA 4FA5A 4JCGA 3ZOOA 2N9IA 1CEDA 5DJQB 1C2NA 1AOFA 3WU2V 1CSUA 2CE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9C A;  1CYI A;  1CTY A;  2V08 A;  3NWV A;  1L0L D;  1LC2 A;  2C1U A;  1HCM A;  4WQD A;  1IRW A;  5DF5 A;  1CXC A;  2JQR A;  3WUI A;  1C7M A;  4Y5R A;  4FAN A;  1A56 A;  2BCN B;  2OZ1 B;  3CXH D;  1KB9 D;  4EIC A;  1I6D A;  4XXL A;  1YIQ A;  3OA8 B;  1BL9 A;  1NMI A;  3SWS A;  1GQ1 A;  3ZOX A;  2JTI B;  4O1Q A;  1I8P A;  5DFS A;  1C6S A;  1CRH A;  4QAO A;  2L4D A;  1NTK D;  4MU8 A;  5KLV D;  2Q3E A;  4WQB A;  4UB8 V;  3VMA A;  1M70 A;  2I8F A;  2LIR A;  2N9J A;  1FI3 A;  1I54 A;  3CWB D;  3O5C A;  2FRC A;  2RN0 A;  1DW1 A;  1CO6 A;  1KIB A;  4PW9 B;  1GDV A;  1KX7 A;  2V07 A;  1A8C A;  3TGU D;  4AAL A;  1HJ5 A;  1I5T A;  2AI5 A;  1FI7 A;  2PCB B;  2QJY B;  4AX3 A;  3A0B V;  1DW3 A;  2ZXY A;  1K3H A;  4N0K A;  2C1D A;  1GJQ A;  4O1W A;  1CYC A;  1W2L A;  3X39 A;  3MK7 C;  2N3Y A;  2IBZ D;  1DW0 A;  3HQ7 A;  1C6O A;  4Q5P A;  3GW6 A;  1LC1 A;  2VHD A;  3VYM A;  3ZCF A;  1FI9 A;  3O20 A;  1SQQ D;  1DW2 A;  4L3H A;  3ZBM A;  2CA4 B;  1C6R A;  3H1J D;  2N18 B;  1NU1 D;  2BGV X;  1CRJ A;  1GU2 A;  1H32 B;  1CIH A;  3ZOW A;  1RZ6 A;  3PLN A;  3OCD A;  1H32 A;  2XTS B;  3SXT A;  1HZU A;  2CXB A;  1W5C T;  1SQV D;  3CU4 A;  1I8O A;  3PXW A;  3WFD C;  4YE1 A;  3ZOY A;  1NIR A;  2N9Y B;  2CA3 B;  2FYN B;  3L74 D;  2HV4 A;  4WQC A;  4NFG B;  3RLM A;  4FAV A;  4WQ7 A;  2D0S A;  1A2S A;  1WVE C;  1YFC A;  1CYJ A;  1MZ4 A;  1CSW A;  2B0Z B;  5KAI V;  1AYG A;  5TJH A;  1R0Q A;  2KS1 A;  2PAC A;  1CRY A;  5CIH B;  3NBS A;  3TDK A;  4L1Q A;  1N90 A;  3WFE C;  1CHH A;  5KLI B;  4WQA A;  2ZOO A;  3GG2 A;  1C75 A;  2Y0D A;  451C A;  5DJQ C;  1SQB D;  5C9M A;  2ORL A;  3M97 X;  5B5E V;  4P4Q B;  1EB7 A;  2BLF B;  1DVV A;  4IL6 V;  1YIC A;  1NTZ D;  3ORV A;  3L70 D;  5AUR A;  3HQ8 A;  5GTH V;  2GB8 B;  1E8E A;  1P84 D;  1CNO A;  4H0K A;  1YTC A;  2GC7 D;  3DMI A;  2YIU B;  2B12 B;  3VRD A;  5KAF V;  3RN1 A;  4PWA A;  1CHI A;  1LS9 A;  2Y0C A;  1CHJ A;  4K3I A;  1CRI A;  3L4M A;  3DR0 A;  1S5L V;  3CX5 W;  4AAN A;  1DVH A;  5CIB B;  5IY5 1;  1FCD C;  1MG2 D;  4RSZ A;  3WFC C;  155C A;  3CP5 A;  1ETP A;  4LJI A;  2ZBO A;  2C1D B;  1L0N D;  3HQ9 A;  1DT1 A;  4U3F D;  2B4Z A;  4GYD A;  1NTM D;  4WQE A;  3RN0 A;  1M6Z A;  3L75 D;  5CYT R;  4FB1 A;  5C0Z A;  3ZIY A;  1IRV A;  1CIF A;  1H1O A;  2N3B A;  1CRC A;  1IQC A;  3TYI A;  1KX2 A;  4DY9 A;  3H1I D;  3SJL A;  1CIG A;  2C8S A;  3A9F A;  3KHU A;  4PJ0 V;  2YQB A;  4EIF A;  1QKS A;  2BCC D;  1ZRT D;  2FWL A;  1GIW A;  1I55 A;  1IZL 0;  1H9X A;  3JBT B;  1CCH A;  1CTZ A;  1SQP D;  1C2R A;  3OCD B;  1QYZ A;  4EID A;  2KNC B;  3NBT A;  4UB6 V;  1CRG A;  2YCC A;  4H0J A;  1IO3 A;  4AAM A;  1LMS A;  2AXT V;  1BE3 D;  1QL3 A;  1CSV A;  2GC4 D;  1LFM A;  1BCC D;  3L73 D;  2RMZ A;  4FA4 A;  4GED B;  2EXV A;  1CC5 A;  1CIE A;  3ITK A;  3PTZ A;  1M60 A;  5CIF B;  2K9J B;  1YCC A;  2YK3 A;  1YEA A;  2C2C A;  1CCR A;  1PP9 D;  1PPJ D;  1S6V B;  3CX5 D;  1RAQ A;  1B7V A;  3SLE A;  1F1C A;  3BCC D;  2FYU D;  3A0H V;  2D0W A;  351C A;  2BPB B;  4KMG