1SQBD

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqbD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqbD01
1J3SA 1RAPA 4XXLA 2CA3B 2AIUA 5CIEB 5CIDB 1SQPD 1RZ6A 451CA 2BPBB 3CXHW 4LJIA 1FI9A 3HQ8A 3PLNA 2C2CA 5CIBB 1E2RA 3VNWA 2AXTV 1DIQC 3PXSA 1WVEC 2ZZS1 4PJ0V 3TDKA 2FWLA 4FA4A 1W2LA 1E8EA 3O20A 1CTYA 3C2CA 1CRHA 1A8CA 3RMZA 1CCRA 2Y0DA 2K9JB 3ZIYA 3VYMA 1FJ0A 1CYCA 3L72D 1GQ1A 1HH7A 2ZBOA 2ZOOA 3L75D 1HZUA 5IY51 1CCHA 4WQ8A 5KKZB 2C1DB 1GIWA 5DFSA 2ORLA 1H32B 2Q3EA 1SQXD 1F1FA 4FAVA 3TF5A 5DJQB 4RSZA 2C1VA 1NMLA 5AURA 3PHLA 3A0BV 4UB8V 3KHUA 1YIQA 1YEBA 2LIRA 4DY9A 4WQ7A 1I8PA 2D0SA 3SLEA 1M70A 2CE0A 4WQEA 2B12B 5CIGB 1KYOW 5KLIB 3SJLA 1AKKA 2PACA 3TGUD 1ETPA 1CC5A 4L3HA 1YFCA 2YK3A 5GTIV 1N50A 1GDVA 2CE1A 1BGYD 3VMAA 4EDFA 3ITKA 2MHMA 1FHBA 3RLMA 1MZ4A 4AANA 3BCCD 1HJ3A 3OCDB 1YCCA 3CXHD 4FB1A 5EXQA 3VRDA 1IO3A 2BCNB 2ZXYA 4WQCA 2B10B 2V08A 2QJYB 1C2RA 1DW2A 1BCCD 1KX2A 2VHDA 1HZVA 1HRCA 4V2KA 1BE3D 1OCDA 1FCDC 1DW3A 3O5CA 1CRCA 3HQ9A 2N3BA 2B0ZB 3H1LD 1DT1A 2DVHA 3SXTA 1CIEA 3H1KD 2CXBA 1K3GA 2OZ1A 3DP5A 1EZVD 1A2SA 1I6EA 3GG2A 5CICB 4FANA 3OA8B 1FI7A 5H2FV 1C6RA 3H1ID 1DVVA 1BL9A 2B11B 3L4MA 2KS1A 1CHIA 4EIDA 1LS9A 4WQBA 1KV9A 1CTJA 1MG2D 1IZL0 1I54A 3A0HV 1H31A 1CIGA 1H33B 2GB8B 2N9YB 1JDLA 1HCMA 1I8OA 3TYIA 4IL6V 3A9FA 3CX5D 3PXTA 1KYOD 1C52A 1CSUA 2A06D 4L3GA 3RN0A 3NBSA 1N9CA 3PXWA 3L70D 5DF5A 2QJPB 4YE1A 4XYDB 2DGEA 2IBZD 1CRYA 1CNOA 4K3IA 1NTMD 4QAOA 1DVHA 2YIUB 1GU2A 3ZOXA 5E79V 1R0QA 1S5LV 4EICA 2N18C 1ZRTD 3SWSA 1KB9D 1QN2A 2B4ZA 3ORVA 2GIWA 1NU1D 3CP5A 1M60A 1FI3A 4PD4D 2ZONG 1KB0A 2GC4D 3CX5W 3RN1A 1QL3A 1AYGA 4O1QA 3WFBC 1PPJD 1AOQA 1P84D 1YTCA 3O1YA 1CORA 1IRWA 2YCCA 1C6SA 3H1HD 2C1DA 3PH2B 1I6DA 2Y0EA 2RN0A 4J20A 1H32A 2C1UA 3WFEC 1OAEA 2N9IA 1SQQD 2JWAA 3PTZA 4U3FD 1U75B 2XTSB 5CYTR 3L73D 5B6QA 1CXAA 4GYDA 4H0JA 2QJKB 3H1JD 1GJQA 1KIBA 1NNOA 1SQBD 4EIEA 1WEJF 1MG3D 2CA4B 1L0ND 2V07A 4D6TD 1C7MA 4AX3A 1CTZA 5CIFB 3ZOYA 1LC2A 4PWAA 5KAFV 2FYUD 1AOFA 1N90A 1IRVA 1NIRA 4UB6V 4FA9A 2GC7D 2N9JA 3ZCFA 1LMSA 1L9JC 3DMIA 1FOCA 3M97X 1I55A 2N18B 1W5CT 1QYZA 1E29A 3MK7C 3OCDA 1DIIC 4Q5PA 1F1CA 2C9XB 1VYDA 4N0KA 2L4DA 4L1QA 3HQ6A 4Y5RA 1CIFA 351CA 1C6OA 2BH5X 4FA5A 4H0KA 1CYJA 1L0LD 1CRIA 1S6VB 3PRJA 3WU2V 2O3JA 1SQVD 3KZIV 5KLVD 1H9XA 1CHJA 2BH4X 1QKSA 5C0ZA 1H1OA 2LITA 1CO6A 1K3HA 3HQ7A 3WC8A 1C75A 3WFDC 2Y0CA 155CA 1EB7A 3L74D 3DR0A 2FYNB 1LFMA 4GEDB 1QL4A 3ZOOA 3OA8A 1CIHA 4RJTA 1L9BC 4PW9B 4O1WA 1YNRA 2L91A 3CWBD 4AALA 1YEAA 1C2NA 1U74B 4P4QB 2N3YA 4WQAA 2BCCD 1CYIA 3JBTB 1LC1A 1H33A 1NTZD 3L71D 3X39A 1CXCA 2JTIB 1RAQA 3ZOWA 3GW6A 1CRGA 1CSVA 1PP9D 4KMGA 1HJ5A 3WFCC 1DW1A 2HV4A 2I8FA 1NTKD 1KX7A 3MK7B 3ZBMA 5GTHV 5TISV 3O0RC 3WUIA 3CYTI 5B66V 1A56A 3L4OA 1COTA 4AAOA 5KAIV 2AI5A 1I5TA 1RZ5A 1CRJA 2YQBA 2PCBB 4FA1A 3NBTA 2BGVX 3FWLA 4A7PA 1ZZHA 1M6ZA 2OZ1B 3SVWA 1NMIA 5B5EV 2MTAC 1CHHA 1HJ4A 1IQCA 4EIFA 5TJHA 5C9MA 1CSXA 2D0WA 4WQ9A 2RMZA 4AAMA 2JQRA 2C8SA 1H31B 1HROA 1H9YA 1CEDA 5DJQC 1CSWA 4WQDA 5CIHB 2KNCB 1N15A 2FRCA 4JCGA 4MU8A 2PCCB 4NFGB 2BLFB 2QG4A 3NWVA 2EXVA 3CU4A 1DW0A 1YICA 1B7VA 1GKSA
chains in the Genus database with same CATH superfamily
1RAPA 3VMXA 4U3FG 1SQPD 1RZ6A 451CA 3KDPB 5CCGA 5KJ7C 1A02J 2WSCH 2MKVA 5CBNA 1OWAA 1SQBG 3G71P 1FDIA 3B5NC 2WQYC 2M3BA 2C2CA 3G4SP 1L0NK 5GTHH 1LTIC 3KYQA 1NGMB 3PXSA 4PJ0V 2FWLA 2FYUK 1E8EA 1DIPA 3E1RA 2Z5IA 1U57A 1CRHA 1KTMA 1LWUA 4H13D 5AVVB 4CPGA 1WMKA 1QL2A 2K9JB 3ZIYA 1FJ0A 1CYCA 5BU8B 1CCHA 4OVNF 5DFSA 1N73C 2Z4EA 1KILC 2W90A 1RE4C 1HF9A 4EIJA 1GK6A 2ZT9B 1RY3A 1VQ5P 1SQVK 5KLVK 2RKLA 1QGKB 3TF5A 4RSZA 3TK1A 5KAFH 3KHUA 3E7KA 1YIQA 2ZYDA 4TLFA 4UB6H 2Q7CA 1VQPP 1W5CE 2QA4P 3P7KA 1PZQA 3SLEA 1G1JA 2QVAA 3A0BE 1AKKA 1PFIA 2PACA 4L3HA 3AE9C 2YK3A 3CLQA 2D2CB 1N50A 2ZAEB 4N3YB 2CE1A 5CCHC 1FZFA 2QEXP 2WWWA 3P8MC 1NTKE 3WU2H 1L4AB 4AANA 1HJ3A 3OCDB 3LW5H 1NTZK 4WBAA 2CPBA 1NU1G 1IO3A 2V08A 3RK3E 2QJYB 2WSFH 2E76B 2Q3IA 3L70J 1HZVA 2IFNA 4V2KA 3CX5H 1JB0J 1FCDC 1DW3A 2MJZA 3HQ9A 2OGUA 2GUVA 2N1TB 2DVHA 3SXTA 1LTBC 1ZLLA 3B8EB 5APYA 1K3GA 3FWNA 2D2CC 5CICB 3OA8B 2O01H 3IF4A 1C6RA 5CJ4A 3GMAA 1XTGB 3HD7D 1BL9A 2XV5A 4L75A 2J5UA 3AEGC 1MKMA 4PD4H 5C39A 2G8YA 4D6TG 1I54A 2P58A 1NAFA 1JNMA 2E74B 5KAIH 3ABVC 3V4WA 2M5AA 2OTKE 1YTZT 1SQQJ 1KYOD 3A0HE 5AW1B 1NAYA 2KP8A 4NPDA 4YE1A 1LT1A 1X0TA 1ZOYC 4HB1A 2WPQA 4IL6E 2DGEA 3FGAD 1L0LG 2YIUB 4ZKUA 1KZUB 5E79V 1R0QA 2E43A 4IL6X 3SWSA 2K9YA 3JCUH 3L72E 2NPSD 1LTGC 1HTLC 2FYUJ 1M60A 3HD7A 1FI3A 3CMAP 3CCRP 3CX5W 4GT1A 2O1KA 4O1QA 1K05A 1VQMP 4C7NB 2Y0EA 2C0WA 1H32A 4ASWA 1OAEA 3D0WA 1BSHA 1SQXK 4WWIA 5GTHE 4U3FD 1SQPJ 3L71G 2AXTH 2FYNC 4RESB 3G6EP 4PV1B 4H0JA 1OMIA 3NMDA 1KIBA 1SQBD 1BGYE 1YI2P 2YKOA 1WEJF 2JO1A 4YTPC 3L74J 3BCCE 2XNDH 2NPSA 3RL0D 5CIFB 1NYHA 3M0AA 4H44C 1N90A 4C7NA 1CW5A 1IFMA 1DEBA 1I55A 1M57D 3RK2C 3RBXA 3V2PA 4WVZA 1E29A 1VPCA 4Q5PA 5KAFE 1F1CA 1JY2O 4N0KA 5AW2B 1BE3E 1IFNA 4UB6E 351CA 4L74A 5AW8B 2B87A 1FC2C 2LR2A 4H0KA 1GL2A 3IN6A 1VQNP 3H1LE 3H25A 1CRIA 2HLOA 1H0TB 3I56P 2PP6A 1H9XA 3H1KE 3M0DC 1CHJA 1JCCA 1QKSA 4Y99C 1K3HA 2DW3A 1LP1B 3VOPA 3WU2E 1H88A 2Y0CA 5APXA 1GD2E 1FAVA 2C9LY 2YKQA 1WT6A 3AE7C 3DR0A 1MUUA 4DZOA 1KV4A 1CIHA 3Q1MA 3CWBD 1LTSC 1YBKA 1C2NA 3CX5E 3JC22 2N3YA 4XA4A 4M3LA 1H0TA 1PV3A 1LT9B 1H33A 