1SQBD

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqbD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqbD01
1IZL0 3L73D 1HJ5A 1A56A 1CIGA 4AANA 2AIUA 4AALA 1NIRA 1H9XA 4EDFA 4MU8A 1CORA 2BPBB 2YK3A 5EXQA 1ZZHA 1LS9A 3NWVA 3CX5W 1IO3A 3ZBMA 1NMLA 1CTJA 1IRVA 4WQEA 4NFGB 1E8EA 2HV4A 4L1QA 1W5CT 1CO6A 2ZONG 1AYGA 1RAQA 1QL4A 2N9JA 2DGEA 1HH7A 4FB1A 2Y0DA 4UB8V 3ZOWA 1HROA 2B4ZA 1CIEA 4O1WA 4H0JA 4AAOA 1WEJF 2D0WA 2C1VA 4FANA 1C7MA 1L9JC 3TDKA 3WU2V 2MTAC 1CHIA 1DIIC 2RN0A 1CXCA 1CHHA 3O1YA 1N9CA 3H1HD 1CRJA 3X39A 1RAPA 2GB8B 1BE3D 2VHDA 4PD4D 2BH5X 3L4MA 5TISV 1FHBA 4UB6V 1QN2A 4FA5A 4AAMA 4J20A 2ZBOA 155CA 1MG3D 1LC2A 1H1OA 1H33A 5DJQB 1C52A 3WC8A 1IQCA 2O3JA 1YEBA 3OCDA 1C75A 4L3GA 3MK7C 1I8OA 1CCRA 1U74B 1I6EA 4WQ9A 3WFBC 2C8SA 4K3IA 5DFSA 3A9FA 2XTSB 2C1UA 2C1DB 5KAFV 3M97X 1N15A 1FJ0A 1CRIA 1SQBD 3VNWA 3SVWA 4WQ7A 3O5CA 1KB9D 3PXSA 2QG4A 4A7PA 1A2SA 1WVEC 1C2NA 451CA 3DMIA 4L3HA 3HQ7A 1JDLA 1B7VA 2PCCB 3PH2B 1MZ4A 3KHUA 4LJIA 4IL6V 2JWAA 1KYOW 3DR0A 4Q5PA 2OZ1B 2ORLA 4WQ8A 1HJ4A 3WFDC 1CNOA 4RSZA 1KX2A 2N3BA 1AKKA 1YCCA 1CRGA 1CRYA 1CYJA 1CXAA 2K9JB 5CIDB 2D0SA 1DW3A 1NMIA 351CA 2CA4B 1I55A 3L74D 1CCHA 5B66V 1YFCA 4D6TD 3JBTB 3ZCFA 1MG2D 1LMSA 1FI3A 2PACA 4JCGA 3CYTI 4WQCA 1NNOA 1OCDA 5CIFB 1DIQC 2BCCD 1W2LA 3L4OA 2FYUD 2BH4X 4EIEA 4KMGA 3SJLA 5DJQC 1GU2A 2N18C 1L9BC 1S5LV 3GG2A 1PPJD 1M6ZA 2BGVX 1C2RA 3H1LD 1C6SA 2GC7D 5CIEB 3L75D 3RMZA 2ZZS1 2FYNB 2N9IA 2JQRA 2ZXYA 1F1FA 1BGYD 3KZIV 3OA8B 3DP5A 1GDVA 1SQXD 2KS1A 5CIGB 2CXBA 4WQBA 1CRCA 1U75B 3NBTA 2Y0EA 5KLVD 5C9MA 1H32A 3VMAA 3RLMA 3WFCC 2V07A 2FRCA 3ORVA 5CIBB 1DW0A 1K3GA 4EIDA 3WUIA 1KYOD 1FI7A 2C2CA 4QAOA 4XYDB 3PRJA 4DY9A 1CTZA 5CIHB 1COTA 1N50A 3TGUD 1YTCA 1IRWA 1NTZD 4EICA 3ZIYA 1H33B 1ETPA 3ZOOA 3WFEC 1A8CA 1HZUA 5E79V 1CHJA 3OCDB 1SQPD 1S6VB 5TJHA 1QKSA 1HRCA 2IBZD 3CXHD 1I8PA 1YIQA 2OZ1A 5CYTR 4PW9B 3NBSA 2I8FA 3BCCD 1H31A 2EXVA 4FA1A 3L71D 2B11B 1CSUA 2CE1A 1AOFA 1KV9A 1I6DA 3O0RC 1OAEA 4N0KA 2B0ZB 1SQQD 4GEDB 3SLEA 3MK7B 3H1KD 1GKSA 3TF5A 3CXHW 1FCDC 3CWBD 1NU1D 4O1QA 2YQBA 5H2FV 1L0LD 4GYDA 4P4QB 1DVHA 3A0HV 2YCCA 3H1JD 2A06D 4WQAA 1I54A 1I5TA 2QJYB 5KAIV 3L70D 1CEDA 1GIWA 5IY51 1KB0A 4FAVA 2QJPB 4PJ0V 1DW1A 1VYDA 1C6OA 1DW2A 1M60A 1YNRA 3VRDA 3ZOYA 1HJ3A 5KKZB 3PXWA 1KX7A 2L91A 3VYMA 5AURA 1CYCA 1F1CA 3ZOXA 1P84D 2BLFB 3SXTA 1SQVD 5GTIV 2AXTV 3OA8A 1QYZA 1GJQA 4PWAA 1KIBA 4FA4A 1CSWA 1PP9D 1HZVA 2LIRA 4AX3A 2KNCB 1EB7A 5GTHV 2L4DA 1CSVA 1CYIA 5B5EV 3RN1A 1EZVD 3ITKA 1CSXA 2LITA 5KLIB 3TYIA 4RJTA 5DF5A 2C1DA 1E2RA 3GW6A 2FWLA 1BL9A 3PXTA 1C6RA 1ZRTD 1YEAA 4V2KA 3L72D 1M70A 1LFMA 5CICB 1HCMA 2PCBB 4U3FD 3PHLA 1RZ6A 2B10B 2RMZA 2GC4D 2N18B 1GQ1A 3PTZA 1H32B 2AI5A 1NTMD 2C9XB 1CIHA 3PLNA 3C2CA 3CU4A 1CC5A 3RN0A 1FOCA 2QJKB 4FA9A 2Y0CA 1NTKD 1FI9A 3FWLA 2YIUB 2GIWA 2N3YA 4WQDA 1J3SA 2V08A 2N9YB 2JTIB 4XXLA 1E29A 1CTYA 1N90A 3SWSA 1R0QA 3HQ6A 1LC1A 1DVVA 3CP5A 2DVHA 3HQ8A 4EIFA 1CRHA 4YE1A 1BCCD 4H0KA 1AOQA 3O20A 5C0ZA 1RZ5A 1YICA 5B6QA 1L0ND 1H9YA 2Q3EA 1CIFA 2CE0A 3CX5D 1K3HA 3H1ID 1QL3A 2CA3B 2MHMA 2BCNB 3HQ9A 2ZOOA 2B12B 1DT1A 1H31B 4Y5RA 3A0BV
chains in the Genus database with same CATH superfamily
1IZL0 5BVZA 2ZXXA 1A56A 3L74J 4O9BA 2JR8A 2BCCG 4D6TJ 2FYUG 4MU8A 3CCQP 2D2CB 4EIJA 3G3ZA 2V7QH 3NWVA 3H1JJ 1DH3A 4NFGB 3L75G 4L1QA 5GTIH 5APQA 1JEKA 2GA1A 1JUNA 1BGYG 1WMKA 2AEFA 3ZOWA 1HROA 2XDJA 1E5WA 3VMZA 1WEJF 1PGQA 1NO4A 1EDJA 3KPEA 3G9RA 2MTAC 4JF7A 5APSA 5AVYB 1SQXJ 2QM8A 1RF1C 2A45G 1LTJB 1CXCA 3O1YA 1LP1B 2Z5HA 3X39A 1RAPA 1LTIC 3E1RA 1FHBA 2E74B 1FU1A 4AAMA 4J20A 5M1BA 1NWQA 1MG3D 3VP9A 1SS1A 2WSFJ 1JTHB 2E5TA 1I8OA 4NPEA 1BSHA 5B66E 1AVYA 1GZLA 1N15A 1FJ0A 5CCHC 3CD6P 2HR3A 2G8YA 3AE4C 3VNWA 3O5CA 3PXSA 3L71G 3NFQA 1GK6A 1VQOP 5CCGD 3HE5B 2XKMA 4L3HA 4H0LC 3HQ7A 1Z56A 1JDLA 2PCCB 2H8PD 2QJPC 1MZ4A 3GLMA 3D70A 5AVWB 4IL6V 1Y47A 3DR0A 3H1LE 1JO5A 1PGJA 3A0BH 3M9HA 3MGNA 5EFWB 1KX2A 1L0LG 1FZAA 1AKKA 4RKUJ 1YCCA 3CWBJ 1CRYA 1BDDA 1BE3E 5CHXA 2RH0A 3L70G 4PJ0H 1OW8A 1VQ9P 3L73J 2YKOA 2CA4B 2AEJA 1ZXGA 1M1JC 4WY4C 3Q1MA 1Y8AA 1YJ9P 2KP8A 4TLFA 1MG2D 3AE6C 5AVUB 3W67A 2IZ1A 1FI3A 2HLOA 1ZN5A 4WQCA 1BDCA 1NNOA 3E7KA 1OCDA 5KTBA 5CIFB 4N78E 1SQVG 2BCCD 2FYUD 1HGZA 2J59M 1PGPA 1NTZE 4XFJA 1GU2A 1LWUC 3VMXA 1S5LV 3GG2A 1M6ZA 3B5NB 1C6SA 5CIEB 1SQQK 1URQD 3L75D 2QVAA 1DIPA 2QSIA 2N9IA 1IJDB 2YIUC 5AVQB 2ZXYA 1NU1K 2O1KA 4UB6H 1BGYD 2GUVA 3OA8B 3DP5A 1JOCA 1RY3A 1PFIA 4U3FG 3H32B 4HYTB 1U75B 3NBTA 5C9MA 4AUWA 1L4AD 3WFCC 2V07A 3L72J 1NTMG 1SQQE 4H13B 3H1KE 1VF5D 1N73A 1KYOD 1FI7A 5KAFH 3VYIA 1HJBA 2C2CA 3GHGA 5KJ7D 1NTKG 3WUUA 1RF1A 1NU1E 1OVRA 4TT3H 1DD4A 1PGOA 1GL2D 1COTA 3JCUE 1YTCA 2OYIC 3P7KA 4W7YA 3PH0A 3WUTA 4LLHA 3Q2YA 1H33B 1BCCG 1ETPA 4PV1C 1HZUA 1T6AA 3OCDB 2FY8A 1L0NG 2IBZD 4PJ0E 3CXHD 1YIQA 2OZ1A 1SFCA 5CYTR 1VQ7P 1N2DC 2NPSC 3BRVB 1EDKA 2A45I 2EXVA 3L71D 5CCHA 1A02J 2E76D 2J5UA 3AE8C 1RH5B 1IFIA 4BRYB 1LT1A 3Q3DA 3C9IA 4Y28J 2HFED 1S2EA 3V2QA 1YTZI 1GKSA 3RK2D 1RQVA 1L2PA 3CXHW 1EZVE 2WVRA 4O1QA 1N7SD 2YQBA 1LNQA 2FFDC 3U1CA 1L0LD 2HG5D 3RL0D 1K73Q 1OMIA 1QVGO 1VDFA 1ZRTE 1NJIQ 3H25A 4NPFX 1VQ8P 4UB6E 3L70D 1UIIA 1YI2P 2QJPB 2W8ZA 4R4MA 2ZXEB 2FKWB 1JMBA 1J1EC 2N1TA 1G2CB 1Q2NA 3PXWA 3SSUA 3IFMA 3F5HA 2V7QJ 1AV1A 1CYCA 3RBXA 3CCMP 1SQVD 5GTIV 3H6PA 1XTGB 4PWAA 