A;  2BH5 X;  3TF5 A;  4L3G A;  4V2K A;  3WFB C;  2BH4 X;  1K3G A;  1COR A;  2ZON G;  1KYO D;  1SQX D;  2MTA C;  3PXS A;  4FA9 A;  5B6Q A;  3H1H D;  3VNW A;  2QG4 A;  4D6T D;  5TIS V;  2O3J A;  1CTJ A;  1BGY D;  1HH7 A;  3CYT I;  2C9X B;  5B66 V;  3HQ6 A;  5CIE B;  1N15 A;  2OZ1 A;  1CSX A;  1DIQ C;  1QN2 A;  1RZ5 A;  1VYD A;  1JDL A;  3H1L D;  1EZV D;  3OA8 A;  3FWL A;  4J20 A;  1C52 A;  4A7P A;  2B11 B;  2MHM A;  1FJ0 A;  1N50 A;  5E79 V;  1KYO W;  4EIE A;  3H1K D;  5KKZ B;  2QJK B;  3MK7 B;  2B10 B;  3CXH W;  5CIC B;  1WEJ F;  1NNO A;  1HJ4 A;  3L4O A;  3SVW A;  1NML A;  4EDF A;  2AIU A;  1OCD A;  5GTI V;  3PH2 B;  1AOQ A;  4WQ8 A;  1QL4 A;  2LIT A;  2GIW A;  1H33 B;  2Y0E A;  1H9Y A;  1AKK A;  1L9B C;  1YNR A;  3PRJ A;  1H31 B;  5CIG B;  1HRC A;  3RMZ A;  1H33 A;  3PHL A;  2C1V A;  1H31 A;  1F1F A;  3L72 D;  4XYD B;  1MG3 D;  1E29 A;  2QJP B;  3C2C A;  4WQ9 A;  1HZV A;  1FOC A;  1U74 B;  3PXT A;  2A06 D;  3L71 D;  5EXQ A;  2PCC B;  2JWA A;  1L9J C;  1KB0 A;  1DII C;  4RJT A;  4PD4 D;  1YEB A;  1HRO A;  2ZZS 1;  5CID B;  2N18 C;  3O1Y A;  1HJ3 A;  4AAO A;  3O0R C;  4FA1 A;  1CXA A;  2L91 A;  1OAE A;  2DGE A;  1KV9 A;  3KZI V;  1COT A;  2DVH A;  3DP5 A;  1FHB A;  5H2F V;  2CE1 A;  1GKS A;  1RAP A;  1I6E A;  1U75 B;  1E2R A;  3WC8 A;  1J3S A;  1ZZH A;  4FA5 A;  4JCG A;  3ZOO A;  2N9I A;  1CED A;  5DJQ B;  1C2N A;  1AOF A;  3WU2 V;  1CSU A;  2CE0 A; 
#chains in the Genus database with same CATH topology
 2V08 A;  1HF9 A;  1L0L D;  2YKQ A;  3AE1 C;  2IFN A;  2C1U A;  1KB9 H;  1VF5 C;  1JY2 P;  3L72 J;  1IRW A;  1CXC A;  3WUI A;  1C7M A;  3H25 A;  2YKP A;  3L71 E;  2BCN B;  1E5W A;  1ZXG A;  1H89 A;  2AEF A;  5KLI C;  2OTL P;  3MUD C;  1HVV A;  1LTJ B;  3SWS A;  1PGQ A;  1LTJ A;  3ZOX A;  3IFM A;  4O1Q A;  1RF0 C;  1PGP A;  1C6S A;  3G71 P;  4H44 B;  1NTK D;  1KIL D;  5KLV D;  1L0L K;  2P2U A;  4UB8 V;  3VMA A;  1M70 A;  1PPJ G;  1FI3 A;  1VDF A;  3O5C A;  3OA7 A;  2FRC A;  4AYC A;  1CO6 A;  4GOF A;  3CL3 D;  1L0L G;  4AAL A;  1CI6 A;  1HJ5 A;  4LC1 A;  2QA4 P;  2QJY B;  3SFE C;  4OGQ C;  3U1A A;  3BAS A;  3VMZ A;  2KI7 B;  1L0L J;  4N0K A;  2C1D A;  1YHQ P;  2B9B A;  1KMI Z;  1YTZ I;  1PGO A;  1NTK K;  5KLV K;  1RY3 A;  1RE4 C;  1N86 A;  1Q86 Q;  5APV A;  3TK1 A;  1KB9 E;  1C6O A;  2Y9Y A;  2WWW A;  1FI9 A;  5AVW B;  3D6Z A;  1DW2 A;  4N78 D;  1DD3 A;  1C6R A;  4HKZ H;  1T2K C;  3CD6 P;  1QVG O;  2BGV X;  2XND H;  1H32 B;  3ZOW A;  1RZ6 A;  1WMK A;  3FX0 A;  2K9Y A;  2WMM A;  1H32 A;  2O1J A;  2G8Y A;  2QJP C;  1NAF A;  1KQS O;  2P7J A;  1BDD A;  3CU4 A;  1NAY A;  1I8O A;  1LWU B;  5CHX A;  3ZOY A;  1NIR A;  2P10 A;  4JBZ A;  2N9Y B;  1LWU A;  1GDT A;  4WQC A;  1DD4 A;  1FZC A;  1KFN A;  4NFG B;  1KIL A;  1T3U A;  1XTC C;  1FZF A;  1WVE C;  4I2L C;  4CPG A;  1CYJ A;  1LTB C;  1QEX A;  1FZE A;  2B0Z B;  1FE6 A;  1N7S C;  1VQP P;  1GL2 C;  5APU A;  5L8R J;  1BSN A;  3W68 A;  4WY4 B;  3M9H A;  1U57 A;  5CIH B;  4PV1 C;  4WY4 A;  2I1J A;  3WFE C;  1CHH A;  1GD2 E;  2CPB A;  2ITA A;  451C A;  1VQN P;  4XE5 B;  2ORL A;  3M97 X;  2YO3 A;  1OMI A;  1S2E A;  3AEF C;  5AUR A;  3HQ8 