3H1ID

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 63
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1iD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1iD02
3CX5D 1A2SA 1CHIA 2Y0CA 2QJPB 1RAPA 1YFCA 2Y0DA 3PH2B 4FAVA 1CO6A 2EXVA 3CXHD 3ZOYA 1I55A 4WQ8A 1YCCA 3TGUD 1CORA 1RZ6A 1CYIA 1M70A 1H31B 4N0KA 2GIWA 3PXTA 1B7VA 2JTIB 155CA 1SQQD 2V07A 4XYDB 3ZIYA 3RN1A 3O20A 3PLNA 4WQDA 2RN0A 3GW6A 4PJ0V 3WU2V 2C9XB 1QYZA 2JQRA 1H9XA 2CA4B 4AX3A 1N90A 1NTMD 1CSXA 4AAMA 3WFDC 2BCNB 2K9JB 1CRYA 1WVEC 3NBSA 3GG2A 2OZ1A 3MK7B 1NNOA 4IL6V 1QL4A 3FWLA 1DT1A 3H1HD 1YEAA 2ZXYA 1GU2A 2PCCB 3TDKA 4AALA 1KB0A 2BH4X 1DW0A 1OCDA 5EXQA 1HZVA 1ETPA 1COTA 1HH7A 1CSWA 3M97X 3O1YA 2C2CA 2GC4D 1FI9A 2CE0A 3HQ9A 1MZ4A 1SQXD 1LFMA 1CRHA 3SWSA 1KB9D 4GYDA 1AOQA 4WQCA 4PD4D 1IO3A 2YCCA 5KAIV 1N15A 1CTYA 1DIQC 1NTZD 2ZBOA 1CCRA 3ZCFA 2IBZD 5GTIV 2YIUB 2CE1A 1I6DA 5CYTR 2N18B 1DW2A 1N9CA 1CIGA 1H9YA 1CIFA 3H1KD 1F1CA 1L9BC 5E79V 3TF5A 1CHHA 2BH5X 1I6EA 3ITKA 2C1DA 1C2NA 2D0SA 2D0WA 1DVHA 1W5CT 1CHJA 2N18C 2HV4A 1S6VB 2ORLA 3RN0A 3X39A 4AAOA 1IQCA 1QKSA 1GKSA 1FOCA 351CA 3DP5A 3HQ8A 1YICA 3OCDB 1CCHA 4L3GA 1P84D 2N3BA 1E29A 3H1LD 1CSUA 5KLIB 2AI5A 2KNCB 4KMGA 1RAQA 1KYOD 1FI7A 4NFGB 3SLEA 1PPJD 1CTJA 2RMZA 1QL3A 1FCDC 1N50A 1LC1A 1FI3A 5CIHB 1PP9D 2PACA 4FA5A 2B4ZA 3CU4A 3WUIA 3L73D 1HZUA 1S5LV 1FHBA 1A56A 1C6SA 5DFSA 1ZRTD 5CIDB 3WFCC 1EZVD 1BCCD 1IRVA 3HQ6A 4H0KA 2B11B 3A0BV 1NIRA 1K3GA 1F1FA 2AXTV 4EIFA 2DVHA 1KX2A 2QJKB 5GTHV 1C7MA 3L71D 3L72D 1CC5A 1GQ1A 1NU1D 4MU8A 4EDFA 4YE1A 2I8FA 2OZ1B 1NMIA 4JCGA 1H32A 1NTKD 5B6QA 1LC2A 3JBTB 1BL9A 3OA8A 3VRDA 3PHLA 2LIRA 1E2RA 3SVWA 2N9JA 4L3HA 5C9MA 5C0ZA 3L74D 2FWLA 1CRJA 1LMSA 1NMLA 3H1ID 2FYUD 4L1QA 1AYGA 1AOFA 1YIQA 4UB8V 2JWAA 1I8OA 1ZZHA 1CNOA 3RLMA 1YTCA 4U3FD 3OA8B 3A0HV 1DIIC 1C75A 1CRIA 5H2FV 3PXSA 1CYJA 1GDVA 1HJ5A 3ZBMA 4V2KA 4J20A 5AURA 5CIGB 2BLFB 4QAOA 4D6TD 2FYNB 3L75D 4FANA 4H0JA 1L0LD 5KLVD 1CSVA 1CIHA 1SQBD 1SQPD 2C1DB 2KS1A 1I5TA 3WFEC 1CIEA 1W2LA 2DGEA 2LITA 5KKZB 1IZL0 3KZIV 1E8EA 3CYTI 2N9IA 2GC7D 1J3SA 1HCMA 2FRCA 5CIEB 4UB6V 1M6ZA 3CWBD 1YEBA 5B66V 3PTZA 2C1VA 451CA 4FB1A 1C6RA 1RZ5A 2PCBB 4WQEA 2B10B 3O5CA 4O1WA 1HJ3A 1U74B 4EICA 1HJ4A 2C8SA 1H31A 3CXHW 1CRCA 1KIBA 4WQ9A 3WC8A 3A9FA 3L4OA 1DW3A 2B0ZB 2CA3B 1IRWA 4WQBA 1EB7A 2CXBA 3KHUA 2BGVX 5CIFB 1C6OA 1OAEA 4K3IA 3ZOWA 3WFBC 2XTSB 3O0RC 1AKKA 1CTZA 1DVVA 1JDLA 1YNRA 4PWAA 1VYDA 1GJQA 3ZOXA 5IY51 1C52A 3RMZA 3VMAA 3PXWA 4FA1A 1BE3D 3PRJA 3ZOOA 4RSZA 2O3JA 1CXAA 2L4DA 2AIUA 4EIEA 1K3HA 1WEJF 4P4QB 3CP5A 3DMIA 2BCCD 4XXLA 3NBTA 2V08A 2YK3A 1GIWA 3NWVA 1FJ0A 2VHDA 3MK7C 3C2CA 3TYIA 2Q3EA 5CICB 1H32B 1HROA 2BPBB 1QN2A 2Y0EA 1H1OA 1CXCA 1H33A 2QJYB 2ZOOA 5DJQB 1I8PA 4PW9B 1HRCA 3VNWA 2N3YA 1CYCA 5DF5A 4GEDB 3HQ7A 2MTAC 4LJIA 3H1JD 1BGYD 2QG4A 3DR0A 2L91A 1L9JC 2N9YB 2GB8B 1H33B 2MHMA 1CRGA 1CEDA 1R0QA 5DJQC 3BCCD 4EIDA 1LS9A 1U75B 4WQ7A 5B5EV 4DY9A 1MG3D 4FA4A 4RJTA 4O1QA 5CIBB 1M60A 1KX7A 1DW1A 1C2RA 3OCDA 5KAFV 2YQBA 1KV9A 1I54A 3SJLA 2ZONG 2B12B 3SXTA 4AANA 3VYMA 3L4MA 3ORVA 3L70D 1L0ND 2C1UA 4FA9A 1A8CA 5TJHA 5TISV 1KYOW 3CX5W 1SQVD 4Q5PA 2A06D 4A7PA 4Y5RA 1MG2D 4WQAA 2ZZS1
chains in the Genus database with same CATH superfamily
1L4AB 3L72E 2QJPB 2KK7A 1ZW0A 1RE4A 1JY3P 2W8ZA 5L8RJ 4FAVA 1SQQJ 2EXVA 3CXHD 3ZOYA 4Y99C 1CORA 3MD0A 1CYIA 4RO0A 2AEJA 2WSCJ 1RF0C 1AQTA 1AA0A 1T6AA 1NTMJ 1BDDA 3RK2C 2PGDA 3UIAA 3D0WA 3O20A 2LR2A 5AVTB 1MFZA 1LWUC 3PLNA 4WQDA 1NKNA 2JEEA 3RGUA 2CA4B 2D2CB 2MJZA 3WFDC 4H13D 3A0BH 3H1KE 4H44B 3CMEP 1URQA 1CRYA 1WVEC 3GG2A 1RE4C 3MK7B 1R8EA 5GTHH 3CCUP 3PJSK 1YI2P 4GT1A 4MN4C 1U7JA 1OCDA 4WY4D 1ETPA 2W6AA 3M97X 1FI9A 1NTZJ 3BASA 1CRHA 2R32A 2YNYA 1KB9D 2KUBA 1IO3A 1KFMA 1FJKA 5KAIV 1N15A 5APWA 1CTYA 3H1KJ 3HTKB 4I7ZB 1URQC 2ZBOA 1CCRA 2YIUB 1IZNB 1FC2C 1USEA 5CYTR 2H89C 1DW2A 1N9CA 1CIGA 1HH0A 5E79E 1VQOP 4N78D 1YJNP 3ITKA 1ZR2A 2OYIA 1WRGA 3L73E 2Z4EA 3CXHH 1M7LA 3CCVP 1BCCE 3P8CE 1GKSA 4IFFA 1Q2NA 1MV8A 1ZMEC 3OCDB 1CCHA 4L3GA 3JC22 3H1LD 1LTGC 2AI5A 1KYOD 4NFGB 1L0LK 2OYIC 3QH9A 3AEBC 3L73J 1T3UA 2RMZA 1DD3A 1FCDC 1KQLA 3U1CA 2IBZG 1FS0E 2FXOA 2WQYC 4OGQD 2B4ZA 3T97A 1E5WA 1HZUA 2QE7H 1PGPA 1A56A 4H13C 2LXCB 5DFSA 1ZRTD 5CIDB 3PH0A 2CPBA 2HPCB 1KB9H 4L73A 4U7JA 2B11B 3QWOC 5AW0B 2FXPA 1K3GA 1SP4A 1NAYA 4C46A 2OTJP 2V7QH 2DVHA 5GTHE 4WY4C 3CCLP 1KX2A 3G6EP 1GD2E 2KXPB 3L71D 1IFMA 1CC5A 1NU1D 1JY2P 1L0LE 2BEQD 2KLVA 1OVUA 2OYHB 4GOEA 2W6JH 3O8ZA 1JCDA 4JCGA 3CWBG 1H32A 5AW8B 3B5NA 1H88A 2H7HA 2YKOA 3OA8A 3PHLA 1DEEG 1H0TB 5CCGA 1CW5A 2WPQA 3SVWA 1GMJA 1PP9G 1GU5A 1EDKA 1VQMP 2ZVOB 1NMLA 2FYZA 4L1QA 1YIQA 1I8OA 2HODB 3VP9A 5APTA 1YTCA 4U3FD 2ZT9B 1OXZA 4W7YA 1SQBJ 1QLED 1VDFA 1KILB 1EZVG 1HJ5A 3ZBMA 1KYOH 1FOSE 5CIGB 3MGNA 2BLFB 4QAOA 