2M0BA 3CC7P 1CRGA 1M90Q 2LXCB 4KMGA 1NTME 1DEEG 2AEFA 2HV4A 1LP1A 1NTKD 1KX7A 4PD4I 1LJ2A 1VF5D 3CC2P 1SVFA 3WUIA 1EXIA 2W6JH 5CBOA 4AAOA 1RF1B 3V6IA 3RK3D 3VYIA 2Q6QA 1S1CX 1SFCD 3GHGA 3HE4B 2FY8A 4PD4E 1OFCX 5AW7B 1NTMG 1YJNP 3NBTA 3VP9A 3VMYA 4A7PA 4TT3H 5KAIE 2XDJA 2HPCA 2OZ1B 1H8AA 3HUSC 1ZXGA 1LT9A 3H1HE 2MTAC 1CHHA 2A45I 1NU1K 5KKZC 2ZYAA 1KFNA 4NPEA 2KS1B 2D0WA 1A02F 2UWJE 1AQTA 2KUBA 3L73E 2JQRA 1LNQA 3L75J 2IZ0A 3H1JE 3BRTB 2FRCA 4JCGA 4MU8A 2ZVNB 2E5TA 3N4XA 1SQXJ 4WY4D 1GW3A 2OYHC 2AEMA 3JCUE 1VQ4P 3CU4A 4IFMA 3F89A 1DW0A 1M56D 1B7VA 1GKSA 3NXSA 3H32A 1Q7YQ 5CIDB 1SFCA 3CXHW 2H7HA 1UIIA 3H1JG 2KSJA 1E2RA 3VNWA 1URQB 1S3JA 1LGHB 1DIQC 3TGUJ 2R3SA 1KYOI 1IK9A 1CTYA 1Q90D 2AXTE 3I5CA 3A3YB 1YQ3C 4HJGH 3IAOA 3VYMA 3S1KA 3L72D 1GQ1A 1HH7A 4JYBA 4LGDE 2ZOOA 4WQ8A 4U3FJ 4OGQB 2C1DB 5CMZA 1J1EC 4I7ZB 4JYCA 1L0LK 3TSIA 1EQ7A 2E75C 2GA1A 1SQBJ 1FE6A 1NMLA 3PHLA 1VQOP 3A0BV 4I1LA 1BDCA 3MHVA 1I8PA 1GDTA 1K04A 1LTJA 1ZR2A 1G1IA 4WQEA 2FYZA 1JEKA 3MZWB 1JY2P 3V2QA 2FFDC 1KQGB 2BEZF 1YFCA 5GTIV 3EFGA 1BGYD 1OW7A 2IYOA 4EDFA 3B5NB 3ITKA 1QVFO 2MHMA 1TU3F 1FHBA 3CL3D 3VP8A 3BCCD 1DX7A 3M9BA 5M1BA 4B86A 2C0XA 4HH2A 4YXWH 3VRDA 2IX7C 2B10B 5AW0B 4PJ0H 1C2RA 1G2CB 3M9QA 1BE3D 2P2UA 5AW4B 4C46A 1AQ5A 3O5CA 1CRCA 1N73B 2IPPA 1KQLA 1KILB 3H1LD 1DT1A 3H6PA 1M8OB 2K1AA 3H1KD 2WVRA 1VL2A 3DP5A 1K8AQ 1A2SA 2RH0A 4LC1A 1BDDA 1FI7A 1X9VA 1KB9H 1N8RQ 1NU1J 1N7SB 2OTLP 1LS9A 1KV9A 5B66H 3A0HV 1H31A 1CIGA 2GB8B 1KMIZ 3W67A 3AE6C 4IOIH 3TYIA 1N73A 4IL6V 3CX5D 4L3GA 1CSUA 2ZT9D 3NBSA 5CCGC 3PXWA 1EDKA 1GZLA 3WUUA 1Q2NA 1PIXA 5AVTB 2WPVB 1X22A 5B5EH 1CNOA 4K3IA 1MFZA 1NTMD 1SQPK 2FXPA 5AVSB 2KYVA 3CCUP 3ZOXA 3B4SA 3AEEC 4H0LC 1VQ9P 1S5LV 4EICA 4RKUJ 1ZRTD 2QM7A 4D6TJ 4U7JA 1FS0E 2B4ZA 2WT7B 3CWBE 3CP5A 2QSIA 2KIKA 3CCSP 4PD4D 1L2PA 3KQGA 5APWA 1KB0A 1N7SC 2Y9ZA 1JTHB 1L4AD 2W83C 2K9JA 1NKNA 1YTCA 2Y9YA 3RBZA 3H1HD 3PH2B 2RN0A 4J20A 2C1UA 3WFEC 1RF0C 2O01N 3CWBG 2E76D 1L0LJ 1MV8A 1OW6A 2H88C 3A7OA 3PTZA 5CYTR 3L73D 3SWKA 1NOHA 3H1JD 3M06A 2WT7A 2OYIB 2N1TD 1NTKG 4EIEA 2AXCA 3OW2O 4DOJA 1MG3D 4W7YA 2CA4B 4H13C 1T3JA 2KSEA 4AX3A 1D7MA 4KJMA 5KAFV 4UB6V 1RQVA 1FOCA 1L4AA 1JMBA 1HBWA 3TNUB 2YXQB 3MK7C 3OCDA 1BCCE 2C9XB 3HQ6A 4Y5RA 5E79H 3L71J 2E74D 2BH5X 4UB8H 1M1KQ 2HYNA 2NZ2A 3WMM0 3E1IA 2WSCJ 1J2JB 3WU2V 1QLED 2ZYGA 3I55P 1Q82Q 3Q5PA 1CI6B 1KORA 2BH4X 1BCCG 1H1OA 1EZVE 1CO6A 2HODB 1KQFB 1WRGA 2OYIC 1M1JB 2N1TA 3HQ7A 1C75A 3H1IE 2W6AA 1OZHA 2FYNB 3RGUA 3SFDC 1K73Q 3OA8A 3AEBC 4YPCA 1FZCC 4PJ0E 4O1WA 1YNRA 5L8RJ 2IBZI 4GOEA 1U74B 2A06E 4P4QB 1YHQP 1LTAC 3H1IG 1CYIA 4RO0A 2JR8A 4H44B 3KXDA 2IZ1A 1RAQA 1CI6A 1KB9I 3QH9A 3GW6A 3C8VA 1Q86Q 1CSVA 2IBZE 4N78E 3RK2B 1FZAA 2XU6A 1EDJA 5TISV 2YO2A 2A06G 3L72G 2IYPA 1KB9E 1GL2D 1M1JC 5KAIV 4Z1MH 5H2FH 2WITA 1I5TA 4PV1D 1NH4A 2ZFCA 1OVRA 1XTCC 3AE8C 2IBZG 1CRJA 5B66E 4FA1A 3HD7C 4Y99B 3HE5B 4MN4C 1CSBA 3LW5J 3SVWA 3HTKB 1HJ4A 1IQCA 4HYTB 1SQQE 1E79H 2WSFJ 3CCLP 5C9MA 5B5EE 1FZEA 2C8SA 1HJBA 1HROA 1H9YA 5DJQC 3CCMP 1KILE 1N15A 1BGYG 3NTNA 1YQ4C 2KZIA 3BCCG 1NTMJ 4ZMDA 1YICA 1J3SA 1L0NE 2K37A 3AE2C 3B71A 4XXLA 2AIUA 3U1AA 5KLIC 2XNXA 2FYUE 2O01J 2BPBB 1SQBK 1IFJA 4ZKPA 1ZV8A 1PGPA 3PLNA 1IZNB 1BE3G 1FDOA 5CIBB 1H89A 4EOTA 2AXTV 1L0NG 4FA4A 3CX5I 3H1LG 4ZNCA 3O20A 1HGVA 4R4LA 1A8CA 3RMZA 1KFMA 3H1KG 2Y0DA 1SQVE 2L5GB 3HUSB 5KLVE 3P32A 1BSNA 2JJLA 2P67A 3D6ZA 2CPSA 5KKZB 3MUDA 1SLQA 1GIWA 2ORLA 4K3AA 3SSUA 3CXHH 1USEA 2JKVA 3RL0g 5AW3B 3H1JJ 2R5BA 3L74E 1X79B 2C1VA 1SQVG 3V4QA 4BWNA 5KLVG 4JF7A 3RL0C 5AW9B 2LIRA 4DY9A 2WMMA 2B88A 3CPWO 2ZVOB 2OYHB 3II6A 1CZQA 1ZRTE 2KK7A 3D70A 4IFFA 2BCCE 3CCVP 1YTZI 4UB8E 5CIGB 4DJGA 1KYOW 3Q3DA 1NTZE 3HUSA 1ETPA 5BVZA 1PP9E 3VMAA 3S9OA 3KZIH 3RLMA 1MZ4A 1J1DC 1VDFA 2KLVA 2QJPC 2BCCG 3UIAA 2KZJA 1DD3A 5EXQA 2ZXYA 1NTZG 4IFDK 1VQ6P 1BCCD 2OYHA 2VHDA 1RF1A 3V2RA 3H1HG 2C9NY 1J1EB 3GF3A 3G3ZA 2B0ZB 3HE4A 3R4YA 2QE7H 2E75B 1UIXA 1JO5A 1CIEA 2CXBA 2OZ1A 3L73G 1URQD 1EZVD 1I6EA 3LIEA 4R4MA 1JMMA 1JY2N 4KT0J 3H1ID 1DVVA 1S9KE 4GKGA 2KS1A 2FFDB 4DT0A 4EIDA 4WQBA 4W7ZA 3BASA 1CTJA 1VF5C 1MG2D 1IZL0 1EDIA 1HH0A 2J59M 5H2FE 2K3RA 4WY4B 1ZP0C 3R2PA 2N9YB 1HCMA 1I8OA 1P84H 4OGQD 3Q5RA 2Z5HA 3A9FA 3RK3C 3PXTA 2QJKC 4O9BA 2A06D 4C7RA 5GTIH 1SFCC 4EI2A 3L70D 5CHXA 1AA0A 4XYDB 1JY3P 1S4XA 4GDOA 2IBZD 1CRYA 4N78D 3V2NA 1T2KD 4QAOA 2YNYA 1YJ9P 2E42A 1EXJA 1URQA 2N18C 1FBMA 1Y47A 1KB9D 3ORVA 5AVUB 3L75E 5KJ7D 2GIWA 3O8ZA 2ZONG 1SS1A 2GC4D 3RN1A 1QL3A 3AE4C 3B5ND 1SQXE 1AYGA 3CCEP 2I8DA 1AOQA 3O1YA 4WY4C 4ASVA 2JDIH 4EYYQ 1C6SA 3IR9A 2C1DA 1USDA 3OAKA 2N9IA 5APSA 1R8EA 2M3EA 3VMZA 1SQQD 1AFOA 2JWAA 3L37A 3BATA 4I2LC 1NHLA 1FZGA 4GYDA 2W8ZA 3TGUE 3A0HH 1KILD 1GJQA 1NNOA 2M8RA 1RE3A 2QIWA 2H8PD 3K5BA 1L0ND 1C7MA 2FKWB 3T97B 5KJ7A 4GODA 2PAJA 1CTZA 1LC2A 3CXHE 1X8YA 2FYUD 1AOFA 4Y28J 1IRVA 1NIRA 4FA9A 3B5NA 1L9JC 4H0LB 3M97X 3CWBJ 1KC8Q 1VQKP 1QYZA 1DIIC 2J58A 1VYDA 2L4DA 2YXRB 4L1QA 2YKPA 2V7QJ 1CIFA 1S5LH 4LLHA 1C6OA 1IJDB 3C9IA 5CCHD 3PP5A 2PFXA 3OJAB 1S6VB 1G2CA 1N86A 1NTKJ 2O3JA 1SQVD 5KLVD 1PGQA 1R5SA 2GUSA 5C0ZA 1QEXA 2IFMA 2LITA 1KILA 1RE4A 3T97A 2XKMA 1OVUA 1NWQA 3M91A 3CC4P 5K5GB 3KZIE 3AE3C 155CA 3GF7A 1EB7A 1PGJA 3L74D 1LFMA 3ZOOA 1SP4A 2R3CA 2I1KA 3MP7B 1N7SA 4AALA 1AV1A 4H13B 1LWUC 3CI9A 2ITAA 2XZRA 3A5TA 1NJIQ 