A;  4ZKP A;  2E76 B;  1E8E A;  4H0K A;  2Q7C A;  3DMI A;  3VRD A;  3RN1 A;  1VQ6 P;  1CHI A;  1ZME C;  4OWF A;  2Q9I A;  1LTJ C;  4IL6 H;  3EFF K;  1LTG C;  1CHJ A;  2C0W A;  1JUN A;  3L4M A;  4BRY A;  4DJG A;  4LLH A;  1DVH A;  5CIB B;  5IY5 1;  2QM7 A;  4RSZ A;  1ETP A;  2FFD B;  4H44 C;  1L0N D;  5BVZ A;  1W2E A;  4GYD A;  2KUB A;  2FFD A;  2AEJ A;  3V4Q A;  4FB1 A;  2WPR A;  1KQL A;  1S5L H;  1R5L A;  2C0X A;  5DJU B;  3SJL A;  2O01 H;  1ZP0 C;  1J1D B;  3KHU A;  3UIA A;  3M0A A;  3BCC E;  2IZ0 A;  4PJ0 V;  3IN6 A;  1A02 J;  2L5G B;  2QJY C;  4C7R A;  2JKV A;  2KOG A;  1ZRT D;  2FWL A;  3P8M C;  3CCJ P;  1KYO E;  3G3Z A;  2WT7 B;  1SQP D;  1C2R A;  3R2P A;  3P32 A;  3CWB G;  1L0N K;  1OVU A;  3B8E B;  4UB6 V;  4Y28 J;  3CWB J;  1CRG A;  2XZR A;  4H0J A;  2ZT9 B;  3LW5 J;  2M5A B;  5AVZ B;  3NTN A;  3GF7 A;  2M5A A;  2W8Z A;  2AXT V;  1FDI A;  1QL3 A;  5GTH E;  1JB0 J;  3P8C E;  1LFM A;  1BCC D;  3CCL P;  1NU1 K;  2IBZ G;  4GED B;  2V7Q J;  1CC5 A;  3AE4 C;  1SQP K;  3Q3D A;  3BVH A;  1S9K D;  2ZYD A;  5AW4 B;  3PTZ A;  1J1E C;  1S5L E;  1PP9 D;  3CX5 D;  1RAQ A;  1NU1 G;  2OTK E;  1SQP G;  3RK3 D;  1G1J A;  1EXJ A;  1NHL A;  4L3G A;  1NU1 J;  4KJM A;  1H8A A;  2BH4 X;  1SQP J;  1MFT A;  2JO1 A;  2GUV A;  2WSE J;  3H1H D;  3SWF A;  4WY4 C;  4ZNC A;  1IK7 A;  1L4A B;  2QG4 A;  4WBA A;  2O3J A;  5TIS V;  3A0H H;  2FXM A;  3L74 G;  1VQ5 P;  1YQ3 C;  3VOP A;  1R8E A;  3HQ6 A;  4C7N B;  2OZ1 A;  1VQO P;  1VYD A;  3L74 J;  4C7N A;  4ZKU A;  1N2D C;  3M91 A;  3S4R A;  1BE3 E;  2NPS B;  1N73 B;  2CPS A;  2NPS A;  1N50 A;  3JSV C;  1PP9 G;  1N73 A;  1KYO W;  1M1J B;  3T97 B;  3I56 P;  3VP8 A;  3V6I A;  5KKZ B;  1KD1 Q;  5CBN A;  3T97 A;  1T6A A;  2GA1 A;  2B10 B;  1PP9 J;  5CIC B;  1JY3 P;  1OW7 A;  4EDF A;  3RL0 B;  1NTZ G;  1HJB A;  1AOQ A;  2LIT A;  1H33 B;  3JCU H;  1H9Y A;  2N1T D;  1SQX E;  3V4W A;  1NTZ J;  1YNR A;  3RBX A;  3RMZ A;  1H33 A;  3CCU P;  2DW3 A;  3CXH I;  2ZYA A;  3HTK A;  1E29 A;  3C2C A;  1BGY E;  4PD4 H;  4BXL A;  3PXT A;  1T3J A;  3L71 D;  5EXQ A;  1YJN P;  1S3J A;  1FDO A;  4RJT A;  3KYQ A;  2ZYG A;  4U3F G;  3O1Y A;  1JY3 O;  3L36 A;  1FAV A;  2L91 A;  1OAE A;  1LTA C;  1Y9B A;  3WUU A;  1ZLL A;  4U3F J;  4UB6 H;  3F5H A;  2DVH A;  3CWB E;  1QVF O;  4ASV A;  3TSI A;  2E75 B;  1U75 B;  3A2A A;  3HE5 B;  3WC8 A;  1ZZH A;  2BEZ F;  3HE5 A;  3KZI H;  5DJQ B;  5H2F H;  5KJ7 D;  1AOF A;  1FU1 A;  1IFM A;  1N9C A;  3ZDM A;  5DJT B;  3CCV P;  1LC2 A;  2HR3 A;  3FGA D;  5E79 E;  3HD7 B;  3CXH H;  4IFD K;  1HCM A;  2PGD A;  2IBZ E;  2JQR A;  3HD7 A;  3CC2 P;  2A06 E;  3WU2 H;  1HWT C;  1SP4 A;  1SQQ E;  1KB9 D;  1Q90 D;  4XXL A;  5CCG D;  2N1T A;  1GK4 A;  4PD4 E;  1ZOY C;  3A0B E;  3O6Q B;  1NMI A;  3O6Q A;  2JTI B;  2WSF J;  1I8P A;  1USD A;  1IFD A;  5TIS H;  2L4D A;  1L4A C;  3K5B A;  1M90 Q;  3AEE C;  2I8F A;  5AVT B;  3V5B A;  2N9J A;  3C8V A;  1T8Z A;  3MD0 A;  1I54 A;  2P1J A;  2Z4E A;  1KTM A;  3AE2 C;  1KIB A;  4L76 A;  5C39 A;  2JR8 A;  2V07 A;  1SLQ A;  1A8C A;  3M9B A;  1N73 C;  2D2C D;  2YXR B;  3CCE P;  2ZXY A;  1K3H A;  1JO5 A;  1H88 A;  4JPZ B;  