1SQBD

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 53
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqbD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqbD01
1CHIA 3HQ9A 1H33B 1B7VA 1CRJA 3TDKA 1CRHA 5DFSA 4FANA 1LC1A 2V07A 3SLEA 1AYGA 1HRCA 1LMSA 1DVVA 2QJYB 1KIBA 1RAQA 1QKSA 1C6RA 1CTJA 1I5TA 1MG3D 1NTKD 2CE0A 3GG2A 1NMLA 3L70D 4WQAA 1F1CA 1JDLA 3O5CA 4FAVA 5TJHA 1GQ1A 1H1OA 2FWLA 4A7PA 1SQBD 5EXQA 1R0QA 3L73D 1CHJA 4D6TD 2K9JB 3VRDA 1NTZD 3WFBC 2AI5A 3OA8A 1DT1A 4XXLA 1GU2A 1NU1D 4EDFA 1K3GA 4WQ9A 1KYOW 1DW3A 1VYDA 5GTHV 1FOCA 2BGVX 1LFMA 2A06D 3DMIA 2AIUA 1BE3D 1CYIA 1IZL0 1U75B 1KB0A 1DW1A 5GTIV 1AOQA 1DIIC 1ZRTD 3CP5A 1I6EA 3PLNA 3PXSA 2YIUB 1H32A 1CO6A 3KZIV 5IY51 1PP9D 1DIQC 3L4MA 2L4DA 2FYUD 1CRCA 2BCNB 4KMGA 4NFGB 5KKZB 2N9YB 1I8OA 4IL6V 1QL3A 2C1DA 3TYIA 1FJ0A 4P4QB 5KAFV 3HQ8A 1KV9A 3OCDA 1N50A 1LS9A 4PJ0V 3L72D 2BH4X 1CYJA 5CIBB 1YICA 4L3HA 2GC4D 5CIFB 1KX2A 2MHMA 1A2SA 1N15A 4FA5A 1CORA 1CSXA 1SQXD 4AAOA 351CA 2N9JA 1CIEA 3CYTI 2CXBA 1K3HA 1EZVD 2ZXYA 1HZVA 1H9XA 4H0JA 1KB9D 1C2NA 3H1LD 2DVHA 3VNWA 4MU8A 2GIWA 1CIFA 1I8PA 1HH7A 4RSZA 2CE1A 4WQBA 1W5CT 2ZBOA 3PHLA 2C1DB 1U74B 1HJ5A 3ZIYA 5DF5A 3M97X 1YEBA 1CCRA 1E2RA 3WFCC 4V2KA 1C6OA 4WQCA 1WEJF 2B4ZA 2D0WA 1CRGA 3WC8A 4Y5RA 1CXCA 2XTSB 2YQBA 1LC2A 2L91A 4YE1A 2JQRA 1S6VB 1YFCA 2CA4B 2LITA 3PH2B 5KLVD 3CXHD 2YCCA 4LJIA 1M6ZA 1C52A 3HQ6A 1CSUA 1IQCA 5AURA 1CEDA 3VMAA 1CSWA 1S5LV 3TGUD 1DW2A 2C8SA 1IRWA 2N9IA 3ORVA 2O3JA 3A0BV 1NTMD 1WVEC 1EB7A 2B10B 2AXTV 1AOFA 2MTAC 3C2CA 5CIHB 3ZBMA 2C2CA 3DR0A 1QL4A 3H1HD 4EICA 2Y0CA 1N90A 5CIDB 3A0HV 1CXAA 2OZ1A 4AX3A 1QN2A 2PCBB 1ZZHA 2ZONG 3L71D 1KYOD 3NWVA 1W2LA 3L4OA 3TF5A 1I55A 1HJ3A 4GEDB 1MZ4A 2GC7D 3CWBD 3X39A 4PWAA 1F1FA 1HROA 3HQ7A 1A8CA 1YNRA 2VHDA 1FHBA 155CA 1H33A 1I54A 1IRVA 1GKSA 4U3FD 5DJQB 4AAMA 4EIDA 5B66V 3NBTA 1AKKA 1N9CA 1CRIA 1L0LD 3WU2V 1DW0A 4FB1A 3BCCD 4FA9A 2LIRA 1L9BC 1M70A 2PACA 3ZOYA 2DGEA 1BL9A 3PRJA 1KX7A 4WQDA 1L9JC 3MK7B 4Q5PA 5B6QA 3RMZA 1C75A 2QJPB 2ZOOA 2BCCD 2Y0EA 3WFDC 1CIGA 2QG4A 4UB8V 2RN0A 5KAIV 1YCCA 3O0RC 3ZOWA 1C7MA 5TISV 3ZCFA 4EIEA 3RN0A 1NMIA 1NNOA 1H31A 1RAPA 1IO3A 2B12B 3MK7C 4PD4D 1J3SA 1CTZA 5C0ZA 5KLIB 1CIHA 1OCDA 4QAOA 3SJLA 4AANA 3WUIA 2OZ1B 3ZOXA 3H1JD 2C1VA 1FI7A 1HZUA 5E79V 2C9XB 2CA3B 3O1YA 3H1KD 1MG2D 4XYDB 3CU4A 1RZ6A 5DJQC 3CX5W 4UB6V 2KNCB 1A56A 2BH5X 2B0ZB 1DVHA 3JBTB 4WQEA 1P84D 1CHHA 3PTZA 4K3IA 3PXWA 3A9FA 1H31B 1HJ4A 1YEAA 2ORLA 2RMZA 1CNOA 4J20A 2FRCA 1I6DA 2IBZD 3PXTA 1SQQD 2JTIB 5CIGB 3SWSA 1FCDC 2D0SA 3OCDB 1CSVA 4RJTA 4H0KA 1NIRA 3NBSA 4JCGA 4GYDA 3RLMA 2HV4A 2PCCB 3CXHW 1C6SA 5CYTR 4L1QA 2FYNB 1BGYD 3OA8B 2EXVA 1GJQA 3L74D 3KHUA 1CRYA 1RZ5A 3DP5A 1BCCD 5C9MA 1GIWA 1ETPA 4EIFA 3H1ID 4AALA 451CA 3RN1A 3GW6A 1H9YA 1GDVA 2I8FA 2YK3A 3L75D 3SVWA 1E29A 4FA4A 3O20A 3SXTA 3WFEC 5H2FV 1PPJD 1E8EA 2C1UA 4PW9B 5B5EV 1H32B 1CCHA 4O1WA 2ZZS1 1C2RA 1COTA 4N0KA 2B11B 4WQ7A 2Y0DA 3VYMA 1SQPD 1FI3A 4FA1A 1FI9A 4WQ8A 3ITKA 1CTYA 2N18C 5CIEB 1YIQA 2BLFB 1HCMA 3CX5D 1CYCA 1OAEA 2V08A 4DY9A 1SQVD 1CC5A 2JWAA 3ZOOA 1YTCA 2KS1A 2N18B 1L0ND 2QJKB 2N3BA 4O1QA 4L3GA 2Q3EA 5CICB 1QYZA 1M60A 3FWLA 2GB8B 2BPBB 2N3YA
chains in the Genus database with same CATH superfamily
3TSIA 4WBAA 2O01H 2P67A 1DH3A 5GTIH 1BGYG 1B7VA 2WTYA 1CRHA 1GW4A 1TU3F 2Q7CA 2V07A 1FAVA 2WSEH 1HRCA 1OW7A 3D6ZA 1IFIA 1N73B 1P84I 1CTJA 1NTKD 3Q3DA 3G3ZA 1AV1A 1PV3A 4FAVA 1SQXE 4I2LC 1GQ1A 2IBZI 3FXDA 3HRNA 3JCUE 2GM4A 1N73C 3CCVP 2XU6A 1SQQE 2WPRA 1BE3G 4ZKUA 1NTZD 3CMAP 3B8EB 5KLVG 1GU2A 2Q9IA 4PD4I 3CCLP 1VQ8P 2OTLP 3GF7A 1NU1J 1VL2A 1FOCA 5AVSB 1GMJA 1BGYE 1NTZE 3A3YB 2QM7A 1QEXA 3S1KA 4JYCA 2WQYC 1GU5A 4D6TG 2WSEJ 1DW1A 2H8PD 2FYUE 1DIIC 1T8ZA 3PLNA 1FZCA 3PXSA 2NZ2A 2AEFA 1CO6A 1KV4A 2M3EA 5CJ4A 1EDKA 3L75J 2KZIA 1Y47A 1ZP0C 3W68A 4N3YB 2Q6QA 2IYPA 5K5GB 1CRCA 2C0WA 1JY2N 1MUUA 4RO0A 2ZVOB 2KNCA 2D2CB 1IFMA 4IL6V 3WU2E 2POHA 1QL3A 1FZGA 1E5WA 3M9HA 5KAFV 2G3AA 4RKUJ 1EXJA 1M90Q 2UWJE 2E76D 4PJ0V 2PGDA 2P10A 1IFDA 1USDA 2FFDC 3L70E 4L3HA 2GC4D 2OYIA 3FGAD 5B66E 1A02J 1LNQA 1CSXA 3L71E 4NPFX 1VF5D 1CIEA 1SS1A 1HZVA 1PGOA 4CPGA 2NPSB 3JSVC 4EI2A 1N73A 3GMAA 2GIWA 1RHZB 1ZOYC 4GOFA 1I8PA 2FXPA 4RSZA 1MFTA 1W5CT 4L75A 1VQNP 2B9BA 3M97X 4UB8H 2R5BA 1KILE 2ZT9B 1LT9B 5BVZA 1VQKP 1CRGA 3WC8A 4ZNCA 4Y5RA 1LC2A 2L91A 4YE1A 1NTKE 3LIDA 1J1EB 2KOGA 2WPSA 1SQVG 2LITA 5KLVD 1SQQJ 4LJIA 1M6ZA 3BRVB 2KP8A 1DIPA 1LTIC 5AURA 1CEDA 3VMAA 3R4YA 1FZCB 2N9IA 3ORVA 3CI9A 1BGYJ 1YTZI 1E79H 3CWBG 3M06A 5CIHB 1QL4A 4BRYA 3AEBC 1FBMA 3LW5J 2Y0CA 3L71J 1NTMK 1FU1A 3TNUA 3KPEA 3I5CA 3ABVC 2B87B 2PRRA 3H1JJ 1OVUA 3CC2P 2AXTE 4WY4C 4C7NA 1QL1A 1HJ3A 1VQOP 3NTNA 3MP7B 1F1FA 1A8CA 1I54A 2IZ0A 5DJQB 5B66V 3NBTA 2OTJP 2FYUK 1X0TA 5KJ7D 2D2CD 3AE3C 1FOSF 1M70A 1YYCA 3PRJA 1JMBA 1OMIA 1SQVJ 3G4SP 1C75A 2W8ZA 3VMXA 4PD4E 3BRTB 2Y0EA 2QG4A 3WUVA 1M1JC 1NH4A 3LW5H 1IK9A 1YCCA 3O0RC 1C7MA 3WUTA 1NTZJ 2B89A 1H31A 2B12B 3MK7C 3A0HH 1HWTC 1J3SA 4PV1C 3G71P 2WVRA 2FYZA 1NTKK 3TGUE 3N7NA 5C0ZA 1LP1B 5KLIB 3L37A 1M1JB 1R8EA 4QAOA 3SJLA 3H1LE 3L73G 4DZOA 3WUIA 1GL2D 3ZOXA 3GF3A 1T3JA 2WT7B 3Q5RA 1HZUA 5E79V 4H44C 3K5BA 1MG2D 5CCHD 2IBZG 2DW3A 1DEBA 2KNCB 3RL0C 4N6JA 1SFCC 3JBTB 3QH9A 2L5GB 2YKOA 3CWBE 3PXWA 1Z56A 2A06E 3S4RA 2IBZD 1G1IA 3HE5A 1ZRTE 4O9BA 2D0SA 