4D6TD 3L75D 4H0JA 5KLVD 1AJYA 3MHVA 1YQ3C 3CXHE 2POHA 2N1TB 4KHXA 4IOIH 5CCHA 5CCGC 1I5TA 1LNQA 4BRYB 1FAVA 1KORA 2DGEA 3Q5RA 1IZL0 1E8EA 2IFMA 1JY3O 1NJIQ 5KAFH 2FYNC 3G9RA 2FRCA 2WPSA 2B87B 3RL0D 3V4WA 4UB6V 2HG5D 1M6ZA 2WT7B 3CWBD 1NTKG 5B66V 2W27A 1L4AA 4OWFA 1BE3E 1Y47A 2C1VA 4I1LA 1YQ4C 2WWWA 2E75C 2PAJA 3L74G 2PCBB 1RQVA 2NRGA 1S4XA 3V2NA 4WQEA 2V4HA 2B10B 1S5LE 1JEKA 1HJ4A 2WPRA 3A9FA 1QEXA 3VMYA 1IRWA 1N73A 2FKWB 1IJDB 1EB7A 4N6JA 5AW3B 2R5DA 3KHUA 2BGVX 5CIFB 4PD4H 3IAOA 3I56P 4R4MA 1K73Q 3USSA 1J1DB 3FXDA 2KB7P 1FDOA 1L4AC 1BE3J 2QJPC 2JO1A 1AKKA 2JR8A 1CTZA 3A7OA 3S4RA 1ZN5A 1GJQA 2YKPA 2KLUA 1GL2D 2ZXXA 1T3JA 1FZAA 4EYYQ 1R5LA 3PXWA 4HJGH 4Y28J 1ZXGA 3VTPC 1VQ8P 1N7LA 2P7JA 3H1IJ 3BVHA 1N73C 1FJPA 1VQ7P 4P4QB 3DMIA 1JO5A 2WPVB 1LTIC 3G71P 2V08A 3R2PA 1SFCD 2AXCA 3HTKA 1GIWA 4H44C 1FJ0A 2A06G 3MK7C 1N8RQ 1GU4A 3H1JJ 1QN2A 1YTZI 3AE8C 2V7QJ 1H1OA 3A0HE 5KAIH 3Q3DA 5DJQB 3VNWA 5H2FE 3TSIA 1SQPJ 4LJIA 4H0LB 4GOFA 3TNUB 3TGUG 1BGYD 2QG4A 4ASVA 1JOCA 1NAFA 2MHMA 3N4XA 1CEDA 1NYHA 1X9VA 1VQNP 2JJLA 1LS9A 1KV4A 1VL2A 2WSFH 3KDPB 4O9BA 1IFIA 2K3RA 4I7ZC 3AEAC 2G8YA 3KXDA 2W6BA 5KAFE 3L70J 1C2RA 2E76D 3OCDA 3Q1MA 1GK4A 2XDJA 1ZRTE 3H32B 1I54A 3SJLA 2KS1B 2ZONG 1M90Q 1NO4A 3VYMA 2H88C 3H1HG 2KSJA 1RQUA 2ZT9D 2BCCG 1FOSF 3D6ZA 3SWFA 2ZYDA 3I5CA 5TISV 2WITA 3CC7P 2A06D 3BATA 3G4SP 1SQXG 4WQAA 2ZZS1 3CX5D 1A2SA 2Y0CA 1RAPA 1IFNA 2Y0DA 2R44A 1LTTC 1CO6A 1K04A 1YCCA 3TGUD 4Z1MH 1PGOA 1ZLLA 4NPFX 1M70A 4PD4E 1ZOYC 2L5GB 2GIWA 4JBZA 2IBZE 5DJTB 4KT0J 2RN0A 3RK2D 4PJ0V 1QYZA 3AE6C 3RK3B 2JQRA 1H9XA 1SLQA 3M9HA 1RY3A 1GDTA 4AAMA 2Q6QA 1JNMA 2IYPA 5APQA 2OYHA 1Q82Q 3FWLA 1DT1A 3H1HD 1VQ9P 1DW0A 2P58A 1H0TA 2I8DA 5EXQA 1SQVG 2C2CA 4WWIA 3HQ9A 1MZ4A 1SQXD 1Y8AA 2E42A 2KP8A 3N7NA 3SWSA 2HODA 5KAIE 2YCCA 3U1AA 3RBXA 4DCKA 1SVFA 1DIQC 3AE2C 5AVWB 2IZ0A 5GTIV 2IDBA 2OYHC 3AEDC 2P10A 1KILA 2N18B 1CZQA 3IN6A 4M3LA 4EOTA 1H9YA 1CIFA 4N3YB 1IK7A 1PP9E 1S9KD 1I6EA 2E76C 4BRYA 1UIIA 1QL1A 3SFEC 3HUSB 2P1JA 1L2PA 1PV3A 1D7MA 2MKVA 3GHGB 3X39A 5BVZA 4AAOA 4ZMDA 2ZT9C 2FFDB 2LXBA 1EZVE 2WT7A 4C7NB 1EQ7A 2HR3A 1FOCA 5APYA 1M1JB 1KILC 1DIPA 1EDIA 1LT1A 351CA 3DP5A 3HQ8A 2NPSB 4UB6H 1ZP0C 1VQ6P 1CSUA 5B66H 1FDIA 1PP9J 1FI7A 3SLEA 3GMAA 1U57A 1QL3A 3KPEA 2YMKA 1N2DC 5APXA 1A02F 1LC1A 2Q9IA 5CIHB 3CD6P 2PACA 4FA5A 1NTKE 2FYUG 3WUIA 1J1EB 1M1KQ 5CJ4A 3H25A 3V4QA 3KQGA 2BASA 1YBKA 1NHLA 3L74E 4EIJA 1MFTA 2JDIH 3WMM0 2ZYGA 3CI9A 1EXJA 1RH5B 2GUVA 2E74B 2O1KA 2OYOA 3L72J 4IL6E 3SWYA 1F1FA 4NPDA 2XNXA 4PV1B 1ZR4A 4EIFA 2QJKB 1NTKJ 5APVA 3AE9C 2I8FA 1J1DC 3H1LG 1S2EA 2KI7B 3L74J 3GF7A 1LC2A 1IFJA 1XTGB 4ZKPA 2R3CA 2QM7A 3CL3D 4IFMA 2KYVA 2N9JA 4L3HA 3MTUE 5BU5A 2FWLA 2QM8A 4LC1A 3MUDA 3H1ID 2FYUD 3TNUA 2JP3A 3KYQA 4JYBA 3VMZA 1ZZHA 3RLMA 2P2UA 4RKUJ 4BWNA 3U59A 2B89A 1C75A 2XV5A 3HD7B 1CRIA 2A06E 1CYJA 5CBNA 3CCRP 3SFDC 1OMIA 1BDCA 2WSSH 3RBZA 1QL2A 4FANA 1AFOA 1GW4A 2ZXEB 3VP8A 1CIHA 1SQXK 3HE5A 1DD4A 1SQPD 1S72P 3H32A 2KS1A 3B5ND 3TGUE 5KKZB 3MUDC 3KZIV 4HB1A 1LT9B 3L71G 4H0LC 1NU1G 5CCGD 2GC7D 1J3SA 3MZWB 1HCMA 4UB6E 1G1IA 5B66E 1WT6A 1YEBA 4K3AA 1OZHA 3PTZA 451CA 1MKMA 5TISH 2C0XA 4FB1A 1C6RA 2Q1KA 3F5HA 3H1HE 1BCCJ 4O1WA 4EICA 2E75D 1JB0J 3CXHW 1CRCA 2BCCE 1W2BO 4U3FG 2K37A 2NZ2A 1DW3A 5CCHD 2CA3B 4L75A 2R3SA 1AQ5A 2FXMA 1SQXE 5CBOA 2IYOA 2O01J 1C6OA 1OAEA 4K3IA 4D6TG 3L75G 1JTHA 3A0BE 1SQVK 3WFBC 1VF5B 3EFGA 2XTSB 5KLVG 2PP6A 3BCCG 4PJ0H 1QGKB 1ZV8A 2C0WA 1JDLA 1YNRA 3AECC 1T2KD 1L4AD 2XKMA 1N7SB 3O6QB 3ZOOA 2O3JA 2AEMA 2BCCJ 4QMAA 1FZBA 4XFJA 3JSVC 1K3HA 3M9BA 1DEBA 3CP5A 1UIXA 3RK3C 1GTWA 4XXLA 1Q81Q 3NBTA 1PGQA 3NWVA 2OGUA 1JMBA 2RKLA 1HUCA 3C2CA 2E5TA 1HROA 2D2CD 1FBMA 3B4SA 4H44D 1H33A 1CXCA 2ZOOA 1PIXA 4PW9B 1HRCA 1L0LJ 2N3YA 1CYCA 5DF5A 5GTIH 1SQVE 1NKZB 1FZCB 2QA4P 3E1IA 3HUSA 2ZYAA 3DR0A 2L91A 1L9JC 3B5NC 1CRGA 3GF3A 2QJYC 3BCCD 3GHGA 1OFCX 1HJBA 2FFDA 4C7NA 3M0DA 5B5EV 1M1JA 1MG3D 2M3BA 2QIWA 1DW1A 2QEXP 2NPSA 3P7KA 2YQBA 3A3YB 2FYUK 1KV9A 2B12B 4GODA 2Z5IA 3ORVA 3HUSC 1L0ND 3LIDA 1KYOW 4Y99B 3C1LA 5CCHC 3GHGC 2FFDC 3LIEA 2PRRA 1FZGA 2LKMA 1M1JC 2GUSA 3SSUA 3CC4P 1EDLA 1NTZG 4WQ8A 2NPSC 4I6MC 5AW5B 1BGYG 1RZ6A 1KB9E 4C7RA 1USDA 4N0KA 1T2KC 1B7VA 2JTIB 155CA 1SQQD 2V07A 3ZIYA 3RN1A 1LP1B 4PJ0E 3GW6A 1OIPA 3WU2V 2FYUE 3AEGC 4AX3A 1N90A 1NTMD 1WMKA 3L4FA 1CSXA 4PD4I 1FZEA 4N78E 1J1EC 3NBSA 1NNOA 2IBZI 1OW8A 4NPEA 2ZXYA 2OARA 4AALA 2BH4X 2D2CC 1LGHB 3VMXA 1URQB 3CLQA 1CI6B 1OX3A 1CSWA 3O1YA 4ZKUA 1G1JA 4GYDA 1AOQA 1PPJG 2QJKC 3S9OA 4B86A 3H1LE 1NTZD 3HD7A 2N9BA 1KYOE 1NU1K 2CE1A 3EFFK 2A45G 1TU3F 3H1KD 1F1CA 1L9BC 1P84I 3CCQP 3TF5A 1CHHA 1YTZT 4ASWA 4YXWH 2YIUC 2E5YA 2ZJSE 1DVHA 1W5CT 1LT9A 2YXQB 1KZUB 2KZJA 1Q86Q 3R4YA 1S6VB 4AYCA 1IQCA 3H1LJ 2OQQA 3KZIH 2WTYA 1QKSA 3HD7C 2CK3H 1X0TA 1YICA 