2D2CD 1KIBA 2YKQA 4FA4A 1QL2A 1FE6A 4AX3A 1EB7A 1OWAA 1M1JB 3H1HJ 1BE3J 1KILE 3TNUB 2LITA 3TYIA 3S1KA 1FS0E 1JY3P 2JKVA 5CBOA 3H1IE 4JYCA 1W2BO 3RK3D 1BL9A 5L8RJ 3NXSA 1M70A 5CICB 2PCBB 4U3FD 1HJ0A 2IZ0A 3P8MC 3L36A 2JP3A 1LWUB 1GQ1A 3PTZA 3V5BA 2OTJP 1NTMD 1NTZJ 3FX0A 4IL6H 1OX3A 2YMKA 3CU4A 2VRSA 1FOCA 1NTKD 2YIUB 2GIWA 2BASA 2W6AA 2YKPA 2W90A 3AE9C 4C7RA 1N90A 1LC1A 1YIJP 2HYNA 1S72P 3CP5A 2DVHA 1N8RQ 1HH0A 1BCCD 5APUA 2FBWC 5AVSB 1LT9A 1Q82Q 3O20A 3L35A 1RZ5A 1HWTC 2I1KA 1L0ND 2SPZA 1H9YA 2CE0A 1PP9E 2KLUA 1K3HA 2KSJA 3L74G 2LXCB 1ZV8A 3UIAA 4D6TG 2I1JA 4DZOA 1USEA 2ZOOA 4Y5RA 3H1KJ 3A0BV 2Q1KA 2OYIB 3OAKA 4AANA 4AALA 4EDFA 3G71P 1KB9I 4PV1B 1UIXA 1FOSF 3V2NA 2YK3A 1S4XA 1PPJG 3CL3D 3ZBMA 1YYCA 1L4AB 1IRVA 4WQEA 4B86A 2HV4A 4I6MC 1CO6A 2ZONG 1AA0A 1QL4A 2DGEA 1NVOA 4GIFA 2Y0DA 4UB8V 1SQXG 1GL2B 1CIEA 4O1WA 2HODB 3AEEC 2KNCA 1T8ZA 4W80A 4AAOA 2C1VA 3VMYA 4FANA 1C7MA 3BASA 4BWNA 1OXZA 1TU3F 2A45H 2IX7C 3WU2V 2YO2A 3HD7A 3W68A 4C7NA 1CHIA 1DIIC 2RN0A 1IFNA 4IL6E 2K1AA 1CHHA 4JPZB 5KLVJ 1CSBA 2GB8B 1DEBA 1SVFA 4PD4D 3L4MA 4UB6V 1FAVA 5AVRB 1LC2A 2FYUK 1H1OA 5DJQB 1LTAC 3TK1A 1M7LA 1IQCA 2ZT9C 2C0XA 1NKNA 1C75A 4L3GA 3CXHH 2Y9ZA 3TGUJ 1CCRA 1U74B 1I6EA 4WQ9A 3M0DA 2QEXP 3A9FA 2KOGA 2XTSB 3GF7A 2C1UA 2PRRA 3RK2B 1JMMA 5KAFV 3I56P 3BCCG 3M97X 1SQPJ 4OGQC 2QG4A 2JEEA 3P32A 4A7PA 3HTKB 3RL0B 1H0TB 2BCCE 2FYUE 451CA 1MZ9A 1ZW0A 1B7VA 3PH2B 1OIPA 5AVZB 3SWKA 2JWAA 1Q81Q 3V6IA 2ORLA 4AQRD 4WQ8A 3CWBG 3WFDC 2Z5IA 1CNOA 3L75E 2KXPB 2WT7B 4LC1A 2MKVA 3KYQA 2N3BA 4L75A 1BGYE 3BATA 4GKGA 5APVA 1CXAA 2K9JB 5CIDB 1AFOA 4I7ZB 351CA 1I55A 3L74D 4L74A 3EFGA 1WT6A 1CCHA 2P10A 2H7HA 4D6TD 2ITAA 1RE3C 5KLIC 3M9BA 3CYTI 1KYOE 2POHA 3OJAB 2BH4X 3RK3B 1X79B 4Z1MH 2C9LY 1IK9A 1FZCC 1PPJD 2BGVX 3AE2C 1DD3A 2DW3A 5APYA 3RMZA 2IBZE 5CCHD 1N73C 3CPWO 3CXHE 1PP9J 3GHGC 1U7MA 3GMAA 3KZIV 3B8EB 2WSEH 3L72G 1GDVA 1SQXD 2KS1A 3L71E 1L0LK 1FZFA 5CIGB 4L76A 3Q5RA 4WQBA 1CRCA 1JY2P 2OYHC 1H32A 3RLMA 1LTBC 3ORVA 2FRCA 3KDPB 3AECC 1SFCC 2KZJA 4N3YB 2JJLA 4QAOA 3PRJA 1K04A 4I2LC 4WVZA 5CIHB 2CPBA 1P84I 1L0LE 3AEGC 1GW3A 1SQVK 4WY4D 2UWJE 1N86A 1MUUA 3L70E 1M8OB 1CHJA 2WQYC 3B71A 1S6VB 1R8EA 1Q90D 1K9MQ 1I8PA 1CW5A 1VQ4P 3NBSA 1KFMA 3MZWB 5DJUB 3BCCD 1H31A 1D7MA 1G1JA 1H89A 2B11B 4DOJA 2Q5UA 1SQVE 5GTIE 4ASVA 1AOFA 3CI9A 1I6DA 5AW8B 2ZT9B 2B0ZB 1CZQA 3AEAC 2N1TC 3TF5A 3CWBD 3RBZA 1NTMK 1JM0A 3M0AA 3MTUE 1LTTC 1LTSC 4OGQB 2KZIA 1NTKK 4GYDA 4P4QB 1DVHA 2YCCA 3FWNA 4GOEA 1I54A 4QMAA 4UB8H 1I5TA 3M9QA 1YQ3C 2KK7A 3LIEA 5IY51 2Q6QA 1KB0A 1YITP 4EYYQ 4U3FE 1C6OA 2FYUJ 3A2AA 1YNRA 3B5NA 1NTME 3WU2H 1HJ3A 1L0NK 4JYBA 3LW5J 3EFFK 2L91A 3VYMA 1RE3A 1FBMA 1NTKE 3SXTA 3H1HG 4PD4H 2LKMA 5AW1B 1VQ6P 2AXTV 1PL5A 3I5CA 3OA8A 1BE3G 4PV1D 1GJQA 3CC2P 1MV8A 1T3UA 2AEMA 2WPSA 2P67A 2WWWA 1FZCA 2LIRA 1BCCE 3CCUP 5GTHV 1VQLP 3V2PA 1JCCA 3RN1A 2NPSD 1OVUA 1L0NE 1KILA 4N6JA 1IFDA 5KLIB 2O1JA 2NRGA 5DF5A 2C1DA 2QA4P 3AEFC 1E2RA 3GW6A 2FWLA 5BU5A 2WSCH 1YEAA 4V2KA 3L72D 3A0BE 1SQBG 3WUVA 1NTZG 1HCMA 1R5LA 3PHLA 4OH8B 3C1LA 1LT9C 1ZMEC 1FOSE 1IZNB 1JY3N 2J58A 4EOTA 4YXWH 2OYHA 1CIHA 3PLNA 1Q86Q 1KMIZ 1N73B 1HF9A 4FA9A 2Y0CA 1HUCA 3FWLA 3GHGB 1RF1B 2V08A 1VPCA 1FDIA 2N9YB 4XXLA 3SWYA 2Q7CA 2YMYA 3HE4B 3SWSA 3HQ6A 1DVVA 2QRXA 3HQ8A 4NPDA 4EIFA 1YJNP 1MFTA 1GTWA 4UB8E 1YICA 3L71J 2V4HA 3KXDA 1NAFA 1CIFA 3CX5D 1SFCB 5H2FH 3WMM0 2BEZF 1MFZA 4OWFA 3D71A 3WU2E 2K9YA 1DT1A 4ZMDA 3A7OA 1QLED 1QEXA 5KAIH 1NIRA 2FXPA 4PD4E 1H9XA 4HKZH 2JWDA 4H44C 3CCLP 4H0LB 1GMJA 1L0LJ 2RKLA 3ABVC 5EXQA 1KZUB 1S9KD 1ZZHA 3CCVP 1G2CA 1LJ2A 2ZJSE 3D6ZA 3CX5W 5C39A 3HD7C 1KQSO 1CTJA 1E8EA 3CX5I 1FZEA 4WBAA 4IOIH 1KQGB 3P8CE 1J1DC 3JSVC 5KAFE 3KZIH 2N9JA 1M56D 1HH7A 4FB1A 3H1LJ 5B5EH 4AYCA 4H0JA 1SQVJ 5CCGA 2D0WA 1YTZT 2N1TB 3VTPC 4WY4B 4IFDK 1EZVG 5KLVG 1SLQA 3TNUA 3M0DC 4GODA 3I55P 2W27A 2IPPA 1X0TA 1N9CA 3H1HD 2WTYA 2WSFH 1SP4A 1BE3D 2VHDA 2MJZA 1Q7YQ 5TISV 4JQ0D 2Q3IA 3TGUG 155CA 2HPCA 4R4LA 1C52A 1RF0A 3WC8A 3M06A 3MUDA 2O3JA 1SQPG 3MK7C 4K3IA 5DFSA 1FC2C 3L74E 2M8RA 3Q5SA 2FXOA 3T97B 4D6TE 1IFMA 5H2FE 1CRIA 5CBNA 1SQBD 2O01H 1KB9D 3MHVA 1WVEC 1J2JB 1C2NA 5KAIE 3DMIA 2QJYC 1SQXK 3KHUA 2R5BA 4XE5B 3CMAP 1YBKA 1PPJE 1QL1A 1DX7A 3S4RA 1URQA 4KT0J 1SQQJ 4I1LA 1E79H 3IAOA 3H1JG 2A06G 3NTNA 1CRGA 3KZIE 1LT9B 1NU1J 1S3JA 4ASWA 2R3SA 2D0SA 3R4YA 1CI6A 1NMIA 2E43A 4YTPC 2JO1A 1YFCA 1L4AA 3ZCFA 2NPSB 2P7JA 2B87A 2H43A 2AXTH 5KJ7A 2E74C 1W2LA 3L4OA 1NOHA 5AW4B 4C46A 4EIEA 1NAYA 4KMGA 3A5TA 1GL2A 2ZT9D 3K5BA 3SJLA 5GTHH 1PP9G 3D0WA 5APTA 2QJKC 4CPGA 5CJ0A 2M3BA 4OGQD 4Y99C 2FFDB 1VQKP 2Z4EA 1EC5A 1F1FA 3BCCE 2G3AA 2WPVB 4DT0A 2M5AA 2ZFCA 4H44B 2AXCA 1GDTA 5KLVD 1XTCC 3VMAA 3EWKA 1J1EB 3N7NA 3HD7B 4C7NB 5CIBB 1DW0A 1R5SA 2ZVNB 4EIDA 1K8AQ 2CK3H 3WUIA 3FGAD 1ZLLA 3CWBE 1J1DB 1N7SA 3N4XA 1S5LX 3CLQA 1CTZA 3QH9A 3TGUD 1IRWA 1JY2N 3U59A 1H0TA 4EICA 3ZIYA 3ZOOA 3O6QA 3WFEC 1A8CA 1K05A 5E79V 1SQPD 3CCSP 3HUSA 1QKSA 3CX5H 3L4FA 1EZVI 1JCDA 4PW9B 2KLVA 2P1JA 3MIWA 2FXMA 2I8FA 4HB1A 2R44A 2OTLP 2OQQA 4BXLA 3AE5C 3BVHA 2KI7B 2OTKE 2PFXA 5AW9B 4W7ZA 1CSUA 2KSEA 3L73G 2ZVOB 2AXTE 3H1IJ 2CE1A 1LTGC 1EDLA 4GEDB 2M0BA 3MK7B 5B66H 2K3RA 5GTHE 1USDA 3B5NC 1ZR2A 2OGUA 1QGKB 1IO4A 3FXDA 1MKMA 5H2FV 1VL2A 3A0HV 5CMZA 2W6JH 3H1JD 2A06D 1HTLC 3L72E 1T2KC 2QJYB 5KAIV 5BU8B 