3MTUE 3KZIE 3B5NA 2IYOA 4PD4H 4GYDA 3V4WA 3CC7P 3U59A 3H1IJ 3RLMA 2YKQA 1LTJB 2HV4A 2LXCB 3CXHW 1C6SA 1MKMA 4IL6E 1NAFA 1W2EA 5KAFE 1KB9I 5C9MA 1GIWA 2KSEA 3AECC 2YMYA 3AE9C 2FBWC 3H1LJ 1OW6A 5TISH 1GDVA 1AFOA 1N8RQ 2I8FA 3HTKB 5AVZB 2YK3A 1NTME 1LT9A 4FA4A 3O20A 1SQBG 1PPJD 3KXDA 1BCCG 1H32B 1RF1C 2P7JA 1MV8A 4N78D 2I8DA 3A0HE 1KFNA 1SQPD 1FI3A 2YMKA 2HLOA 2JO1A 3L72E 1X8YA 2CPSA 3L35A 1YIQA 4XFJA 1N7SB 2FYNC 1OW8A 4MN4C 1PP9J 4B86A 1CI6A 5GTIE 3M9BA 4EYYQ 1LGHB 1FJKA 1SQQG 2MJZA 2IDBA 1KB9E 2N18B 4BXLA 2K9JA 4W80A 4ASWA 5APUA 1YI2P 1SQXG 2BPBB 3BCCG 2KB7P 1YJ9P 2CK3H 1KQFB 1H33B 1FC2C 4OGQD 3H1LG 3SLEA 1AYGA 1LMSA 1RAQA 1LTJA 1QKSA 1NTZG 1I5TA 3KZIH 2CE0A 2OYHB 3IFMA 3L70D 1F1CA 3B4SA 5AVWB 4R4LA 1JDLA 3MUDC 2E75D 1L4AA 1QL2A 4K3AA 3CCQP 1GTWA 2I1JA 2QVAA 1R0QA 2P58A 2WSSH 1CI6B 4OWFA 2NPSD 4D6TD 3VRDA 3RL0g 1PGJA 2E42A 1BDDA 3RK2B 1KTMA 2OGUA 1NU1D 1L0NJ 1IC2A 1M1JA 4EDFA 1K3GA 4WQ9A 1KYOW 3H1KJ 5B5EH 1DW3A 5CCGD 3C1LA 2WMMA 1EDJA 2C9NY 2Z5HA 2H88C 1UIIA 3RK2C 1KB9H 2BEZF 1KB0A 2IBZE 5GTIV 1NTZK 1ZRTD 2W27A 1I6EA 3GLMA 1L0NE 5L8RJ 2J58A 1JM0A 1PP9D 3L4MA 2L4DA 1SQVK 3EFGA 1OVVA 1L0LK 5APTA 1OVRA 2BCNB 2AXTH 2M8RA 1BE3J 5KKZB 1I8OA 1Q86Q 2ZT9C 3R2PA 2FYUJ 5H2FE 3P8CE 5KLVJ 2C1DA 4AYCA 1KQLA 4P4QB 1HUCA 2NRGA 3HE5B 3CD6P 3L72D 4GOEA 1M57D 5CIBB 1WT6A 3CX5I 3RK3B 3H1KE 1NYHA 2MHMA 3B5NB 1KQGB 3D6YA 1SQXD 4AAOA 1JY2P 2KI7B 1CZQA 2JWDA 2N9JA 1IFNA 2CXBA 4AQRD 2ZXYA 4HKZH 5APQA 1M8OB 4H0JA 1C2NA 3RK3C 2DVHA 2MKVA 4W7ZA 3VNWA 2YIUC 1CIFA 2CE1A 4TLFA 1J1EC 1SQBK 2HODA 1R5SA 5C39A 1L0LJ 3M0DC 1RY3A 5DF5A 1CCRA 2Q3IA 3KQGA 1VQ7P 4IFFA 1GL2C 3V6IA 1C6OA 4IL6H 2YO2A 2D0WA 2N9BA 1JY2O 1CXCA 2XTSB 3PH2B 2CA4B 2WSCJ 1ZN5A 5CCHA 4PJ0H 2YXQB 5B66H 1ZXGA 4C7RA 1VF5C 2K88A 2BCCJ 1CSWA 1IO4A 1X79B 1G2CA 3H1HE 3GHGA 2FXOA 2C8SA 1L0NK 2AXCA 1SQBJ 2WPVB 4HB1A 1JY3P 1WVEC 2B10B 1LWUC 2HODB 1T2KC 1VF5B 1GK6A 1G1JA 1JTHB 1Q81Q 1RE3A 3T97A 3ZBMA 2C2CA 2ZYGA 1PL5A 1RQVA 1OFCX 1MFZA 2XV5A 3A0HV 3SWYA 2G8YA 4AX3A 4KT0J 3CL3D 5GTHE 3AEFC 4GIFA 1KZUB 1W2LA 5CHXA 3L4OA 3LIEA 1I55A 4PWAA 1HROA 4WY4D 3HQ7A 1YNRA 1HGVA 4H44B 5CJ0A 2E76B 3U1AA 3CCSP 3L72G 4U3FD 4IL6X 4AAMA 1L4AD 3WU2V 1P84H 3V4QA 1U7JA 2DGEA 1VDFA 1KX7A 2Z5IA 3CWBJ 3MK7B 4Q5PA 3RMZA 4PJ0E 3V5BA 1DD3A 3I56P 2BCCD 5CCGA 1Q7YQ 2O1JA 3W67A 3VN0A 1KYOI 2OARA 5KAIV 1AVYA 1KORA 1RF0C 4EIEA 4DCKA 1NMIA 1PIXA 4UB8E 5EFWB 3E1IA 1RAPA 1IO3A 2BCCE 2O1KA 1EZVE 2ITAA 2WPQA 1HBWA 1S5LX 1NU1K 1S1CX 2J59M 1Q90D 1SQPK 2AEJA 1S5LH 1AVOA 1URQC 2M5AA 3CU4A 1RZ6A 3A0BH 3HD7C 1L0NG 3SSUA 2QEXP 3F5HA 2J5UA 2BH5X 3CPWO 2A45I 3VTPC 3CC4P 2R32A 1URQB 4RESB 4WQEA 2QJPC 2KIKA 3HD7B 4M3LA 2V4HA 1HJ4A 1EZVG 2RMZA 1LTJC 4J20A 2O01N 5AVYB 1KFMA 1RF1B 1P84E 2JTIB 5CIGB 3TGUJ 2PAJA 1HH0A 1FCDC 1CSVA 4RJTA 4H0KA 3NBSA 4JCGA 1H89A 4BWNA 2LR2A 2FXMA 1N7SA 4L1QA 3AEAC 3OA8B 4NPDA 1BCCD 2QE7H 3T97B 1ETPA 2K37A 3CCJP 3SWKA 3JC22 3H1ID 451CA 3GW6A 2A06G 1SFCD 3C8VA 3L75D 2Z4EA 3V2RA 1EDLA 3SXTA 3WFEC 3H1HJ 1NVOA 1FZBA 1U57A 3RBZA 1Y9BA 1R5LA 1RF1A 4O1WA 2ZZS1 4N0KA 2B11B 4WQ7A 2E75B 3TYYA 1H0TA 3CXHI 4L73A 1CTYA 2N18C 3HTKA 1QLED 2BLFB 1YITP 3CX5D 4YTPC 1CYCA 3Q5PA 1OAEA 5AW4B 1SQVD 1A02F 4U3FE 2HYNA 1S9KD 2QIWA 2KK7A 4WVZA 1L0ND 5BU5A 4O1QA 5CICB 1QYZA 4U3FJ 1KILB 3FWLA 2N1TA 2B87A 3Q2YA 5KAFH 1S5LE 1Q82Q 4WB4A 2M0BA 3AE4C 2XNDH 1JB0J 1YQ3C 3NXSA 1NOHA 1WMKA 3L74E 3NMDA 3HE4B 5DFSA 4FANA 1LC1A 2QJKC 3A0BE 3U1CA 1KYOH 4QMAA 3WMM0 3V2PA 1VQLP 3H32A 1C6RA 1MG3D 3GG2A 3Q5SA 1URQA 2YKPA 2ZXEB 3H1IG 4WQAA 3H25A 1LT1A 2WSFJ 2CPBA 5TJHA 1RE4C 3BVHA 3L75G 3P32A 1YTZT 2FWLA 2D2CC 1NTMJ 3O6QB 1SQBD 3AEEC 2OYIB 4HH2A 5APXA 3WUUA 3A5TA 1CHJA 2VRSA 2C0XA 5AVUB 1X9VA 4XXLA 1GW3A 1EXIA 3L72J 4DT0A 2E74B 3M9QA 2K3RA 3VMYA 1VYDA 5GTHV 2O01J 2BGVX 1LFMA 1PP9G 1USEA 4H13D 3I55P 1VQ4P 3DMIA 1G2CB 2AIUA 3FWNA 1U75B 1EQ7A 1SQQK 4I7ZB 1VQ6P 1S72P 3FX0A 3D71A 3CP5A 2WZ7A 1LJ2A 1ZR4A 2YIUB 3KZIV 1J2JB 1T2KD 1FOSE 3L75E 4I7ZC 2FYUD 4KMGA 4NFGB 2JP3A 2N9YB 3F89A 1D7MA 2OYOA 1N50A 2K1AA 1LS9A 4WY4A 4JQ0D 3E1RA 3NFQA 4IFMA 1YICA 1QVGO 5KAIE 1A2SA 4FA5A 1CORA 3CX5E 4D6TJ 1JO5A 1CSBA 3JCUH 351CA 1NAYA 1LWUA 1K3HA 1HGZA 3TNUB 2KZJA 4D6TE 3M91A 3H1LD 1RF0A 1GL2B 1OWAA 3D70A 2H43A 4WQBA 1K8AQ 1LP1A 3PHLA 1FDMA 2C1DB 1HJ5A 1HTLC 1YEBA 5KLVE 4WY4B 1SP4A 3HE4A 1H88A 4UB6E 1OZHA 1SQVE 1BE3E 4V2KA 1LTSC 1ZW0A 4KHXA 2A45H 1EC5A 2PP6A 2B4ZA 3CCEP 1JCDA 1KMIZ 3S9OA 1S6VB 1BSNA 2PFXA 1YFCA 3H1KG 2IZ1A 1NU1G 1C52A 1U7MA 3HQ6A 1CSUA 1IQCA 1FS0E 1PFIA 5AW2B 1KQSO 5AVTB 1L2PA 1RQUA 1DW2A 2OQQA 1IRWA 4LLHA 3CCRP 1YQ4C 1NTMD 1EB7A 1QGKB 1AOFA 3C2CA 1YHQP 2E74D 1LTGC 3PJSK 2E43A 3H6PA 5CIDB 3RK3D 4PV1D 1CXAA 4YXWH 3B5ND 5AVRB 2PCBB 2KS1B 4Y28J 1SQPE 1SQBE 1KYOD 3AEDC 1NTMG 3TF5A 3OAKA 3H32B 1MZ4A 1N7LA 2QRXA 5M1BA 1JOCA 1IK7A 1JEKA 2XDJA 2VHDA 2FKWB 1IRVA 1GKSA 1YIJP 1N9CA 1CRIA 1DW0A 4FB1A 2KXPB 3BCCD 2WITA 3HUSA 3L74J 1L9BC 5AW6B 1SFCB 4ZMDA 1FZCC 1BL9A 3L4FA 4WQDA 1L9JC 5B6QA 2KLUA 2QJPB 1DEEG 2AEMA 1CIGA 2KSJA 3ZDMA 2ZFCA 4OH8B 1HF9A 1NKZB 4UB8V 2RN0A 2QA4P 2KUBA 3ZOWA 1BCCE 5CBNA 5TISV 3L70G 3KYQA 3MIWA 3RN0A 3B71A 5APSA 1JNMA 4PD4D 2KLVA 1CTZA 2OTKE 1CIHA 1OCDA 3HUSC 2OZ1B 2C1VA 1M1KQ 2IPPA 2CA3B 3AE1C 3HD7A 4XYDB 3CCUP 1ZV8A 4KJMA 2W6AA 4H0LD 1A56A 3C9IA 3HUSB 3TK1A 1S2EA 1J1DC 1RH5B 5AW5B 1DVHA 1L4AC 1N86A 