2N3BA 2ZAEB 1E29A 1KILD 2GA1A 5KLIB 1EZVI 5AW4B 2WSCH 1RAQA 3L71E 4L76A 5KLVK 1NU1E 1PPJD 1A02J 1CTJA 1LT9C 1E79H 1LTJB 4H13B 2N1TD 4XE5B 3FXEA 1N50A 1FI3A 2Y9YA 2SPZA 2C9LY 2HPCA 2CPSA 3CU4A 1RF1B 3L73D 1S5LV 3C8VA 1R5SA 2FBWC 3D71A 4WY4B 2I1JA 3OW2O 1BCCD 1X8YA 3O6QA 1N7SA 1IRVA 3GLMA 2M5AB 3L71J 4U3FE 3V5BA 1NU1J 4H0KA 1VQ4P 3W67A 4AQRD 2BEZF 1SQBG 1LTBC 2AXTV 1VQPP 1PL5A 4D6TE 3L75E 1C7MA 1GQ1A 4MU8A 4EDFA 5KLVE 2OZ1B 3BCCE 1VF5C 1AVYA 1NMIA 2HLOA 2H8PD 1PZQA 5B6QA 1SQQK 1OVRA 1G2CB 2LIRA 1E2RA 1LTAC 4U3FJ 1RHZB 1FZCA 5C9MA 5C0ZA 3CWBE 1CRJA 1LMSA 1NTMK 1AOFA 3OA7A 1AVOA 4UB8V 3II6A 4D6TJ 3L75J 1KTMA 3OA8B 3A0HV 2N1TA 2YXRB 5H2FV 2RH0A 4V2KA 4J20A 3CX5H 4EI2A 5KTBA 5AURA 2FYNB 2R5BA 1K9MQ 5AW9B 1L0LD 2B87A 1CSVA 1HJ0A 1YITP 1SQBD 2K9YA 4I2LC 2J59M 2O01N 2C1DB 3KZIE 5M1BA 5B5EH 3Q5PA 1FZCC 3CWBJ 2LITA 4OGQB 3AE7C 3M06A 2A45H 1NTZK 1QX8A 3OAKA 3NMDA 5AVVB 2YO2A 5CJ0A 4H0LD 2N1TC 3M91A 1RF0A 2WSFJ 4IFDK 1BSHA 3M0AA 3F89A 1KQFB 2K88A 2WSEH 1RZ5A 4WVZA 3H1IG 1QVGO 2KIKA 1HJ3A 3CCMP 3FX0A 2B9BA 2O1JA 2C8SA 1KIBA 3WC8A 3L4OA 4WQBA 1OW7A 1LP1A 1EC5A 2CXBA 1BSNA 3H1JG 3V6IA 3ZOWA 3NTNA 1YYCA 1FU1A 1NTZE 1MUUA 3WU2H 1SQPG 1N73B 1DVVA 1RE3A 1BGYE 4PWAA 1HWTC 4JQ0D 3ZOXA 4HKZH 3TYYA 5IY51 4JYCA 1C52A 2WZ7A 3VMAA 3EWKA 4FA1A 1BE3D 4YPCA 4RSZA 1CXAA 4RESB 2L4DA 1VQLP 1CI6A 2AIUA 4EIEA 4TT3H 5AVXB 3W68A 1FE6A 3L70G 1T8ZA 1JY2N 4K35A 3AE4C 4BXLA 3HRNA 2HYNA 2VHDA 1OW6A 4L74A 3RK3D 2Q3EA 2YKQA 5CICB 1OVVA 1BGYJ 1RE3C 2Q7CA 4LGDE 1NOHA 1I8PA 3AE3C 2FY8A 3V2PA 4GEDB 4AUWA 1KILE 3CPWO 3RL0B 1YJ9P 3H1JD 3L36A 3CX5E 1VQKP 1PPJE 5DJQC 1HGVA 4EIDA 5C39A 1U75B 1DX7A 4WQ7A 5B5EE 1EDJA 2OTKE 1S1CX 2WVRA 1JM0A 4O1QA 1GZLA 1KX7A 4W80A 3CXHI 4WB4A 3OJAB 3WUVA 5DJUB 4AANA 3B71A 2C9NY 2UWJE 5AVRB 3L4MA 3L70D 2I1KA 1LTJA 3VYIA 1A8CA 1JUNA 3L35A 4Q5PA 3B8EB 3TK1A 3CC2P 4Y5RA 3TGUJ 4CPGA 3M9QA 1CHIA 1GK6A 1GL2B 1RF1A 1IO4A 1M56D 1SQBK 1YFCA 3PH2B 1H8AA 2J5UA 3IF4A 3ZDMA 4DJGA 1I55A 4WY4A 3G3ZA 4JPZB 5KLIC 1S5LH 1H31B 2M5AA 2NPSD 3PXTA 3VN0A 2WSEJ 4XYDB 1W2EA 1LTJC 3WU2E 2ZFCA 1SFCB 2W83C 2C9XB 4OVNF 3CCSP 1KB9I 3H1HJ 2KOGA 2KSEA 2BCNB 1K05A 2K9JB 2P67A 1RF1C 3D6YA 2OZ1A 2AXTH 1OWAA 5KJ7D 1S9KE 4IL6V 4GIFA 1QL4A 3HE4B 1FZFA 1SQXJ 1YEAA 4LLHA 1GU2A 2PCCB 3TDKA 3V2RA 1KB0A 3CCEP 2IFNA 1L0NG 1K8AQ 1G2CA 3FWNA 3BRVB 1HZVA 1SQBE 1COTA 1HH7A 2GC4D 2ZVNB 1KQSO 2CE0A 1LFMA 2E74D 1Y9BA 4WQCA 4PD4D 3C9IA 2QVAA 1S5LX 1S3JA 3NFQA 4PV1D 2E76B 3ZCFA 2IBZD 2Q3IA 4UB8H 1HGZA 3WUUA 2M3EA 1I6DA 1JMMA 4JF7A 3SWKA 3A0HH 1SQQG 1HVVA 5AVUB 1EXIA 5H2FH 3IR9A 5E79V 2JWDA 2BH5X 3NXSA 2C1DA 1KYOI 1C2NA 1KD1Q 2D0SA 2D0WA 1FDMA 1NTMG 2XZRA 1CHJA 1M8OB 2N18C 2HV4A 5AVYB 2ORLA 1X79B 3RN0A 4DZOA 1SQVJ 3BRTB 4R4LA 3MIWA 4ZNCA 3JCUH 3L72G 1YHQP 4HYTB 5TISE 3A2AA 2QSIA 3HD7D 1P84D 5KJ7A 2KNCB 3E1RA 2QRXA 4KMGA 3CCJP 3RK2B 3M0DC 2E43A 4HH2A 1AV1A 1SQPK 4OGQC 1LWUB 1U7MA 1PP9D 5AW7B 1YIJP 2B88A 1X22A 1FHBA 3FGAD 3H1KG 1C6SA 4XA4A 4DOJA 1J2JB 3H1IE 3RK3E 3IFMA 3WFCC 5AVQB 1EZVD 5KJ7C 1M57D 3Q2YA 1HF9A 3P32A 3HQ6A 3AE1C 1HTLC 3ABVC 1IC2A 1NGMB 3A0BV 2AXTE 1NIRA 1N86A 3E7KA 3H1JE 5AW2B 2IZ1A 1XTCC 3AE5C 5GTHV 1KN7A 3A5TA 3AEEC 3L72D 4W7ZA 2E74C 4YE1A 1SQPE 2VRSA 2GM4A 4PV1C 5CMZA 1NTKD 2FYUJ 1VF5D 4KJMA 3JBTB 1BL9A 5AVZB 3VRDA 3RL0g 5GTIE 3L74D 1LTSC 1IFDA 4OH8B 1DH3A 1N7SD 4UB8E 1Q7YQ 1AYGA 1NWQA 2JWAA 2K1AA 2M0BA 3L73G 1CNOA 3L70E 2W90A 1JCCA 1DIIC 1P84H 3PXSA 1GDVA 1BCCG 1LJ2A 1QVFO 3LW5H 2H43A 2WMMA 2ITAA 1HBWA 2OYIB 2M8RA 3WFEC 1CIEA 1W2LA 3RL0C 3JCUE 4YXDC 3CYTI 2XU6A 2N9IA 5CIEB 3HE5B 4TLFA 4DT0A 3D70A 1CSBA 5KKZC 1GL2A 5AVSB 3V2QA 3P8MC 3CMAP 3O5CA 1IFPA 1U74B 3I55P 1VQ5P 3Q5SA 1H31A 4WQ9A 2IX7C 1JY3N 1YJWP 2B0ZB 3H6PA 1SFCA 3P8CD 1L0NK 3T97B 1JY2O 5K5GB 1L0LG 1Q90D 3O0RC 2K9JA 1GL2C 1Z56A 2YO3A 3HE4A 4GDOA 1VYDA 2XNDH 3VOPA 2IPPA 5APSA 2AEFA 3RMZA 3MP7B 1JTHB 1NVOA 3PRJA 4IL6H 2Y9ZA 3PP5A 4YTPC 4WBAA 1WEJF 5CHXA 1SFCC 2KZIA 1MZ9A 1N7SC 1W5CE 4GKGA 2BCCD 2Q5UA 2YK3A 1KFNA 2JKVA 1KC8Q 3AEFC 3TYIA 2DW3A 1H32B 3B5NB 2BPBB 2Y0EA 1L0NE 2QJYB 3L37A 1H89A 1VPCA 5KLVJ 1P84E 5AW6B 3HQ7A 3BCCJ 2MTAC 2OTLP 5BU8B 2G3AA 2N9YB 2GB8B 1H33B 1SS1A 1NH4A 1URQD 5E79H 1R0QA 1NTKK 1PFIA 5EFWB 5APUA 1KMIZ 4IL6X 2YMYA 3K5BA 3S1KA 3CX5I 4DY9A 4FA4A 3WUTA 1SQQE 2E75B 4RJTA 1BE3G 5CIBB 1M60A 2PFXA 1L0NJ 2J58A 5KAFV 5AW1B 2KNCA 3SXTA 1NTME 2HFED 3EQ2A 2A45I 1KQGB 2C1UA 1PGJA 4FA9A 1LWUA 2Z5HA 3LW5J 1GW3A 5TJHA 3CX5W 1SQVD 1IK9A 4A7PA 2O01H 1MG2D
chains in the Genus database with same CATH topology