4FAVA 1DW1A 3EQ2A 1VYDA 1SFCD 1EXIA 3B4SA 2Q9IA 4H13C 1VQPP 1KILC 3VRDA 2E75C 1KX7A 2GUSA 1AVOA 3IF4A 4ZKPA 1F1CA 1LTJA 1KQLA 3ZOXA 1P84D 2ZYDA 1LP1A 3AEDC 2OYOA 5TISH 1QYZA 2WITA 2R32A 4H0LD 1U57A 2W83C 1PP9D 1HZVA 3E1IA 2WSSH 1CSVA 5B5EV 2YO3A 1YHQP 3ITKA 1JTHA 4DJGA 3CX5E 4KJMA 2N9BA 4RJTA 1S1CX 2OARA 3NMDA 3PXTA 3II6A 1KB9H 2KS1B 4M3LA 3V4WA 1RZ6A 2RMZA 3V4QA 2N1TD 3HE5A 1H88A 1H32B 2AI5A 4GT1A 2IBZG 4HH2A 4L73A 1S9KE 3C2CA 2QJKB 4WQDA 4Y99B 3VN0A 2JTIB 2P2UA 1JNMA 4LGDE 2E42A 4H0KA 3BCCJ 1IK7A 1YJWP 3HRNA 5C0ZA 1RE4A 2O01J 2Q3EA 1KN7A 2R5DA 1HGVA 1KD1Q 1AJYA 2KYVA 1JY2O 1PIXA 2MHMA 3AE3C 3JCUH 2B12B 1H31B 2FYNC 2YNYA 3CC7P 3A3YB 1X8YA 1GU4A 3L73D 1HJ5A 3H1HE 1CIGA 2AIUA 3RK3E 2YXRB 3CCEP 5TISE 1FZGA 1SQBK 1NTZK 1CORA 2BPBB 5CCGC 3IN6A 1LS9A 2R3CA 2BCCJ 1IO3A 3CCJP 3H1LG 1NMLA 3F89A 2WPRA 1W5CT 1AYGA 1RAQA 2H89C 1SQBE 2IDBA 3L75J 4K35A 1KB9E 2B4ZA 3QWOC 1RF0C 3H32A 3MUDC 1L9JC 1BGYJ 1N7LA 3TDKA 3CC4P 1OW6A 2QIWA 4U7JA 1NGMB 1CRJA 2BH5X 3SFEC 3OW2O 1QN2A 4FA5A 2KUBA 1OZHA 2ZBOA 1FZCB 4WB4A 1QX8A 2QE7H 1H33A 5AW2B 5E79H 2IFNA 3ZDMA 1YEBA 3OCDA 1GK4A 1KILB 2E75B 4XA4A 3WFBC 2C8SA 1EXJA 2C1DB 2WZ7A 3PJSK 1URQC 3TSIA 4RESB 3HE4A 1KORA 2KIKA 2H88C 3USSA 3SVWA 4WQ7A 4H44D 2B89A 3VP8A 1A2SA 2C9NY 3L37A 4BRYA 3HD7D 2OYHB 3R2PA 1SQQG 3MP7B 4LJIA 3H1KG 2P58A 1KYOW 5KLVK 4Q5PA 2OZ1B 1L4AC 1M57D 3S9OA 1A02F 1HJ4A 5KKZC 1NU1G 1KYOI 4RSZA 1VF5C 3AE1C 4GOFA 3A0HH 5KJ7C 1OW7A 2ZAEB 1CYJA 1GL2C 1RQUA 1H8AA 3SWFA 1DW3A 3OA7A 1T3JA 1NHLA 4MN4C 4WWIA 4YXDC 5KLVE 5B66V 1FZBA 2IBZI 1SQPK 3JBTB 1FDOA 3CXHI 1LMSA 3L70J 1M90Q 2PACA 4JCGA 1U7JA 1P84H 2W6BA 2B88A 1VQ5P 1DIQC 3IR9A 3TGUE 2E76C 5DJQC 2N18C 4WY4A 1M1JA 3PP5A 1L9BC 4GDOA 3Q5PA 1X22A 5E79E 1KV4A 1C2RA 3H1LD 1SQPE 2GC7D 2ZZS1 1BSNA 2FYNB 3RK2C 1HVVA 1FDMA 2JQRA 5AW3B 2IYPA 1N7SC 3KQGA 1KC8Q 3RL0C 3VOPA 2CXBA 5AVVB 2GM4A 1LWUA 3RL0g 2Y0EA 3D6YA 2LXBA 2JDIH 1G1IA 3HUSC 2ZYGA 1K3GA 2WSEJ 2O01N 2WMMA 1W2EA 4U3FJ 3T97A 2XNDH 2FYZA 2Y9YA 4XYDB 4N78D 4RO0A 1NTMJ 2QM7A 1YQ4C 4DY9A 4ZNCA 1AQ5A 1N50A 1NTZD 1NKZB 3A0HE 2HPCB 2BEQD 2A06E 1NTKJ 3H1JE 5AVTB 1IC2A 4I7ZC 2D2CC 1SQBJ 1GW4A 5TJHA 1HRCA 3JC22 1M1KQ 2M3EA 2PAJA 1DEEG 1JB0J 3SFDC 1BCCJ 3H1IG 4IFFA 3LIDA 3G6EP 2E74D 2XU6A 4FA1A 1L0NJ 3O8ZA 1P84E 2OYIA 3RK3C 3BRTB 1JY3O 5APXA 1KQFB 1KV9A 2XNXA 3O0RC 1OAEA 4N0KA 5AW5B 1SQQD 1SQXE 3SLEA 3H1KD 3CCRP 2XV5A 5B5EE 1FCDC 5AW7B 4EI2A 3RGUA 2I8DA 1NU1D 1FJPA 2NPSA 1GD2E 1URQB 1LTJC 1W5CE 2E5YA 1IFJA 5CJ4A 4WQAA 3LW5H 1OVVA 4IL6X 1CEDA 1GIWA 1CI6B 2IFMA 5AW6B 2HODA 1S5LH 4PJ0V 3G4SP 1NH4A 1KFNA 3C8VA 1RHZB 2C0WA 1DW2A 1M60A 4KHXA 3ZOYA 5KKZB 1IFPA 5AURA 1VF5B 2FFDA 2B87B 1ZP0C 3TYYA 2BLFB 2IYOA 5APWA 1QVFO 4JBZA 1Y9BA 1HBWA 1CSWA 1ZOYC 2KNCB 2L4DA 1NYHA 1LGHB 1CYIA 1EZVD 2YXQB 5AW0B 2KB7P 1KYOH 1VQMP 1GU5A 1CSXA 3AE7C 2CPSA 3FXEA 3U1AA 1AQTA 2B9BA 1C6RA 1ZRTD 1X9VA 3M91A 2M5AB 4YPCA 2NZ2A 3L73E 2E76B 1LFMA 4OVNF 1FJKA 3HTKA 2B10B 1KTMA 2GC4D 2L5GB 2N18B 2XZRA 4HJGH 3B5ND 4IFMA 1RE4C 2K88A 1VQNP 2C9XB 2WSCJ 1PZQA 1OFCX 1WRGA 1CC5A 3RN0A 2ZYAA 3P8CD 1FI9A 2N3YA 1J3SA 1EDIA 1N7SB 5K5GB 2WT7A 1EQ7A 1E29A 1CTYA 1T2KD 1R0QA 4ZKUA 1ZR4A 1PV3A 4PD4I 3AEBC 2PGDA 1CRHA 4YE1A 1AOQA 2WPQA 3O6QB 2K37A 5DJTB 2K9JA 3GF3A 4H13D 5B6QA 1KILD 3HUSB 2E75D 4K3AA 1S5LE 3MD0A 3H1ID 1QL3A 3V2RA 2LR2A 2CA3B 5AVXB 2BCNB 3HQ9A 3CMEP 4DCKA 2PP6A
chains in the Genus database with same CATH topology
1IZL0 3L73D 1HJ5A 1A56A 1CIGA 4AANA 2AIUA 4AALA 1NIRA 1H9XA 4EDFA 4MU8A 1CORA 2BPBB 2YK3A 5EXQA 1ZZHA 1LS9A 3NWVA 3CX5W 1IO3A 3ZBMA 1NMLA 1CTJA 1IRVA 4WQEA 4NFGB 1E8EA 2HV4A 4L1QA 1W5CT 1CO6A 2ZONG 1AYGA 1RAQA 1QL4A 2N9JA 2DGEA 1HH7A 4FB1A 2Y0DA 4UB8V 3ZOWA 1HROA 2B4ZA 1CIEA 4O1WA 4H0JA 4AAOA 1WEJF 2D0WA 2C1VA 4FANA 1C7MA 1L9JC 3TDKA 3WU2V 2MTAC 1CHIA 1DIIC 2RN0A 1CXCA 1CHHA 3O1YA 1N9CA 3H1HD 1CRJA 3X39A 1RAPA 2GB8B 1BE3D 2VHDA 4PD4D 2BH5X 3L4MA 5TISV 1FHBA 4UB6V 1QN2A 4FA5A 4AAMA 4J20A 2ZBOA 155CA 1MG3D 1LC2A 1H1OA 1H33A 5DJQB 1C52A 3WC8A 1IQCA 2O3JA 1YEBA 3OCDA 1C75A 4L3GA 3MK7C 1I8OA 1CCRA 1U74B 1I6EA 4WQ9A 3WFBC 2C8SA 4K3IA 5DFSA 3A9FA 2XTSB 2C1UA 2C1DB 5KAFV 3M97X 1N15A 1FJ0A 1CRIA 1SQBD 3VNWA 3SVWA 4WQ7A 3O5CA 1KB9D 3PXSA 2QG4A 4A7PA 1A2SA 1WVEC 1C2NA 451CA 3DMIA 4L3HA 3HQ7A 1JDLA 1B7VA 2PCCB 3PH2B 1MZ4A 3KHUA 4LJIA 4IL6V 2JWAA 1KYOW 3DR0A 4Q5PA 2OZ1B 2ORLA 4WQ8A 1HJ4A 3WFDC 1CNOA 4RSZA 1KX2A 2N3BA 1AKKA 1YCCA 1CRGA 1CRYA 1CYJA 1CXAA 2K9JB 5CIDB 2D0SA 1DW3A 1NMIA 351CA 2CA4B 1I55A 3L74D 1CCHA 5B66V 1YFCA 4D6TD 3JBTB 3ZCFA 1MG2D 1LMSA 1FI3A 2PACA 4JCGA 3CYTI 4WQCA 1NNOA 1OCDA 5CIFB 1DIQC 2BCCD 1W2LA 3L4OA 2FYUD 2BH4X 4EIEA 4KMGA 3SJLA 5DJQC 1GU2A 2N18C 1L9BC 1S5LV 3GG2A 1PPJD 1M6ZA 2BGVX 1C2RA 3H1LD 1C6SA 2GC7D 5CIEB 3L75D 3RMZA 2ZZS1 2FYNB 2N9IA 2JQRA 2ZXYA 1F1FA 1BGYD 3KZIV 3OA8B 3DP5A 1GDVA 1SQXD 2KS1A 5CIGB 2CXBA 4WQBA 1CRCA 1U75B 3NBTA 2Y0EA 5KLVD 5C9MA 1H32A 3VMAA 3RLMA 3WFCC 2V07A 2FRCA 3ORVA 5CIBB 1DW0A 1K3GA 4EIDA 3WUIA 1KYOD 1FI7A 2C2CA 4QAOA 4XYDB 3PRJA 4DY9A 1CTZA 5CIHB 1COTA 1N50A 3TGUD 1YTCA 1IRWA 1NTZD 4EICA 3ZIYA 1H33B 1ETPA 3ZOOA 3WFEC 1A8CA 1HZUA 5E79V 1CHJA 3OCDB 1SQPD 1S6VB 5TJHA 1QKSA 1HRCA 2IBZD 3CXHD 1I8PA 1YIQA 2OZ1A 5CYTR 4PW9B 3NBSA 2I8FA 3BCCD 1H31A 2EXVA 4FA1A 3L71D 2B11B 1CSUA 2CE1A 1AOFA 1KV9A 1I6DA 3O0RC 1OAEA 4N0KA 2B0ZB 1SQQD 