2XKMA 2XZRA 1NO4A 2GA1A 3PTZA 1IFPA 4K3IA 5APWA 3A9FA 3SFDC 2YNYA 1OXZA 4JYBA 1VQMP 1YEAA 2ORLA 1CNOA 2N1TB 4Y99C 2K9YA 1I6DA 2W90A 1J1DB 5KAIH 3L74G 5AVVB 1L4AB 3SWSA 3P8MC 3AE7C 3OCDB 1MZ9A 3RK2D 1NIRA 1KILD 1PGQA 5CMZA 4YPCA 4R4MA 4TT3H 5DJUB 1N7SC 2SPZA 3AE2C 1NHLA 2FYNB 2FFDA 1OX3A 3L74D 1RZ5A 3P8CD 2GUVA 3PP5A 1YJNP 4U7JA 3RL0B 1KILC 4ASVA 1JCCA 3RN1A 1H9YA 2JR8A 2E75C 5CBOA 3SVWA 1E29A 1VPCA 1SQXJ 1URQD 3CLQA 3SWFA 4HYTB 1X22A 2ZVNB 1KC8Q 4PW9B 5B5EV 1FDOA 2W6BA 3RK3E 3CCMP 1VQPP 1SQPJ 1VQ9P 1FDIA 4OGQC 1JY3O 2OYHC 3VYMA 5AVQB 4FA1A 5E79H 5AW7B 4WQ8A 1NTKJ 2M3BA 3ITKA 3VP8A 1GDTA 5CIEB 1BSHA 1HCMA 1KILA 2Q1KA 2OYIC 1ZLLA 4DY9A 2JWAA 2C9LY 3EFFK 1YTCA 2KS1A 5APYA 5AW9B 2QJKB 4L3GA 3CXHE 2Q3EA 4NPEA 5GTHH 1SLQA 1T6AA 3GHGB 2BASA 3MUDA 2N3YA 4H0LC 2OYHA 3A2AA 3PH0A 1CHIA 3HQ9A 1EZVI 4WWIA 1CRJA 3TDKA 4IFDK 1DVVA 2QJYB 5CCHC 1KIBA 4LC1A 2YO3A 3L70J 3GHGC 2QM8A 3E7KA 1NMLA 2B88A 1GU4A 1VQ5P 2H7HA 3O5CA 2HPCA 1SFCA 5KJ7A 5APVA 1H1OA 3II6A 2E74C 4A7PA 1S4XA 1ZR2A 5KTBA 5EXQA 2HR3A 3A7OA 3L73D 2K9JB 4EIJA 1RE3C 2KYVA 3WFBC 5AVXB 4U3FG 2AI5A 1NTKG 3OA8A 1DT1A 2BEQD 1NWQA 3IF4A 1M56D 5AW3B 2ZXXA 1IJDB 3EQ2A 4OVNF 3D0WA 3FXEA 3B5NC 1L0LE 2A06D 2BCCG 1BCCJ 2IFNA 3MHVA 1BE3D 1CYIA 1IZL0 1AOQA 3SFEC 1H8AA 1IZNB 1FZAA 2ZAEB 1W2BO 1H32A 2IFMA 5IY51 1LTBC 2R5DA 2LXBA 3O8ZA 4XE5B 3P7KA 4GODA 4C7NB 1DIQC 2JDIH 1RE4A 3L71G 3VYIA 1PPJE 3BASA 4YXDC 4N78E 3TYIA 4JPZB 3IN6A 3Q1MA 1FJ0A 3HQ8A 1KV9A 3OCDA 4GT1A 2HG5D 1JMMA 2BH4X 1CYJA 2FY8A 5CIFB 2RH0A 1KX2A 3MZWB 4LGDE 3RBXA 1N15A 1FZFA 1UIXA 1BDCA 3MGNA 4GDOA 1K73Q 1GD2E 1KYOE 2Y9ZA 3CYTI 1EZVD 5KJ7C 1H9XA 3BATA 3G6EP 2V7QJ 2FFDB 1KB9D 2JEEA 3OW2O 2JKVA 4MU8A 5KLVK 3OA7A 2W6JH 1HH7A 2ZBOA 1AQTA 5CCGC 1U74B 3ZIYA 1FJPA 3KDPB 4DOJA 4DJGA 5KKZC 1E2RA 3M0AA 3WFCC 3IR9A 4WQCA 1WEJF 3H1JG 5AW1B 2YQBA 1WRGA 1H0TB 2JQRA 1W5CE 3CXHD 3HD7D 2E76C 2YCCA 4L74A 2R3SA 3IAOA 1LT9C 1FZEA 4L76A 4XA4A 1S5LV 4JBZA 3TGUD 1SVFA 4IOIH 4H13B 1JY3N 3AE8C 1S3JA 2R3CA 3A0BV 2HFED 2NPSC 2O3JA 1NU1E 2AXTV 4UB6H 2MTAC 3DR0A 3L36A 2R44A 5AW0B 3H1HD 1DX7A 4EICA 1SQPG 1N90A 4H13C 2OZ1A 1NGMB 1KN7A 1QN2A 1ZZHA 2ZONG 3L71D 2FYUG 1NJIQ 3NWVA 2P1JA 3L73E 1DD4A 4GEDB 2GC7D 3CWBD 3X39A 3AEGC 1ZMEC 1T3UA 1LTAC 3L73J 1FHBA 5B5EE 155CA 1PP9E 1H33A 1N2DC 2Y9YA 4AUWA 4EIDA 1GK4A 1EDIA 1AKKA 3RL0D 1L0LD 3O6QA 1PZQA 4FA9A 1YBKA 2LIRA 4EOTA 2PACA 3ZOYA 2ZT9D 2N1TD 2IX7C 3G9RA 4BRYB 1K9MQ 2ZOOA 4Z1MH 3WFDC 1LWUB 2H89C 1QX8A 2N1TC 4Y99B 2ZJSE 2WWWA 3ZCFA 1L0LG 2ZYDA 4I6MC 1NNOA 1S9KE 1NKNA 3VP9A 1HJ0A 5H2FH 1XTGB 3TGUG 1YJWP 2ZYAA 1OIPA 4AANA 3VOPA 2GUSA 3H1JD 2Q5UA 5DJTB 1PPJG 1K04A 3V2NA 1FI7A 2C9XB 2V7QH 3O1YA 1QVFO 3H1KD 1SQXK 5DJQC 3CX5W 5KLIC 1FE6A 3USSA 4UB6V 1AA0A 3CXHH 2E5TA 1CW5A 1IFJA 2B0ZB 4K35A 2LKMA 4W7YA 1P84D 3AE6C 5E79E 1CHHA 1H31B 1LTTC 2FRCA 2P2UA 4HJGH 3PXTA 1AJYA 3H1HG 3N4XA 1GL2A 1SQQD 3QWOC 1K05A 2WSCH 4PV1B 1N7SD 3BCCE 1JTHA 3CMEP 2XNXA 2HPCB 4I1LA 2PCCB 3WU2H 5CYTR 3H1IE 1GZLA 1Q2NA 3RGUA 1HJBA 1BGYD 2EXVA 1GJQA 3KHUA 1CRYA 4C46A 3BCCJ 3DP5A 2A45G 2NPSA 1KD1Q 4EIFA 2RKLA 4AALA 5AW8B 1JUNA 1HVVA 4OGQB 4H0LB 1AQ5A 3VMZA 3UIAA 4H44D 2YXRB 5H2FV 1E8EA 2C1UA 1Y8AA 1CCHA 3AE5C 1PGPA 3EWKA 3M0DA 1C2RA 1COTA 4ZKPA 2Y0DA 2I1KA 4JF7A 1FI9A 2E5YA 3CX5H 2WSFH 1M7LA 2WT7A 3V2QA 2V08A 3OJAB 1CC5A 1XTCC 5BU8B 3ZOOA 5TISE 2M5AB 2N3BA 2QSIA 1M60A 2QJYC 3MD0A 2GB8B 2JJLA 3H1JE 4GKGA 2W83C
chains in the Genus database with same CATH topology
1CHIA 3HQ9A 1H33B 1B7VA 1CRJA 3TDKA 1CRHA 5DFSA 4FANA 1LC1A 2V07A 3SLEA 1AYGA 1HRCA 1LMSA 1DVVA 2QJYB 1KIBA 1RAQA 1QKSA 1C6RA 1CTJA 1I5TA 1MG3D 1NTKD 2CE0A 3GG2A 1NMLA 3L70D 4WQAA 1F1CA 1JDLA 3O5CA 4FAVA 5TJHA 1GQ1A 1H1OA 2FWLA 4A7PA 1SQBD 5EXQA 1R0QA 3L73D 1CHJA 4D6TD 2K9JB 3VRDA 1NTZD 3WFBC 2AI5A 3OA8A 1DT1A 4XXLA 1GU2A 1NU1D 4EDFA 1K3GA 4WQ9A 1KYOW 1DW3A 1VYDA 5GTHV 1FOCA 2BGVX 1LFMA 2A06D 3DMIA 2AIUA 1BE3D 1CYIA 1IZL0 1U75B 1KB0A 1DW1A 5GTIV 1AOQA 1DIIC 1ZRTD 3CP5A 1I6EA 3PLNA 3PXSA 2YIUB 1H32A 1CO6A 3KZIV 5IY51 1PP9D 1DIQC 3L4MA 2L4DA 2FYUD 1CRCA 2BCNB 4KMGA 4NFGB 5KKZB 2N9YB 1I8OA 4IL6V 1QL3A 2C1DA 3TYIA 1FJ0A 4P4QB 5KAFV 3HQ8A 1KV9A 3OCDA 1N50A 1LS9A 4PJ0V 3L72D 2BH4X 1CYJA 5CIBB 1YICA 4L3HA 2GC4D 5CIFB 1KX2A 2MHMA 1A2SA 1N15A 4FA5A 1CORA 1CSXA 1SQXD 4AAOA 351CA 2N9JA 1CIEA 3CYTI 2CXBA 1K3HA 1EZVD 2ZXYA 1HZVA 1H9XA 4H0JA 1KB9D 1C2NA 3H1LD 2DVHA 3VNWA 4MU8A 2GIWA 1CIFA 1I8PA 1HH7A 4RSZA 2CE1A 4WQBA 1W5CT 2ZBOA 3PHLA 2C1DB 1U74B 1HJ5A 3ZIYA 5DF5A 3M97X 1YEBA 1CCRA 1E2RA 3WFCC 4V2KA 1C6OA 4WQCA 1WEJF 2B4ZA 2D0WA 1CRGA 3WC8A 4Y5RA 1CXCA 2XTSB 2YQBA 1LC2A 2L91A 4YE1A 2JQRA 1S6VB 1YFCA 2CA4B 2LITA 3PH2B 5KLVD 3CXHD 2YCCA 4LJIA 1M6ZA 1C52A 3HQ6A 1CSUA 1IQCA 5AURA 1CEDA 3VMAA 1CSWA 1S5LV 3TGUD 1DW2A 2C8SA 1IRWA 2N9IA 3ORVA 2O3JA 3A0BV 1NTMD 1WVEC 1EB7A 2B10B 2AXTV 1AOFA 2MTAC 3C2CA 5CIHB 3ZBMA 2C2CA 3DR0A 1QL4A 3H1HD 4EICA 2Y0CA 1N90A 5CIDB 3A0HV 1CXAA 2OZ1A 4AX3A 1QN2A 2PCBB 1ZZHA 2ZONG 3L71D 1KYOD 3NWVA 1W2LA 3L4OA 3TF5A 1I55A 1HJ3A 4GEDB 1MZ4A 2GC7D 3CWBD 3X39A 4PWAA 1F1FA 1HROA 3HQ7A 1A8CA 1YNRA 2VHDA 1FHBA 155CA 1H33A 1I54A 1IRVA 1GKSA 4U3FD 5DJQB 4AAMA 4EIDA 5B66V 3NBTA 1AKKA 1N9CA 1CRIA 1L0LD 3WU2V 1DW0A 4FB1A 3BCCD 4FA9A 2LIRA 1L9BC 1M70A 2PACA 3ZOYA 2DGEA 1BL9A 3PRJA 1KX7A 4WQDA 1L9JC 3MK7B 4Q5PA 5B6QA 3RMZA 1C75A 2QJPB 