4QMAA 2BCCD 3FXDA 1S2EA 2D2CD 1IO4A 1NTZD 2ZXXA 1CXCA 1IFPA 3ZOWA 2W6BA 5CCHA 3CCQP 5BU5A 1BCCJ 2OARA 1RF0A 3VTPC 1PP9D 5AVXB 1HJ5A 1DW1A 1OXZA 3MK7B 5GTHV 2BASA 3BVHA 2FBWC 1IFIA 3O0RC 3O6QB 2WSEJ 3CYTI 5B66V 1RH5B 1COTA 1P84I 4I6MC 1PL5A 1RZ5A 3AE5C 1NTMK 1NU1E 2PRRA 2YQBA 2PCBB 1RHZB 3FWLA 1ZZHA 1PPJE 3H1IJ 1P84E 1M6ZA 1T6AA 1NMIA 5B5EV 5GTIE 3U59A 1DH3A 1GU4A 1JTHA 3PH0A 5TJHA 3V5BA 2WTYA 1RQUA 2ZT9C 4WQ9A 2KOGA 1FZCB 3O6QA 2LKMA 3L72J 1PPJG 1QX8A 2ZXEB 4WQDA 4BXLA 5CIHB 2GM4A 2KNCB 1S9KD 2AEJA 2M5AB 2PCCB 3NFQA 2EXVA 1EZVI 1GW4A 4D6TE 2CA3B 4OH8B 1HVVA 5CIEB 2OYIA 2WSSH 4LJIA 1FI9A 2YMYA 3HQ8A 1AVYA 1E5WA 2N9BA 1L4AC 2B89A 5TISH 1WVEC 2ZZS1 3TDKA 1FZCA 2PGDA 1W2LA 1GK4A 1JOCA 4OWFA 1W2EA 3HD7B 3C2CA 2KNCA 3TNUA 1L0LE 1BGYJ 2QJYC 1CCRA 3EFFK 2E76C 3SWYA 3BCCJ 4H44D 1EZVG 2ZBOA 3L75D 1HZUA 5IY51 1OVVA 1OIPA 1H32B 1K9MQ 3RK2D 2Q3EA 3L70E 3IFMA 1SQXD 3C1LA 1F1FA 2P10A 2N1TC 3L4FA 5APTA 4FAVA 2A45H 1BE3J 5DJQB 5AURA 2HODA 3USSA 1M1JA 3U1CA 1DD4A 2VRSA 4UB8V 3F5HA 1YEBA 1L0NJ 3H1LJ 4WQ7A 2D0SA 1M70A 2CE0A 1NO4A 3L70G 1S5LE 3AEDC 3H1KJ 1N7LA 1FOSE 1YYCA 2B12B 3WUVA 5KLIB 3SJLA 2W27A 3Q2YA 1ZR4A 1FDMA 3P8CE 3L71E 3ZDMA 3TGUD 2NPSB 1CC5A 5APVA 1GDVA 2E74C 3EQ2A 2YMKA 1S5LX 1JY3O 1QL1A 1YCCA 3CXHD 1HWTC 3EWKA 1SQVJ 4FB1A 5KLVJ 2B87B 4WQCA 2BCNB 1M7LA 1AVOA 1GL2B 3AE1C 1FU1A 5DJTB 1DW2A 3WUTA 5AW6B 3S4RA 2YIUC 1KX2A 3QWOC 1HRCA 1KYOH 1OCDA 5AW5B 3TYYA 1JUNA 5AVRB 2WPRA 1MZ9A 2IDBA 2N3BA 4WB4A 2P7JA 5AVQB 1SQQG 2WZ7A 1GTWA 3M0DA 2I1JA 2NRGA 3PJSK 3HE5A 2R32A 2P1JA 1R5LA 4KHXA 3RL0B 2NPSC 5APUA 5APQA 3GLMA 3HTKA 3GG2A 4FANA 1FJKA 1NVOA 2BCCJ 5H2FV 1NTZJ 1HUCA 2Q1KA 1Z56A 4GOFA 2B11B 3L4MA 3AECC 1W2BO 1CHIA 1VQLP 1PP9J 3M9HA 1H33B 1IC2A 2FYUG 1JDLA 3H1HJ 2QM8A 1GL2C 3CD6P 1SQPE 1QVGO 4PV1C 4W80A 1C52A 4DCKA 1J1DB 3RN0A 3KPEA 1N9CA 1N2DC 5DF5A 2QJPB 3L73J 3L36A 4L76A 1ZMEC 2H43A 1LTTC 1DVHA 1GU2A 3GHGB 1SQPG 4N6JA 3MD0A 2HG5D 1VQ7P 3SWFA 2HPCB 1QN2A 2O1JA 1OX3A 1NU1D 4AUWA 5E79E 3MTUE 3MUDC 4L73A 4NPFX 3L74G 3WFBC 1PPJD 2H89C 2CK3H 1P84D 1HJ0A 1CORA 1IRWA 2G3AA 2YCCA 1MFTA 1I6DA 5DJUB 4JPZB 2Q9IA 1KN7A 1VF5B 2BEQD 4XFJA 1IFDA 1GU5A 2KB7P 5TISE 1U75B 2HR3A 2XTSB 3AEFC 2FXMA 3OA7A 5B6QA 1CXAA 1HGZA 4BRYB 3G9RA 3H32B 1NTKK 5AVWB 3RK3B 3L35A 2QJKB 1PP9G 1SFCB 3GHGC 1PGOA 2E5YA 1EDLA 2E75D 1JY3N 4JQ0D 2V07A 4D6TD 1VQ8P 2ZJSE 3BRVB 1OW8A 3ZOYA 1LT9C 4PWAA 2YO3A 2GC7D 2N9JA 3ZCFA 1Q81Q 1LMSA 3DMIA 2JEEA 1JCDA 2N18B 1W5CT 2JP3A 2HFED 4K35A 4AQRD 2QRXA 3A0BH 1AJYA 2V7QH 4FA5A 1RF1C 4BRYA 1T3UA 4YXDC 1CYJA 1L0LD 3PRJA 1NKZB 3KZIV 3N7NA 3D71A 1S72P 2A45G 1KQSO 2KLUA 3FXEA 2Q5UA 3FX0A 1U7MA 1YITP 1Y8AA 1ZW0A 4AYCA 3WC8A 3WFDC 1T8ZA 1LTJB 4GEDB 1QL4A 2WPSA 3HRNA 3VN0A 4RJTA 1L9BC 3Q5SA 1JM0A 4PW9B 1U7JA 2L91A 2OTJP 2V4HA 2R5DA 2FFDA 1YEAA 3CMEP 1KYOE 4WQAA 3JBTB 1LC1A 1FZBA 4WY4A 3P8CD 3L71D 3X39A 2JTIB 1KD1Q 1FJPA 1YIJP 3CCJP 4XE5B 3AEAC 2SPZA 3WFCC 2I8FA 2B9BA 1Y9BA 3ZBMA 1GMJA 1EC5A 1A56A 3L4OA 3L75G 2WSEH 2OQQA 1URQC 2AI5A 5CJ0A 5KTBA 1SQXG 1LTJC 5CCGD 3JSVC 2BGVX 3CXHI 3SFEC 3MGNA 1YJWP 3MIWA 2KXPB 3LIDA 2FXOA 3D6YA 5EFWB 2LXBA 1ZN5A 4IL6H 5AVZB 4OGQC 4H0LD 4EIFA 2POHA 2OYOA 2KI7B 4I7ZC 2R44A 4U3FE 1CSXA 3W68A 2RMZA 4AAMA 1H31B 3TGUG 1FOSF 4GIFA 1CEDA 1CSWA 1N7SD 1IK7A 3A2AA 1LWUB 1SQQK 1SQBE 1T2KC 4NFGB 2BLFB 4JBZA 2QG4A 3NWVA 4HKZH 2JWDA 5AVYB 1RE3C 2K88A
chains in the Genus database with same CATH topology
1J3SA 1RAPA 4XXLA 2CA3B 2AIUA 5CIEB 5CIDB 1SQPD 1RZ6A 451CA 2BPBB 3CXHW 4LJIA 1FI9A 3HQ8A 3PLNA 2C2CA 5CIBB 1E2RA 3VNWA 2AXTV 1DIQC 3PXSA 1WVEC 2ZZS1 4PJ0V 3TDKA 2FWLA 4FA4A 1W2LA 1E8EA 3O20A 1CTYA 3C2CA 1CRHA 1A8CA 3RMZA 1CCRA 2Y0DA 2K9JB 3ZIYA 3VYMA 1FJ0A 1CYCA 3L72D 1GQ1A 1HH7A 2ZBOA 2ZOOA 3L75D 1HZUA 5IY51 1CCHA 4WQ8A 5KKZB 2C1DB 1GIWA 5DFSA 2ORLA 1H32B 2Q3EA 1SQXD 1F1FA 4FAVA 3TF5A 5DJQB 4RSZA 2C1VA 1NMLA 5AURA 3PHLA 3A0BV 4UB8V 3KHUA 1YIQA 1YEBA 2LIRA 4DY9A 4WQ7A 1I8PA 2D0SA 3SLEA 1M70A 2CE0A 4WQEA 2B12B 5CIGB 1KYOW 5KLIB 3SJLA 1AKKA 2PACA 3TGUD 1ETPA 1CC5A 4L3HA 1YFCA 2YK3A 5GTIV 1N50A 1GDVA 2CE1A 1BGYD 3VMAA 4EDFA 3ITKA 2MHMA 1FHBA 3RLMA 1MZ4A 4AANA 3BCCD 1HJ3A 3OCDB 1YCCA 3CXHD 4FB1A 5EXQA 3VRDA 1IO3A 2BCNB 2ZXYA 4WQCA 2B10B 2V08A 2QJYB 1C2RA 1DW2A 1BCCD 1KX2A 2VHDA 1HZVA 1HRCA 4V2KA 1BE3D 1OCDA 1FCDC 1DW3A 3O5CA 1CRCA 3HQ9A 2N3BA 2B0ZB 3H1LD 1DT1A 2DVHA 3SXTA 1CIEA 3H1KD 2CXBA 1K3GA 2OZ1A 3DP5A 1EZVD 1A2SA 1I6EA 3GG2A 5CICB 4FANA 3OA8B 1FI7A 5H2FV 1C6RA 3H1ID 1DVVA 1BL9A 2B11B 3L4MA 2KS1A 1CHIA 4EIDA 1LS9A 4WQBA 1KV9A 1CTJA 1MG2D 1IZL0 1I54A 3A0HV 1H31A 1CIGA 1H33B 2GB8B 2N9YB 1JDLA 1HCMA 1I8OA 3TYIA 4IL6V 3A9FA 3CX5D 3PXTA 1KYOD 1C52A 1CSUA 2A06D 4L3GA 3RN0A 3NBSA 1N9CA 3PXWA 3L70D 5DF5A 2QJPB 4YE1A 4XYDB 2DGEA 2IBZD 1CRYA 1CNOA 4K3IA 1NTMD 4QAOA 1DVHA 2YIUB 1GU2A 3ZOXA 5E79V 1R0QA 1S5LV 4EICA 2N18C 1ZRTD 3SWSA 1KB9D 1QN2A 2B4ZA 3ORVA 2GIWA 1NU1D 3CP5A 1M60A 1FI3A 4PD4D 2ZONG 1KB0A 2GC4D 3CX5W 3RN1A 1QL3A 1AYGA 4O1QA 3WFBC 1PPJD 1AOQA 1P84D 1YTCA 3O1YA 1CORA 1IRWA 2YCCA 1C6SA 3H1HD 2C1DA 3PH2B 1I6DA 2Y0EA 2RN0A 4J20A 1H32A 2C1UA 3WFEC 1OAEA 2N9IA 1SQQD 2JWAA 3PTZA 4U3FD 1U75B 2XTSB 5CYTR 3L73D 5B6QA 1CXAA 4GYDA 4H0JA 2QJKB 3H1JD 1GJQA 1KIBA 1NNOA 1SQBD 4EIEA 1WEJF 1MG3D 2CA4B 1L0ND 2V07A 4D6TD 1C7MA 4AX3A 1CTZA 5CIFB 3ZOYA 1LC2A 4PWAA 5KAFV 2FYUD 1AOFA 