4GEDB 3SLEA 3MK7B 3H1KD 1GKSA 3TF5A 3CXHW 1FCDC 3CWBD 1NU1D 4O1QA 2YQBA 5H2FV 1L0LD 4GYDA 4P4QB 1DVHA 3A0HV 2YCCA 3H1JD 2A06D 4WQAA 1I54A 1I5TA 2QJYB 5KAIV 3L70D 1CEDA 1GIWA 5IY51 1KB0A 4FAVA 2QJPB 4PJ0V 1DW1A 1VYDA 1C6OA 1DW2A 1M60A 1YNRA 3VRDA 3ZOYA 1HJ3A 5KKZB 3PXWA 1KX7A 2L91A 3VYMA 5AURA 1CYCA 1F1CA 3ZOXA 1P84D 2BLFB 3SXTA 1SQVD 5GTIV 2AXTV 3OA8A 1QYZA 1GJQA 4PWAA 1KIBA 4FA4A 1CSWA 1PP9D 1HZVA 2LIRA 4AX3A 2KNCB 1EB7A 5GTHV 2L4DA 1CSVA 1CYIA 5B5EV 3RN1A 1EZVD 3ITKA 1CSXA 2LITA 5KLIB 3TYIA 4RJTA 5DF5A 2C1DA 1E2RA 3GW6A 2FWLA 1BL9A 3PXTA 1C6RA 1ZRTD 1YEAA 4V2KA 3L72D 1M70A 1LFMA 5CICB 1HCMA 2PCBB 4U3FD 3PHLA 1RZ6A 2B10B 2RMZA 2GC4D 2N18B 1GQ1A 3PTZA 1H32B 2AI5A 1NTMD 2C9XB 1CIHA 3PLNA 3C2CA 3CU4A 1CC5A 3RN0A 1FOCA 2QJKB 4FA9A 2Y0CA 1NTKD 1FI9A 3FWLA 2YIUB 2GIWA 2N3YA 4WQDA 1J3SA 2V08A 2N9YB 2JTIB 4XXLA 1E29A 1CTYA 1N90A 3SWSA 1R0QA 3HQ6A 1LC1A 1DVVA 3CP5A 2DVHA 3HQ8A 4EIFA 1CRHA 4YE1A 1BCCD 4H0KA 1AOQA 3O20A 5C0ZA 1RZ5A 1YICA 5B6QA 1L0ND 1H9YA 2Q3EA 1CIFA 2CE0A 3CX5D 1K3HA 3H1ID 1QL3A 2CA3B 2MHMA 2BCNB 3HQ9A 2ZOOA 2B12B 1DT1A 1H31B 4Y5RA 3A0BV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZL 0;  3L73 D;  1HJ5 A;  1A56 A;  1CIG A;  4AAN A;  2AIU A;  4AAL A;  1NIR A;  1H9X A;  4EDF A;  4MU8 A;  1COR A;  2BPB B;  2YK3 A;  5EXQ A;  1ZZH A;  1LS9 A;  3NWV A;  3CX5 W;  1IO3 A;  3ZBM A;  1NML A;  1CTJ A;  1IRV A;  4WQE A;  4NFG B;  1E8E A;  2HV4 A;  4L1Q A;  1W5C T;  1CO6 A;  2ZON G;  1AYG A;  1RAQ A;  1QL4 A;  2N9J A;  2DGE A;  1HH7 A;  4FB1 A;  2Y0D A;  4UB8 V;  3ZOW A;  1HRO A;  2B4Z A;  1CIE A;  4O1W A;  4H0J A;  4AAO A;  1WEJ F;  2D0W A;  2C1V A;  4FAN A;  1C7M A;  1L9J C;  3TDK A;  3WU2 V;  2MTA C;  1CHI A;  1DII C;  2RN0 A;  1CXC A;  1CHH A;  3O1Y A;  1N9C A;  3H1H D;  1CRJ A;  3X39 A;  1RAP A;  2GB8 B;  1BE3 D;  2VHD A;  4PD4 D;  2BH5 X;  3L4M A;  5TIS V;  1FHB A;  4UB6 V;  1QN2 A;  4FA5 A;  4AAM A;  4J20 A;  2ZBO A;  155C A;  1MG3 D;  1LC2 A;  1H1O A;  1H33 A;  5DJQ B;  1C52 A;  3WC8 A;  1IQC A;  2O3J A;  1YEB A;  3OCD A;  1C75 A;  4L3G A;  3MK7 C;  1I8O A;  1CCR A;  1U74 B;  1I6E A;  4WQ9 A;  3WFB C;  2C8S A;  4K3I A;  5DFS A;  3A9F A;  2XTS B;  2C1U A;  2C1D B;  5KAF V;  3M97 X;  1N15 A;  1FJ0 A;  1CRI A;  1SQB D;  3VNW A;  3SVW A;  4WQ7 A;  3O5C A;  1KB9 D;  3PXS A;  2QG4 A;  4A7P A;  1A2S A;  1WVE C;  1C2N A;  451C A;  3DMI A;  4L3H A;  3HQ7 A;  1JDL A;  1B7V A;  2PCC B;  3PH2 B;  1MZ4 A;  3KHU A;  4LJI A;  4IL6 V;  2JWA A;  1KYO W;  3DR0 A;  4Q5P A;  2OZ1 B;  2ORL A;  4WQ8 A;  1HJ4 A;  3WFD C;  1CNO A;  4RSZ A;  1KX2 A;  2N3B A;  1AKK A;  1YCC A;  1CRG A;  1CRY A;  1CYJ A;  1CXA A;  2K9J B;  5CID B;  2D0S A;  1DW3 A;  1NMI A;  351C A;  2CA4 B;  1I55 A;  3L74 D;  1CCH A;  5B66 V;  1YFC A;  4D6T D;  3JBT B;  3ZCF A;  1MG2 D;  1LMS A;  1FI3 A;  2PAC A;  4JCG A;  3CYT I;  4WQC A;  1NNO A;  1OCD A;  5CIF B;  1DIQ C;  2BCC D;  1W2L A;  3L4O A;  2FYU D;  2BH4 X;  4EIE A;  4KMG A;  3SJL A;  5DJQ C;  1GU2 A;  2N18 C;  1L9B C;  1S5L V;  3GG2 A;  1PPJ D;  1M6Z A;  2BGV X;  1C2R A;  3H1L D;  1C6S A;  2GC7 D;  5CIE B;  3L75 D;  3RMZ A;  2ZZS 1;  2FYN B;  2N9I A;  2JQR A;  2ZXY A;  1F1F A;  1BGY D;  3KZI V;  3OA8 B;  3DP5 A;  1GDV A;  1SQX D;  2KS1 A;  5CIG B;  2CXB A;  4WQB A;  1CRC A;  1U75 B;  3NBT A;  2Y0E A;  5KLV D;  5C9M A;  1H32 A;  3VMA A;  3RLM A;  3WFC C;  2V07 A;  2FRC A;  3ORV A;  5CIB B;  1DW0 A;  1K3G A;  4EID A;  3WUI A;  1KYO D;  1FI7 A;  2C2C A;  4QAO A;  4XYD B;  3PRJ A;  4DY9 A;  1CTZ A;  5CIH B;  1COT A;  1N50 A;  3TGU D;  1YTC A;  1IRW A;  1NTZ D;  4EIC A;  3ZIY A;  1H33 B;  1ETP A;  3ZOO A;  3WFE C;  1A8C A;  1HZU A;  5E79 V;  1CHJ A;  3OCD B;  1SQP D;  1S6V B;  5TJH A;  1QKS A;  1HRC A;  2IBZ D;  3CXH D;  1I8P A;  1YIQ A;  2OZ1 A;  5CYT R;  4PW9 B;  3NBS A;  2I8F A;  3BCC D;  1H31 A;  2EXV A;  4FA1 A;  3L71 D;  2B11 B;  1CSU A;  2CE1 A;  1AOF A;  1KV9 A;  1I6D A;  3O0R C;  1OAE A;  4N0K A;  2B0Z B;  1SQQ D;  4GED B;  3SLE A;  3MK7 B;  3H1K D;  1GKS A;  3TF5 A;  3CXH W;  1FCD C;  3CWB D;  1NU1 D;  4O1Q A;  2YQB A;  5H2F V;  1L0L D;  4GYD A;  4P4Q B;  1DVH A;  3A0H V;  2YCC A;  3H1J D;  2A06 D;  4WQA A;  1I54 A;  1I5T A;  2QJY B;  5KAI V;  3L70 D;  1CED A;  1GIW A;  5IY5 1;  1KB0 A;  4FAV A;  2QJP B;  4PJ0 V;  1DW1 A;  1VYD A;  1C6O A;  1DW2 A;  1M60 A;  1YNR A;  3VRD A;  3ZOY A;  1HJ3 A;  5KKZ B;  3PXW A;  1KX7 A;  2L91 A;  3VYM A;  5AUR A;  1CYC A;  1F1C A;  3ZOX A;  1P84 D;  2BLF B;  3SXT A;  1SQV D;  5GTI V;  2AXT V;  3OA8 A;  1QYZ A;  1GJQ A;  4PWA A;  1KIB A;  4FA4 A;  1CSW A;  1PP9 D;  1HZV A;  2LIR A;  4AX3 A;  2KNC B;  1EB7 A;  5GTH V;  2L4D A;  1CSV A;  1CYI A;  5B5E V;  3RN1 A;  1EZV D;  3ITK A;  1CSX A;  2LIT A;  5KLI B;  3TYI A;  4RJT A;  5DF5 A;  2C1D A;  1E2R A;  3GW6 A;  2FWL A;  1BL9 A;  3PXT A;  1C6R A;  1ZRT D;  1YEA A;  4V2K A;  3L72 D;  1M70 A;  1LFM A;  5CIC B;  1HCM A;  2PCB B;  4U3F D;  3PHL A;  1RZ6 A;  2B10 B;  2RMZ A;  2GC4 D;  2N18 B;  1GQ1 A;  3PTZ A;  1H32 B;  2AI5 A;  1NTM D;  2C9X B;  1CIH A;  3PLN A;  3C2C A;  3CU4 A;  1CC5 A;  3RN0 A;  1FOC A;  2QJK B;  4FA9 A;  2Y0C A;  1NTK D;  1FI9 A;  3FWL A;  2YIU B;  2GIW A;  2N3Y A;  4WQD A;  1J3S A;  2V08 A;  2N9Y B;  2JTI B;  4XXL A;  1E29 A;  1CTY A;  1N90 A;  3SWS A;  1R0Q A;  3HQ6 A;  1LC1 A;  1DVV A;  3CP5 A;  2DVH A;  3HQ8 A;  4EIF A;  1CRH A;  4YE1 A;  1BCC D;  4H0K A;  1AOQ A;  3O20 A;  5C0Z A;  1RZ5 A;  1YIC A;  5B6Q A;  1L0N D;  1H9Y A;  2Q3E A;  1CIF A;  2CE0 A;  3CX5 D;  1K3H A;  3H1I D;  1QL3 A;  2CA3 B;  2MHM A;  2BCN B;  3HQ9 A;  2ZOO A;  2B12 B;  1DT1 A;  1H31 B;  4Y5R A;  3A0B V; 