1M1J C;  1GJQ A;  4O1W A;  5KKZ C;  4GT1 A;  1M57 D;  1CYC A;  1W2L A;  1OIP A;  4TLF A;  4EI2 A;  1NJI Q;  3NFQ A;  1DW0 A;  3HQ7 A;  1KB9 I;  3H1L G;  3VYM A;  3RL0 C;  3O20 A;  3USS A;  1VQL P;  2NZ2 A;  2KZI A;  1EDL A;  3H1J D;  3H1L J;  3WU2 E;  3SSU A;  1NTZ E;  1JCC A;  1CRJ A;  3B5N B;  1KQF B;  3EFG A;  4OVN F;  4EIJ A;  5KAI E;  4H0L D;  3H1K G;  1P84 E;  2QE7 H;  3B5N A;  2POH A;  2OYI C;  3SXT A;  3AE7 C;  1W5C T;  3H1K J;  4N3Y B;  1WRG A;  4YE1 A;  1NO4 A;  3A5T A;  3TGU E;  5B5E E;  3A3Y B;  3HE4 B;  3MZW B;  4HB1 A;  4WQ7 A;  3HE4 A;  4U3F E;  1LNQ A;  3FXE A;  3L75 E;  2WZ7 A;  5KAF E;  3C9I A;  1KFM A;  2H43 A;  3NBS A;  2Q3I A;  3H1J G;  1OW6 A;  3S9O A;  4W7Z A;  4WQA A;  3GG2 A;  1C75 A;  2WPQ A;  2CK3 H;  5DJQ C;  4YPC A;  3Q5P A;  1G2C B;  3H1J J;  2O1K A;  2IX7 C;  2R3C A;  1G2C A;  2KIK A;  1DVV A;  4IL6 V;  3HD7 C;  2UWJ E;  2ZVO B;  3M06 A;  1FBM A;  5GTH V;  5CJ0 A;  3CME P;  1MZ9 A;  4OH8 B;  3B4S A;  1SQV E;  2YIU B;  1LTT C;  3G9R A;  4PWA A;  5APW A;  3H32 B;  2Y0C A;  3E1R A;  1JMM A;  4ZMD A;  4K3I A;  1JY2 O;  3DR0 A;  1S5L V;  3CX5 W;  3H32 A;  1CI6 B;  1VQ7 P;  1FCD C;  1MG2 D;  1M7L A;  3AED C;  2C1D B;  3HQ9 A;  3G4S P;  4WQE A;  3RN0 A;  1BSH A;  5CYT R;  5C0Z A;  3C1L A;  2N3B A;  3TYI A;  1IQC A;  1EQ7 A;  1KX2 A;  2ZXX A;  1GW3 A;  3H1I D;  1EXI A;  5APQ A;  1SFC D;  4R4L A;  3A9F A;  2FYU E;  1X8Y A;  4IFF A;  4EIF A;  1QKS A;  1GTW A;  1SQB E;  2BCC D;  5CCH D;  2R5D A;  2R5B A;  1I55 A;  1NTK G;  2WSC J;  1KYO I;  5KLV G;  4IL6 X;  3L70 E;  1S4X A;  3U59 A;  1NTK J;  1IO4 A;  4D6T E;  3GLM A;  4EID A;  5KLV J;  1JEK A;  2KLV A;  2VRS A;  4WB4 A;  5APS A;  4AQR D;  1VQ8 P;  4GOD A;  3H1L E;  1EZV E;  1FZC B;  1JM0 A;  1M56 D;  1KIL B;  3B5N C;  1Y8A A;  5AVR B;  1GW4 A;  1BE3 D;  1TU3 F;  1E79 H;  1NTM E;  2WVR A;  1CSV A;  1RQU A;  3L73 D;  2P58 A;  4L74 A;  2EXV A;  2FBW C;  2YKO A;  1CIE A;  1JY2 N;  5CIF B;  4Y99 B;  1Q82 Q;  2OTJ P;  2YK3 A;  1CCR A;  1HH0 A;  3KPE A;  1YTZ T;  3OJA B;  5AVS B;  2YMK A;  2LKM A;  1KYO H;  1FZA A;  2A45 I;  3A0H V;  2Q5U A;  2O01 J;  2BPB B;  1FOS E;  2WSS H;  1K3G A;  2YXQ B;  1RE3 A;  1SQX D;  3L72 E;  5B6Q A;  3JC2 2;  2E74 D;  4B86 A;  2IDB A;  1CTJ A;  1BGY D;  1GZL A;  5CCH A;  1PL5 A;  1NWQ A;  1CSX A;  4BRY B;  4AUW A;  4WWI A;  1VQM P;  5GTI E;  1QN2 A;  1RZ5 A;  3OA8 A;  2OYH A;  1KC8 Q;  1AA0 A;  5GTH H;  4A7P A;  1S72 P;  2JJL A;  5M1B A;  2Z5I A;  1FJ0 A;  2YIU C;  1ZR4 A;  2QEX P;  5E79 V;  3MGN A;  1SQX K;  2C9N Y;  1VQK P;  5CJ4 A;  1K73 Q;  3MK7 B;  1PPJ E;  3LID A;  2IFM A;  2A45 H;  1AVY A;  1HJ4 A;  3SVW A;  3V2N A;  2KP8 A;  2O01 N;  1Y47 A;  4C46 A;  3PH2 B;  1L0L E;  3W67 A;  1AKK A;  2C1V A;  2GUS A;  1OFC X;  1MG3 D;  4QMA A;  1HZV A;  2JP3 A;  1FOC A;  4JF7 A;  2A06 D;  5CBO A;  1EDJ A;  2FXP A;  1URQ D;  1L9J C;  2W6J H;  1K9M Q;  1M8O B;  4PD4 D;  1L0N G;  2IPP A;  1HRO A;  4IFM A;  3GHG B;  2AEM A;  1HJ3 A;  4AAO A;  1WT6 A;  4LGD E;  3GHG A;  1NTK E;  1KIL E;  5KLV E;  3GF3 A;  2DGE A;  2P67 A;  1L0N J;  5AW0 B;  2QRX A;  3KZI V;  1X79 B;  5AVY B;  1AJY A;  5H2F