1N90A 1IRVA 1NIRA 4UB6V 4FA9A 2GC7D 2N9JA 3ZCFA 1LMSA 1L9JC 3DMIA 1FOCA 3M97X 1I55A 2N18B 1W5CT 1QYZA 1E29A 3MK7C 3OCDA 1DIIC 4Q5PA 1F1CA 2C9XB 1VYDA 4N0KA 2L4DA 4L1QA 3HQ6A 4Y5RA 1CIFA 351CA 1C6OA 2BH5X 4FA5A 4H0KA 1CYJA 1L0LD 1CRIA 1S6VB 3PRJA 3WU2V 2O3JA 1SQVD 3KZIV 5KLVD 1H9XA 1CHJA 2BH4X 1QKSA 5C0ZA 1H1OA 2LITA 1CO6A 1K3HA 3HQ7A 3WC8A 1C75A 3WFDC 2Y0CA 155CA 1EB7A 3L74D 3DR0A 2FYNB 1LFMA 4GEDB 1QL4A 3ZOOA 3OA8A 1CIHA 4RJTA 1L9BC 4PW9B 4O1WA 1YNRA 2L91A 3CWBD 4AALA 1YEAA 1C2NA 1U74B 4P4QB 2N3YA 4WQAA 2BCCD 1CYIA 3JBTB 1LC1A 1H33A 1NTZD 3L71D 3X39A 1CXCA 2JTIB 1RAQA 3ZOWA 3GW6A 1CRGA 1CSVA 1PP9D 4KMGA 1HJ5A 3WFCC 1DW1A 2HV4A 2I8FA 1NTKD 1KX7A 3MK7B 3ZBMA 5GTHV 5TISV 3O0RC 3WUIA 3CYTI 5B66V 1A56A 3L4OA 1COTA 4AAOA 5KAIV 2AI5A 1I5TA 1RZ5A 1CRJA 2YQBA 2PCBB 4FA1A 3NBTA 2BGVX 3FWLA 4A7PA 1ZZHA 1M6ZA 2OZ1B 3SVWA 1NMIA 5B5EV 2MTAC 1CHHA 1HJ4A 1IQCA 4EIFA 5TJHA 5C9MA 1CSXA 2D0WA 4WQ9A 2RMZA 4AAMA 2JQRA 2C8SA 1H31B 1HROA 1H9YA 1CEDA 5DJQC 1CSWA 4WQDA 5CIHB 2KNCB 1N15A 2FRCA 4JCGA 4MU8A 2PCCB 4NFGB 2BLFB 2QG4A 3NWVA 2EXVA 3CU4A 1DW0A 1YICA 1B7VA 1GKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3S A;  1RAP A;  4XXL A;  2CA3 B;  2AIU A;  5CIE B;  5CID B;  1SQP D;  1RZ6 A;  451C A;  2BPB B;  3CXH W;  4LJI A;  1FI9 A;  3HQ8 A;  3PLN A;  2C2C A;  5CIB B;  1E2R A;  3VNW A;  2AXT V;  1DIQ C;  3PXS A;  1WVE C;  2ZZS 1;  4PJ0 V;  3TDK A;  2FWL A;  4FA4 A;  1W2L A;  1E8E A;  3O20 A;  1CTY A;  3C2C A;  1CRH A;  1A8C A;  3RMZ A;  1CCR A;  2Y0D A;  2K9J B;  3ZIY A;  3VYM A;  1FJ0 A;  1CYC A;  3L72 D;  1GQ1 A;  1HH7 A;  2ZBO A;  2ZOO A;  3L75 D;  1HZU A;  5IY5 1;  1CCH A;  4WQ8 A;  5KKZ B;  2C1D B;  1GIW A;  5DFS A;  2ORL A;  1H32 B;  2Q3E A;  1SQX D;  1F1F A;  4FAV A;  3TF5 A;  5DJQ B;  4RSZ A;  2C1V A;  1NML A;  5AUR A;  3PHL A;  3A0B V;  4UB8 V;  3KHU A;  1YIQ A;  1YEB A;  2LIR A;  4DY9 A;  4WQ7 A;  1I8P A;  2D0S A;  3SLE A;  1M70 A;  2CE0 A;  4WQE A;  2B12 B;  5CIG B;  1KYO W;  5KLI B;  3SJL A;  1AKK A;  2PAC A;  3TGU D;  1ETP A;  1CC5 A;  4L3H A;  1YFC A;  2YK3 A;  5GTI V;  1N50 A;  1GDV A;  2CE1 A;  1BGY D;  3VMA A;  4EDF A;  3ITK A;  2MHM A;  1FHB A;  3RLM A;  1MZ4 A;  4AAN A;  3BCC D;  1HJ3 A;  3OCD B;  1YCC A;  3CXH D;  4FB1 A;  5EXQ A;  3VRD A;  1IO3 A;  2BCN B;  2ZXY A;  4WQC A;  2B10 B;  2V08 A;  2QJY B;  1C2R A;  1DW2 A;  1BCC D;  1KX2 A;  2VHD A;  1HZV A;  1HRC A;  4V2K A;  1BE3 D;  1OCD A;  1FCD C;  1DW3 A;  3O5C A;  1CRC A;  3HQ9 A;  2N3B A;  2B0Z B;  3H1L D;  1DT1 A;  2DVH A;  3SXT A;  1CIE A;  3H1K D;  2CXB A;  1K3G A;  2OZ1 A;  3DP5 A;  1EZV D;  1A2S A;  1I6E A;  3GG2 A;  5CIC B;  4FAN A;  3OA8 B;  1FI7 A;  5H2F V;  1C6R A;  3H1I D;  1DVV A;  1BL9 A;  2B11 B;  3L4M A;  2KS1 A;  1CHI A;  4EID A;  1LS9 A;  4WQB A;  1KV9 A;  1CTJ A;  1MG2 D;  1IZL 0;  1I54 A;  3A0H V;  1H31 A;  1CIG A;  1H33 B;  2GB8 B;  2N9Y B;  1JDL A;  1HCM A;  1I8O A;  3TYI A;  4IL6 V;  3A9F A;  3CX5 D;  3PXT A;  1KYO D;  1C52 A;  1CSU A;  2A06 D;  4L3G A;  3RN0 A;  3NBS A;  1N9C A;  3PXW A;  3L70 D;  5DF5 A;  2QJP B;  4YE1 A;  4XYD B;  2DGE A;  2IBZ D;  1CRY A;  1CNO A;  4K3I A;  1NTM D;  4QAO A;  1DVH A;  2YIU B;  1GU2 A;  3ZOX A;  5E79 V;  1R0Q A;  1S5L V;  4EIC A;  2N18 C;  1ZRT D;  3SWS A;  1KB9 D;  1QN2 A;  2B4Z A;  3ORV A;  2GIW A;  1NU1 D;  3CP5 A;  1M60 A;  1FI3 A;  4PD4 D;  2ZON G;  1KB0 A;  2GC4 D;  3CX5 W;  3RN1 A;  1QL3 A;  1AYG A;  4O1Q A;  3WFB C;  1PPJ D;  1AOQ A;  1P84 D;  1YTC A;  3O1Y A;  1COR A;  1IRW A;  2YCC A;  1C6S A;  3H1H D;  2C1D A;  3PH2 B;  1I6D A;  2Y0E A;  2RN0 A;  4J20 A;  1H32 A;  2C1U A;  3WFE C;  1OAE A;  2N9I A;  1SQQ D;  2JWA A;  3PTZ A;  4U3F D;  1U75 B;  2XTS B;  5CYT R;  3L73 D;  5B6Q A;  1CXA A;  4GYD A;  4H0J A;  2QJK B;  3H1J D;  1GJQ A;  1KIB A;  1NNO A;  1SQB D;  4EIE A;  1WEJ F;  1MG3 D;  2CA4 B;  1L0N D;  2V07 A;  4D6T D;  1C7M A;  4AX3 A;  1CTZ A;  5CIF B;  3ZOY A;  1LC2 A;  4PWA A;  5KAF V;  2FYU D;  1AOF A;  1N90 A;  1IRV A;  1NIR A;  4UB6 V;  4FA9 A;  2GC7 D;  2N9J A;  3ZCF A;  1LMS A;  1L9J C;  3DMI A;  1FOC A;  3M97 X;  1I55 A;  2N18 B;  1W5C T;  1QYZ A;  1E29 A;  3MK7 C;  3OCD A;  1DII C;  4Q5P A;  1F1C A;  2C9X B;  1VYD A;  4N0K A;  2L4D A;  4L1Q A;  3HQ6 A;  4Y5R A;  1CIF A;  351C A;  1C6O A;  2BH5 X;  4FA5 A;  4H0K A;  1CYJ A;  1L0L D;  1CRI A;  1S6V B;  3PRJ A;  3WU2 V;  2O3J A;  1SQV D;  3KZI V;  5KLV D;  1H9X A;  1CHJ A;  2BH4 X;  1QKS A;  5C0Z A;  1H1O A;  2LIT A;  1CO6 A;  1K3H A;  3HQ7 A;  3WC8 A;  1C75 A;  3WFD C;  2Y0C A;  155C A;  1EB7 A;  3L74 D;  3DR0 A;  2FYN B;  1LFM A;  4GED B;  1QL4 A;  3ZOO A;  3OA8 A;  1CIH A;  4RJT A;  1L9B C;  4PW9 B;  4O1W A;  1YNR A;  2L91 A;  3CWB D;  4AAL A;  1YEA A;  1C2N A;  1U74 B;  4P4Q B;  2N3Y A;  4WQA A;  2BCC D;  1CYI A;  3JBT B;  1LC1 A;  1H33 A;  1NTZ D;  3L71 D;  3X39 A;  1CXC A;  2JTI B;  1RAQ A;  3ZOW A;  3GW6 A;  1CRG A;  1CSV A;  1PP9 D;  4KMG A;  1HJ5 A;  3WFC C;  1DW1 A;  2HV4 A;  2I8F A;  1NTK D;  1KX7 A;  3MK7 B;  3ZBM A;  5GTH V;  5TIS V;  3O0R C;  3WUI A;  3CYT I;  5B66 V;  1A56 A;  3L4O A;  1COT A;  4AAO A;  5KAI V;  2AI5 A;  1I5T A;  1RZ5 A;  1CRJ A;  2YQB A;  2PCB B;  4FA1 A;  3NBT A;  2BGV X;  3FWL A;  4A7P A;  1ZZH A;  1M6Z A;  2OZ1 B;  3SVW A;  1NMI A;  5B5E V;  2MTA C;  1CHH A;  1HJ4 A;  1IQC A;  4EIF A;  5TJH A;  5C9M A;  1CSX A;  2D0W A;  4WQ9 A;  2RMZ A;  4AAM A;  2JQR A;  2C8S A;  1H31 B;  1HRO A;  1H9Y A;  1CED A;  5DJQ C;  1CSW A;  4WQD A;  5CIH B;  2KNC B;  1N15 A;  2FRC A;  4JCG A;  4MU8 A;  2PCC B;  4NFG B;  2BLF B;  2QG4 A;  3NWV A;  2EXV A;  3CU4 A;  1DW0 A;  1YIC A;  1B7V A;  1GKS A; 