#chains in the Genus database with same CATH topology
 1IZL 0;  5BVZ A;  2ZXX A;  1A56 A;  3L74 J;  4O9B A;  2JR8 A;  2BCC G;  4D6T J;  2FYU G;  4MU8 A;  3CCQ P;  2D2C B;  4EIJ A;  3G3Z A;  2V7Q H;  3NWV A;  3H1J J;  1DH3 A;  4NFG B;  3L75 G;  4L1Q A;  5GTI H;  5APQ A;  1JEK A;  2GA1 A;  1JUN A;  1BGY G;  1WMK A;  2AEF A;  3ZOW A;  1HRO A;  2XDJ A;  1E5W A;  3VMZ A;  1WEJ F;  1PGQ A;  1NO4 A;  1EDJ A;  3KPE A;  3G9R A;  2MTA C;  4JF7 A;  5APS A;  5AVY B;  1SQX J;  2QM8 A;  1RF1 C;  2A45 G;  1LTJ B;  1CXC A;  3O1Y A;  1LP1 B;  2Z5H A;  3X39 A;  1RAP A;  1LTI C;  3E1R A;  1FHB A;  2E74 B;  1FU1 A;  4AAM A;  4J20 A;  5M1B A;  1NWQ A;  1MG3 D;  3VP9 A;  1SS1 A;  2WSF J;  1JTH B;  2E5T A;  1I8O A;  4NPE A;  1BSH A;  5B66 E;  1AVY A;  1GZL A;  1N15 A;  1FJ0 A;  5CCH C;  3CD6 P;  2HR3 A;  2G8Y A;  3AE4 C;  3VNW A;  3O5C A;  3PXS A;  3L71 G;  3NFQ A;  1GK6 A;  1VQO P;  5CCG D;  3HE5 B;  2XKM A;  4L3H A;  4H0L C;  3HQ7 A;  1Z56 A;  1JDL A;  2PCC B;  2H8P D;  2QJP C;  1MZ4 A;  3GLM A;  3D70 A;  5AVW B;  4IL6 V;  1Y47 A;  3DR0 A;  3H1L E;  1JO5 A;  1PGJ A;  3A0B H;  3M9H A;  3MGN A;  5EFW B;  1KX2 A;  1L0L G;  1FZA A;  1AKK A;  4RKU J;  1YCC A;  3CWB J;  1CRY A;  1BDD A;  1BE3 E;  5CHX A;  2RH0 A;  3L70 G;  4PJ0 H;  1OW8 A;  1VQ9 P;  3L73 J;  2YKO A;  2CA4 B;  2AEJ A;  1ZXG A;  1M1J C;  4WY4 C;  3Q1M A;  1Y8A A;  1YJ9 P;  2KP8 A;  4TLF A;  1MG2 D;  3AE6 C;  5AVU B;  3W67 A;  2IZ1 A;  1FI3 A;  2HLO A;  1ZN5 A;  4WQC A;  1BDC A;  1NNO A;  3E7K A;  1OCD A;  5KTB A;  5CIF B;  4N78 E;  1SQV G;  2BCC D;  2FYU D;  1HGZ A;  2J59 M;  1PGP A;  1NTZ E;  4XFJ A;  1GU2 A;  1LWU C;  3VMX A;  1S5L V;  3GG2 A;  1M6Z A;  3B5N B;  1C6S A;  5CIE B;  1SQQ K;  1URQ D;  3L75 D;  2QVA A;  1DIP A;  2QSI A;  2N9I A;  1IJD B;  2YIU C;  5AVQ B;  2ZXY A;  1NU1 K;  2O1K A;  4UB6 H;  1BGY D;  2GUV A;  3OA8 B;  3DP5 A;  1JOC A;  1RY3 A;  1PFI A;  4U3F G;  3H32 B;  4HYT B;  1U75 B;  3NBT A;  5C9M A;  4AUW A;  1L4A D;  3WFC C;  2V07 A;  3L72 J;  1NTM G;  1SQQ E;  4H13 B;  3H1K E;  1VF5 D;  1N73 A;  1KYO D;  1FI7 A;  5KAF H;  3VYI A;  1HJB A;  2C2C A;  3GHG A;  5KJ7 D;  1NTK G;  3WUU A;  1RF1 A;  1NU1 E;  1OVR A;  4TT3 H;  1DD4 A;  1PGO A;  1GL2 D;  1COT A;  3JCU E;  1YTC A;  2OYI C;  3P7K A;  4W7Y A;  3PH0 A;  3WUT A;  4LLH A;  3Q2Y A;  1H33 B;  1BCC G;  1ETP A;  4PV1 C;  1HZU A;  1T6A A;  3OCD B;  2FY8 A;  1L0N G;  2IBZ D;  4PJ0 E;  3CXH D;  1YIQ A;  2OZ1 A;  1SFC A;  5CYT R;  1VQ7 P;  1N2D C;  2NPS C;  3BRV B;  1EDK A;  2A45 I;  2EXV A;  3L71 D;  5CCH A;  1A02 J;  2E76 D;  2J5U A;  3AE8 C;  1RH5 B;  1IFI A;  4BRY B;  1LT1 A;  3Q3D A;  3C9I A;  4Y28 J;  2HFE D;  1S2E A;  3V2Q A;  1YTZ I;  1GKS A;  3RK2 D;  1RQV A;  1L2P A;  3CXH W;  1EZV E;  2WVR A;  4O1Q A;  1N7S D;  2YQB A;  1LNQ A;  2FFD C;  3U1C A;  1L0L D;  2HG5 D;  3RL0 D;  1K73 Q;  1OMI A;  1QVG O;  1VDF A;  1ZRT E;  1NJI Q;  3H25 A;  4NPF X;  1VQ8 P;  4UB6 E;  3L70 D;  1UII A;  1YI2 P;  2QJP B;  2W8Z A;  4R4M A;  2ZXE B;  2FKW B;  1JMB A;  1J1E C;  2N1T A;  1G2C B;  1Q2N A;  3PXW A;  3SSU A;  3IFM A;  3F5H A;  2V7Q J;  1AV1 A;  1CYC A;  3RBX A;  3CCM P;  1SQV D;  5GTI V;  3H6P A;  1XTG B;  4PWA A;  2D2C D;  1KIB A;  2YKQ A;  4FA4 A;  1QL2 A;  1FE6 A;  4AX3 A;  1EB7 A;  1OWA A;  1M1J B;  3H1H J;  1BE3 J;  1KIL E;  3TNU B;  2LIT A;  3TYI A;  3S1K A;  1FS0 E;  1JY3 P;  2JKV A;  5CBO A;  3H1I E;  4JYC A;  1W2B O;  3RK3 D;  1BL9 A;  5L8R J;  3NXS A;  1M70 A;  5CIC B;  2PCB B;  4U3F D;  1HJ0 A;  2IZ0 A;  3P8M C;  3L36 A;  2JP3 A;  1LWU B;  1GQ1 A;  3PTZ A;  3V5B A;  2OTJ P;  1NTM D;  1NTZ J;  3FX0 A;  4IL6 H;  1OX3 A;  2YMK A;  3CU4 A;  2VRS A;  1FOC A;  1NTK D;  2YIU B;  2GIW A;  2BAS A;  2W6A A;  2YKP A;  2W90 A;  3AE9 C;  4C7R A;  1N90 A;  1LC1 A;  1YIJ P;  2HYN A;  1S72 P;  3CP5 A;  2DVH A;  1N8R Q;  1HH0 A;  1BCC D;  5APU A;  2FBW C;  5AVS B;  1LT9 A;  1Q82 Q;  3O20 A;  3L35 A;  1RZ5 A;  1HWT C;  2I1K A;  1L0N D;  2SPZ A;  1H9Y A;  2CE0 A;  1PP9 E;  2KLU A;  1K3H A;  2KSJ A;  3L74 G;  2LXC B;  1ZV8 A;  3UIA A;  4D6T G;  2I1J A;  4DZO A;  1USE A;  2ZOO A;  4Y5R A;  3H1K J;  3A0B V;  2Q1K A;  2OYI B;  3OAK A;  4AAN A;  4AAL A;  4EDF A;  3G71 P;  1KB9 I;  4PV1 B;  1UIX A;  1FOS F;  3V2N A;  2YK3 A;  1S4X A;  1PPJ G;  3CL3 D;  3ZBM A;  1YYC A;  1L4A B;  1IRV A;  4WQE A;  4B86 A;  2HV4 A;  4I6M C;  1CO6 A;  2ZON G;  1AA0 A;  1QL4 A;  2DGE A;  1NVO A;  4GIF A;  2Y0D A;  4UB8 V;  1SQX G;  1GL2 B;  1CIE A;  4O1W A;  2HOD B;  3AEE C;  2KNC A;  1T8Z A;  4W80 A;  4AAO A;  2C1V A;  3VMY A;  4FAN A;  1C7M A;  3BAS A;  4BWN A;  1OXZ A;  1TU3 F;  2A45 H;  2IX7 C;  3WU2 V;  2YO2 A;  3HD7 A;  3W68 A;  4C7N A;  1CHI A;  1DII C;  2RN0 A;  1IFN A;  4IL6 E;  2K1A A;  1CHH A;  4JPZ B;  5KLV J;  1CSB A;  2GB8 B;  1DEB A;  1SVF A;  4PD4 D;  3L4M A;  4UB6 V;  1FAV A;  5AVR B;  1LC2 A;  2FYU K;  1H1O A;  5DJQ B;  