2ZOOA 2BCCD 2Y0EA 3WFDC 1CIGA 2QG4A 4UB8V 2RN0A 5KAIV 1YCCA 3O0RC 3ZOWA 1C7MA 5TISV 3ZCFA 4EIEA 3RN0A 1NMIA 1NNOA 1H31A 1RAPA 1IO3A 2B12B 3MK7C 4PD4D 1J3SA 1CTZA 5C0ZA 5KLIB 1CIHA 1OCDA 4QAOA 3SJLA 4AANA 3WUIA 2OZ1B 3ZOXA 3H1JD 2C1VA 1FI7A 1HZUA 5E79V 2C9XB 2CA3B 3O1YA 3H1KD 1MG2D 4XYDB 3CU4A 1RZ6A 5DJQC 3CX5W 4UB6V 2KNCB 1A56A 2BH5X 2B0ZB 1DVHA 3JBTB 4WQEA 1P84D 1CHHA 3PTZA 4K3IA 3PXWA 3A9FA 1H31B 1HJ4A 1YEAA 2ORLA 2RMZA 1CNOA 4J20A 2FRCA 1I6DA 2IBZD 3PXTA 1SQQD 2JTIB 5CIGB 3SWSA 1FCDC 2D0SA 3OCDB 1CSVA 4RJTA 4H0KA 1NIRA 3NBSA 4JCGA 4GYDA 3RLMA 2HV4A 2PCCB 3CXHW 1C6SA 5CYTR 4L1QA 2FYNB 1BGYD 3OA8B 2EXVA 1GJQA 3L74D 3KHUA 1CRYA 1RZ5A 3DP5A 1BCCD 5C9MA 1GIWA 1ETPA 4EIFA 3H1ID 4AALA 451CA 3RN1A 3GW6A 1H9YA 1GDVA 2I8FA 2YK3A 3L75D 3SVWA 1E29A 4FA4A 3O20A 3SXTA 3WFEC 5H2FV 1PPJD 1E8EA 2C1UA 4PW9B 5B5EV 1H32B 1CCHA 4O1WA 2ZZS1 1C2RA 1COTA 4N0KA 2B11B 4WQ7A 2Y0DA 3VYMA 1SQPD 1FI3A 4FA1A 1FI9A 4WQ8A 3ITKA 1CTYA 2N18C 5CIEB 1YIQA 2BLFB 1HCMA 3CX5D 1CYCA 1OAEA 2V08A 4DY9A 1SQVD 1CC5A 2JWAA 3ZOOA 1YTCA 2KS1A 2N18B 1L0ND 2QJKB 2N3BA 4O1QA 4L3GA 2Q3EA 5CICB 1QYZA 1M60A 3FWLA 2GB8B 2BPBB 2N3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHI A;  3HQ9 A;  1H33 B;  1B7V A;  1CRJ A;  3TDK A;  1CRH A;  5DFS A;  4FAN A;  1LC1 A;  2V07 A;  3SLE A;  1AYG A;  1HRC A;  1LMS A;  1DVV A;  2QJY B;  1KIB A;  1RAQ A;  1QKS A;  1C6R A;  1CTJ A;  1I5T A;  1MG3 D;  1NTK D;  2CE0 A;  3GG2 A;  1NML A;  3L70 D;  4WQA A;  1F1C A;  1JDL A;  3O5C A;  4FAV A;  5TJH A;  1GQ1 A;  1H1O A;  2FWL A;  4A7P A;  1SQB D;  5EXQ A;  1R0Q A;  3L73 D;  1CHJ A;  4D6T D;  2K9J B;  3VRD A;  1NTZ D;  3WFB C;  2AI5 A;  3OA8 A;  1DT1 A;  4XXL A;  1GU2 A;  1NU1 D;  4EDF A;  1K3G A;  4WQ9 A;  1KYO W;  1DW3 A;  1VYD A;  5GTH V;  1FOC A;  2BGV X;  1LFM A;  2A06 D;  3DMI A;  2AIU A;  1BE3 D;  1CYI A;  1IZL 0;  1U75 B;  1KB0 A;  1DW1 A;  5GTI V;  1AOQ A;  1DII C;  1ZRT D;  3CP5 A;  1I6E A;  3PLN A;  3PXS A;  2YIU B;  1H32 A;  1CO6 A;  3KZI V;  5IY5 1;  1PP9 D;  1DIQ C;  3L4M A;  2L4D A;  2FYU D;  1CRC A;  2BCN B;  4KMG A;  4NFG B;  5KKZ B;  2N9Y B;  1I8O A;  4IL6 V;  1QL3 A;  2C1D A;  3TYI A;  1FJ0 A;  4P4Q B;  5KAF V;  3HQ8 A;  1KV9 A;  3OCD A;  1N50 A;  1LS9 A;  4PJ0 V;  3L72 D;  2BH4 X;  1CYJ A;  5CIB B;  1YIC A;  4L3H A;  2GC4 D;  5CIF B;  1KX2 A;  2MHM A;  1A2S A;  1N15 A;  4FA5 A;  1COR A;  1CSX A;  1SQX D;  4AAO A;  351C A;  2N9J A;  1CIE A;  3CYT I;  2CXB A;  1K3H A;  1EZV D;  2ZXY A;  1HZV A;  1H9X A;  4H0J A;  1KB9 D;  1C2N A;  3H1L D;  2DVH A;  3VNW A;  4MU8 A;  2GIW A;  1CIF A;  1I8P A;  1HH7 A;  4RSZ A;  2CE1 A;  4WQB A;  1W5C T;  2ZBO A;  3PHL A;  2C1D B;  1U74 B;  1HJ5 A;  3ZIY A;  5DF5 A;  3M97 X;  1YEB A;  1CCR A;  1E2R A;  3WFC C;  4V2K A;  1C6O A;  4WQC A;  1WEJ F;  2B4Z A;  2D0W A;  1CRG A;  3WC8 A;  4Y5R A;  1CXC A;  2XTS B;  2YQB A;  1LC2 A;  2L91 A;  4YE1 A;  2JQR A;  1S6V B;  1YFC A;  2CA4 B;  2LIT A;  3PH2 B;  5KLV D;  3CXH D;  2YCC A;  4LJI A;  1M6Z A;  1C52 A;  3HQ6 A;  1CSU A;  1IQC A;  5AUR A;  1CED A;  3VMA A;  1CSW A;  1S5L V;  3TGU D;  1DW2 A;  2C8S A;  1IRW A;  2N9I A;  3ORV A;  2O3J A;  3A0B V;  1NTM D;  1WVE C;  1EB7 A;  2B10 B;  2AXT V;  1AOF A;  2MTA C;  3C2C A;  5CIH B;  3ZBM A;  2C2C A;  3DR0 A;  1QL4 A;  3H1H D;  4EIC A;  2Y0C A;  1N90 A;  5CID B;  3A0H V;  1CXA A;  2OZ1 A;  4AX3 A;  1QN2 A;  2PCB B;  1ZZH A;  2ZON G;  3L71 D;  1KYO D;  3NWV A;  1W2L A;  3L4O A;  3TF5 A;  1I55 A;  1HJ3 A;  4GED B;  1MZ4 A;  2GC7 D;  3CWB D;  3X39 A;  4PWA A;  1F1F A;  1HRO A;  3HQ7 A;  1A8C A;  1YNR A;  2VHD A;  1FHB A;  155C A;  1H33 A;  1I54 A;  1IRV A;  1GKS A;  4U3F D;  5DJQ B;  4AAM A;  4EID A;  5B66 V;  3NBT A;  1AKK A;  1N9C A;  1CRI A;  1L0L D;  3WU2 V;  1DW0 A;  4FB1 A;  3BCC D;  4FA9 A;  2LIR A;  1L9B C;  1M70 A;  2PAC A;  3ZOY A;  2DGE A;  1BL9 A;  3PRJ A;  1KX7 A;  4WQD A;  1L9J C;  3MK7 B;  4Q5P A;  5B6Q A;  3RMZ A;  1C75 A;  2QJP B;  2ZOO A;  2BCC D;  2Y0E A;  3WFD C;  1CIG A;  2QG4 A;  4UB8 V;  2RN0 A;  5KAI V;  1YCC A;  3O0R C;  3ZOW A;  1C7M A;  5TIS V;  3ZCF A;  4EIE A;  3RN0 A;  1NMI A;  1NNO A;  1H31 A;  1RAP A;  1IO3 A;  2B12 B;  3MK7 C;  4PD4 D;  1J3S A;  1CTZ A;  5C0Z A;  5KLI B;  1CIH A;  1OCD A;  4QAO A;  3SJL A;  4AAN A;  3WUI A;  2OZ1 B;  3ZOX A;  3H1J D;  2C1V A;  1FI7 A;  1HZU A;  5E79 V;  2C9X B;  2CA3 B;  3O1Y A;  3H1K D;  1MG2 D;  4XYD B;  3CU4 A;  1RZ6 A;  5DJQ C;  3CX5 W;  4UB6 V;  2KNC B;  1A56 A;  2BH5 X;  2B0Z B;  1DVH A;  3JBT B;  4WQE A;  1P84 D;  1CHH A;  3PTZ A;  4K3I A;  3PXW A;  3A9F A;  1H31 B;  1HJ4 A;  1YEA A;  2ORL A;  2RMZ A;  1CNO A;  4J20 A;  2FRC A;  1I6D A;  2IBZ D;  3PXT A;  1SQQ D;  2JTI B;  5CIG B;  3SWS A;  1FCD C;  2D0S A;  3OCD B;  1CSV A;  4RJT A;  4H0K A;  1NIR A;  3NBS A;  4JCG A;  4GYD A;  3RLM A;  2HV4 A;  2PCC B;  3CXH W;  1C6S A;  5CYT R;  4L1Q A;  2FYN B;  1BGY D;  3OA8 B;  2EXV A;  1GJQ A;  3L74 D;  3KHU A;  1CRY A;  1RZ5 A;  3DP5 A;  1BCC D;  5C9M A;  1GIW A;  1ETP A;  4EIF A;  3H1I D;  4AAL A;  451C A;  3RN1 A;  3GW6 A;  1H9Y A;  1GDV A;  2I8F A;  2YK3 A;  3L75 D;  3SVW A;  1E29 A;  4FA4 A;  3O20 A;  3SXT A;  3WFE C;  5H2F V;  1PPJ D;  1E8E A;  2C1U A;  4PW9 B;  5B5E V;  1H32 B;  1CCH A;  4O1W A;  2ZZS 1;  1C2R A;  1COT A;  4N0K A;  2B11 B;  4WQ7 A;  2Y0D A;  3VYM A;  1SQP D;  1FI3 A;  4FA1 A;  1FI9 A;  4WQ8 A;  3ITK A;  1CTY A;  2N18 C;  5CIE B;  1YIQ A;  2BLF B;  1HCM A;  3CX5 D;  1CYC A;  1OAE A;  2V08 A;  4DY9 A;  1SQV D;  1CC5 A;  2JWA A;  3ZOO A;  1YTC A;  2KS1 A;  2N18 B;  1L0N D;  2QJK B;  2N3B A;  4O1Q A;  4L3G A;  2Q3E A;  5CIC B;  1QYZ A;  1M60 A;  3FWL A;  2GB8 B;  2BPB B;  2N3Y A; 