3CX5D 1A2SA 1CHIA 2Y0CA 2QJPB 1RAPA 1YFCA 2Y0DA 3PH2B 4FAVA 1CO6A 2EXVA 3CXHD 3ZOYA 1I55A 4WQ8A 1YCCA 3TGUD 1CORA 1RZ6A 1CYIA 1M70A 1H31B 4N0KA 2GIWA 3PXTA 1B7VA 2JTIB 155CA 1SQQD 2V07A 4XYDB 3ZIYA 3RN1A 3O20A 3PLNA 4WQDA 2RN0A 3GW6A 4PJ0V 3WU2V 2C9XB 1QYZA 2JQRA 1H9XA 2CA4B 4AX3A 1N90A 1NTMD 1CSXA 4AAMA 3WFDC 2BCNB 2K9JB 1CRYA 1WVEC 3NBSA 3GG2A 2OZ1A 3MK7B 1NNOA 4IL6V 1QL4A 3FWLA 1DT1A 3H1HD 1YEAA 2ZXYA 1GU2A 2PCCB 3TDKA 4AALA 1KB0A 2BH4X 1DW0A 1OCDA 5EXQA 1HZVA 1ETPA 1COTA 1HH7A 1CSWA 3M97X 3O1YA 2C2CA 2GC4D 1FI9A 2CE0A 3HQ9A 1MZ4A 1SQXD 1LFMA 1CRHA 3SWSA 1KB9D 4GYDA 1AOQA 4WQCA 4PD4D 1IO3A 2YCCA 5KAIV 1N15A 1CTYA 1DIQC 1NTZD 2ZBOA 1CCRA 3ZCFA 2IBZD 5GTIV 2YIUB 2CE1A 1I6DA 5CYTR 2N18B 1DW2A 1N9CA 1CIGA 1H9YA 1CIFA 3H1KD 1F1CA 1L9BC 5E79V 3TF5A 1CHHA 2BH5X 1I6EA 3ITKA 2C1DA 1C2NA 2D0SA 2D0WA 1DVHA 1W5CT 1CHJA 2N18C 2HV4A 1S6VB 2ORLA 3RN0A 3X39A 4AAOA 1IQCA 1QKSA 1GKSA 1FOCA 351CA 3DP5A 3HQ8A 1YICA 3OCDB 1CCHA 4L3GA 1P84D 2N3BA 1E29A 3H1LD 1CSUA 5KLIB 2AI5A 2KNCB 4KMGA 1RAQA 1KYOD 1FI7A 4NFGB 3SLEA 1PPJD 1CTJA 2RMZA 1QL3A 1FCDC 1N50A 1LC1A 1FI3A 5CIHB 1PP9D 2PACA 4FA5A 2B4ZA 3CU4A 3WUIA 3L73D 1HZUA 1S5LV 1FHBA 1A56A 1C6SA 5DFSA 1ZRTD 5CIDB 3WFCC 1EZVD 1BCCD 1IRVA 3HQ6A 4H0KA 2B11B 3A0BV 1NIRA 1K3GA 1F1FA 2AXTV 4EIFA 2DVHA 1KX2A 2QJKB 5GTHV 1C7MA 3L71D 3L72D 1CC5A 1GQ1A 1NU1D 4MU8A 4EDFA 4YE1A 2I8FA 2OZ1B 1NMIA 4JCGA 1H32A 1NTKD 5B6QA 1LC2A 3JBTB 1BL9A 3OA8A 3VRDA 3PHLA 2LIRA 1E2RA 3SVWA 2N9JA 4L3HA 5C9MA 5C0ZA 3L74D 2FWLA 1CRJA 1LMSA 1NMLA 3H1ID 2FYUD 4L1QA 1AYGA 1AOFA 1YIQA 4UB8V 2JWAA 1I8OA 1ZZHA 1CNOA 3RLMA 1YTCA 4U3FD 3OA8B 3A0HV 1DIIC 1C75A 1CRIA 5H2FV 3PXSA 1CYJA 1GDVA 1HJ5A 3ZBMA 4V2KA 4J20A 5AURA 5CIGB 2BLFB 4QAOA 4D6TD 2FYNB 3L75D 4FANA 4H0JA 1L0LD 5KLVD 1CSVA 1CIHA 1SQBD 1SQPD 2C1DB 2KS1A 1I5TA 3WFEC 1CIEA 1W2LA 2DGEA 2LITA 5KKZB 1IZL0 3KZIV 1E8EA 3CYTI 2N9IA 2GC7D 1J3SA 1HCMA 2FRCA 5CIEB 4UB6V 1M6ZA 3CWBD 1YEBA 5B66V 3PTZA 2C1VA 451CA 4FB1A 1C6RA 1RZ5A 2PCBB 4WQEA 2B10B 3O5CA 4O1WA 1HJ3A 1U74B 4EICA 1HJ4A 2C8SA 1H31A 3CXHW 1CRCA 1KIBA 4WQ9A 3WC8A 3A9FA 3L4OA 1DW3A 2B0ZB 2CA3B 1IRWA 4WQBA 1EB7A 2CXBA 3KHUA 2BGVX 5CIFB 1C6OA 1OAEA 4K3IA 3ZOWA 3WFBC 2XTSB 3O0RC 1AKKA 1CTZA 1DVVA 1JDLA 1YNRA 4PWAA 1VYDA 1GJQA 3ZOXA 5IY51 1C52A 3RMZA 3VMAA 3PXWA 4FA1A 1BE3D 3PRJA 3ZOOA 4RSZA 2O3JA 1CXAA 2L4DA 2AIUA 4EIEA 1K3HA 1WEJF 4P4QB 3CP5A 3DMIA 2BCCD 4XXLA 3NBTA 2V08A 2YK3A 1GIWA 3NWVA 1FJ0A 2VHDA 3MK7C 3C2CA 3TYIA 2Q3EA 5CICB 1H32B 1HROA 2BPBB 1QN2A 2Y0EA 1H1OA 1CXCA 1H33A 2QJYB 2ZOOA 5DJQB 1I8PA 4PW9B 1HRCA 3VNWA 2N3YA 1CYCA 5DF5A 4GEDB 3HQ7A 2MTAC 4LJIA 3H1JD 1BGYD 2QG4A 3DR0A 2L91A 1L9JC 2N9YB 2GB8B 1H33B 2MHMA 1CRGA 1CEDA 1R0QA 5DJQC 3BCCD 4EIDA 1LS9A 1U75B 4WQ7A 5B5EV 4DY9A 1MG3D 4FA4A 4RJTA 4O1QA 5CIBB 1M60A 1KX7A 1DW1A 1C2RA 3OCDA 5KAFV 2YQBA 1KV9A 1I54A 3SJLA 2ZONG 2B12B 3SXTA 4AANA 3VYMA 3L4MA 3ORVA 3L70D 1L0ND 2C1UA 4FA9A 1A8CA 5TJHA 5TISV 1KYOW 3CX5W 1SQVD 4Q5PA 2A06D 4A7PA 4Y5RA 1MG2D 4WQAA 2ZZS1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 D;  1A2S A;  1CHI A;  2Y0C A;  2QJP B;  1RAP A;  1YFC A;  2Y0D A;  3PH2 B;  4FAV A;  1CO6 A;  2EXV A;  3CXH D;  3ZOY A;  1I55 A;  4WQ8 A;  1YCC A;  3TGU D;  1COR A;  1RZ6 A;  1CYI A;  1M70 A;  1H31 B;  4N0K A;  2GIW A;  3PXT A;  1B7V A;  2JTI B;  155C A;  1SQQ D;  2V07 A;  4XYD B;  3ZIY A;  3RN1 A;  3O20 A;  3PLN A;  4WQD A;  2RN0 A;  3GW6 A;  4PJ0 V;  3WU2 V;  2C9X B;  1QYZ A;  2JQR A;  1H9X A;  2CA4 B;  4AX3 A;  1N90 A;  1NTM D;  1CSX A;  4AAM A;  3WFD C;  2BCN B;  2K9J B;  1CRY A;  1WVE C;  3NBS A;  3GG2 A;  2OZ1 A;  3MK7 B;  1NNO A;  4IL6 V;  1QL4 A;  3FWL A;  1DT1 A;  3H1H D;  1YEA A;  2ZXY A;  1GU2 A;  2PCC B;  3TDK A;  4AAL A;  1KB0 A;  2BH4 X;  1DW0 A;  1OCD A;  5EXQ A;  1HZV A;  1ETP A;  1COT A;  1HH7 A;  1CSW A;  3M97 X;  3O1Y A;  2C2C A;  2GC4 D;  1FI9 A;  2CE0 A;  3HQ9 A;  1MZ4 A;  1SQX D;  1LFM A;  1CRH A;  3SWS A;  1KB9 D;  4GYD A;  1AOQ A;  4WQC A;  4PD4 D;  1IO3 A;  2YCC A;  5KAI V;  1N15 A;  1CTY A;  1DIQ C;  1NTZ D;  2ZBO A;  1CCR A;  3ZCF A;  2IBZ D;  5GTI V;  2YIU B;  2CE1 A;  1I6D A;  5CYT R;  2N18 B;  1DW2 A;  1N9C A;  1CIG A;  1H9Y A;  1CIF A;  3H1K D;  1F1C A;  1L9B C;  5E79 V;  3TF5 A;  1CHH A;  2BH5 X;  1I6E A;  3ITK A;  2C1D A;  1C2N A;  2D0S A;  2D0W A;  1DVH A;  1W5C T;  1CHJ A;  2N18 C;  2HV4 A;  1S6V B;  2ORL A;  3RN0 A;  3X39 A;  4AAO A;  1IQC A;  1QKS A;  1GKS A;  1FOC A;  351C A;  3DP5 A;  3HQ8 A;  1YIC A;  3OCD B;  1CCH A;  4L3G A;  1P84 D;  2N3B A;  1E29 A;  3H1L D;  1CSU A;  5KLI B;  2AI5 A;  2KNC B;  4KMG A;  1RAQ A;  1KYO D;  1FI7 A;  4NFG B;  3SLE A;  1PPJ D;  1CTJ A;  2RMZ A;  1QL3 A;  1FCD C;  1N50 A;  1LC1 A;  1FI3 A;  5CIH B;  1PP9 D;  2PAC A;  4FA5 A;  2B4Z A;  3CU4 A;  3WUI A;  3L73 D;  1HZU A;  1S5L V;  1FHB A;  1A56 A;  1C6S A;  5DFS A;  1ZRT D;  5CID B;  3WFC C;  1EZV D;  1BCC D;  1IRV A;  3HQ6 A;  4H0K A;  2B11 B;  3A0B V;  1NIR A;  1K3G A;  1F1F A;  2AXT V;  4EIF A;  2DVH A;  1KX2 A;  2QJK B;  5GTH V;  1C7M A;  3L71 D;  3L72 