#chains in the Genus database with same CATH topology
 1RAP A;  3VMX A;  4U3F G;  1SQP D;  1RZ6 A;  451C A;  3KDP B;  5CCG A;  5KJ7 C;  1A02 J;  2WSC H;  2MKV A;  5CBN A;  1OWA A;  1SQB G;  3G71 P;  1FDI A;  3B5N C;  2WQY C;  2M3B A;  2C2C A;  3G4S P;  1L0N K;  5GTH H;  1LTI C;  3KYQ A;  1NGM B;  3PXS A;  4PJ0 V;  2FWL A;  2FYU K;  1E8E A;  1DIP A;  3E1R A;  2Z5I A;  1U57 A;  1CRH A;  1KTM A;  1LWU A;  4H13 D;  5AVV B;  4CPG A;  1WMK A;  1QL2 A;  2K9J B;  3ZIY A;  1FJ0 A;  1CYC A;  5BU8 B;  1CCH A;  4OVN F;  5DFS A;  1N73 C;  2Z4E A;  1KIL C;  2W90 A;  1RE4 C;  1HF9 A;  4EIJ A;  1GK6 A;  2ZT9 B;  1RY3 A;  1VQ5 P;  1SQV K;  5KLV K;  2RKL A;  1QGK B;  3TF5 A;  4RSZ A;  3TK1 A;  5KAF H;  3KHU A;  3E7K A;  1YIQ A;  2ZYD A;  4TLF A;  4UB6 H;  2Q7C A;  1VQP P;  1W5C E;  2QA4 P;  3P7K A;  1PZQ A;  3SLE A;  1G1J A;  2QVA A;  3A0B E;  1AKK A;  1PFI A;  2PAC A;  4L3H A;  3AE9 C;  2YK3 A;  3CLQ A;  2D2C B;  1N50 A;  2ZAE B;  4N3Y B;  2CE1 A;  5CCH C;  1FZF A;  2QEX P;  2WWW A;  3P8M C;  1NTK E;  3WU2 H;  1L4A B;  4AAN A;  1HJ3 A;  3OCD B;  3LW5 H;  1NTZ K;  4WBA A;  2CPB A;  1NU1 G;  1IO3 A;  2V08 A;  3RK3 E;  2QJY B;  2WSF H;  2E76 B;  2Q3I A;  3L70 J;  1HZV A;  2IFN A;  4V2K A;  3CX5 H;  1JB0 J;  1FCD C;  1DW3 A;  2MJZ A;  3HQ9 A;  2OGU A;  2GUV A;  2N1T B;  2DVH A;  3SXT A;  1LTB C;  1ZLL A;  3B8E B;  5APY A;  1K3G A;  3FWN A;  2D2C C;  5CIC B;  3OA8 B;  2O01 H;  3IF4 A;  1C6R A;  5CJ4 A;  3GMA A;  1XTG B;  3HD7 D;  1BL9 A;  2XV5 A;  4L75 A;  2J5U A;  3AEG C;  1MKM A;  4PD4 H;  5C39 A;  2G8Y A;  4D6T G;  1I54 A;  2P58 A;  1NAF A;  1JNM A;  2E74 B;  5KAI H;  3ABV C;  3V4W A;  2M5A A;  2OTK E;  1YTZ T;  1SQQ J;  1KYO D;  3A0H E;  5AW1 B;  1NAY A;  2KP8 A;  4NPD A;  4YE1 A;  1LT1 A;  1X0T A;  1ZOY C;  4HB1 A;  2WPQ A;  4IL6 E;  2DGE A;  3FGA D;  1L0L G;  2YIU B;  4ZKU A;  1KZU B;  5E79 V;  1R0Q A;  2E43 A;  4IL6 X;  3SWS A;  2K9Y A;  3JCU H;  3L72 E;  2NPS D;  1LTG C;  1HTL C;  2FYU J;  1M60 A;  3HD7 A;  1FI3 A;  3CMA P;  3CCR P;  3CX5 W;  4GT1 A;  2O1K A;  4O1Q A;  1K05 A;  1VQM P;  4C7N B;  2Y0E A;  2C0W A;  1H32 A;  4ASW A;  1OAE A;  3D0W A;  1BSH A;  1SQX K;  4WWI A;  5GTH E;  4U3F D;  1SQP J;  3L71 G;  2AXT H;  2FYN C;  4RES B;  3G6E P;  4PV1 B;  4H0J A;  1OMI A;  3NMD A;  1KIB A;  1SQB D;  1BGY E;  1YI2 P;  2YKO A;  1WEJ F;  2JO1 A;  4YTP C;  3L74 J;  3BCC E;  2XND H;  2NPS A;  3RL0 D;  5CIF B;  1NYH A;  3M0A A;  4H44 C;  1N90 A;  4C7N A;  1CW5 A;  1IFM A;  1DEB A;  1I55 A;  1M57 D;  3RK2 C;  3RBX A;  3V2P A;  4WVZ A;  1E29 A;  1VPC A;  4Q5P A;  5KAF E;  1F1C A;  1JY2 O;  4N0K A;  5AW2 B;  1BE3 E;  1IFN A;  4UB6 E;  351C A;  4L74 A;  5AW8 B;  2B87 A;  1FC2 C;  2LR2 A;  4H0K A;  1GL2 A;  3IN6 A;  1VQN P;  3H1L E;  3H25 A;  1CRI A;  2HLO A;  1H0T B;  3I56 P;  2PP6 A;  1H9X A;  3H1K E;  3M0D C;  1CHJ A;  1JCC A;  1QKS A;  4Y99 C;  1K3H A;  2DW3 A;  1LP1 B;  3VOP A;  3WU2 E;  1H88 A;  2Y0C A;  5APX A;  1GD2 E;  1FAV A;  2C9L Y;  2YKQ A;  1WT6 A;  3AE7 C;  3DR0 A;  1MUU A;  4DZO A;  1KV4 A;  1CIH A;  3Q1M A;  3CWB D;  1LTS C;  1YBK A;  1C2N A;  3CX5 E;  3JC2 2;  2N3Y A;  4XA4 A;  4M3L A;  1H0T A;  1PV3 A;  1LT9 B;  1H33 A;  2M0B A;  3CC7 P;  1CRG A;  1M90 Q;  2LXC B;  4KMG A;  1NTM E;  1DEE G;  2AEF A;  2HV4 A;  1LP1 A;  1NTK D;  1KX7 A;  4PD4 I;  1LJ2 A;  1VF5 D;  3CC2 P;  1SVF A;  3WUI A;  1EXI A;  2W6J H;  5CBO A;  4AAO A;  1RF1 B;  3V6I A;  3RK3 D;  3VYI A;  2Q6Q A;  1S1C X;  1SFC D;  3GHG A;  3HE4 B;  2FY8 A;  4PD4 E;  1OFC X;  5AW7 B;  1NTM G;  1YJN P;  3NBT A;  3VP9 A;  3VMY A;  4A7P A;  4TT3 H;  5KAI E;  2XDJ A;  2HPC A;  2OZ1 B;  1H8A A;  3HUS C;  1ZXG A;  1LT9 A;  3H1H E;  2MTA C;  1CHH A;  2A45 I;  1NU1 K;  5KKZ C;  2ZYA A;  1KFN A;  4NPE A;  2KS1 B;  2D0W A;  1A02 F;  2UWJ E;  1AQT A;  2KUB A;  3L73 E;  2JQR A;  1LNQ A;  3L75 J;  2IZ0 A;  3H1J E;  3BRT B;  2FRC A;  4JCG A;  4MU8 A;  2ZVN B;  2E5T A;  3N4X A;  1SQX J;  4WY4 D;  1GW3 A;  2OYH C;  2AEM A;  3JCU E;  1VQ4 P;  3CU4 A;  4IFM A;  3F89 A;  1DW0 A;  1M56 D;  1B7V A;  1GKS A;  3NXS A;  3H32 A;  1Q7Y Q;  5CID B;  1SFC A;  3CXH W;  2H7H A;  1UII A;  3H1J G;  2KSJ A;  1E2R A;  3VNW A;  1URQ B;  1S3J A;  1LGH B;  1DIQ C;  3TGU J;  2R3S A;  1KYO I;  1IK9 A;  1CTY A;  1Q90 D;  2AXT E;  3I5C A;  3A3Y B;  1YQ3 C;  4HJG H;  3IAO A;  3VYM A;  3S1K A;  3L72 D;  1GQ1 A;  1HH7 A;  4JYB A;  4LGD E;  2ZOO A;  4WQ8 A;  4U3F J;  4OGQ B;  2C1D B;  5CMZ A;  1J1E C;  4I7Z B;  4JYC A;  1L0L K;  3TSI A;  1EQ7 A;  2E75 C;  2GA1 A;  1SQB J;  1FE6 A;  1NML A;  3PHL A;  1VQO P;  3A0B V;  4I1L A;  1BDC A;  3MHV A;  1I8P A;  1GDT A;  1K04 A;  1LTJ A;  1ZR2 A;  1G1I A;  4WQE A;  2FYZ A;  1JEK A;  3MZW B;  1JY2 P;  3V2Q A;  2FFD C;  1KQG B;  2BEZ F;  1YFC A;  5GTI V;  3EFG A;  1BGY D;  1OW7 A;  2IYO A;  4EDF A;  3B5N B;  3ITK A;  1QVF O;  2MHM A;  1TU3 F;  1FHB A;  3CL3 D;  