#chains in the Genus database with same CATH topology
 3TSI A;  4WBA A;  2O01 H;  2P67 A;  1DH3 A;  5GTI H;  1BGY G;  1B7V A;  2WTY A;  1CRH A;  1GW4 A;  1TU3 F;  2Q7C A;  2V07 A;  1FAV A;  2WSE H;  1HRC A;  1OW7 A;  3D6Z A;  1IFI A;  1N73 B;  1P84 I;  1CTJ A;  1NTK D;  3Q3D A;  3G3Z A;  1AV1 A;  1PV3 A;  4FAV A;  1SQX E;  4I2L C;  1GQ1 A;  2IBZ I;  3FXD A;  3HRN A;  3JCU E;  2GM4 A;  1N73 C;  3CCV P;  2XU6 A;  1SQQ E;  2WPR A;  1BE3 G;  4ZKU A;  1NTZ D;  3CMA P;  3B8E B;  5KLV G;  1GU2 A;  2Q9I A;  4PD4 I;  3CCL P;  1VQ8 P;  2OTL P;  3GF7 A;  1NU1 J;  1VL2 A;  1FOC A;  5AVS B;  1GMJ A;  1BGY E;  1NTZ E;  3A3Y B;  2QM7 A;  1QEX A;  3S1K A;  4JYC A;  2WQY C;  1GU5 A;  4D6T G;  2WSE J;  1DW1 A;  2H8P D;  2FYU E;  1DII C;  1T8Z A;  3PLN A;  1FZC A;  3PXS A;  2NZ2 A;  2AEF A;  1CO6 A;  1KV4 A;  2M3E A;  5CJ4 A;  1EDK A;  3L75 J;  2KZI A;  1Y47 A;  1ZP0 C;  3W68 A;  4N3Y B;  2Q6Q A;  2IYP A;  5K5G B;  1CRC A;  2C0W A;  1JY2 N;  1MUU A;  4RO0 A;  2ZVO B;  2KNC A;  2D2C B;  1IFM A;  4IL6 V;  3WU2 E;  2POH A;  1QL3 A;  1FZG A;  1E5W A;  3M9H A;  5KAF V;  2G3A A;  4RKU J;  1EXJ A;  1M90 Q;  2UWJ E;  2E76 D;  4PJ0 V;  2PGD A;  2P10 A;  1IFD A;  1USD A;  2FFD C;  3L70 E;  4L3H A;  2GC4 D;  2OYI A;  3FGA D;  5B66 E;  1A02 J;  1LNQ A;  1CSX A;  3L71 E;  4NPF X;  1VF5 D;  1CIE A;  1SS1 A;  1HZV A;  1PGO A;  4CPG A;  2NPS B;  3JSV C;  4EI2 A;  1N73 A;  3GMA A;  2GIW A;  1RHZ B;  1ZOY C;  4GOF A;  1I8P A;  2FXP A;  4RSZ A;  1MFT A;  1W5C T;  4L75 A;  1VQN P;  2B9B A;  3M97 X;  4UB8 H;  2R5B A;  1KIL E;  2ZT9 B;  1LT9 B;  5BVZ A;  1VQK P;  1CRG A;  3WC8 A;  4ZNC A;  4Y5R A;  1LC2 A;  2L91 A;  4YE1 A;  1NTK E;  3LID A;  1J1E B;  2KOG A;  2WPS A;  1SQV G;  2LIT A;  5KLV D;  1SQQ J;  4LJI A;  1M6Z A;  3BRV B;  2KP8 A;  1DIP A;  1LTI C;  5AUR A;  1CED A;  3VMA A;  3R4Y A;  1FZC B;  2N9I A;  3ORV A;  3CI9 A;  1BGY J;  1YTZ I;  1E79 H;  3CWB G;  3M06 A;  5CIH B;  1QL4 A;  4BRY A;  3AEB C;  1FBM A;  3LW5 J;  2Y0C A;  3L71 J;  1NTM K;  1FU1 A;  3TNU A;  3KPE A;  3I5C A;  3ABV C;  2B87 B;  2PRR A;  3H1J J;  1OVU A;  3CC2 P;  2AXT E;  4WY4 C;  4C7N A;  1QL1 A;  1HJ3 A;  1VQO P;  3NTN A;  3MP7 B;  1F1F A;  1A8C A;  1I54 A;  2IZ0 A;  5DJQ B;  5B66 V;  3NBT A;  2OTJ P;  2FYU K;  1X0T A;  5KJ7 D;  2D2C D;  3AE3 C;  1FOS F;  1M70 A;  1YYC A;  3PRJ A;  1JMB A;  1OMI A;  1SQV J;  3G4S P;  1C75 A;  2W8Z A;  3VMX A;  4PD4 E;  3BRT B;  2Y0E A;  2QG4 A;  3WUV A;  1M1J C;  1NH4 A;  3LW5 H;  1IK9 A;  1YCC A;  3O0R C;  1C7M A;  3WUT A;  1NTZ J;  2B89 A;  1H31 A;  2B12 B;  3MK7 C;  3A0H H;  1HWT C;  1J3S A;  4PV1 C;  3G71 P;  2WVR A;  2FYZ A;  1NTK K;  3TGU E;  3N7N A;  5C0Z A;  1LP1 B;  5KLI B;  3L37 A;  1M1J B;  1R8E A;  4QAO A;  3SJL A;  3H1L E;  3L73 G;  4DZO A;  3WUI A;  1GL2 D;  3ZOX A;  3GF3 A;  1T3J A;  2WT7 B;  3Q5R A;  1HZU A;  5E79 V;  4H44 C;  3K5B A;  1MG2 D;  5CCH D;  2IBZ G;  2DW3 A;  1DEB A;  2KNC B;  3RL0 C;  4N6J A;  1SFC C;  3JBT B;  3QH9 A;  2L5G B;  2YKO A;  3CWB E;  3PXW A;  1Z56 A;  2A06 E;  3S4R A;  2IBZ D;  1G1I A;  3HE5 A;  1ZRT E;  4O9B A;  2D0S A;  3MTU E;  3KZI E;  3B5N A;  2IYO A;  4PD4 H;  4GYD A;  3V4W A;  3CC7 P;  3U59 A;  3H1I J;  3RLM A;  2YKQ A;  1LTJ B;  2HV4 A;  2LXC B;  3CXH W;  1C6S A;  1MKM A;  4IL6 E;  1NAF A;  1W2E A;  5KAF E;  1KB9 I;  5C9M A;  1GIW A;  2KSE A;  3AEC C;  2YMY A;  3AE9 C;  2FBW C;  3H1L J;  1OW6 A;  5TIS H;  1GDV A;  1AFO A;  1N8R Q;  2I8F A;  3HTK B;  5AVZ B;  2YK3 A;  1NTM E;  1LT9 A;  4FA4 A;  3O20 A;  1SQB G;  1PPJ D;  3KXD A;  1BCC G;  1H32 B;  1RF1 C;  2P7J A;  1MV8 A;  4N78 D;  2I8D A;  3A0H E;  1KFN A;  1SQP D;  1FI3 A;  2YMK A;  2HLO A;  2JO1 A;  3L72 E;  1X8Y A;  2CPS A;  3L35 A;  1YIQ A;  4XFJ A;  1N7S B;  2FYN C;  1OW8 A;  4MN4 C;  1PP9 J;  4B86 A;  1CI6 A;  5GTI E;  3M9B A;  4EYY Q;  1LGH B;  1FJK A;  1SQQ G;  2MJZ A;  2IDB A;  1KB9 E;  2N18 B;  4BXL A;  2K9J A;  4W80 A;  4ASW A;  5APU A;  1YI2 P;  1SQX G;  2BPB B;  3BCC G;  2KB7 P;  1YJ9 P;  2CK3 H;  1KQF B;  1H33 B;  1FC2 C;  4OGQ D;  3H1L G;  3SLE A;  1AYG A;  1LMS A;  1RAQ A;  1LTJ A;  1QKS A;  1NTZ G;  1I5T A;  3KZI H;  2CE0 A;  2OYH B;  3IFM A;  3L70 D;  1F1C A;  3B4S A;  5AVW B;  4R4L A;  1JDL A;  3MUD C;  2E75 D;  1L4A A;  1QL2 A;  4K3A A;  3CCQ P;  1GTW A;  2I1J A;  2QVA A;  1R0Q A;  2P58 A;  2WSS H;  1CI6 B;  4OWF A;  2NPS D;  4D6T D;  3VRD A;  3RL0 g;  1PGJ A;  2E42 A;  1BDD A;  3RK2 B;  1KTM A;  2OGU A;  1NU1 D;  1L0N J;  1IC2 A;  1M1J A;  4EDF A;  1K3G A;  4WQ9 A;  1KYO W;  3H1K J;  5B5E H;  1DW3 A;  5CCG D;  3C1L A;  2WMM A;  1EDJ A;  2C9N Y;  2Z5H A;  2H88 C;  1UII A;  3RK2 C;  1KB9 H;  2BEZ F;  1KB0 A;  2IBZ E;  5GTI V;  1NTZ K;  1ZRT D;  2W27 A;  1I6E A;  3GLM A;  1L0N E;  5L8R J;  2J58 A;  1JM0 A;  1PP9 D;  3L4M A;  2L4D A;  1SQV K;  3EFG A;  1OVV A;  1L0L K;  5APT A;  1OVR A;  2BCN