1LTA C;  3TK1 A;  1M7L A;  1IQC A;  2ZT9 C;  2C0X A;  1NKN A;  1C75 A;  4L3G A;  3CXH H;  2Y9Z A;  3TGU J;  1CCR A;  1U74 B;  1I6E A;  4WQ9 A;  3M0D A;  2QEX P;  3A9F A;  2KOG A;  2XTS B;  3GF7 A;  2C1U A;  2PRR A;  3RK2 B;  1JMM A;  5KAF V;  3I56 P;  3BCC G;  3M97 X;  1SQP J;  4OGQ C;  2QG4 A;  2JEE A;  3P32 A;  4A7P A;  3HTK B;  3RL0 B;  1H0T B;  2BCC E;  2FYU E;  451C A;  1MZ9 A;  1ZW0 A;  1B7V A;  3PH2 B;  1OIP A;  5AVZ B;  3SWK A;  2JWA A;  1Q81 Q;  3V6I A;  2ORL A;  4AQR D;  4WQ8 A;  3CWB G;  3WFD C;  2Z5I A;  1CNO A;  3L75 E;  2KXP B;  2WT7 B;  4LC1 A;  2MKV A;  3KYQ A;  2N3B A;  4L75 A;  1BGY E;  3BAT A;  4GKG A;  5APV A;  1CXA A;  2K9J B;  5CID B;  1AFO A;  4I7Z B;  351C A;  1I55 A;  3L74 D;  4L74 A;  3EFG A;  1WT6 A;  1CCH A;  2P10 A;  2H7H A;  4D6T D;  2ITA A;  1RE3 C;  5KLI C;  3M9B A;  3CYT I;  1KYO E;  2POH A;  3OJA B;  2BH4 X;  3RK3 B;  1X79 B;  4Z1M H;  2C9L Y;  1IK9 A;  1FZC C;  1PPJ D;  2BGV X;  3AE2 C;  1DD3 A;  2DW3 A;  5APY A;  3RMZ A;  2IBZ E;  5CCH D;  1N73 C;  3CPW O;  3CXH E;  1PP9 J;  3GHG C;  1U7M A;  3GMA A;  3KZI V;  3B8E B;  2WSE H;  3L72 G;  1GDV A;  1SQX D;  2KS1 A;  3L71 E;  1L0L K;  1FZF A;  5CIG B;  4L76 A;  3Q5R A;  4WQB A;  1CRC A;  1JY2 P;  2OYH C;  1H32 A;  3RLM A;  1LTB C;  3ORV A;  2FRC A;  3KDP B;  3AEC C;  1SFC C;  2KZJ A;  4N3Y B;  2JJL A;  4QAO A;  3PRJ A;  1K04 A;  4I2L C;  4WVZ A;  5CIH B;  2CPB A;  1P84 I;  1L0L E;  3AEG C;  1GW3 A;  1SQV K;  4WY4 D;  2UWJ E;  1N86 A;  1MUU A;  3L70 E;  1M8O B;  1CHJ A;  2WQY C;  3B71 A;  1S6V B;  1R8E A;  1Q90 D;  1K9M Q;  1I8P A;  1CW5 A;  1VQ4 P;  3NBS A;  1KFM A;  3MZW B;  5DJU B;  3BCC D;  1H31 A;  1D7M A;  1G1J A;  1H89 A;  2B11 B;  4DOJ A;  2Q5U A;  1SQV E;  5GTI E;  4ASV A;  1AOF A;  3CI9 A;  1I6D A;  5AW8 B;  2ZT9 B;  2B0Z B;  1CZQ A;  3AEA C;  2N1T C;  3TF5 A;  3CWB D;  3RBZ A;  1NTM K;  1JM0 A;  3M0A A;  3MTU E;  1LTT C;  1LTS C;  4OGQ B;  2KZI A;  1NTK K;  4GYD A;  4P4Q B;  1DVH A;  2YCC A;  3FWN A;  4GOE A;  1I54 A;  4QMA A;  4UB8 H;  1I5T A;  3M9Q A;  1YQ3 C;  2KK7 A;  3LIE A;  5IY5 1;  2Q6Q A;  1KB0 A;  1YIT P;  4EYY Q;  4U3F E;  1C6O A;  2FYU J;  3A2A A;  1YNR A;  3B5N A;  1NTM E;  3WU2 H;  1HJ3 A;  1L0N K;  4JYB A;  3LW5 J;  3EFF K;  2L91 A;  3VYM A;  1RE3 A;  1FBM A;  1NTK E;  3SXT A;  3H1H G;  4PD4 H;  2LKM A;  5AW1 B;  1VQ6 P;  2AXT V;  1PL5 A;  3I5C A;  3OA8 A;  1BE3 G;  4PV1 D;  1GJQ A;  3CC2 P;  1MV8 A;  1T3U A;  2AEM A;  2WPS A;  2P67 A;  2WWW A;  1FZC A;  2LIR A;  1BCC E;  3CCU P;  5GTH V;  1VQL P;  3V2P A;  1JCC A;  3RN1 A;  2NPS D;  1OVU A;  1L0N E;  1KIL A;  4N6J A;  1IFD A;  5KLI B;  2O1J A;  2NRG A;  5DF5 A;  2C1D A;  2QA4 P;  3AEF C;  1E2R A;  3GW6 A;  2FWL A;  5BU5 A;  2WSC H;  1YEA A;  4V2K A;  3L72 D;  3A0B E;  1SQB G;  3WUV A;  1NTZ G;  1HCM A;  1R5L A;  3PHL A;  4OH8 B;  3C1L A;  1LT9 C;  1ZME C;  1FOS E;  1IZN B;  1JY3 N;  2J58 A;  4EOT A;  4YXW H;  2OYH A;  1CIH A;  3PLN A;  1Q86 Q;  1KMI Z;  1N73 B;  1HF9 A;  4FA9 A;  2Y0C A;  1HUC A;  3FWL A;  3GHG B;  1RF1 B;  2V08 A;  1VPC A;  1FDI A;  2N9Y B;  4XXL A;  3SWY A;  2Q7C A;  2YMY A;  3HE4 B;  3SWS A;  3HQ6 A;  1DVV A;  2QRX A;  3HQ8 A;  4NPD A;  4EIF A;  1YJN P;  1MFT A;  1GTW A;  4UB8 E;  1YIC A;  3L71 J;  2V4H A;  3KXD A;  1NAF A;  1CIF A;  3CX5 D;  1SFC B;  5H2F H;  3WMM 0;  2BEZ F;  1MFZ A;  4OWF A;  3D71 A;  3WU2 E;  2K9Y A;  1DT1 A;  4ZMD A;  3A7O A;  1QLE D;  1QEX A;  5KAI H;  1NIR A;  2FXP A;  4PD4 E;  1H9X A;  4HKZ H;  2JWD A;  4H44 C;  3CCL P;  4H0L B;  1GMJ A;  1L0L J;  2RKL A;  3ABV C;  5EXQ A;  1KZU B;  1S9K D;  1ZZH A;  3CCV P;  1G2C A;  1LJ2 A;  2ZJS E;  3D6Z A;  3CX5 W;  5C39 A;  3HD7 C;  1KQS O;  1CTJ A;  1E8E A;  3CX5 I;  1FZE A;  4WBA A;  4IOI H;  1KQG B;  3P8C E;  1J1D C;  3JSV C;  5KAF E;  3KZI H;  2N9J A;  1M56 D;  1HH7 A;  4FB1 A;  3H1L J;  5B5E H;  4AYC A;  4H0J A;  1SQV J;  5CCG A;  2D0W A;  1YTZ T;  2N1T B;  3VTP C;  4WY4 B;  4IFD K;  1EZV G;  5KLV G;  1SLQ A;  3TNU A;  3M0D C;  4GOD A;  3I55 P;  2W27 A;  2IPP A;  1X0T A;  1N9C A;  3H1H D;  2WTY A;  2WSF H;  1SP4 A;  1BE3 D;  2VHD A;  2MJZ A;  1Q7Y Q;  5TIS V;  4JQ0 D;  2Q3I A;  3TGU G;  155C A;  2HPC A;  4R4L A;  1C52 A;  1RF0 A;  3WC8 A;  3M06 A;  3MUD A;  2O3J A;  1SQP G;  3MK7 C;  4K3I A;  5DFS A;  1FC2 C;  3L74 E;  2M8R A;  3Q5S A;  2FXO A;  3T97 B;  4D6T E;  1IFM A;  5H2F E;  1CRI A;  5CBN A;  1SQB D;  2O01 H;  1KB9 D;  3MHV A;  1WVE C;  1J2J B;  1C2N A;  5KAI E;  3DMI A;  2QJY C;  1SQX K;  3KHU A;  2R5B A;  4XE5 B;  3CMA P;  1YBK A;  1PPJ E;  1QL1 A;  1DX7 A;  3S4R A;  1URQ A;  4KT0 J;  1SQQ J;  4I1L A;  1E79 H;  3IAO A;  3H1J G;  2A06 G;  3NTN A;  1CRG A;  3KZI E;  1LT9 B;  1NU1 J;  1S3J A;  4ASW A;  2R3S A;  2D0S A;  3R4Y A;  1CI6 A;  1NMI A;  2E43 A;  4YTP C;  2JO1 A;  1YFC A;  1L4A A;  3ZCF A;  2NPS B;  2P7J A;  2B87 A;  2H43 A;  2AXT H;  5KJ7 A;  2E74 C;  1W2L A;  3L4O A;  1NOH A;  5AW4 B;  4C46 A;  4EIE A;  1NAY A;  4KMG A;  3A5T A;  1GL2 A;  2ZT9 D;  3K5B A;  3SJL A;  5GTH H;  1PP9 G;  3D0W A;  5APT A;  2QJK C;  4CPG A;  5CJ0 A;  2M3B A;  4OGQ D;  4Y99 C;  2FFD B;  1VQK P;  2Z4E A;  1EC5 A;  1F1F A;  3BCC E;  2G3A A;  2WPV B;  4DT0 A;  2M5A A;  2ZFC A;  4H44 B;  2AXC A;  1GDT A;  5KLV D;  1XTC