D;  1CC5 A;  1GQ1 A;  1NU1 D;  4MU8 A;  4EDF A;  4YE1 A;  2I8F A;  2OZ1 B;  1NMI A;  4JCG A;  1H32 A;  1NTK D;  5B6Q A;  1LC2 A;  3JBT B;  1BL9 A;  3OA8 A;  3VRD A;  3PHL A;  2LIR A;  1E2R A;  3SVW A;  2N9J A;  4L3H A;  5C9M A;  5C0Z A;  3L74 D;  2FWL A;  1CRJ A;  1LMS A;  1NML A;  3H1I D;  2FYU D;  4L1Q A;  1AYG A;  1AOF A;  1YIQ A;  4UB8 V;  2JWA A;  1I8O A;  1ZZH A;  1CNO A;  3RLM A;  1YTC A;  4U3F D;  3OA8 B;  3A0H V;  1DII C;  1C75 A;  1CRI A;  5H2F V;  3PXS A;  1CYJ A;  1GDV A;  1HJ5 A;  3ZBM A;  4V2K A;  4J20 A;  5AUR A;  5CIG B;  2BLF B;  4QAO A;  4D6T D;  2FYN B;  3L75 D;  4FAN A;  4H0J A;  1L0L D;  5KLV D;  1CSV A;  1CIH A;  1SQB D;  1SQP D;  2C1D B;  2KS1 A;  1I5T A;  3WFE C;  1CIE A;  1W2L A;  2DGE A;  2LIT A;  5KKZ B;  1IZL 0;  3KZI V;  1E8E A;  3CYT I;  2N9I A;  2GC7 D;  1J3S A;  1HCM A;  2FRC A;  5CIE B;  4UB6 V;  1M6Z A;  3CWB D;  1YEB A;  5B66 V;  3PTZ A;  2C1V A;  451C A;  4FB1 A;  1C6R A;  1RZ5 A;  2PCB B;  4WQE A;  2B10 B;  3O5C A;  4O1W A;  1HJ3 A;  1U74 B;  4EIC A;  1HJ4 A;  2C8S A;  1H31 A;  3CXH W;  1CRC A;  1KIB A;  4WQ9 A;  3WC8 A;  3A9F A;  3L4O A;  1DW3 A;  2B0Z B;  2CA3 B;  1IRW A;  4WQB A;  1EB7 A;  2CXB A;  3KHU A;  2BGV X;  5CIF B;  1C6O A;  1OAE A;  4K3I A;  3ZOW A;  3WFB C;  2XTS B;  3O0R C;  1AKK A;  1CTZ A;  1DVV A;  1JDL A;  1YNR A;  4PWA A;  1VYD A;  1GJQ A;  3ZOX A;  5IY5 1;  1C52 A;  3RMZ A;  3VMA A;  3PXW A;  4FA1 A;  1BE3 D;  3PRJ A;  3ZOO A;  4RSZ A;  2O3J A;  1CXA A;  2L4D A;  2AIU A;  4EIE A;  1K3H A;  1WEJ F;  4P4Q B;  3CP5 A;  3DMI A;  2BCC D;  4XXL A;  3NBT A;  2V08 A;  2YK3 A;  1GIW A;  3NWV A;  1FJ0 A;  2VHD A;  3MK7 C;  3C2C A;  3TYI A;  2Q3E A;  5CIC B;  1H32 B;  1HRO A;  2BPB B;  1QN2 A;  2Y0E A;  1H1O A;  1CXC A;  1H33 A;  2QJY B;  2ZOO A;  5DJQ B;  1I8P A;  4PW9 B;  1HRC A;  3VNW A;  2N3Y A;  1CYC A;  5DF5 A;  4GED B;  3HQ7 A;  2MTA C;  4LJI A;  3H1J D;  1BGY D;  2QG4 A;  3DR0 A;  2L91 A;  1L9J C;  2N9Y B;  2GB8 B;  1H33 B;  2MHM A;  1CRG A;  1CED A;  1R0Q A;  5DJQ C;  3BCC D;  4EID A;  1LS9 A;  1U75 B;  4WQ7 A;  5B5E V;  4DY9 A;  1MG3 D;  4FA4 A;  4RJT A;  4O1Q A;  5CIB B;  1M60 A;  1KX7 A;  1DW1 A;  1C2R A;  3OCD A;  5KAF V;  2YQB A;  1KV9 A;  1I54 A;  3SJL A;  2ZON G;  2B12 B;  3SXT A;  4AAN A;  3VYM A;  3L4M A;  3ORV A;  3L70 D;  1L0N D;  2C1U A;  4FA9 A;  1A8C A;  5TJH A;  5TIS V;  1KYO W;  3CX5 W;  1SQV D;  4Q5P A;  2A06 D;  4A7P A;  4Y5R A;  1MG2 D;  4WQA A;  2ZZS 1; 
#chains in the Genus database with same CATH topology
 1L4A B;  3L72 E;  2QJP B;  2KK7 A;  1ZW0 A;  1RE4 A;  1JY3 P;  2W8Z A;  5L8R J;  4FAV A;  1SQQ J;  2EXV A;  3CXH D;  3ZOY A;  4Y99 C;  1COR A;  3MD0 A;  1CYI A;  4RO0 A;  2AEJ A;  2WSC J;  1RF0 C;  1AQT A;  1AA0 A;  1T6A A;  1NTM J;  1BDD A;  3RK2 C;  2PGD A;  3UIA A;  3D0W A;  3O20 A;  2LR2 A;  5AVT B;  1MFZ A;  1LWU C;  3PLN A;  4WQD A;  1NKN A;  2JEE A;  3RGU A;  2CA4 B;  2D2C B;  2MJZ A;  3WFD C;  4H13 D;  3A0B H;  3H1K E;  4H44 B;  3CME P;  1URQ A;  1CRY A;  1WVE C;  3GG2 A;  1RE4 C;  3MK7 B;  1R8E A;  5GTH H;  3CCU P;  3PJS K;  1YI2 P;  4GT1 A;  4MN4 C;  1U7J A;  1OCD A;  4WY4 D;  1ETP A;  2W6A A;  3M97 X;  1FI9 A;  1NTZ J;  3BAS A;  1CRH A;  2R32 A;  2YNY A;  1KB9 D;  2KUB A;  1IO3 A;  1KFM A;  1FJK A;  5KAI V;  1N15 A;  5APW A;  1CTY A;  3H1K J;  3HTK B;  4I7Z B;  1URQ C;  2ZBO A;  1CCR A;  2YIU B;  1IZN B;  1FC2 C;  1USE A;  5CYT R;  2H89 C;  1DW2 A;  1N9C A;  1CIG A;  1HH0 A;  5E79 E;  1VQO P;  4N78 D;  1YJN P;  3ITK A;  1ZR2 A;  2OYI A;  1WRG A;  3L73 E;  2Z4E A;  3CXH H;  1M7L A;  3CCV P;  1BCC E;  3P8C E;  1GKS A;  4IFF A;  1Q2N A;  1MV8 A;  1ZME C;  3OCD B;  1CCH A;  4L3G A;  3JC2 2;  3H1L D;  1LTG C;  2AI5 A;  1KYO D;  4NFG B;  1L0L K;  2OYI C;  3QH9 A;  3AEB C;  3L73 J;  1T3U A;  2RMZ A;  1DD3 A;  1FCD C;  1KQL A;  3U1C A;  2IBZ G;  1FS0 E;  2FXO A;  2WQY C;  4OGQ D;  2B4Z A;  3T97 A;  1E5W A;  1HZU A;  2QE7 H;  1PGP A;  1A56 A;  4H13 C;  2LXC B;  5DFS A;  1ZRT D;  5CID B;  3PH0 A;  2CPB A;  2HPC B;  1KB9 H;  4L73 A;  4U7J A;  2B11 B;  3QWO C;  5AW0 B;  2FXP A;  1K3G A;  1SP4 A;  1NAY A;  4C46 A;  2OTJ P;  2V7Q H;  2DVH A;  5GTH E;  4WY4 C;  3CCL P;  1KX2 A;  3G6E P;  1GD2 E;  2KXP B;  3L71 D;  1IFM A;  1CC5 A;  1NU1 D;  1JY2 P;  1L0L E;  2BEQ D;  2KLV A;  1OVU A;  2OYH B;  4GOE A;  2W6J H;  3O8Z A;  1JCD A;  4JCG A;  3CWB G;  1H32 A;  5AW8 B;  3B5N A;  1H88 A;  2H7H A;  2YKO A;  3OA8 A;  3PHL A;  1DEE G;  1H0T B;  5CCG A;  1CW5 A;  2WPQ A;  3SVW A;  1GMJ A;  1PP9 G;  1GU5 A;  1EDK A;  1VQM P;  2ZVO B;  1NML A;  2FYZ A;  4L1Q A;  1YIQ A;  1I8O A;  2HOD B;  3VP9 A;  5APT A;  1YTC A;  4U3F D;  2ZT9 B;  1OXZ A;  4W7Y A;  1SQB J;  1QLE D;  1VDF A;  1KIL B;  1EZV G;  1HJ5 A;  