B;  2AXT H;  2M8R A;  1BE3 J;  5KKZ B;  1I8O A;  1Q86 Q;  2ZT9 C;  3R2P A;  2FYU J;  5H2F E;  3P8C E;  5KLV J;  2C1D A;  4AYC A;  1KQL A;  4P4Q B;  1HUC A;  2NRG A;  3HE5 B;  3CD6 P;  3L72 D;  4GOE A;  1M57 D;  5CIB B;  1WT6 A;  3CX5 I;  3RK3 B;  3H1K E;  1NYH A;  2MHM A;  3B5N B;  1KQG B;  3D6Y A;  1SQX D;  4AAO A;  1JY2 P;  2KI7 B;  1CZQ A;  2JWD A;  2N9J A;  1IFN A;  2CXB A;  4AQR D;  2ZXY A;  4HKZ H;  5APQ A;  1M8O B;  4H0J A;  1C2N A;  3RK3 C;  2DVH A;  2MKV A;  4W7Z A;  3VNW A;  2YIU C;  1CIF A;  2CE1 A;  4TLF A;  1J1E C;  1SQB K;  2HOD A;  1R5S A;  5C39 A;  1L0L J;  3M0D C;  1RY3 A;  5DF5 A;  1CCR A;  2Q3I A;  3KQG A;  1VQ7 P;  4IFF A;  1GL2 C;  3V6I A;  1C6O A;  4IL6 H;  2YO2 A;  2D0W A;  2N9B A;  1JY2 O;  1CXC A;  2XTS B;  3PH2 B;  2CA4 B;  2WSC J;  1ZN5 A;  5CCH A;  4PJ0 H;  2YXQ B;  5B66 H;  1ZXG A;  4C7R A;  1VF5 C;  2K88 A;  2BCC J;  1CSW A;  1IO4 A;  1X79 B;  1G2C A;  3H1H E;  3GHG A;  2FXO A;  2C8S A;  1L0N K;  2AXC A;  1SQB J;  2WPV B;  4HB1 A;  1JY3 P;  1WVE C;  2B10 B;  1LWU C;  2HOD B;  1T2K C;  1VF5 B;  1GK6 A;  1G1J A;  1JTH B;  1Q81 Q;  1RE3 A;  3T97 A;  3ZBM A;  2C2C A;  2ZYG A;  1PL5 A;  1RQV A;  1OFC X;  1MFZ A;  2XV5 A;  3A0H V;  3SWY A;  2G8Y A;  4AX3 A;  4KT0 J;  3CL3 D;  5GTH E;  3AEF C;  4GIF A;  1KZU B;  1W2L A;  5CHX A;  3L4O A;  3LIE A;  1I55 A;  4PWA A;  1HRO A;  4WY4 D;  3HQ7 A;  1YNR A;  1HGV A;  4H44 B;  5CJ0 A;  2E76 B;  3U1A A;  3CCS P;  3L72 G;  4U3F D;  4IL6 X;  4AAM A;  1L4A D;  3WU2 V;  1P84 H;  3V4Q A;  1U7J A;  2DGE A;  1VDF A;  1KX7 A;  2Z5I A;  3CWB J;  3MK7 B;  4Q5P A;  3RMZ A;  4PJ0 E;  3V5B A;  1DD3 A;  3I56 P;  2BCC D;  5CCG A;  1Q7Y Q;  2O1J A;  3W67 A;  3VN0 A;  1KYO I;  2OAR A;  5KAI V;  1AVY A;  1KOR A;  1RF0 C;  4EIE A;  4DCK A;  1NMI A;  1PIX A;  4UB8 E;  5EFW B;  3E1I A;  1RAP A;  1IO3 A;  2BCC E;  2O1K A;  1EZV E;  2ITA A;  2WPQ A;  1HBW A;  1S5L X;  1NU1 K;  1S1C X;  2J59 M;  1Q90 D;  1SQP K;  2AEJ A;  1S5L H;  1AVO A;  1URQ C;  2M5A A;  3CU4 A;  1RZ6 A;  3A0B H;  3HD7 C;  1L0N G;  3SSU A;  2QEX P;  3F5H A;  2J5U A;  2BH5 X;  3CPW O;  2A45 I;  3VTP C;  3CC4 P;  2R32 A;  1URQ B;  4RES B;  4WQE A;  2QJP C;  2KIK A;  3HD7 B;  4M3L A;  2V4H A;  1HJ4 A;  1EZV G;  2RMZ A;  1LTJ C;  4J20 A;  2O01 N;  5AVY B;  1KFM A;  1RF1 B;  1P84 E;  2JTI B;  5CIG B;  3TGU J;  2PAJ A;  1HH0 A;  1FCD C;  1CSV A;  4RJT A;  4H0K A;  3NBS A;  4JCG A;  1H89 A;  4BWN A;  2LR2 A;  2FXM A;  1N7S A;  4L1Q A;  3AEA C;  3OA8 B;  4NPD A;  1BCC D;  2QE7 H;  3T97 B;  1ETP A;  2K37 A;  3CCJ P;  3SWK A;  3JC2 2;  3H1I D;  451C A;  3GW6 A;  2A06 G;  1SFC D;  3C8V A;  3L75 D;  2Z4E A;  3V2R A;  1EDL A;  3SXT A;  3WFE C;  3H1H J;  1NVO A;  1FZB A;  1U57 A;  3RBZ A;  1Y9B A;  1R5L A;  1RF1 A;  4O1W A;  2ZZS 1;  4N0K A;  2B11 B;  4WQ7 A;  2E75 B;  3TYY A;  1H0T A;  3CXH I;  4L73 A;  1CTY A;  2N18 C;  3HTK A;  1QLE D;  2BLF B;  1YIT P;  3CX5 D;  4YTP C;  1CYC A;  3Q5P A;  1OAE A;  5AW4 B;  1SQV D;  1A02 F;  4U3F E;  2HYN A;  1S9K D;  2QIW A;  2KK7 A;  4WVZ A;  1L0N D;  5BU5 A;  4O1Q A;  5CIC B;  1QYZ A;  4U3F J;  1KIL B;  3FWL A;  2N1T A;  2B87 A;  3Q2Y A;  5KAF H;  1S5L E;  1Q82 Q;  4WB4 A;  2M0B A;  3AE4 C;  2XND H;  1JB0 J;  1YQ3 C;  3NXS A;  1NOH A;  1WMK A;  3L74 E;  3NMD A;  3HE4 B;  5DFS A;  4FAN A;  1LC1 A;  2QJK C;  3A0B E;  3U1C A;  1KYO H;  4QMA A;  3WMM 0;  3V2P A;  1VQL P;  3H32 A;  1C6R A;  1MG3 D;  3GG2 A;  3Q5S A;  1URQ A;  2YKP A;  2ZXE B;  3H1I G;  4WQA A;  3H25 A;  1LT1 A;  2WSF J;  2CPB A;  5TJH A;  1RE4 C;  3BVH A;  3L75 G;  3P32 A;  1YTZ T;  2FWL A;  2D2C C;  1NTM J;  3O6Q B;  1SQB D;  3AEE C;  2OYI B;  4HH2 A;  5APX A;  3WUU A;  3A5T A;  1CHJ A;  2VRS A;  2C0X A;  5AVU B;  1X9V A;  4XXL A;  1GW3 A;  1EXI A;  3L72 J;  4DT0 A;  2E74 B;  3M9Q A;  2K3R A;  3VMY A;  1VYD A;  5GTH V;  2O01 J;  2BGV X;  1LFM A;  1PP9 G;  1USE A;  4H13 D;  3I55 P;  1VQ4 P;  3DMI A;  1G2C B;  2AIU A;  3FWN A;  1U75 B;  1EQ7 A;  1SQQ K;  4I7Z B;  1VQ6 P;  1S72 P;  3FX0 A;  3D71 A;  3CP5 A;  2WZ7 A;  1LJ2 A;  1ZR4 A;  2YIU B;  3KZI V;  1J2J B;  1T2K D;  1FOS E;  3L75 E;  4I7Z C;  2FYU D;  4KMG A;  4NFG B;  2JP3 A;  2N9Y B;  3F89 A;  1D7M A;  2OYO A;  1N50 A;  2K1A A;  1LS9 A;  4WY4 A;  4JQ0 D;  3E1R A;  3NFQ A;  4IFM A;  1YIC A;  1QVG O;  5KAI E;  1A2S A;  4FA5 A;  1COR A;  3CX5 E;  4D6T J;  1JO5 A;  1CSB A;  3JCU H;  351C A;  1NAY A;  1LWU A;  1K3H A;  1HGZ A;  3TNU B;  2KZJ A;  4D6T E;  3M91 A;  3H1L D;  1RF0 A;  1GL2 B;  1OWA A;  3D70 A;  2H43 A;  4WQB A;  1K8A Q;  1LP1 A;  3PHL A;  1FDM A;  2C1D B;  1HJ5 A;  1HTL C;  1YEB A;  5KLV E;  4WY4 B;  1SP4 A;  3HE4 A;  1H88 A;  4UB6 E;  1OZH A;  1SQV E;  1BE3 E;  4V2K A;  1LTS C;  1ZW0 A;  4KHX A;  2A45 H;  1EC5 A;  2PP6 A;  2B4Z A;  3CCE P;  1JCD A;  1KMI Z;  3S9O A;  1S6V B;  1BSN A;  2PFX A;  1YFC A;  3H1K G;  2IZ1 A;  1NU1 G;  1C52 A;  1U7M A;  3HQ6 A;  1CSU A;  1IQC A;  1FS0 E;  1PFI A;  5AW2 B;  1KQS O;  5AVT B;  1L2P A;  1RQU A;  1DW2 A;  2OQQ A;  1IRW A;  4LLH A;  3CCR P;  1YQ4 C;  1NTM D;  1EB7 A;  1QGK B;  1AOF A;  3C2C A;  1YHQ P;  2E74 D;  1LTG C;  3PJS K;  2E43 A;  3H6P A;  5CID B;  3RK3 D;  4PV1 D;  1CXA A;  4YXW H;  3B5N D;  5AVR B;  2PCB B;  2KS1 B;  4Y28 J;  1SQP E;  1SQB E;  1KYO