C;  3VMA A;  3EWK A;  1J1E B;  3N7N A;  3HD7 B;  4C7N B;  5CIB B;  1DW0 A;  1R5S A;  2ZVN B;  4EID A;  1K8A Q;  2CK3 H;  3WUI A;  3FGA D;  1ZLL A;  3CWB E;  1J1D B;  1N7S A;  3N4X A;  1S5L X;  3CLQ A;  1CTZ A;  3QH9 A;  3TGU D;  1IRW A;  1JY2 N;  3U59 A;  1H0T A;  4EIC A;  3ZIY A;  3ZOO A;  3O6Q A;  3WFE C;  1A8C A;  1K05 A;  5E79 V;  1SQP D;  3CCS P;  3HUS A;  1QKS A;  3CX5 H;  3L4F A;  1EZV I;  1JCD A;  4PW9 B;  2KLV A;  2P1J A;  3MIW A;  2FXM A;  2I8F A;  4HB1 A;  2R44 A;  2OTL P;  2OQQ A;  4BXL A;  3AE5 C;  3BVH A;  2KI7 B;  2OTK E;  2PFX A;  5AW9 B;  4W7Z A;  1CSU A;  2KSE A;  3L73 G;  2ZVO B;  2AXT E;  3H1I J;  2CE1 A;  1LTG C;  1EDL A;  4GED B;  2M0B A;  3MK7 B;  5B66 H;  2K3R A;  5GTH E;  1USD A;  3B5N C;  1ZR2 A;  2OGU A;  1QGK B;  1IO4 A;  3FXD A;  1MKM A;  5H2F V;  1VL2 A;  3A0H V;  5CMZ A;  2W6J H;  3H1J D;  2A06 D;  1HTL C;  3L72 E;  1T2K C;  2QJY B;  5KAI V;  5BU8 B;  4FAV A;  1DW1 A;  3EQ2 A;  1VYD A;  1SFC D;  1EXI A;  3B4S A;  2Q9I A;  4H13 C;  1VQP P;  1KIL C;  3VRD A;  2E75 C;  1KX7 A;  2GUS A;  1AVO A;  3IF4 A;  4ZKP A;  1F1C A;  1LTJ A;  1KQL A;  3ZOX A;  1P84 D;  2ZYD A;  1LP1 A;  3AED C;  2OYO A;  5TIS H;  1QYZ A;  2WIT A;  2R32 A;  4H0L D;  1U57 A;  2W83 C;  1PP9 D;  1HZV A;  3E1I A;  2WSS H;  1CSV A;  5B5E V;  2YO3 A;  1YHQ P;  3ITK A;  1JTH A;  4DJG A;  3CX5 E;  4KJM A;  2N9B A;  4RJT A;  1S1C X;  2OAR A;  3NMD A;  3PXT A;  3II6 A;  1KB9 H;  2KS1 B;  4M3L A;  3V4W A;  1RZ6 A;  2RMZ A;  3V4Q A;  2N1T D;  3HE5 A;  1H88 A;  1H32 B;  2AI5 A;  4GT1 A;  2IBZ G;  4HH2 A;  4L73 A;  1S9K E;  3C2C A;  2QJK B;  4WQD A;  4Y99 B;  3VN0 A;  2JTI B;  2P2U A;  1JNM A;  4LGD E;  2E42 A;  4H0K A;  3BCC J;  1IK7 A;  1YJW P;  3HRN A;  5C0Z A;  1RE4 A;  2O01 J;  2Q3E A;  1KN7 A;  2R5D A;  1HGV A;  1KD1 Q;  1AJY A;  2KYV A;  1JY2 O;  1PIX A;  2MHM A;  3AE3 C;  3JCU H;  2B12 B;  1H31 B;  2FYN C;  2YNY A;  3CC7 P;  3A3Y B;  1X8Y A;  1GU4 A;  3L73 D;  1HJ5 A;  3H1H E;  1CIG A;  2AIU A;  3RK3 E;  2YXR B;  3CCE P;  5TIS E;  1FZG A;  1SQB K;  1NTZ K;  1COR A;  2BPB B;  5CCG C;  3IN6 A;  1LS9 A;  2R3C A;  2BCC J;  1IO3 A;  3CCJ P;  3H1L G;  1NML A;  3F89 A;  2WPR A;  1W5C T;  1AYG A;  1RAQ A;  2H89 C;  1SQB E;  2IDB A;  3L75 J;  4K35 A;  1KB9 E;  2B4Z A;  3QWO C;  1RF0 C;  3H32 A;  3MUD C;  1L9J C;  1BGY J;  1N7L A;  3TDK A;  3CC4 P;  1OW6 A;  2QIW A;  4U7J A;  1NGM B;  1CRJ A;  2BH5 X;  3SFE C;  3OW2 O;  1QN2 A;  4FA5 A;  2KUB A;  1OZH A;  2ZBO A;  1FZC B;  4WB4 A;  1QX8 A;  2QE7 H;  1H33 A;  5AW2 B;  5E79 H;  2IFN A;  3ZDM A;  1YEB A;  3OCD A;  1GK4 A;  1KIL B;  2E75 B;  4XA4 A;  3WFB C;  2C8S A;  1EXJ A;  2C1D B;  2WZ7 A;  3PJS K;  1URQ C;  3TSI A;  4RES B;  3HE4 A;  1KOR A;  2KIK A;  2H88 C;  3USS A;  3SVW A;  4WQ7 A;  4H44 D;  2B89 A;  3VP8 A;  1A2S A;  2C9N Y;  3L37 A;  4BRY A;  3HD7 D;  2OYH B;  3R2P A;  1SQQ G;  3MP7 B;  4LJI A;  3H1K G;  2P58 A;  1KYO W;  5KLV K;  4Q5P A;  2OZ1 B;  1L4A C;  1M57 D;  3S9O A;  1A02 F;  1HJ4 A;  5KKZ C;  1NU1 G;  1KYO I;  4RSZ A;  1VF5 C;  3AE1 C;  4GOF A;  3A0H H;  5KJ7 C;  1OW7 A;  2ZAE B;  1CYJ A;  1GL2 C;  1RQU A;  1H8A A;  3SWF A;  1DW3 A;  3OA7 A;  1T3J A;  1NHL A;  4MN4 C;  4WWI A;  4YXD C;  5KLV E;  5B66 V;  1FZB A;  2IBZ I;  1SQP K;  3JBT B;  1FDO A;  3CXH I;  1LMS A;  3L70 J;  1M90 Q;  2PAC A;  4JCG A;  1U7J A;  1P84 H;  2W6B A;  2B88 A;  1VQ5 P;  1DIQ C;  3IR9 A;  3TGU E;  2E76 C;  5DJQ C;  2N18 C;  4WY4 A;  1M1J A;  3PP5 A;  1L9B C;  4GDO A;  3Q5P A;  1X22 A;  5E79 E;  1KV4 A;  1C2R A;  3H1L D;  1SQP E;  2GC7 D;  2ZZS 1;  1BSN A;  2FYN B;  3RK2 C;  1HVV A;  1FDM A;  2JQR A;  5AW3 B;  2IYP A;  1N7S C;  3KQG A;  1KC8 Q;  3RL0 C;  3VOP A;  2CXB A;  5AVV B;  2GM4 A;  1LWU A;  3RL0 g;  2Y0E A;  3D6Y A;  2LXB A;  2JDI H;  1G1I A;  3HUS C;  2ZYG A;  1K3G A;  2WSE J;  2O01 N;  2WMM A;  1W2E A;  4U3F J;  3T97 A;  2XND H;  2FYZ A;  2Y9Y A;  4XYD B;  4N78 D;  4RO0 A;  1NTM J;  2QM7 A;  1YQ4 C;  4DY9 A;  4ZNC A;  1AQ5 A;  1N50 A;  1NTZ D;  1NKZ B;  3A0H E;  2HPC B;  2BEQ D;  2A06 E;  1NTK J;  3H1J E;  5AVT B;  1IC2 A;  4I7Z C;  2D2C C;  1SQB J;  1GW4 A;  5TJH A;  1HRC A;  3JC2 2;  1M1K Q;  2M3E A;  2PAJ A;  1DEE G;  1JB0 J;  3SFD C;  1BCC J;  3H1I G;  4IFF A;  3LID A;  3G6E P;  2E74 D;  2XU6 A;  4FA1 A;  1L0N J;  3O8Z A;  1P84 E;  2OYI A;  3RK3 C;  3BRT B;  1JY3 O;  5APX A;  1KQF B;  1KV9 A;  2XNX A;  3O0R C;  1OAE A;  4N0K A;  5AW5 B;  1SQQ D;  1SQX E;  3SLE A;  3H1K D;  3CCR P;  2XV5 A;  5B5E E;  1FCD C;  5AW7 B;  4EI2 A;  3RGU A;  2I8D A;  1NU1 D;  1FJP A;  2NPS A;  1GD2 E;  1URQ B;  1LTJ C;  1W5C E;  2E5Y A;  1IFJ A;  5CJ4 A;  4WQA A;  3LW5 H;  1OVV A;  4IL6 X;  1CED A;  1GIW A;  1CI6 B;  2IFM A;  5AW6 B;  2HOD A;  1S5L H;  4PJ0 V;  3G4S P;  1NH4 A;  1KFN A;  3C8V A;  1RHZ B;  2C0W A;  1DW2 A;  1M60 A;  4KHX A;  3ZOY A;  5KKZ B;  1IFP A;  5AUR A;  1VF5 B;  2FFD A;  2B87 B;  1ZP0 C;  3TYY A;  2BLF B;  2IYO A;  5APW A;  1QVF O;  4JBZ A;  1Y9B A;  1HBW A;  1CSW A;  1ZOY C;  2KNC B;  2L4D A;  1NYH A;  1LGH B;  1CYI A;  1EZV D;  2YXQ B;  5AW0 B;  2KB7 P;  1KYO H;  1VQM P;  1GU5 A;  1CSX A;  3AE7 C;  2CPS A;  3FXE A;  3U1A A;  1AQT A;  2B9B A;  1C6R A;  1ZRT D;  1X9V A;  3M91 A;  2M5A B;  4YPC A;  2NZ2 A;  3L73 E;  2E76 B;  1LFM A;  4OVN F;  1FJK A;  3HTK A;  2B10 B;  1KTM A;  2GC4 D;  2L5G B;  2N18 B;  2XZR A;  4HJG H;  3B5N D;  4IFM A;  1RE4 C;  2K88 A;  1VQN P;  2C9X B;  2WSC J;  1PZQ A;  1OFC X;  1WRG A;  1CC5 A;  3RN0 A;  2ZYA A;  3P8C D;  1FI9 A;  2N3Y A;  1J3S A;  1EDI A;  1N7S B;  5K5G B;  2WT7 A;  1EQ7 A;  1E29 A;  1CTY A;  1T2K D;  1R0Q A;  4ZKU A;  1ZR4 A;  1PV3 A;  4PD4 I;  3AEB C;  2PGD A;  1CRH A;  4YE1 A;  1AOQ A;  2WPQ A;  3O6Q B;  2K37 A;  5DJT B;  2K9J A;  3GF3 A;  4H13 D;  5B6Q A;  1KIL D;  3HUS B;  2E75 D;  4K3A A;  1S5L E;  3MD0 A;  3H1I D;  1QL3 A;  3V2R A;  2LR2 A;  2CA3 B;  5AVX B;  2BCN B;  3HQ9 A;  3CME P;  4DCK A;  2PP6 A; 