V;  3CCS P;  1LWU C;  2WIT A;  1FZC C;  3AEB C;  3RL0 g;  3M9Q A;  1J3S A;  1KIL C;  2MJZ A;  4GDO A;  4JCG A;  1Z56 A;  3Q5R A;  1G1I A;  1DX7 A;  3WU2 V;  3NWV A;  4UB8 E;  4L73 A;  3RK2 D;  4H13 D;  4WQD A;  2KB7 P;  3CI9 A;  2IBZ I;  1VQ4 P;  5DF5 A;  1NOH A;  4Y99 C;  3VYI A;  2Q1K A;  4FAN A;  3L4F A;  2OZ1 B;  3CXH D;  1KN7 A;  4N78 E;  3I55 P;  1YIQ A;  4PD4 I;  2E5T A;  1QLE D;  1PIX A;  1BCC G;  5K5G B;  5DFS A;  1CRH A;  2PP6 A;  4QAO A;  1U7M A;  1HJ0 A;  2BAS A;  2E76 C;  3LW5 H;  2WPS A;  4WQB A;  1BCC J;  5KTB A;  2LIR A;  1YYC A;  2RN0 A;  3PH0 A;  1DW1 A;  3N7N A;  2XV5 A;  1YBK A;  3TGU D;  2V7Q H;  1VF5 D;  1I5T A;  2AI5 A;  1HUC A;  1PGJ A;  2FFD C;  5E79 H;  3H1H G;  1DEB A;  1A02 F;  3CCQ P;  1CW5 A;  1D7M A;  2R44 A;  3X39 A;  3H1H J;  4MN4 C;  1OW8 A;  1ZW0 A;  3HTK B;  3MK7 C;  2BEQ D;  3RK3 B;  2N3Y A;  2W83 C;  2RKL A;  2QVA A;  1HGV A;  1J1D C;  2PRR A;  3A0B H;  3GW6 A;  4Z1M H;  1LC1 A;  1NH4 A;  4YTP C;  3ZBM A;  1GU5 A;  2CA4 B;  2AXC A;  2J59 M;  2N18 B;  1KOR A;  3CMA P;  1GU2 A;  1CIH A;  1P84 I;  1YJW P;  1K04 A;  5AVQ B;  1LT9 A;  3IAO A;  2PFX A;  2KSE A;  1IFI A;  2M0B A;  3PLN A;  3OCD A;  1SS1 A;  2XTS B;  2CXB A;  1SQV D;  2KYV A;  3PXW A;  3IF4 A;  3WFD C;  4OGQ D;  2ZT9 C;  3MIW A;  2C9L Y;  2HV4 A;  3GHG C;  4FAV A;  3BRV B;  1UIX A;  2D0S A;  1IK9 A;  4KT0 J;  2NRG A;  1KZU B;  5AW3 B;  3CCM P;  1MZ4 A;  1CSW A;  2QM8 A;  4KHX A;  1AYG A;  2KS1 B;  3L71 G;  1KQG B;  1NYH A;  1T2K D;  2KS1 A;  2PAC A;  1JOC A;  2B89 A;  1RQV A;  3TDK A;  1N90 A;  3L71 J;  3PJS K;  2N1T B;  5KLI B;  2Y0D A;  1N8R Q;  3AE3 C;  1L2P A;  5KAI H;  1SQB D;  2H89 C;  1NU1 E;  1P84 H;  2HFE D;  4P4Q B;  1SQP E;  1EB7 A;  1YIC A;  3ORV A;  3BRT B;  2GM4 A;  3L70 D;  4XA4 A;  1YIT P;  1YIJ P;  2JWD A;  3VN0 A;  1BDC A;  1CNO A;  2GC7 D;  2B12 B;  2LR2 A;  5B5E H;  3E1I A;  5APT A;  3L74 E;  4HYT B;  1JY3 N;  1N7S D;  1GL2 D;  155C A;  1SVF A;  2NPS C;  2J58 A;  4LJI A;  5KAF H;  3B71 A;  4PV1 D;  3SFD C;  3V2Q A;  2B4Z A;  1NTM D;  3V2R A;  3G6E P;  3ZIY A;  3H6P A;  1H1O A;  3AE9 C;  4GOE A;  3QWO C;  1PP9 E;  3CX5 E;  2C8S A;  2K3R A;  1IC2 A;  5KJ7 A;  2AXT E;  3F89 A;  3E7K A;  2FKW B;  4DZO A;  3CPW O;  2IYP A;  2W6A A;  1AQ5 A;  1DEE G;  3JBT B;  3N4X A;  1CCH A;  4W7Y A;  4NPF X;  1VQ9 P;  1CSB A;  3AE6 C;  3CLQ A;  1CTZ A;  5EFW B;  1X9V A;  1QYZ A;  1NTM K;  2XNX A;  1QL2 A;  1H0T A;  5CCG A;  2WTY A;  1UII A;  2LXB A;  4H44 D;  1LTS C;  2WSF H;  1VPC A;  2WQY C;  1IO3 A;  1EZV I;  3HRN A;  2MKV A;  4AAM A;  3L37 A;  2B87 B;  1LP1 A;  2B87 A;  2RMZ A;  2YNY A;  2R3S A;  4FA4 A;  2W6B A;  1EDK A;  2FY8 A;  2E75 C;  4I6M C;  1X0T A;  1OXZ A;  2K9J B;  3WUV A;  2D2C B;  3VTP C;  2C2C A;  1FS0 E;  1PPJ D;  2OYO A;  2K9J A;  3SLE A;  2M8R A;  1F1C A;  3BCC D;  2D0W A;  4KMG A;  1PV3 A;  3TF5 A;  2FXO A;  3WFB C;  2H8P D;  1KYO D;  2M3B A;  3OAK A;  3M0D A;  3BAT A;  3VNW A;  2I1K A;  2SPZ A;  3CYT I;  2N1T C;  3L35 A;  2XDJ A;  5CIE B;  1DIQ C;  4H0L B;  1JDL A;  1C52 A;  1KV4 A;  1OX3 A;  2KLU A;  3R4Y A;  1W5C E;  2JDI H;  5AW1 B;  2HOD B;  1FC2 