3VP8 A;  3BCC D;  1DX7 A;  3M9B A;  5M1B A;  4B86 A;  2C0X A;  4HH2 A;  4YXW H;  3VRD A;  2IX7 C;  2B10 B;  5AW0 B;  4PJ0 H;  1C2R A;  1G2C B;  3M9Q A;  1BE3 D;  2P2U A;  5AW4 B;  4C46 A;  1AQ5 A;  3O5C A;  1CRC A;  1N73 B;  2IPP A;  1KQL A;  1KIL B;  3H1L D;  1DT1 A;  3H6P A;  1M8O B;  2K1A A;  3H1K D;  2WVR A;  1VL2 A;  3DP5 A;  1K8A Q;  1A2S A;  2RH0 A;  4LC1 A;  1BDD A;  1FI7 A;  1X9V A;  1KB9 H;  1N8R Q;  1NU1 J;  1N7S B;  2OTL P;  1LS9 A;  1KV9 A;  5B66 H;  3A0H V;  1H31 A;  1CIG A;  2GB8 B;  1KMI Z;  3W67 A;  3AE6 C;  4IOI H;  3TYI A;  1N73 A;  4IL6 V;  3CX5 D;  4L3G A;  1CSU A;  2ZT9 D;  3NBS A;  5CCG C;  3PXW A;  1EDK A;  1GZL A;  3WUU A;  1Q2N A;  1PIX A;  5AVT B;  2WPV B;  1X22 A;  5B5E H;  1CNO A;  4K3I A;  1MFZ A;  1NTM D;  1SQP K;  2FXP A;  5AVS B;  2KYV A;  3CCU P;  3ZOX A;  3B4S A;  3AEE C;  4H0L C;  1VQ9 P;  1S5L V;  4EIC A;  4RKU J;  1ZRT D;  2QM7 A;  4D6T J;  4U7J A;  1FS0 E;  2B4Z A;  2WT7 B;  3CWB E;  3CP5 A;  2QSI A;  2KIK A;  3CCS P;  4PD4 D;  1L2P A;  3KQG A;  5APW A;  1KB0 A;  1N7S C;  2Y9Z A;  1JTH B;  1L4A D;  2W83 C;  2K9J A;  1NKN A;  1YTC A;  2Y9Y A;  3RBZ A;  3H1H D;  3PH2 B;  2RN0 A;  4J20 A;  2C1U A;  3WFE C;  1RF0 C;  2O01 N;  3CWB G;  2E76 D;  1L0L J;  1MV8 A;  1OW6 A;  2H88 C;  3A7O A;  3PTZ A;  5CYT R;  3L73 D;  3SWK A;  1NOH A;  3H1J D;  3M06 A;  2WT7 A;  2OYI B;  2N1T D;  1NTK G;  4EIE A;  2AXC A;  3OW2 O;  4DOJ A;  1MG3 D;  4W7Y A;  2CA4 B;  4H13 C;  1T3J A;  2KSE A;  4AX3 A;  1D7M A;  4KJM A;  5KAF V;  4UB6 V;  1RQV A;  1FOC A;  1L4A A;  1JMB A;  1HBW A;  3TNU B;  2YXQ B;  3MK7 C;  3OCD A;  1BCC E;  2C9X B;  3HQ6 A;  4Y5R A;  5E79 H;  3L71 J;  2E74 D;  2BH5 X;  4UB8 H;  1M1K Q;  2HYN A;  2NZ2 A;  3WMM 0;  3E1I A;  2WSC J;  1J2J B;  3WU2 V;  1QLE D;  2ZYG A;  3I55 P;  1Q82 Q;  3Q5P A;  1CI6 B;  1KOR A;  2BH4 X;  1BCC G;  1H1O A;  1EZV E;  1CO6 A;  2HOD B;  1KQF B;  1WRG A;  2OYI C;  1M1J B;  2N1T A;  3HQ7 A;  1C75 A;  3H1I E;  2W6A A;  1OZH A;  2FYN B;  3RGU A;  3SFD C;  1K73 Q;  3OA8 A;  3AEB C;  4YPC A;  1FZC C;  4PJ0 E;  4O1W A;  1YNR A;  5L8R J;  2IBZ I;  4GOE A;  1U74 B;  2A06 E;  4P4Q B;  1YHQ P;  1LTA C;  3H1I G;  1CYI A;  4RO0 A;  2JR8 A;  4H44 B;  3KXD A;  2IZ1 A;  1RAQ A;  1CI6 A;  1KB9 I;  3QH9 A;  3GW6 A;  3C8V A;  1Q86 Q;  1CSV A;  2IBZ E;  4N78 E;  3RK2 B;  1FZA A;  2XU6 A;  1EDJ A;  5TIS V;  2YO2 A;  2A06 G;  3L72 G;  2IYP A;  1KB9 E;  1GL2 D;  1M1J C;  5KAI V;  4Z1M H;  5H2F H;  2WIT A;  1I5T A;  4PV1 D;  1NH4 A;  2ZFC A;  1OVR A;  1XTC C;  3AE8 C;  2IBZ G;  1CRJ A;  5B66 E;  4FA1 A;  3HD7 C;  4Y99 B;  3HE5 B;  4MN4 C;  1CSB A;  3LW5 J;  3SVW A;  3HTK B;  1HJ4 A;  1IQC A;  4HYT B;  1SQQ E;  1E79 H;  2WSF J;  3CCL P;  5C9M A;  5B5E E;  1FZE A;  2C8S A;  1HJB A;  1HRO A;  1H9Y A;  5DJQ C;  3CCM P;  1KIL E;  1N15 A;  1BGY G;  3NTN A;  1YQ4 C;  2KZI A;  3BCC G;  1NTM J;  4ZMD A;  1YIC A;  1J3S A;  1L0N E;  2K37 A;  3AE2 C;  3B71 A;  4XXL A;  2AIU A;  3U1A A;  5KLI C;  2XNX A;  2FYU E;  2O01 J;  2BPB B;  1SQB K;  1IFJ A;  4ZKP A;  1ZV8 A;  1PGP A;  3PLN A;  1IZN B;  1BE3 G;  1FDO A;  5CIB B;  1H89 A;  4EOT A;  2AXT V;  1L0N G;  4FA4 A;  3CX5 I;  3H1L G;  4ZNC A;  3O20 A;  1HGV A;  4R4L A;  1A8C A;  3RMZ A;  1KFM A;  3H1K G;  2Y0D A;  1SQV E;  2L5G B;  3HUS B;  5KLV E;  3P32 A;  1BSN A;  2JJL A;  2P67 A;  3D6Z A;  2CPS A;  5KKZ B;  3MUD A;  1SLQ A;  1GIW A;  2ORL A;  4K3A A;  3SSU A;  3CXH H;  1USE A;  2JKV A;  3RL0 g;  5AW3 B;  3H1J J;  2R5B A;  3L74 E;  1X79 B;  2C1V A;  1SQV G;  3V4Q A;  4BWN A;  5KLV G;  4JF7 A;  3RL0 C;  5AW9 B;  2LIR A;  4DY9 A;  2WMM A;  2B88 A;  3CPW O;  2ZVO B;  2OYH B;  3II6 A;  1CZQ A;  1ZRT E;  2KK7 A;  3D70 A;  4IFF A;  2BCC E;  3CCV P;  1YTZ I;  4UB8 E;  5CIG B;  4DJG A;  1KYO W;  3Q3D A;  1NTZ E;  3HUS A;  1ETP A;  5BVZ A;  1PP9 E;  3VMA A;  3S9O A;  3KZI H;  3RLM A;  1MZ4 A;  1J1D C;  1VDF A;  2KLV A;  2QJP C;  2BCC G;  3UIA A;  2KZJ A;  1DD3 A;  5EXQ A;  2ZXY A;  1NTZ G;  4IFD K;  1VQ6 P;  1BCC D;  2OYH A;  2VHD A;  1RF1 A;  3V2R A;  3H1H G;  2C9N Y;  1J1E B;  3GF3 A;  3G3Z A;  2B0Z B;  3HE4 A;  3R4Y A;  2QE7 H;  2E75 B;  1UIX A;  1JO5 A;  1CIE A;  2CXB A;  2OZ1 A;  3L73 G;  1URQ D;  1EZV D;  1I6E A;  3LIE A;  4R4M A;  1JMM A;  1JY2 N;  4KT0 J;  3H1I D;  1DVV A;  1S9K E;  4GKG A;  2KS1 A;  2FFD B;  4DT0 A;  4EID A;  4WQB A;  4W7Z A;  3BAS A;  1CTJ A;  1VF5 C;  1MG2 D;  1IZL 0;  1EDI A;  1HH0 A;  2J59 M;  5H2F E;  2K3R A;  4WY4 B;  1ZP0 C;  3R2P A;  2N9Y B;  1HCM A;  1I8O A;  1P84 H;  4OGQ D;  3Q5R A;  2Z5H A;  3A9F A;  3RK3 C;  3PXT A;  2QJK C;  4O9B A;  2A06 D;  4C7R A;  5GTI H;  1SFC C;  4EI2 A;  3L70 D;  5CHX A;  1AA0 A;  4XYD B;  1JY3 P;  1S4X A;  4GDO A;  2IBZ D;  1CRY A;  4N78 D;  3V2N A;  1T2K D;  4QAO A;  2YNY A;  1YJ9 P;  2E42 A;  1EXJ A;  1URQ A;  2N18 C;  1FBM A;  1Y47 A;  1KB9 D;  3ORV A;  5AVU B;  3L75 E;  5KJ7 D;  2GIW A;  3O8Z A;  2ZON G;  1SS1 A;  2GC4 D;  3RN1 A;  1QL3 A;  3AE4 C;  3B5N D;  1SQX E;  1AYG A;  3CCE P;  2I8D A;  1AOQ A;  3O1Y A;  4WY4 C;  4ASV A;  2JDI H;  4EYY Q;  1C6S A;  3IR9 A;  2C1D A;  1USD A;  3OAK A;  2N9I A;  5APS A;  1R8E A;  2M3E A;  3VMZ A;  1SQQ D;  1AFO A;  2JWA A;  3L37 A;  3BAT A;  4I2L C;  1NHL A;  1FZG A;  4GYD A;  