3ZBM A;  1KYO H;  1FOS E;  5CIG B;  3MGN A;  2BLF B;  4QAO A;  4D6T D;  3L75 D;  4H0J A;  5KLV D;  1AJY A;  3MHV A;  1YQ3 C;  3CXH E;  2POH A;  2N1T B;  4KHX A;  4IOI H;  5CCH A;  5CCG C;  1I5T A;  1LNQ A;  4BRY B;  1FAV A;  1KOR A;  2DGE A;  3Q5R A;  1IZL 0;  1E8E A;  2IFM A;  1JY3 O;  1NJI Q;  5KAF H;  2FYN C;  3G9R A;  2FRC A;  2WPS A;  2B87 B;  3RL0 D;  3V4W A;  4UB6 V;  2HG5 D;  1M6Z A;  2WT7 B;  3CWB D;  1NTK G;  5B66 V;  2W27 A;  1L4A A;  4OWF A;  1BE3 E;  1Y47 A;  2C1V A;  4I1L A;  1YQ4 C;  2WWW A;  2E75 C;  2PAJ A;  3L74 G;  2PCB B;  1RQV A;  2NRG A;  1S4X A;  3V2N A;  4WQE A;  2V4H A;  2B10 B;  1S5L E;  1JEK A;  1HJ4 A;  2WPR A;  3A9F A;  1QEX A;  3VMY A;  1IRW A;  1N73 A;  2FKW B;  1IJD B;  1EB7 A;  4N6J A;  5AW3 B;  2R5D A;  3KHU A;  2BGV X;  5CIF B;  4PD4 H;  3IAO A;  3I56 P;  4R4M A;  1K73 Q;  3USS A;  1J1D B;  3FXD A;  2KB7 P;  1FDO A;  1L4A C;  1BE3 J;  2QJP C;  2JO1 A;  1AKK A;  2JR8 A;  1CTZ A;  3A7O A;  3S4R A;  1ZN5 A;  1GJQ A;  2YKP A;  2KLU A;  1GL2 D;  2ZXX A;  1T3J A;  1FZA A;  4EYY Q;  1R5L A;  3PXW A;  4HJG H;  4Y28 J;  1ZXG A;  3VTP C;  1VQ8 P;  1N7L A;  2P7J A;  3H1I J;  3BVH A;  1N73 C;  1FJP A;  1VQ7 P;  4P4Q B;  3DMI A;  1JO5 A;  2WPV B;  1LTI C;  3G71 P;  2V08 A;  3R2P A;  1SFC D;  2AXC A;  3HTK A;  1GIW A;  4H44 C;  1FJ0 A;  2A06 G;  3MK7 C;  1N8R Q;  1GU4 A;  3H1J J;  1QN2 A;  1YTZ I;  3AE8 C;  2V7Q J;  1H1O A;  3A0H E;  5KAI H;  3Q3D A;  5DJQ B;  3VNW A;  5H2F E;  3TSI A;  1SQP J;  4LJI A;  4H0L B;  4GOF A;  3TNU B;  3TGU G;  1BGY D;  2QG4 A;  4ASV A;  1JOC A;  1NAF A;  2MHM A;  3N4X A;  1CED A;  1NYH A;  1X9V A;  1VQN P;  2JJL A;  1LS9 A;  1KV4 A;  1VL2 A;  2WSF H;  3KDP B;  4O9B A;  1IFI A;  2K3R A;  4I7Z C;  3AEA C;  2G8Y A;  3KXD A;  2W6B A;  5KAF E;  3L70 J;  1C2R A;  2E76 D;  3OCD A;  3Q1M A;  1GK4 A;  2XDJ A;  1ZRT E;  3H32 B;  1I54 A;  3SJL A;  2KS1 B;  2ZON G;  1M90 Q;  1NO4 A;  3VYM A;  2H88 C;  3H1H G;  2KSJ A;  1RQU A;  2ZT9 D;  2BCC G;  1FOS F;  3D6Z A;  3SWF A;  2ZYD A;  3I5C A;  5TIS V;  2WIT A;  3CC7 P;  2A06 D;  3BAT A;  3G4S P;  1SQX G;  4WQA A;  2ZZS 1;  3CX5 D;  1A2S A;  2Y0C A;  1RAP A;  1IFN A;  2Y0D A;  2R44 A;  1LTT C;  1CO6 A;  1K04 A;  1YCC A;  3TGU D;  4Z1M H;  1PGO A;  1ZLL A;  4NPF X;  1M70 A;  4PD4 E;  1ZOY C;  2L5G B;  2GIW A;  4JBZ A;  2IBZ E;  5DJT B;  4KT0 J;  2RN0 A;  3RK2 D;  4PJ0 V;  1QYZ A;  3AE6 C;  3RK3 B;  2JQR A;  1H9X A;  1SLQ A;  3M9H A;  1RY3 A;  1GDT A;  4AAM A;  2Q6Q A;  1JNM A;  2IYP A;  5APQ A;  2OYH A;  1Q82 Q;  3FWL A;  1DT1 A;  3H1H D;  1VQ9 P;  1DW0 A;  2P58 A;  1H0T A;  2I8D A;  5EXQ A;  1SQV G;  2C2C A;  4WWI A;  3HQ9 A;  1MZ4 A;  1SQX D;  1Y8A A;  2E42 A;  2KP8 A;  3N7N A;  3SWS A;  2HOD A;  5KAI E;  2YCC A;  3U1A A;  3RBX A;  4DCK A;  1SVF A;  1DIQ C;  3AE2 C;  5AVW B;  2IZ0 A;  5GTI V;  2IDB A;  2OYH C;  3AED C;  2P10 A;  1KIL A;  2N18 B;  1CZQ A;  3IN6 A;  4M3L A;  4EOT A;  1H9Y A;  1CIF A;  4N3Y B;  1IK7 A;  1PP9 E;  1S9K D;  1I6E A;  2E76 C;  4BRY A;  1UII A;  1QL1 A;  3SFE C;  3HUS B;  2P1J A;  1L2P A;  1PV3 A;  1D7M A;  2MKV A;  3GHG B;  3X39 A;  5BVZ A;  4AAO A;  4ZMD A;  2ZT9 C;  2FFD B;  2LXB A;  1EZV E;  2WT7 A;  4C7N B;  1EQ7 A;  2HR3 A;  1FOC A;  5APY A;  1M1J B;  1KIL C;  1DIP A;  1EDI A;  1LT1 A;  351C A;  3DP5 A;  3HQ8 A;  2NPS B;  4UB6 H;  1ZP0 C;  1VQ6 P;  1CSU A;  5B66 H;  1FDI A;  1PP9 J;  1FI7 A;  3SLE A;  3GMA A;  1U57 A;  1QL3 A;  3KPE A;  2YMK A;  1N2D C;  5APX A;  1A02 F;  1LC1 A;  2Q9I A;  5CIH B;  3CD6 P;  2PAC A;  4FA5 A;  1NTK E;  2FYU G;  3WUI A;  1J1E B;  1M1K Q;  5CJ4 A;  3H25 A;  3V4Q A;  3KQG A;  2BAS A;  1YBK A;  1NHL A;  3L74 E;  4EIJ A;  1MFT A;  2JDI H;  3WMM 0;  2ZYG A;  3CI9 A;  1EXJ A;  1RH5 B;  2GUV A;  2E74 B;  2O1K A;  2OYO A;  3L72 J;  4IL6 E;  3SWY A;  1F1F A;  4NPD A;  2XNX A;  4PV1 B;  1ZR4 A;  4EIF A;  2QJK B;  1NTK J;  5APV A;  3AE9 C;  2I8F A;  1J1D C;  3H1L G;  1S2E A;  2KI7 B;  3L74 J;  3GF7 A;  1LC2 A;  1IFJ A;  1XTG B;  4ZKP A;  2R3C A;  2QM7 A;  3CL3 D;  4IFM A;  2KYV A;  2N9J A;  4L3H A;  3MTU E;  5BU5 A;  2FWL A;  2QM8 A;  4LC1 A;  3MUD A;  3H1I D;  2FYU D;  3TNU A;  2JP3 A;  3KYQ A;  4JYB A;  3VMZ A;  1ZZH A;  3RLM A;  2P2U A;  4RKU J;  4BWN A;  3U59 A;  2B89 A;  1C75 A;  2XV5 A;  3HD7 B;  1CRI A;  2A06 E;  1CYJ A;  5CBN A;  3CCR P;  3SFD C;  1OMI A;  1BDC A;  2WSS H;  3RBZ A;  1QL2 A;  4FAN A;  1AFO A;  1GW4 A;  2ZXE B;  3VP8 A;  1CIH A;  1SQX K;  3HE5 A;  1DD4 A;  1SQP D;  1S72 P;  3H32 A;  2KS1 A;  3B5N D;  3TGU E;  5KKZ B;  3MUD C;  3KZI V;  4HB1 A;  1LT9 B;  3L71 G;  4H0L C;  1NU1 G;  5CCG D;  2GC7 D;  1J3S A;  3MZW B;  1HCM A;  4UB6 E;  1G1I A;  5B66 E;  1WT6 A;  1YEB A;  4K3A A;  1OZH A;  3PTZ A;  451C A;  1MKM A;  