D;  3AED C;  1NTM G;  3TF5 A;  3OAK A;  3H32 B;  1MZ4 A;  1N7L A;  2QRX A;  5M1B A;  1JOC A;  1IK7 A;  1JEK A;  2XDJ A;  2VHD A;  2FKW B;  1IRV A;  1GKS A;  1YIJ P;  1N9C A;  1CRI A;  1DW0 A;  4FB1 A;  2KXP B;  3BCC D;  2WIT A;  3HUS A;  3L74 J;  1L9B C;  5AW6 B;  1SFC B;  4ZMD A;  1FZC C;  1BL9 A;  3L4F A;  4WQD A;  1L9J C;  5B6Q A;  2KLU A;  2QJP B;  1DEE G;  2AEM A;  1CIG A;  2KSJ A;  3ZDM A;  2ZFC A;  4OH8 B;  1HF9 A;  1NKZ B;  4UB8 V;  2RN0 A;  2QA4 P;  2KUB A;  3ZOW A;  1BCC E;  5CBN A;  5TIS V;  3L70 G;  3KYQ A;  3MIW A;  3RN0 A;  3B71 A;  5APS A;  1JNM A;  4PD4 D;  2KLV A;  1CTZ A;  2OTK E;  1CIH A;  1OCD A;  3HUS C;  2OZ1 B;  2C1V A;  1M1K Q;  2IPP A;  2CA3 B;  3AE1 C;  3HD7 A;  4XYD B;  3CCU P;  1ZV8 A;  4KJM A;  2W6A A;  4H0L D;  1A56 A;  3C9I A;  3HUS B;  3TK1 A;  1S2E A;  1J1D C;  1RH5 B;  5AW5 B;  1DVH A;  1L4A C;  1N86 A;  2XKM A;  2XZR A;  1NO4 A;  2GA1 A;  3PTZ A;  1IFP A;  4K3I A;  5APW A;  3A9F A;  3SFD C;  2YNY A;  1OXZ A;  4JYB A;  1VQM P;  1YEA A;  2ORL A;  1CNO A;  2N1T B;  4Y99 C;  2K9Y A;  1I6D A;  2W90 A;  1J1D B;  5KAI H;  3L74 G;  5AVV B;  1L4A B;  3SWS A;  3P8M C;  3AE7 C;  3OCD B;  1MZ9 A;  3RK2 D;  1NIR A;  1KIL D;  1PGQ A;  5CMZ A;  4YPC A;  4R4M A;  4TT3 H;  5DJU B;  1N7S C;  2SPZ A;  3AE2 C;  1NHL A;  2FYN B;  2FFD A;  1OX3 A;  3L74 D;  1RZ5 A;  3P8C D;  2GUV A;  3PP5 A;  1YJN P;  4U7J A;  3RL0 B;  1KIL C;  4ASV A;  1JCC A;  3RN1 A;  1H9Y A;  2JR8 A;  2E75 C;  5CBO A;  3SVW A;  1E29 A;  1VPC A;  1SQX J;  1URQ D;  3CLQ A;  3SWF A;  4HYT B;  1X22 A;  2ZVN B;  1KC8 Q;  4PW9 B;  5B5E V;  1FDO A;  2W6B A;  3RK3 E;  3CCM P;  1VQP P;  1SQP J;  1VQ9 P;  1FDI A;  4OGQ C;  1JY3 O;  2OYH C;  3VYM A;  5AVQ B;  4FA1 A;  5E79 H;  5AW7 B;  4WQ8 A;  1NTK J;  2M3B A;  3ITK A;  3VP8 A;  1GDT A;  5CIE B;  1BSH A;  1HCM A;  1KIL A;  2Q1K A;  2OYI C;  1ZLL A;  4DY9 A;  2JWA A;  2C9L Y;  3EFF K;  1YTC A;  2KS1 A;  5APY A;  5AW9 B;  2QJK B;  4L3G A;  3CXH E;  2Q3E A;  4NPE A;  5GTH H;  1SLQ A;  1T6A A;  3GHG B;  2BAS A;  3MUD A;  2N3Y A;  4H0L C;  2OYH A;  3A2A A;  3PH0 A;  1CHI A;  3HQ9 A;  1EZV I;  4WWI A;  1CRJ A;  3TDK A;  4IFD K;  1DVV A;  2QJY B;  5CCH C;  1KIB A;  4LC1 A;  2YO3 A;  3L70 J;  3GHG C;  2QM8 A;  3E7K A;  1NML A;  2B88 A;  1GU4 A;  1VQ5 P;  2H7H A;  3O5C A;  2HPC A;  1SFC A;  5KJ7 A;  5APV A;  1H1O A;  3II6 A;  2E74 C;  4A7P A;  1S4X A;  1ZR2 A;  5KTB A;  5EXQ A;  2HR3 A;  3A7O A;  3L73 D;  2K9J B;  4EIJ A;  1RE3 C;  2KYV A;  3WFB C;  5AVX B;  4U3F G;  2AI5 A;  1NTK G;  3OA8 A;  1DT1 A;  2BEQ D;  1NWQ A;  3IF4 A;  1M56 D;  5AW3 B;  2ZXX A;  1IJD B;  3EQ2 A;  4OVN F;  3D0W A;  3FXE A;  3B5N C;  1L0L E;  2A06 D;  2BCC G;  1BCC J;  2IFN A;  3MHV A;  1BE3 D;  1CYI A;  1IZL 0;  1AOQ A;  3SFE C;  1H8A A;  1IZN B;  1FZA A;  2ZAE B;  1W2B O;  1H32 A;  2IFM A;  5IY5 1;  1LTB C;  2R5D A;  2LXB A;  3O8Z A;  4XE5 B;  3P7K A;  4GOD A;  4C7N B;  1DIQ C;  2JDI H;  1RE4 A;  3L71 G;  3VYI A;  1PPJ E;  3BAS A;  4YXD C;  4N78 E;  3TYI A;  4JPZ B;  3IN6 A;  3Q1M A;  1FJ0 A;  3HQ8 A;  1KV9 A;  3OCD A;  4GT1 A;  2HG5 D;  1JMM A;  2BH4 X;  1CYJ A;  2FY8 A;  5CIF B;  2RH0 A;  1KX2 A;  3MZW B;  4LGD E;  3RBX A;  1N15 A;  1FZF A;  1UIX A;  1BDC A;  3MGN A;  4GDO A;  1K73 Q;  1GD2 E;  1KYO E;  2Y9Z A;  3CYT I;  1EZV D;  5KJ7 C;  1H9X A;  3BAT A;  3G6E P;  2V7Q J;  2FFD B;  1KB9 D;  2JEE A;  3OW2 O;  2JKV A;  4MU8 A;  5KLV K;  3OA7 A;  2W6J H;  1HH7 A;  2ZBO A;  1AQT A;  5CCG C;  1U74 B;  3ZIY A;  1FJP A;  3KDP B;  4DOJ A;  4DJG A;  5KKZ C;  1E2R A;  3M0A A;  3WFC C;  3IR9 A;  4WQC A;  1WEJ F;  3H1J G;  5AW1 B;  2YQB A;  1WRG A;  1H0T B;  2JQR A;  1W5C E;  3CXH D;  3HD7 D;  2E76 C;  2YCC A;  4L74 A;  2R3S A;  3IAO A;  1LT9 C;  1FZE A;  4L76 A;  4XA4 A;  1S5L V;  4JBZ A;  3TGU D;  1SVF A;  4IOI H;  4H13 B;  1JY3 N;  3AE8 C;  1S3J A;  2R3C A;  3A0B V;  2HFE D;  2NPS C;  2O3J A;  1NU1 E;  2AXT V;  4UB6 H;  2MTA C;  3DR0 A;  3L36 A;  2R44 A;  5AW0 B;  3H1H D;  1DX7 A;  4EIC A;  1SQP G;  1N90 A;  4H13 C;  2OZ1 A;  1NGM B;  1KN7 A;  1QN2 A;  1ZZH A;  2ZON G;  3L71 D;  2FYU G;  1NJI Q;  3NWV A;  2P1J A;  3L73 E;  1DD4 A;  4GED B;  2GC7 D;  3CWB D;  3X39 A;  3AEG C;  1ZME C;  1T3U A;  1LTA C;  3L73 J;  1FHB A;  5B5E E;  155C A;  1PP9 E;  1H33 A;  1N2D C;  2Y9Y A;  4AUW A;  4EID A;  1GK4 A;  1EDI A;  1AKK A;  3RL0 D;  1L0L D;  3O6Q A;  1PZQ A;  4FA9 A;  1YBK A;  2LIR A;  4EOT A;  2PAC A;  3ZOY A;  2ZT9 D;  2N1T D;  2IX7 C;  3G9R A;  4BRY B;  1K9M Q;  2ZOO A;  4Z1M H;  3WFD C;  1LWU B;  2H89 C;  1QX8 A;  2N1T C;  4Y99 B;  2ZJS E;  2WWW A;  3ZCF A;  1L0L G;  2ZYD A;  4I6M C;  1NNO A;  1S9K E;  1NKN A;  3VP9 A;  1HJ0 A;  5H2F H;  1XTG B;  3TGU G;  1YJW P;  2ZYA A;  1OIP A;  4AAN A;  3VOP A;  2GUS A;  3H1J D;  2Q5U A;  5DJT B;  1PPJ G;  1K04 A;  3V2N A;  1FI7 A;  2C9X B;  2V7Q H;  3O1Y A;  1QVF O;  3H1K D;  1SQX K;  5DJQ C;  3CX5 W;  5KLI C;  1FE6 A;  3USS A;  4UB6 V;  1AA0 A;  3CXH H;  2E5T A;  1CW5 A;  1IFJ A;  2B0Z B;  4K35 A;  2LKM A;  4W7Y A;  1P84 D;  3AE6 C;  5E79 E;  1CHH A;  1H31 B;  1LTT C;  2FRC A;  2P2U A;  4HJG H;  3PXT A;  1AJY A;  3H1H G;  3N4X A;  1GL2 A;  1SQQ D;  3QWO C;  1K05 A;  2WSC H;  4PV1 B;  1N7S D;  3BCC E;  1JTH A;  3CME P;  2XNX A;  2HPC B;  4I1L A;  2PCC B;  3WU2 H;  5CYT R;  3H1I E;  1GZL A;  1Q2N A;  3RGU A;  1HJB A;  1BGY D;  2EXV A;  1GJQ A;  3KHU A;  1CRY A;  4C46 A;  3BCC J;  3DP5 A;  2A45 G;  2NPS A;  1KD1 Q;  4EIF A;  2RKL A;  4AAL A;  5AW8 B;  1JUN A;  1HVV A;  4OGQ B;  4H0L B;  1AQ5 A;  3VMZ A;  3UIA A;  4H44 D;  2YXR B;  5H2F V;  1E8E A;  2C1U A;  1Y8A A;  1CCH A;  3AE5 C;  1PGP A;  3EWK A;  3M0D A;  1C2R A;  1COT A;  4ZKP A;  2Y0D A;  2I1K A;  4JF7 A;  1FI9 A;  2E5Y A;  3CX5 H;  2WSF H;  1M7L A;  2WT7 A;  3V2Q A;  2V08 A;  3OJA B;  1CC5 A;  1XTC C;  5BU8 B;  3ZOO A;  5TIS E;  2M5A B;  2N3B A;  2QSI A;  1M60 A;  2QJY C;  3MD0 A;  2GB8 B;  2JJL A;  3H1J E;  4GKG A;  2W83 C; 