2W8Z A;  3TGU E;  3A0H H;  1KIL D;  1GJQ A;  1NNO A;  2M8R A;  1RE3 A;  2QIW A;  2H8P D;  3K5B A;  1L0N D;  1C7M A;  2FKW B;  3T97 B;  5KJ7 A;  4GOD A;  2PAJ A;  1CTZ A;  1LC2 A;  3CXH E;  1X8Y A;  2FYU D;  1AOF A;  4Y28 J;  1IRV A;  1NIR A;  4FA9 A;  3B5N A;  1L9J C;  4H0L B;  3M97 X;  3CWB J;  1KC8 Q;  1VQK P;  1QYZ A;  1DII C;  2J58 A;  1VYD A;  2L4D A;  2YXR B;  4L1Q A;  2YKP A;  2V7Q J;  1CIF A;  1S5L H;  4LLH A;  1C6O A;  1IJD B;  3C9I A;  5CCH D;  3PP5 A;  2PFX A;  3OJA B;  1S6V B;  1G2C A;  1N86 A;  1NTK J;  2O3J A;  1SQV D;  5KLV D;  1PGQ A;  1R5S A;  2GUS A;  5C0Z A;  1QEX A;  2IFM A;  2LIT A;  1KIL A;  1RE4 A;  3T97 A;  2XKM A;  1OVU A;  1NWQ A;  3M91 A;  3CC4 P;  5K5G B;  3KZI E;  3AE3 C;  155C A;  3GF7 A;  1EB7 A;  1PGJ A;  3L74 D;  1LFM A;  3ZOO A;  1SP4 A;  2R3C A;  2I1K A;  3MP7 B;  1N7S A;  4AAL A;  1AV1 A;  4H13 B;  1LWU C;  3CI9 A;  2ITA A;  2XZR A;  3A5T A;  1NJI Q;  4QMA A;  2BCC D;  3FXD A;  1S2E A;  2D2C D;  1IO4 A;  1NTZ D;  2ZXX A;  1CXC A;  1IFP A;  3ZOW A;  2W6B A;  5CCH A;  3CCQ P;  5BU5 A;  1BCC J;  2OAR A;  1RF0 A;  3VTP C;  1PP9 D;  5AVX B;  1HJ5 A;  1DW1 A;  1OXZ A;  3MK7 B;  5GTH V;  2BAS A;  3BVH A;  2FBW C;  1IFI A;  3O0R C;  3O6Q B;  2WSE J;  3CYT I;  5B66 V;  1RH5 B;  1COT A;  1P84 I;  4I6M C;  1PL5 A;  1RZ5 A;  3AE5 C;  1NTM K;  1NU1 E;  2PRR A;  2YQB A;  2PCB B;  1RHZ B;  3FWL A;  1ZZH A;  1PPJ E;  3H1I J;  1P84 E;  1M6Z A;  1T6A A;  1NMI A;  5B5E V;  5GTI E;  3U59 A;  1DH3 A;  1GU4 A;  1JTH A;  3PH0 A;  5TJH A;  3V5B A;  2WTY A;  1RQU A;  2ZT9 C;  4WQ9 A;  2KOG A;  1FZC B;  3O6Q A;  2LKM A;  3L72 J;  1PPJ G;  1QX8 A;  2ZXE B;  4WQD A;  4BXL A;  5CIH B;  2GM4 A;  2KNC B;  1S9K D;  2AEJ A;  2M5A B;  2PCC B;  3NFQ A;  2EXV A;  1EZV I;  1GW4 A;  4D6T E;  2CA3 B;  4OH8 B;  1HVV A;  5CIE B;  2OYI A;  2WSS H;  4LJI A;  1FI9 A;  2YMY A;  3HQ8 A;  1AVY A;  1E5W A;  2N9B A;  1L4A C;  2B89 A;  5TIS H;  1WVE C;  2ZZS 1;  3TDK A;  1FZC A;  2PGD A;  1W2L A;  1GK4 A;  1JOC A;  4OWF A;  1W2E A;  3HD7 B;  3C2C A;  2KNC A;  3TNU A;  1L0L E;  1BGY J;  2QJY C;  1CCR A;  3EFF K;  2E76 C;  3SWY A;  3BCC J;  4H44 D;  1EZV G;  2ZBO A;  3L75 D;  1HZU A;  5IY5 1;  1OVV A;  1OIP A;  1H32 B;  1K9M Q;  3RK2 D;  2Q3E A;  3L70 E;  3IFM A;  1SQX D;  3C1L A;  1F1F A;  2P10 A;  2N1T C;  3L4F A;  5APT A;  4FAV A;  2A45 H;  1BE3 J;  5DJQ B;  5AUR A;  2HOD A;  3USS A;  1M1J A;  3U1C A;  1DD4 A;  2VRS A;  4UB8 V;  3F5H A;  1YEB A;  1L0N J;  3H1L J;  4WQ7 A;  2D0S A;  1M70 A;  2CE0 A;  1NO4 A;  3L70 G;  1S5L E;  3AED C;  3H1K J;  1N7L A;  1FOS E;  1YYC A;  2B12 B;  3WUV A;  5KLI B;  3SJL A;  2W27 A;  3Q2Y A;  1ZR4 A;  1FDM A;  3P8C E;  3L71 E;  3ZDM A;  3TGU D;  2NPS B;  1CC5 A;  5APV A;  1GDV A;  2E74 C;  3EQ2 A;  2YMK A;  1S5L X;  1JY3 O;  1QL1 A;  1YCC A;  3CXH D;  1HWT C;  3EWK A;  1SQV J;  4FB1 A;  5KLV J;  2B87 B;  4WQC A;  2BCN B;  1M7L A;  1AVO A;  1GL2 B;  3AE1 C;  1FU1 A;  5DJT B;  1DW2 A;  3WUT A;  5AW6 B;  3S4R A;  2YIU C;  1KX2 A;  3QWO C;  1HRC A;  1KYO H;  1OCD A;  5AW5 B;  3TYY A;  1JUN A;  5AVR B;  2WPR A;  1MZ9 A;  2IDB A;  2N3B A;  4WB4 A;  2P7J A;  5AVQ B;  1SQQ G;  2WZ7 A;  1GTW A;  3M0D A;  2I1J A;  2NRG A;  3PJS K;  3HE5 A;  2R32 A;  2P1J A;  1R5L A;  4KHX A;  3RL0 B;  2NPS C;  5APU A;  5APQ A;  3GLM A;  3HTK A;  3GG2 A;  4FAN A;  1FJK A;  1NVO A;  2BCC J;  5H2F V;  1NTZ J;  1HUC A;  2Q1K A;  1Z56 A;  4GOF A;  2B11 B;  3L4M A;  3AEC C;  1W2B O;  1CHI A;  1VQL P;  1PP9 J;  3M9H A;  1H33 B;  1IC2 A;  2FYU G;  1JDL A;  3H1H J;  2QM8 A;  1GL2 C;  3CD6 P;  1SQP E;  1QVG O;  4PV1 C;  4W80 A;  1C52 A;  4DCK A;  1J1D B;  3RN0 A;  3KPE A;  1N9C A;  1N2D C;  5DF5 A;  2QJP B;  3L73 J;  3L36 A;  4L76 A;  1ZME C;  2H43 A;  1LTT C;  1DVH A;  1GU2 A;  3GHG B;  1SQP G;  4N6J A;  3MD0 A;  2HG5 D;  1VQ7 P;  3SWF A;  2HPC B;  1QN2 A;  2O1J A;  1OX3 A;  1NU1 D;  4AUW A;  5E79 E;  3MTU E;  3MUD C;  4L73 A;  4NPF X;  3L74 G;  3WFB C;  1PPJ D;  2H89 C;  2CK3 H;  1P84 D;  1HJ0 A;  1COR A;  1IRW A;  2G3A A;  2YCC A;  1MFT A;  1I6D A;  5DJU B;  4JPZ B;  2Q9I A;  1KN7 A;  1VF5 B;  2BEQ D;  4XFJ A;  1IFD A;  1GU5 A;  2KB7 P;  5TIS E;  1U75 B;  2HR3 A;  2XTS B;  3AEF C;  2FXM A;  3OA7 A;  5B6Q A;  1CXA A;  1HGZ A;  4BRY B;  3G9R A;  3H32 B;  1NTK K;  5AVW B;  3RK3 B;  3L35 A;  2QJK B;  1PP9 G;  1SFC B;  3GHG C;  1PGO A;  2E5Y A;  1EDL A;  2E75 D;  1JY3 N;  4JQ0 D;  2V07 A;  4D6T D;  1VQ8 P;  2ZJS E;  3BRV B;  1OW8 A;  3ZOY A;  1LT9 C;  4PWA A;  2YO3 A;  2GC7 D;  2N9J A;  3ZCF A;  1Q81 Q;  1LMS A;  3DMI A;  2JEE A;  1JCD A;  2N18 B;  1W5C T;  2JP3 A;  2HFE D;  4K35 A;  4AQR D;  2QRX A;  3A0B H;  1AJY A;  2V7Q H;  4FA5 A;  1RF1 C;  4BRY A;  1T3U A;  4YXD C;  1CYJ A;  1L0L D;  3PRJ A;  1NKZ B;  3KZI V;  3N7N A;  3D71 A;  1S72 P;  2A45 G;  1KQS O;  2KLU A;  3FXE A;  2Q5U A;  3FX0 A;  1U7M A;  1YIT P;  1Y8A A;  1ZW0 A;  4AYC A;  3WC8 A;  3WFD C;  1T8Z A;  1LTJ B;  4GED B;  1QL4 A;  2WPS A;  3HRN A;  3VN0 A;  4RJT A;  1L9B C;  3Q5S A;  1JM0 A;  4PW9 B;  1U7J A;  2L91 A;  2OTJ P;  2V4H A;  2R5D A;  2FFD A;  1YEA A;  3CME P;  1KYO E;  4WQA A;  3JBT B;  1LC1 A;  1FZB A;  4WY4 A;  3P8C D;  3L71 D;  3X39 A;  2JTI B;  1KD1 Q;  1FJP A;  1YIJ P;  3CCJ P;  4XE5 B;  3AEA C;  2SPZ A;  3WFC C;  2I8F A;  2B9B A;  1Y9B A;  3ZBM A;  1GMJ A;  1EC5 A;  1A56 A;  3L4O A;  3L75 G;  2WSE H;  2OQQ A;  1URQ C;  2AI5 A;  5CJ0 A;  5KTB A;  1SQX G;  1LTJ C;  5CCG D;  3JSV C;  2BGV X;  3CXH I;  3SFE C;  3MGN A;  1YJW P;  3MIW A;  2KXP B;  3LID A;  2FXO A;  3D6Y A;  5EFW B;  2LXB A;  1ZN5 A;  4IL6 H;  5AVZ B;  4OGQ C;  4H0L D;  4EIF A;  2POH A;  2OYO A;  2KI7 B;  4I7Z C;  2R44 A;  4U3F E;  1CSX A;  3W68 A;  2RMZ A;  4AAM A;  1H31 B;  3TGU G;  1FOS F;  4GIF A;  1CED A;  1CSW A;  1N7S D;  1IK7 A;  3A2A A;  1LWU B;  1SQQ K;  1SQB E;  1T2K C;  4NFG B;  2BLF B;  4JBZ A;  2QG4 A;  3NWV A;  4HKZ H;  2JWD A;  5AVY B;  1RE3 C;  2K88 A; 