C;  5B66 H;  4WVZ A;  3EQ2 A;  2HOD A;  2Z5H A;  3P8C D;  2QJK B;  3BCC G;  1USE A;  5AW5 B;  2J5U A;  3CXH W;  1MV8 A;  1WEJ F;  1NNO A;  4ASW A;  3L4O A;  3BCC J;  3S1K A;  3V2P A;  4WY4 D;  2AIU A;  4WQ8 A;  1QL4 A;  3CC4 P;  1L9B C;  1H31 B;  5CIG B;  1IFP A;  1OVR A;  1H31 A;  1F1F A;  2QIW A;  2I8D A;  5KJ7 C;  4IOI H;  5GTI H;  4DT0 A;  1Q7Y Q;  2PCC B;  2E76 D;  4U7J A;  4GIF A;  1QX8 A;  2V4H A;  1DII C;  1YEB A;  1S5L X;  2ZZS 1;  1N7L A;  4JYB A;  5CMZ A;  3O0R C;  4FA1 A;  1FJK A;  5CCG C;  3D6Y A;  1IZN B;  3H1I G;  1FHB A;  3FWN A;  3H1K E;  1GKS A;  1PFI A;  5B66 E;  3VMY A;  3H1I J;  1FOS F;  2BCC G;  1J1E B;  2A45 G;  3QH9 A;  4FA5 A;  4DOJ A;  2BCC J;  1CED A;  1C2N A;  2CE0 A;  1CYI A;  1CTY A;  1SFC B;  2M3E A;  1M1K Q;  1RHZ B;  1XTG B;  1SFC A;  3AEA C;  2K37 A;  2D2C C;  4Y5R A;  4BWN A;  2WSC H;  3VP9 A;  1A56 A;  4EIC A;  1I6D A;  2E42 A;  3EWK A;  1LTI C;  3ABV C;  1BE3 G;  3H1J E;  3OA8 B;  3AEG C;  1BL9 A;  2OYH B;  1GQ1 A;  3Q5S A;  1RF1 B;  3L73 G;  3M0D C;  2IYO A;  1BE3 J;  5AVV B;  2ZT9 D;  4K35 A;  2E43 A;  3MTU E;  1RF1 A;  4MU8 A;  2Q3E A;  3Q1M A;  3L73 J;  1R5S A;  4YXD C;  1CZQ A;  3CWB D;  1JMB A;  5APY A;  4H0L C;  2KK7 A;  4PW9 B;  1GDV A;  1KX7 A;  4RES B;  1QGK B;  1FI7 A;  1SQX G;  2PCB B;  4UB8 H;  4AX3 A;  3A0B V;  4I7Z B;  1DW3 A;  1IFN A;  4O9B A;  2N9B A;  1BGY G;  2R32 A;  1SQX J;  3NMD A;  2QJK C;  1ZN5 A;  3AE5 C;  5AVX B;  2IBZ D;  1BGY J;  3AEC C;  1AFO A;  5AW9 B;  4Q5P A;  2YMY A;  2VHD A;  2HLO A;  3ZCF A;  1L4A D;  1SQQ D;  4L3H A;  1NGM B;  2E74 B;  1NU1 D;  4NPD A;  1Q2N A;  3HUS B;  2WT7 A;  3KDP B;  2OQQ A;  3KXD A;  2KXP B;  3HUS A;  3I5C A;  1HZU A;  2IZ1 A;  2NPS D;  4YXW H;  4XFJ A;  2CA3 B;  5BU8 B;  2FYN B;  3L74 D;  3U1C A;  4IL6 E;  3RLM A;  1SQQ K;  2B88 A;  1A2S A;  1YFC A;  1X22 A;  1DIP A;  2YO2 A;  3RL0 D;  5KAI V;  3D70 A;  5TJH A;  3H1I E;  2A06 G;  1SQQ G;  1W2B O;  3OW2 O;  1R0Q A;  1CRY A;  4L1Q A;  3A7O A;  1OWA A;  2BCC E;  1SQQ J;  4RO0 A;  2ZOO A;  5C9M A;  3FXD A;  1RE3 C;  5B5E V;  1SFC C;  3TNU B;  2BLF B;  1NTZ D;  2RH0 A;  3TNU A;  1URQ B;  1EDI A;  4W80 A;  2GB8 B;  1P84 D;  1FZG A;  5CCH C;  1YTC A;  1L4A A;  4GKG A;  1URQ A;  4EOT A;  5KAF V;  1LS9 A;  2HG5 D;  5BU5 A;  4AAN A;  1HTL C;  1CRI A;  5APX A;  2OYH C;  5AW6 B;  1RF1 C;  2ZFC A;  1Q81 Q;  3MP7 B;  2E75 D;  3WFC C;  3CP5 A;  2ZBO A;  2LXC B;  3L73 E;  3KQG A;  1DT1 A;  2Q6Q A;  4U3F D;  1K05 A;  2KZJ A;  1M6Z A;  3L75 D;  1NTZ K;  1IRV A;  1CIF A;  1CRC A;  1M1J A;  3RGU A;  4DY9 A;  3CX5 I;  3Q2Y A;  4K3A A;  1CIG A;  1YJ9 P;  1YQ4 C;  3HD7 D;  1ZV8 A;  2YQB A;  1K8A Q;  4NPE A;  2G3A A;  3RK2 B;  4H13 B;  1GIW A;  2XU6 A;  4I7Z C;  1IZL 0;  2WSE H;  1H9X A;  4M3L A;  1PZQ A;  5AW8 B;  1LT9 B;  3OCD B;  2QSI A;  4L75 A;  4PJ0 H;  2OYI B;  1FZB A;  1S1C X;  2K1A A;  2KNC B;  3NBT A;  1IFJ A;  2OYI A;  2FYZ A;  2KNC A;  1NKN A;  3TGU G;  2YCC A;  3A0H E;  3SWK A;  3AE8 C;  1JNM A;  1NKZ B;  2E74 C;  3WMM 0;  3L75 G;  3TGU J;  5AVU B;  1LMS A;  1LGH B;  3HUS C;  5AW2 B;  1L0N E;  2KSJ A;  3L75 J;  2GC4 D;  1J2J B;  3TYY A;  