5TIS H;  2C0X A;  4FB1 A;  1C6R A;  2Q1K A;  3F5H A;  3H1H E;  1BCC J;  4O1W A;  4EIC A;  2E75 D;  1JB0 J;  3CXH W;  1CRC A;  2BCC E;  1W2B O;  4U3F G;  2K37 A;  2NZ2 A;  1DW3 A;  5CCH D;  2CA3 B;  4L75 A;  2R3S A;  1AQ5 A;  2FXM A;  1SQX E;  5CBO A;  2IYO A;  2O01 J;  1C6O A;  1OAE A;  4K3I A;  4D6T G;  3L75 G;  1JTH A;  3A0B E;  1SQV K;  3WFB C;  1VF5 B;  3EFG A;  2XTS B;  5KLV G;  2PP6 A;  3BCC G;  4PJ0 H;  1QGK B;  1ZV8 A;  2C0W A;  1JDL A;  1YNR A;  3AEC C;  1T2K D;  1L4A D;  2XKM A;  1N7S B;  3O6Q B;  3ZOO A;  2O3J A;  2AEM A;  2BCC J;  4QMA A;  1FZB A;  4XFJ A;  3JSV C;  1K3H A;  3M9B A;  1DEB A;  3CP5 A;  1UIX A;  3RK3 C;  1GTW A;  4XXL A;  1Q81 Q;  3NBT A;  1PGQ A;  3NWV A;  2OGU A;  1JMB A;  2RKL A;  1HUC A;  3C2C A;  2E5T A;  1HRO A;  2D2C D;  1FBM A;  3B4S A;  4H44 D;  1H33 A;  1CXC A;  2ZOO A;  1PIX A;  4PW9 B;  1HRC A;  1L0L J;  2N3Y A;  1CYC A;  5DF5 A;  5GTI H;  1SQV E;  1NKZ B;  1FZC B;  2QA4 P;  3E1I A;  3HUS A;  2ZYA A;  3DR0 A;  2L91 A;  1L9J C;  3B5N C;  1CRG A;  3GF3 A;  2QJY C;  3BCC D;  3GHG A;  1OFC X;  1HJB A;  2FFD A;  4C7N A;  3M0D A;  5B5E V;  1M1J A;  1MG3 D;  2M3B A;  2QIW A;  1DW1 A;  2QEX P;  2NPS A;  3P7K A;  2YQB A;  3A3Y B;  2FYU K;  1KV9 A;  2B12 B;  4GOD A;  2Z5I A;  3ORV A;  3HUS C;  1L0N D;  3LID A;  1KYO W;  4Y99 B;  3C1L A;  5CCH C;  3GHG C;  2FFD C;  3LIE A;  2PRR A;  1FZG A;  2LKM A;  1M1J C;  2GUS A;  3SSU A;  3CC4 P;  1EDL A;  1NTZ G;  4WQ8 A;  2NPS C;  4I6M C;  5AW5 B;  1BGY G;  1RZ6 A;  1KB9 E;  4C7R A;  1USD A;  4N0K A;  1T2K C;  1B7V A;  2JTI B;  155C A;  1SQQ D;  2V07 A;  3ZIY A;  3RN1 A;  1LP1 B;  4PJ0 E;  3GW6 A;  1OIP A;  3WU2 V;  2FYU E;  3AEG C;  4AX3 A;  1N90 A;  1NTM D;  1WMK A;  3L4F A;  1CSX A;  4PD4 I;  1FZE A;  4N78 E;  1J1E C;  3NBS A;  1NNO A;  2IBZ I;  1OW8 A;  4NPE A;  2ZXY A;  2OAR A;  4AAL A;  2BH4 X;  2D2C C;  1LGH B;  3VMX A;  1URQ B;  3CLQ A;  1CI6 B;  1OX3 A;  1CSW A;  3O1Y A;  4ZKU A;  1G1J A;  4GYD A;  1AOQ A;  1PPJ G;  2QJK C;  3S9O A;  4B86 A;  3H1L E;  1NTZ D;  3HD7 A;  2N9B A;  1KYO E;  1NU1 K;  2CE1 A;  3EFF K;  2A45 G;  1TU3 F;  3H1K D;  1F1C A;  1L9B C;  1P84 I;  3CCQ P;  3TF5 A;  1CHH A;  1YTZ T;  4ASW A;  4YXW H;  2YIU C;  2E5Y A;  2ZJS E;  1DVH A;  1W5C T;  1LT9 A;  2YXQ B;  1KZU B;  2KZJ A;  1Q86 Q;  3R4Y A;  1S6V B;  4AYC A;  1IQC A;  3H1L J;  2OQQ A;  3KZI H;  2WTY A;  1QKS A;  3HD7 C;  2CK3 H;  1X0T A;  1YIC A;  2N3B A;  2ZAE B;  1E29 A;  1KIL D;  2GA1 A;  5KLI B;  1EZV I;  5AW4 B;  2WSC H;  1RAQ A;  3L71 E;  4L76 A;  5KLV K;  1NU1 E;  1PPJ D;  1A02 J;  1CTJ A;  1LT9 C;  1E79 H;  1LTJ B;  4H13 B;  2N1T D;  4XE5 B;  3FXE A;  1N50 A;  1FI3 A;  2Y9Y A;  2SPZ A;  2C9L Y;  2HPC A;  2CPS A;  3CU4 A;  1RF1 B;  3L73 D;  1S5L V;  3C8V A;  1R5S A;  2FBW C;  3D71 A;  4WY4 B;  2I1J A;  3OW2 O;  1BCC D;  1X8Y A;  3O6Q A;  1N7S A;  1IRV A;  3GLM A;  2M5A B;  3L71 J;  4U3F E;  3V5B A;  1NU1 J;  4H0K A;  1VQ4 P;  3W67 A;  4AQR D;  2BEZ F;  1SQB G;  1LTB C;  2AXT V;  1VQP P;  1PL5 A;  4D6T E;  3L75 E;  1C7M A;  1GQ1 A;  4MU8 A;  4EDF A;  5KLV E;  2OZ1 B;  3BCC E;  1VF5 C;  1AVY A;  1NMI A;  2HLO A;  2H8P D;  1PZQ A;  5B6Q A;  1SQQ K;  1OVR A;  1G2C B;  2LIR A;  1E2R A;  1LTA C;  4U3F J;  1RHZ B;  1FZC A;  5C9M A;  5C0Z A;  3CWB E;  1CRJ A;  1LMS A;  1NTM K;  1AOF A;  3OA7 A;  1AVO A;  4UB8 V;  3II6 A;  4D6T J;  3L75 J;  1KTM A;  3OA8 B;  3A0H V;  2N1T A;  2YXR B;  5H2F V;  2RH0 A;  4V2K A;  4J20 A;  3CX5 H;  4EI2 A;  5KTB A;  5AUR A;  2FYN B;  2R5B A;  1K9M Q;  5AW9 B;  1L0L D;  2B87 A;  1CSV A;  1HJ0 A;  1YIT P;  1SQB D;  2K9Y A;  4I2L C;  2J59 M;  2O01 N;  2C1D B;  3KZI E;  5M1B A;  5B5E H;  3Q5P A;  1FZC C;  3CWB J;  2LIT A;  4OGQ B;  3AE7 C;  3M06 A;  2A45 H;  1NTZ K;  1QX8 A;  3OAK A;  3NMD A;  5AVV B;  2YO2 A;  5CJ0 A;  4H0L D;  2N1T C;  3M91 A;  1RF0 A;  2WSF J;  4IFD K;  1BSH A;  3M0A A;  3F89 A;  1KQF B;  2K88 A;  2WSE H;  1RZ5 A;  4WVZ A;  3H1I G;  1QVG O;  2KIK A;  1HJ3 A;  3CCM P;  3FX0 A;  2B9B A;  2O1J A;  2C8S A;  1KIB A;  3WC8 A;  3L4O A;  4WQB A;  1OW7 A;  1LP1 A;  1EC5 A;  2CXB A;  1BSN A;  3H1J G;  3V6I A;  3ZOW A;  3NTN A;  1YYC A;  1FU1 A;  1NTZ E;  1MUU A;  3WU2 H;  1SQP G;  1N73 B;  1DVV A;  1RE3 A;  1BGY E;  4PWA A;  1HWT C;  4JQ0 D;  3ZOX A;  4HKZ H;  3TYY A;  5IY5 1;  4JYC A;  1C52 A;  2WZ7 A;  3VMA A;  3EWK A;  4FA1 A;  1BE3 D;  4YPC A;  4RSZ A;  1CXA A;  4RES B;  2L4D A;  1VQL P;  1CI6 A;  2AIU A;  4EIE A;  4TT3 H;  5AVX B;  3W68 A;  1FE6 A;  3L70 G;  1T8Z A;  1JY2 N;  4K35 A;  3AE4 C;  4BXL A;  3HRN A;  2HYN A;  2VHD A;  1OW6 A;  4L74 A;  3RK3 D;  2Q3E A;  2YKQ A;  5CIC B;  1OVV A;  1BGY J;  1RE3 C;  2Q7C A;  4LGD E;  1NOH A;  1I8P A;  3AE3 C;  2FY8 A;  3V2P A;  4GED