#chains in the Genus database with same CATH homology
 1J3S A;  1RAP A;  4XXL A;  2CA3 B;  2AIU A;  5CIE B;  5CID B;  1SQP D;  1RZ6 A;  451C A;  2BPB B;  3CXH W;  4LJI A;  1FI9 A;  3HQ8 A;  3PLN A;  2C2C A;  5CIB B;  1E2R A;  3VNW A;  2AXT V;  1DIQ C;  3PXS A;  1WVE C;  2ZZS 1;  4PJ0 V;  3TDK A;  2FWL A;  4FA4 A;  1W2L A;  1E8E A;  3O20 A;  1CTY A;  3C2C A;  1CRH A;  1A8C A;  3RMZ A;  1CCR A;  2Y0D A;  2K9J B;  3ZIY A;  3VYM A;  1FJ0 A;  1CYC A;  3L72 D;  1GQ1 A;  1HH7 A;  2ZBO A;  2ZOO A;  3L75 D;  1HZU A;  5IY5 1;  1CCH A;  4WQ8 A;  5KKZ B;  2C1D B;  1GIW A;  5DFS A;  2ORL A;  1H32 B;  2Q3E A;  1SQX D;  1F1F A;  4FAV A;  3TF5 A;  5DJQ B;  4RSZ A;  2C1V A;  1NML A;  5AUR A;  3PHL A;  3A0B V;  4UB8 V;  3KHU A;  1YIQ A;  1YEB A;  2LIR A;  4DY9 A;  4WQ7 A;  1I8P A;  2D0S A;  3SLE A;  1M70 A;  2CE0 A;  4WQE A;  2B12 B;  5CIG B;  1KYO W;  5KLI B;  3SJL A;  1AKK A;  2PAC A;  3TGU D;  1ETP A;  1CC5 A;  4L3H A;  1YFC A;  2YK3 A;  5GTI V;  1N50 A;  1GDV A;  2CE1 A;  1BGY D;  3VMA A;  4EDF A;  3ITK A;  2MHM A;  1FHB A;  3RLM A;  1MZ4 A;  4AAN A;  3BCC D;  1HJ3 A;  3OCD B;  1YCC A;  3CXH D;  4FB1 A;  5EXQ A;  3VRD A;  1IO3 A;  2BCN B;  2ZXY A;  4WQC A;  2B10 B;  2V08 A;  2QJY B;  1C2R A;  1DW2 A;  1BCC D;  1KX2 A;  2VHD A;  1HZV A;  1HRC A;  4V2K A;  1BE3 D;  1OCD A;  1FCD C;  1DW3 A;  3O5C A;  1CRC A;  3HQ9 A;  2N3B A;  2B0Z B;  3H1L D;  1DT1 A;  2DVH A;  3SXT A;  1CIE A;  3H1K D;  2CXB A;  1K3G A;  2OZ1 A;  3DP5 A;  1EZV D;  1A2S A;  1I6E A;  3GG2 A;  5CIC B;  4FAN A;  3OA8 B;  1FI7 A;  5H2F V;  1C6R A;  3H1I D;  1DVV A;  1BL9 A;  2B11 B;  3L4M A;  2KS1 A;  1CHI A;  4EID A;  1LS9 A;  4WQB A;  1KV9 A;  1CTJ A;  1MG2 D;  1IZL 0;  1I54 A;  3A0H V;  1H31 A;  1CIG A;  1H33 B;  2GB8 B;  2N9Y B;  1JDL A;  1HCM A;  1I8O A;  3TYI A;  4IL6 V;  3A9F A;  3CX5 D;  3PXT A;  1KYO D;  1C52 A;  1CSU A;  2A06 D;  4L3G A;  3RN0 A;  3NBS A;  1N9C A;  3PXW A;  3L70 D;  5DF5 A;  2QJP B;  4YE1 A;  4XYD B;  2DGE A;  2IBZ D;  1CRY A;  1CNO A;  4K3I A;  1NTM D;  4QAO A;  1DVH A;  2YIU B;  1GU2 A;  3ZOX A;  5E79 V;  1R0Q A;  1S5L V;  4EIC A;  2N18 C;  1ZRT D;  3SWS A;  1KB9 D;  1QN2 A;  2B4Z A;  3ORV A;  2GIW A;  1NU1 D;  3CP5 A;  1M60 A;  1FI3 A;  4PD4 D;  2ZON G;  1KB0 A;  2GC4 D;  3CX5 W;  3RN1 A;  1QL3 A;  1AYG A;  4O1Q A;  3WFB C;  1PPJ D;  1AOQ A;  1P84 D;  1YTC A;  3O1Y A;  1COR A;  1IRW A;  2YCC A;  1C6S A;  3H1H D;  2C1D A;  3PH2 B;  1I6D A;  2Y0E A;  2RN0 A;  4J20 A;  1H32 A;  2C1U A;  3WFE C;  1OAE A;  2N9I A;  1SQQ D;  2JWA A;  3PTZ A;  4U3F D;  1U75 B;  2XTS B;  5CYT R;  3L73 D;  5B6Q A;  1CXA A;  4GYD A;  4H0J A;  2QJK B;  3H1J D;  1GJQ A;  1KIB A;  1NNO A;  1SQB D;  4EIE A;  1WEJ F;  1MG3 D;  2CA4 B;  1L0N D;  2V07 A;  4D6T D;  1C7M A;  4AX3 A;  1CTZ A;  5CIF B;  3ZOY A;  1LC2 A;  4PWA A;  5KAF V;  2FYU D;  1AOF A;  1N90 A;  1IRV A;  1NIR A;  4UB6 V;  4FA9 A;  2GC7 D;  2N9J A;  3ZCF A;  1LMS A;  1L9J C;  3DMI A;  1FOC A;  3M97 X;  1I55 A;  2N18 B;  1W5C T;  1QYZ A;  1E29 A;  3MK7 C;  3OCD A;  1DII C;  4Q5P A;  1F1C A;  2C9X B;  1VYD A;  4N0K A;  2L4D A;  4L1Q A;  3HQ6 A;  4Y5R A;  1CIF A;  351C A;  1C6O A;  2BH5 X;  4FA5 A;  4H0K A;  1CYJ A;  1L0L D;  1CRI A;  1S6V B;  3PRJ A;  3WU2 V;  2O3J A;  1SQV D;  3KZI V;  5KLV D;  1H9X A;  1CHJ A;  2BH4 X;  1QKS A;  5C0Z A;  1H1O A;  2LIT A;  1CO6 A;  1K3H A;  3HQ7 A;  3WC8 A;  1C75 A;  3WFD C;  2Y0C A;  155C A;  1EB7 A;  3L74 D;  3DR0 A;  2FYN B;  1LFM A;  4GED B;  1QL4 A;  3ZOO A;  3OA8 A;  1CIH A;  4RJT A;  1L9B C;  4PW9 B;  4O1W A;  1YNR A;  2L91 A;  3CWB D;  4AAL A;  1YEA A;  1C2N A;  1U74 B;  4P4Q B;  2N3Y A;  4WQA A;  2BCC D;  1CYI A;  3JBT B;  1LC1 A;  1H33 A;  1NTZ D;  3L71 D;  3X39 A;  1CXC A;  2JTI B;  1RAQ A;  3ZOW A;  3GW6 A;  1CRG A;  1CSV A;  1PP9 D;  4KMG A;  1HJ5 A;  3WFC C;  1DW1 A;  2HV4 A;  2I8F A;  1NTK D;  1KX7 A;  3MK7 B;  3ZBM A;  5GTH V;  5TIS V;  3O0R C;  3WUI A;  3CYT I;  5B66 V;  1A56 A;  3L4O A;  1COT A;  4AAO A;  5KAI V;  2AI5 A;  1I5T A;  1RZ5 A;  1CRJ A;  2YQB A;  2PCB B;  4FA1 A;  3NBT A;  2BGV X;  3FWL A;  4A7P A;  1ZZH A;  1M6Z A;  2OZ1 B;  3SVW A;  1NMI A;  5B5E V;  2MTA C;  1CHH A;  1HJ4 A;  1IQC A;  4EIF A;  5TJH A;  5C9M A;  1CSX A;  2D0W A;  4WQ9 A;  2RMZ A;  4AAM A;  2JQR A;  2C8S A;  1H31 B;  1HRO A;  1H9Y A;  1CED A;  5DJQ C;  1CSW A;  4WQD A;  5CIH B;  2KNC B;  1N15 A;  2FRC A;  4JCG A;  4MU8 A;  2PCC B;  4NFG B;  2BLF B;  2QG4 A;  3NWV A;  2EXV A;  3CU4 A;  1DW0 A;  1YIC A;  1B7V A;  1GKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...