3D71 A;  3II6 A;  1FJP A;  3CX5 H;  3D0W A;  3PP5 A;  1ZR2 A;  1VF5 B;  3ITK A;  2AXT H;  4JQ0 D;  1M60 A;  2FYN C;  1YCC A;  1YEA A;  2E5Y A;  1S6V B;  1SQV K;  1B7V A;  3SWY A;  1MKM A;  2FYU D;  1ZRT E;  351C A;  3WUT A;  2BH5 X;  1VL2 A;  3MUD A;  4V2K A;  3VMX A;  1HBW A;  2W27 A;  1SQV G;  1COR A;  2ZON G;  2HYN A;  4HJG H;  2MTA C;  3PXS A;  2XKM A;  4FA9 A;  1RF0 A;  3JCU E;  1U7J A;  2ZXE B;  3P7K A;  1DH3 A;  3B5N D;  4D6T D;  2ZJS E;  1SQV J;  2W90 A;  1MUU A;  1HH7 A;  4I1L A;  2C9X B;  5B66 V;  4PJ0 E;  1N15 A;  1EC5 A;  1MFZ A;  3CC7 P;  1GU4 A;  1OVV A;  3H1L D;  1EZV D;  3FWL A;  4J20 A;  2FYU K;  2B11 B;  4EYY Q;  1URQ C;  4OGQ B;  2H88 C;  1HGZ A;  1SQB K;  1BCC E;  4N6J A;  2MHM A;  2OGU A;  1AV1 A;  2ZAE B;  1S9K E;  1IJD B;  4EIE A;  3H1K D;  1LJ2 A;  4UB6 E;  2FYU G;  2PAJ A;  2HPC B;  3LIE A;  2OAR A;  5AW7 B;  1SQB G;  2ZVN B;  2Y9Z A;  4JYC A;  2HPC A;  1GK6 A;  1RE4 A;  2FYU J;  1NML A;  3CCR P;  3RK3 E;  1QL1 A;  1OCD A;  5GTI V;  3L70 G;  1SQB J;  3KZI E;  4D6T G;  2GIW A;  2Y0E A;  2K88 A;  3PRJ A;  5H2F E;  1HRC A;  3L70 J;  3H1H E;  3PHL A;  1JCD A;  3L72 D;  4XYD B;  1LT1 A;  3RK3 C;  4RKU J;  4D6T J;  1H0T B;  1NVO A;  2QJP B;  1RH5 B;  3CXH E;  4WQ9 A;  1EZV G;  4R4M A;  1AQT A;  1U74 B;  4DCK A;  2JWA A;  1YI2 P;  1KB0 A;  3IR9 A;  4H13 C;  3RK2 C;  4TT3 H;  5CID B;  1GMJ A;  1NTM G;  2N18 C;  3GMA A;  1LT9 C;  1LP1 B;  1CXA A;  1KV9 A;  3MHV A;  3NXS A;  1NTM J;  3RBZ A;  1COT A;  3DP5 A;  1OZH A;  1AVO A;  5TIS E;  2CE1 A;  1JTH B;  1RAP A;  1I6E A;  1N7S B;  1GL2 B;  1JTH A;  1E2R A;  2JEE A;  1N7S A;  1GL2 A;  4PV1 B;  2WPV B;  2H7H A;  3ZOO A;  2N9I A;  4HH2 A;  3L72 G;  1CSU A;  1FDM A;  3O8Z A; 
#chains in the Genus database with same CATH homology
 1N9C A;  1CYI A;  1CTY A;  2V08 A;  3NWV A;  1L0L D;  1LC2 A;  2C1U A;  1HCM A;  4WQD A;  1IRW A;  5DF5 A;  1CXC A;  2JQR A;  3WUI A;  1C7M A;  4Y5R A;  4FAN A;  1A56 A;  2BCN B;  2OZ1 B;  3CXH D;  1KB9 D;  4EIC A;  1I6D A;  4XXL A;  1YIQ A;  3OA8 B;  1BL9 A;  1NMI A;  3SWS A;  1GQ1 A;  3ZOX A;  2JTI B;  4O1Q A;  1I8P A;  5DFS A;  1C6S A;  1CRH A;  4QAO A;  2L4D A;  1NTK D;  4MU8 A;  5KLV D;  2Q3E A;  4WQB A;  4UB8 V;  3VMA A;  1M70 A;  2I8F A;  2LIR A;  2N9J A;  1FI3 A;  1I54 A;  3CWB D;  3O5C A;  2FRC A;  2RN0 A;  1DW1 A;  1CO6 A;  1KIB A;  4PW9 B;  1GDV A;  1KX7 A;  2V07 A;  1A8C A;  3TGU D;  4AAL A;  1HJ5 A;  1I5T A;  2AI5 A;  1FI7 A;  2PCB B;  2QJY B;  4AX3 A;  3A0B V;  1DW3 A;  2ZXY A;  1K3H A;  4N0K A;  2C1D A;  1GJQ A;  4O1W A;  1CYC A;  1W2L A;  3X39 A;  3MK7 C;  2N3Y A;  2IBZ D;  1DW0 A;  3HQ7 A;  1C6O A;  4Q5P A;  3GW6 A;  1LC1 A;  2VHD A;  3VYM A;  3ZCF A;  1FI9 A;  3O20 A;  1SQQ D;  1DW2 A;  4L3H A;  3ZBM A;  2CA4 B;  1C6R A;  3H1J D;  2N18 B;  1NU1 D;  2BGV X;  1CRJ A;  1GU2 A;  1H32 B;  1CIH A;  3ZOW A;  1RZ6 A;  3PLN A;  3OCD A;  1H32 A;  2XTS B;  3SXT A;  1HZU A;  2CXB A;  1W5C T;  1SQV D;  3CU4 A;  1I8O A;  3PXW A;  3WFD C;  4YE1 A;  3ZOY A;  1NIR A;  2N9Y B;  2CA3 B;  2FYN B;  3L74 D;  2HV4 A;  4WQC A;  4NFG B;  3RLM A;  4FAV A;  4WQ7 A;  2D0S A;  1A2S A;  1WVE C;  