#chains in the Genus database with same CATH homology
 1CHI A;  3HQ9 A;  1H33 B;  1B7V A;  1CRJ A;  3TDK A;  1CRH A;  5DFS A;  4FAN A;  1LC1 A;  2V07 A;  3SLE A;  1AYG A;  1HRC A;  1LMS A;  1DVV A;  2QJY B;  1KIB A;  1RAQ A;  1QKS A;  1C6R A;  1CTJ A;  1I5T A;  1MG3 D;  1NTK D;  2CE0 A;  3GG2 A;  1NML A;  3L70 D;  4WQA A;  1F1C A;  1JDL A;  3O5C A;  4FAV A;  5TJH A;  1GQ1 A;  1H1O A;  2FWL A;  4A7P A;  1SQB D;  5EXQ A;  1R0Q A;  3L73 D;  1CHJ A;  4D6T D;  2K9J B;  3VRD A;  1NTZ D;  3WFB C;  2AI5 A;  3OA8 A;  1DT1 A;  4XXL A;  1GU2 A;  1NU1 D;  4EDF A;  1K3G A;  4WQ9 A;  1KYO W;  1DW3 A;  1VYD A;  5GTH V;  1FOC A;  2BGV X;  1LFM A;  2A06 D;  3DMI A;  2AIU A;  1BE3 D;  1CYI A;  1IZL 0;  1U75 B;  1KB0 A;  1DW1 A;  5GTI V;  1AOQ A;  1DII C;  1ZRT D;  3CP5 A;  1I6E A;  3PLN A;  3PXS A;  2YIU B;  1H32 A;  1CO6 A;  3KZI V;  5IY5 1;  1PP9 D;  1DIQ C;  3L4M A;  2L4D A;  2FYU D;  1CRC A;  2BCN B;  4KMG A;  4NFG B;  5KKZ B;  2N9Y B;  1I8O A;  4IL6 V;  1QL3 A;  2C1D A;  3TYI A;  1FJ0 A;  4P4Q B;  5KAF V;  3HQ8 A;  1KV9 A;  3OCD A;  1N50 A;  1LS9 A;  4PJ0 V;  3L72 D;  2BH4 X;  1CYJ A;  5CIB B;  1YIC A;  4L3H A;  2GC4 D;  5CIF B;  1KX2 A;  2MHM A;  1A2S A;  1N15 A;  4FA5 A;  1COR A;  1CSX A;  1SQX D;  4AAO A;  351C A;  2N9J A;  1CIE A;  3CYT I;  2CXB A;  1K3H A;  1EZV D;  2ZXY A;  1HZV A;  1H9X A;  4H0J A;  1KB9 D;  1C2N A;  3H1L D;  2DVH A;  3VNW A;  4MU8 A;  2GIW A;  1CIF A;  1I8P A;  1HH7 A;  4RSZ A;  2CE1 A;  4WQB A;  1W5C T;  2ZBO A;  3PHL A;  2C1D B;  1U74 B;  1HJ5 A;  3ZIY A;  5DF5 A;  3M97 X;  1YEB A;  1CCR A;  1E2R A;  3WFC C;  4V2K A;  1C6O A;  4WQC A;  1WEJ F;  2B4Z A;  2D0W A;  1CRG A;  3WC8 A;  4Y5R A;  1CXC A;  2XTS B;  2YQB A;  1LC2 A;  2L91 A;  4YE1 A;  2JQR A;  1S6V B;  1YFC A;  2CA4 B;  2LIT A;  3PH2 B;  5KLV D;  3CXH D;  2YCC A;  4LJI A;  1M6Z A;  1C52 A;  3HQ6 A;  1CSU A;  1IQC A;  5AUR A;  1CED A;  3VMA A;  1CSW A;  1S5L V;  3TGU D;  1DW2 A;  2C8S A;  1IRW A;  2N9I A;  3ORV A;  2O3J A;  3A0B V;  1NTM D;  1WVE C;  1EB7 A;  2B10 B;  2AXT V;  1AOF A;  2MTA C;  3C2C A;  5CIH B;  3ZBM A;  2C2C A;  3DR0 A;  1QL4 A;  3H1H D;  4EIC A;  2Y0C A;  1N90 A;  5CID B;  3A0H V;  1CXA A;  2OZ1 A;  4AX3 A;  1QN2 A;  2PCB B;  1ZZH A;  2ZON G;  3L71 D;  1KYO D;  3NWV A;  1W2L A;  3L4O A;  3TF5 A;  1I55 A;  1HJ3 A;  4GED B;  1MZ4 A;  2GC7 D;  3CWB D;  3X39 A;  4PWA A;  1F1F A;  1HRO A;  3HQ7 A;  1A8C A;  1YNR A;  2VHD A;  1FHB A;  155C A;  1H33 A;  1I54 A;  1IRV A;  1GKS A;  4U3F D;  5DJQ B;  4AAM A;  4EID A;  5B66 V;  3NBT A;  1AKK A;  1N9C A;  1CRI A;  1L0L D;  3WU2 V;  1DW0 A;  4FB1 A;  3BCC D;  4FA9 A;  2LIR A;  1L9B C;  1M70 A;  2PAC A;  3ZOY A;  2DGE A;  1BL9 A;  3PRJ A;  1KX7 A;  4WQD A;  1L9J C;  3MK7 B;  4Q5P A;  5B6Q A;  3RMZ A;  1C75 A;  2QJP B;  2ZOO A;  2BCC D;  2Y0E A;  3WFD C;  1CIG A;  2QG4 A;  4UB8 V;  2RN0 A;  5KAI V;  1YCC A;  3O0R C;  3ZOW A;  1C7M A;  5TIS V;  3ZCF A;  4EIE A;  3RN0 A;  1NMI A;  1NNO A;  1H31 A;  1RAP A;  1IO3 A;  2B12 B;  3MK7 C;  4PD4 D;  1J3S A;  1CTZ A;  5C0Z A;  5KLI B;  1CIH A;  1OCD A;  4QAO A;  3SJL A;  4AAN A;  3WUI A;  2OZ1 B;  3ZOX A;  3H1J D;  2C1V A;  1FI7 A;  1HZU A;  5E79 V;  2C9X B;  2CA3 B;  3O1Y A;  3H1K D;  1MG2 D;  4XYD B;  3CU4 A;  1RZ6 A;  5DJQ C;  3CX5 W;  4UB6 V;  2KNC B;  1A56 A;  2BH5 X;  2B0Z B;  1DVH A;  3JBT B;  4WQE A;  1P84 D;  1CHH A;  3PTZ A;  4K3I A;  3PXW A;  3A9F A;  1H31 B;  1HJ4 A;  1YEA A;  2ORL A;  2RMZ A;  1CNO A;  4J20 A;  2FRC A;  1I6D A;  2IBZ D;  3PXT A;  1SQQ D;  2JTI B;  5CIG B;  3SWS A;  1FCD C;  2D0S A;  3OCD B;  1CSV A;  4RJT A;  4H0K A;  1NIR A;  3NBS A;  4JCG A;  4GYD A;  3RLM A;  2HV4 A;  2PCC B;  3CXH W;  1C6S A;  5CYT R;  4L1Q A;  2FYN B;  1BGY D;  3OA8 B;  2EXV A;  1GJQ A;  3L74 D;  3KHU A;  1CRY A;  1RZ5 A;  3DP5 A;  1BCC D;  5C9M A;  1GIW A;  1ETP A;  4EIF A;  3H1I D;  4AAL A;  451C A;  3RN1 A;  3GW6 A;  1H9Y A;  1GDV A;  2I8F A;  2YK3 A;  3L75 D;  3SVW A;  1E29 A;  4FA4 A;  3O20 A;  3SXT A;  3WFE C;  5H2F V;  1PPJ D;  1E8E A;  2C1U A;  4PW9 B;  5B5E V;  1H32 B;  1CCH A;  4O1W A;  2ZZS 1;  1C2R A;  1COT A;  4N0K A;  2B11 B;  4WQ7 A;  2Y0D A;  3VYM A;  1SQP D;  1FI3 A;  4FA1 A;  1FI9 A;  4WQ8 A;  3ITK A;  1CTY A;  2N18 C;  5CIE B;  1YIQ A;  2BLF B;  1HCM A;  3CX5 D;  1CYC A;  1OAE A;  2V08 A;  4DY9 A;  1SQV D;  1CC5 A;  2JWA A;  3ZOO A;  1YTC A;  2KS1 A;  2N18 B;  1L0N D;  2QJK B;  2N3B A;  4O1Q A;  4L3G A;  2Q3E A;  5CIC B;  1QYZ A;  1M60 A;  3FWL A;  2GB8 B;  2BPB B;  2N3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...