#chains in the Genus database with same CATH homology
 1IZL 0;  3L73 D;  1HJ5 A;  1A56 A;  1CIG A;  4AAN A;  2AIU A;  4AAL A;  1NIR A;  1H9X A;  4EDF A;  4MU8 A;  1COR A;  2BPB B;  2YK3 A;  5EXQ A;  1ZZH A;  1LS9 A;  3NWV A;  3CX5 W;  1IO3 A;  3ZBM A;  1NML A;  1CTJ A;  1IRV A;  4WQE A;  4NFG B;  1E8E A;  2HV4 A;  4L1Q A;  1W5C T;  1CO6 A;  2ZON G;  1AYG A;  1RAQ A;  1QL4 A;  2N9J A;  2DGE A;  1HH7 A;  4FB1 A;  2Y0D A;  4UB8 V;  3ZOW A;  1HRO A;  2B4Z A;  1CIE A;  4O1W A;  4H0J A;  4AAO A;  1WEJ F;  2D0W A;  2C1V A;  4FAN A;  1C7M A;  1L9J C;  3TDK A;  3WU2 V;  2MTA C;  1CHI A;  1DII C;  2RN0 A;  1CXC A;  1CHH A;  3O1Y A;  1N9C A;  3H1H D;  1CRJ A;  3X39 A;  1RAP A;  2GB8 B;  1BE3 D;  2VHD A;  4PD4 D;  2BH5 X;  3L4M A;  5TIS V;  1FHB A;  4UB6 V;  1QN2 A;  4FA5 A;  4AAM A;  4J20 A;  2ZBO A;  155C A;  1MG3 D;  1LC2 A;  1H1O A;  1H33 A;  5DJQ B;  1C52 A;  3WC8 A;  1IQC A;  2O3J A;  1YEB A;  3OCD A;  1C75 A;  4L3G A;  3MK7 C;  1I8O A;  1CCR A;  1U74 B;  1I6E A;  4WQ9 A;  3WFB C;  2C8S A;  4K3I A;  5DFS A;  3A9F A;  2XTS B;  2C1U A;  2C1D B;  5KAF V;  3M97 X;  1N15 A;  1FJ0 A;  1CRI A;  1SQB D;  3VNW A;  3SVW A;  4WQ7 A;  3O5C A;  1KB9 D;  3PXS A;  2QG4 A;  4A7P A;  1A2S A;  1WVE C;  1C2N A;  451C A;  3DMI A;  4L3H A;  3HQ7 A;  1JDL A;  1B7V A;  2PCC B;  3PH2 B;  1MZ4 A;  3KHU A;  4LJI A;  4IL6 V;  2JWA A;  1KYO W;  3DR0 A;  4Q5P A;  2OZ1 B;  2ORL A;  4WQ8 A;  1HJ4 A;  3WFD C;  1CNO A;  4RSZ A;  1KX2 A;  2N3B A;  1AKK A;  1YCC A;  1CRG A;  1CRY A;  1CYJ A;  1CXA A;  2K9J B;  5CID B;  2D0S A;  1DW3 A;  1NMI A;  351C A;  2CA4 B;  1I55 A;  3L74 D;  1CCH A;  5B66 V;  1YFC A;  4D6T D;  3JBT B;  3ZCF A;  1MG2 D;  1LMS A;  1FI3 A;  2PAC A;  4JCG A;  3CYT I;  4WQC A;  1NNO A;  1OCD A;  5CIF B;  1DIQ C;  2BCC D;  1W2L A;  3L4O A;  2FYU D;  2BH4 X;  4EIE A;  4KMG A;  3SJL A;  5DJQ C;  1GU2 A;  2N18 C;  1L9B C;  1S5L V;  3GG2 A;  1PPJ D;  1M6Z A;  2BGV X;  1C2R A;  3H1L D;  1C6S A;  2GC7 D;  5CIE B;  3L75 D;  3RMZ A;  2ZZS 1;  2FYN B;  2N9I A;  2JQR A;  2ZXY A;  1F1F A;  1BGY D;  3KZI V;  3OA8 B;  3DP5 A;  1GDV A;  1SQX D;  2KS1 A;  5CIG B;  2CXB A;  4WQB A;  1CRC A;  1U75 B;  3NBT A;  2Y0E A;  5KLV D;  5C9M A;  1H32 A;  3VMA A;  3RLM A;  3WFC C;  2V07 A;  2FRC A;  3ORV A;  5CIB B;  1DW0 A;  1K3G A;  4EID A;  3WUI A;  1KYO D;  1FI7 A;  2C2C A;  4QAO A;  4XYD B;  3PRJ A;  4DY9 A;  1CTZ A;  5CIH B;  1COT A;  1N50 A;  3TGU D;  1YTC A;  1IRW A;  1NTZ D;  4EIC A;  3ZIY A;  1H33 B;  1ETP A;  3ZOO A;  3WFE C;  1A8C A;  1HZU A;  5E79 V;  1CHJ A;  3OCD B;  1SQP D;  1S6V B;  5TJH A;  1QKS A;  1HRC A;  2IBZ D;  3CXH D;  1I8P A;  1YIQ A;  2OZ1 A;  5CYT R;  4PW9 B;  3NBS A;  2I8F A;  3BCC D;  1H31 A;  2EXV A;  4FA1 A;  3L71 D;  2B11 B;  1CSU A;  2CE1 A;  1AOF A;  1KV9 A;  1I6D A;  3O0R C;  1OAE A;  4N0K A;  2B0Z B;  1SQQ D;  4GED B;  3SLE A;  3MK7 B;  3H1K D;  1GKS A;  3TF5 A;  3CXH W;  1FCD C;  3CWB D;  1NU1 D;  4O1Q A;  2YQB A;  5H2F V;  1L0L D;  4GYD A;  4P4Q B;  1DVH A;  3A0H V;  2YCC A;  3H1J D;  2A06 D;  4WQA A;  1I54 A;  1I5T A;  2QJY B;  5KAI V;  3L70 D;  1CED A;  1GIW A;  5IY5 1;  1KB0 A;  4FAV A;  2QJP B;  4PJ0 V;  1DW1 A;  1VYD A;  1C6O A;  1DW2 A;  1M60 A;  1YNR A;  3VRD A;  3ZOY A;  1HJ3 A;  5KKZ B;  3PXW A;  1KX7 A;  2L91 A;  3VYM A;  5AUR A;  1CYC A;  1F1C A;  3ZOX A;  1P84 D;  2BLF B;  3SXT A;  1SQV D;  5GTI V;  2AXT V;  3OA8 A;  1QYZ A;  1GJQ A;  4PWA A;  1KIB A;  4FA4 A;  1CSW A;  1PP9 D;  1HZV A;  2LIR A;  4AX3 A;  2KNC B;  1EB7 A;  5GTH V;  2L4D A;  1CSV A;  1CYI A;  5B5E V;  3RN1 A;  1EZV D;  3ITK A;  1CSX A;  2LIT A;  5KLI B;  3TYI A;  4RJT A;  5DF5 A;  2C1D A;  1E2R A;  3GW6 A;  2FWL A;  1BL9 A;  3PXT A;  1C6R A;  1ZRT D;  1YEA A;  4V2K A;  3L72 D;  1M70 A;  1LFM A;  5CIC B;  1HCM A;  2PCB B;  4U3F D;  3PHL A;  1RZ6 A;  2B10 B;  2RMZ A;  2GC4 D;  2N18 B;  1GQ1 A;  3PTZ A;  1H32 B;  2AI5 A;  1NTM D;  2C9X B;  1CIH A;  3PLN A;  3C2C A;  3CU4 A;  1CC5 A;  3RN0 A;  1FOC A;  2QJK B;  4FA9 A;  2Y0C A;  1NTK D;  1FI9 A;  3FWL A;  2YIU B;  2GIW A;  2N3Y A;  4WQD A;  1J3S A;  2V08 A;  2N9Y B;  2JTI B;  4XXL A;  1E29 A;  1CTY A;  1N90 A;  3SWS A;  1R0Q A;  3HQ6 A;  1LC1 A;  1DVV A;  3CP5 A;  2DVH A;  3HQ8 A;  4EIF A;  1CRH A;  4YE1 A;  1BCC D;  4H0K A;  1AOQ A;  3O20 A;  5C0Z A;  1RZ5 A;  1YIC A;  5B6Q A;  1L0N D;  1H9Y A;  2Q3E A;  1CIF A;  2CE0 A;  3CX5 D;  1K3H A;  3H1I D;  1QL3 A;  2CA3 B;  2MHM A;  2BCN B;  3HQ9 A;  2ZOO A;  2B12 B;  1DT1 A;  1H31 B;  4Y5R A;  3A0B V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...