1YFC A;  1CYJ A;  1MZ4 A;  1CSW A;  2B0Z B;  5KAI V;  1AYG A;  5TJH A;  1R0Q A;  2KS1 A;  2PAC A;  1CRY A;  5CIH B;  3NBS A;  3TDK A;  4L1Q A;  1N90 A;  3WFE C;  1CHH A;  5KLI B;  4WQA A;  2ZOO A;  3GG2 A;  1C75 A;  2Y0D A;  451C A;  5DJQ C;  1SQB D;  5C9M A;  2ORL A;  3M97 X;  5B5E V;  4P4Q B;  1EB7 A;  2BLF B;  1DVV A;  4IL6 V;  1YIC A;  1NTZ D;  3ORV A;  3L70 D;  5AUR A;  3HQ8 A;  5GTH V;  2GB8 B;  1E8E A;  1P84 D;  1CNO A;  4H0K A;  1YTC A;  2GC7 D;  3DMI A;  2YIU B;  2B12 B;  3VRD A;  5KAF V;  3RN1 A;  4PWA A;  1CHI A;  1LS9 A;  2Y0C A;  1CHJ A;  4K3I A;  1CRI A;  3L4M A;  3DR0 A;  1S5L V;  3CX5 W;  4AAN A;  1DVH A;  5CIB B;  5IY5 1;  1FCD C;  1MG2 D;  4RSZ A;  3WFC C;  155C A;  3CP5 A;  1ETP A;  4LJI A;  2ZBO A;  2C1D B;  1L0N D;  3HQ9 A;  1DT1 A;  4U3F D;  2B4Z A;  4GYD A;  1NTM D;  4WQE A;  3RN0 A;  1M6Z A;  3L75 D;  5CYT R;  4FB1 A;  5C0Z A;  3ZIY A;  1IRV A;  1CIF A;  1H1O A;  2N3B A;  1CRC A;  1IQC A;  3TYI A;  1KX2 A;  4DY9 A;  3H1I D;  3SJL A;  1CIG A;  2C8S A;  3A9F A;  3KHU A;  4PJ0 V;  2YQB A;  4EIF A;  1QKS A;  2BCC D;  1ZRT D;  2FWL A;  1GIW A;  1I55 A;  1IZL 0;  1H9X A;  3JBT B;  1CCH A;  1CTZ A;  1SQP D;  1C2R A;  3OCD B;  1QYZ A;  4EID A;  2KNC B;  3NBT A;  4UB6 V;  1CRG A;  2YCC A;  4H0J A;  1IO3 A;  4AAM A;  1LMS A;  2AXT V;  1BE3 D;  1QL3 A;  1CSV A;  2GC4 D;  1LFM A;  1BCC D;  3L73 D;  2RMZ A;  4FA4 A;  4GED B;  2EXV A;  1CC5 A;  1CIE A;  3ITK A;  3PTZ A;  1M60 A;  5CIF B;  2K9J B;  1YCC A;  2YK3 A;  1YEA A;  2C2C A;  1CCR A;  1PP9 D;  1PPJ D;  1S6V B;  3CX5 D;  1RAQ A;  1B7V A;  3SLE A;  1F1C A;  3BCC D;  2FYU D;  3A0H V;  2D0W A;  351C A;  2BPB B;  4KMG A;  2BH5 X;  3TF5 A;  4L3G A;  4V2K A;  3WFB C;  2BH4 X;  1K3G A;  1COR A;  2ZON G;  1KYO D;  1SQX D;  2MTA C;  3PXS A;  4FA9 A;  5B6Q A;  3H1H D;  3VNW A;  2QG4 A;  4D6T D;  5TIS V;  2O3J A;  1CTJ A;  1BGY D;  1HH7 A;  3CYT I;  2C9X B;  5B66 V;  3HQ6 A;  5CIE B;  1N15 A;  2OZ1 A;  1CSX A;  1DIQ C;  1QN2 A;  1RZ5 A;  1VYD A;  1JDL A;  3H1L D;  1EZV D;  3OA8 A;  3FWL A;  4J20 A;  1C52 A;  4A7P A;  2B11 B;  2MHM A;  1FJ0 A;  1N50 A;  5E79 V;  1KYO W;  4EIE A;  3H1K D;  5KKZ B;  2QJK B;  3MK7 B;  2B10 B;  3CXH W;  5CIC B;  1WEJ F;  1NNO A;  1HJ4 A;  3L4O A;  3SVW A;  1NML A;  4EDF A;  2AIU A;  1OCD A;  5GTI V;  3PH2 B;  1AOQ A;  4WQ8 A;  1QL4 A;  2LIT A;  2GIW A;  1H33 B;  2Y0E A;  1H9Y A;  1AKK A;  1L9B C;  1YNR A;  3PRJ A;  1H31 B;  5CIG B;  1HRC A;  3RMZ A;  1H33 A;  3PHL A;  2C1V A;  1H31 A;  1F1F A;  3L72 D;  4XYD B;  1MG3 D;  1E29 A;  2QJP B;  3C2C A;  4WQ9 A;  1HZV A;  1FOC A;  1U74 B;  3PXT A;  2A06 D;  3L71 D;  5EXQ A;  2PCC B;  2JWA A;  1L9J C;  1KB0 A;  1DII C;  4RJT A;  4PD4 D;  1YEB A;  1HRO A;  2ZZS 1;  5CID B;  2N18 C;  3O1Y A;  1HJ3 A;  4AAO A;  3O0R C;  4FA1 A;  1CXA A;  2L91 A;  1OAE A;  2DGE A;  1KV9 A;  3KZI V;  1COT A;  2DVH A;  3DP5 A;  1FHB A;  5H2F V;  2CE1 A;  1GKS A;  1RAP A;  1I6E A;  1U75 B;  1E2R A;  3WC8 A;  1J3S A;  1ZZH A;  4FA5 A;  4JCG A;  3ZOO A;  2N9I A;  1CED A;  5DJQ B;  1C2N A;  1AOF A;  3WU2 V;  1CSU A;  2CE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...