B;  4AUW A;  1KIL E;  3CPW O;  3RL0 B;  1YJ9 P;  3H1J D;  3L36 A;  3CX5 E;  1VQK P;  1PPJ E;  5DJQ C;  1HGV A;  4EID A;  5C39 A;  1U75 B;  1DX7 A;  4WQ7 A;  5B5E E;  1EDJ A;  2OTK E;  1S1C X;  2WVR A;  1JM0 A;  4O1Q A;  1GZL A;  1KX7 A;  4W80 A;  3CXH I;  4WB4 A;  3OJA B;  3WUV A;  5DJU B;  4AAN A;  3B71 A;  2C9N Y;  2UWJ E;  5AVR B;  3L4M A;  3L70 D;  2I1K A;  1LTJ A;  3VYI A;  1A8C A;  1JUN A;  3L35 A;  4Q5P A;  3B8E B;  3TK1 A;  3CC2 P;  4Y5R A;  3TGU J;  4CPG A;  3M9Q A;  1CHI A;  1GK6 A;  1GL2 B;  1RF1 A;  1IO4 A;  1M56 D;  1SQB K;  1YFC A;  3PH2 B;  1H8A A;  2J5U A;  3IF4 A;  3ZDM A;  4DJG A;  1I55 A;  4WY4 A;  3G3Z A;  4JPZ B;  5KLI C;  1S5L H;  1H31 B;  2M5A A;  2NPS D;  3PXT A;  3VN0 A;  2WSE J;  4XYD B;  1W2E A;  1LTJ C;  3WU2 E;  2ZFC A;  1SFC B;  2W83 C;  2C9X B;  4OVN F;  3CCS P;  1KB9 I;  3H1H J;  2KOG A;  2KSE A;  2BCN B;  1K05 A;  2K9J B;  2P67 A;  1RF1 C;  3D6Y A;  2OZ1 A;  2AXT H;  1OWA A;  5KJ7 D;  1S9K E;  4IL6 V;  4GIF A;  1QL4 A;  3HE4 B;  1FZF A;  1SQX J;  1YEA A;  4LLH A;  1GU2 A;  2PCC B;  3TDK A;  3V2R A;  1KB0 A;  3CCE P;  2IFN A;  1L0N G;  1K8A Q;  1G2C A;  3FWN A;  3BRV B;  1HZV A;  1SQB E;  1COT A;  1HH7 A;  2GC4 D;  2ZVN B;  1KQS O;  2CE0 A;  1LFM A;  2E74 D;  1Y9B A;  4WQC A;  4PD4 D;  3C9I A;  2QVA A;  1S5L X;  1S3J A;  3NFQ A;  4PV1 D;  2E76 B;  3ZCF A;  2IBZ D;  2Q3I A;  4UB8 H;  1HGZ A;  3WUU A;  2M3E A;  1I6D A;  1JMM A;  4JF7 A;  3SWK A;  3A0H H;  1SQQ G;  1HVV A;  5AVU B;  1EXI A;  5H2F H;  3IR9 A;  5E79 V;  2JWD A;  2BH5 X;  3NXS A;  2C1D A;  1KYO I;  1C2N A;  1KD1 Q;  2D0S A;  2D0W A;  1FDM A;  1NTM G;  2XZR A;  1CHJ A;  1M8O B;  2N18 C;  2HV4 A;  5AVY B;  2ORL A;  1X79 B;  3RN0 A;  4DZO A;  1SQV J;  3BRT B;  4R4L A;  3MIW A;  4ZNC A;  3JCU H;  3L72 G;  1YHQ P;  4HYT B;  5TIS E;  3A2A A;  2QSI A;  3HD7 D;  1P84 D;  5KJ7 A;  2KNC B;  3E1R A;  2QRX A;  4KMG A;  3CCJ P;  3RK2 B;  3M0D C;  2E43 A;  4HH2 A;  1AV1 A;  1SQP K;  4OGQ C;  1LWU B;  1U7M A;  1PP9 D;  5AW7 B;  1YIJ P;  2B88 A;  1X22 A;  1FHB A;  3FGA D;  3H1K G;  1C6S A;  4XA4 A;  4DOJ A;  1J2J B;  3H1I E;  3RK3 E;  3IFM A;  3WFC C;  5AVQ B;  1EZV D;  5KJ7 C;  1M57 D;  3Q2Y A;  1HF9 A;  3P32 A;  3HQ6 A;  3AE1 C;  1HTL C;  3ABV C;  1IC2 A;  1NGM B;  3A0B V;  2AXT E;  1NIR A;  1N86 A;  3E7K A;  3H1J E;  5AW2 B;  2IZ1 A;  1XTC C;  3AE5 C;  5GTH V;  1KN7 A;  3A5T A;  3AEE C;  3L72 D;  4W7Z A;  2E74 C;  4YE1 A;  1SQP E;  2VRS A;  2GM4 A;  4PV1 C;  5CMZ A;  1NTK D;  2FYU J;  1VF5 D;  4KJM A;  3JBT B;  1BL9 A;  5AVZ B;  3VRD A;  3RL0 g;  5GTI E;  3L74 D;  1LTS C;  1IFD A;  4OH8 B;  1DH3 A;  1N7S D;  4UB8 E;  1Q7Y Q;  1AYG A;  1NWQ A;  2JWA A;  2K1A A;  2M0B A;  3L73 G;  1CNO A;  3L70 E;  2W90 A;  1JCC A;  1DII C;  1P84 H;  3PXS A;  1GDV A;  1BCC G;  1LJ2 A;  1QVF O;  3LW5 H;  2H43 A;  2WMM A;  2ITA A;  1HBW A;  2OYI B;  2M8R A;  3WFE C;  1CIE A;  1W2L A;  3RL0 C;  3JCU E;  4YXD C;  3CYT I;  2XU6 A;  2N9I A;  5CIE B;  3HE5 B;  4TLF A;  4DT0 A;  3D70 A;  1CSB A;  5KKZ C;  1GL2 A;  5AVS B;  3V2Q A;  3P8M C;  3CMA P;  3O5C A;  1IFP A;  1U74 B;  3I55 P;  1VQ5 P;  3Q5S A;  1H31 A;  4WQ9 A;  2IX7 C;  1JY3 N;  1YJW P;  2B0Z B;  3H6P A;  1SFC A;  3P8C D;  1L0N K;  3T97 B;  1JY2 O;  5K5G B;  1L0L G;  1Q90 D;  3O0R C;  2K9J A;  1GL2 C;  1Z56 A;  2YO3 A;  3HE4 A;  4GDO A;  1VYD A;  2XND H;  3VOP A;  2IPP A;  5APS A;  2AEF A;  3RMZ A;  3MP7 B;  1JTH B;  1NVO A;  3PRJ A;  4IL6 H;  2Y9Z A;  3PP5 A;  4YTP C;  4WBA A;  1WEJ F;  5CHX A;  1SFC C;  2KZI A;  1MZ9 A;  1N7S C;  1W5C E;  4GKG A;  2BCC D;  2Q5U A;  2YK3 A;  1KFN A;  2JKV A;  1KC8 Q;  3AEF C;  3TYI A;  2DW3 A;  1H32 B;  3B5N B;  2BPB B;  2Y0E A;  1L0N E;  2QJY B;  3L37 A;  1H89 A;  1VPC A;  5KLV J;  1P84 E;  5AW6 B;  3HQ7 A;  3BCC J;  2MTA C;  2OTL P;  5BU8 B;  2G3A A;  2N9Y B;  2GB8 B;  1H33 B;  1SS1 A;  1NH4 A;  1URQ D;  5E79 H;  1R0Q A;  1NTK K;  1PFI A;  5EFW B;  5APU A;  1KMI Z;  4IL6 X;  2YMY A;  3K5B A;  3S1K A;  3CX5 I;  4DY9 A;  4FA4 A;  3WUT A;  1SQQ E;  2E75 B;  4RJT A;  1BE3 G;  5CIB B;  1M60 A;  2PFX A;  1L0N J;  2J58 A;  5KAF V;  5AW1 B;  2KNC A;  3SXT A;  1NTM E;  2HFE D;  3EQ2 A;  2A45 I;  1KQG B;  2C1U A;  1PGJ A;  4FA9 A;  1LWU A;  2Z5H A;  3LW5 J;  1GW3 A;  5TJH A;  3CX5 W;  1SQV D;  1IK9 A;  4A7P A;  2O01 H;  1MG2 D; 
#chains in the Genus database with same CATH homology
 3CX5 D;  1A2S A;  1CHI A;  2Y0C A;  2QJP B;  1RAP A;  1YFC A;  2Y0D A;  3PH2 B;  4FAV A;  1CO6 A;  2EXV A;  3CXH D;  3ZOY A;  1I55 A;  4WQ8 A;  1YCC A;  3TGU D;  1COR A;  1RZ6 A;  1CYI A;  1M70 A;  1H31 B;  4N0K A;  2GIW A;  3PXT A;  1B7V A;  2JTI B;  155C A;  1SQQ D;  2V07 A;  4XYD B;  3ZIY A;  3RN1 A;  3O20 A;  3PLN A;  4WQD A;  2RN0 A;  3GW6 A;  4PJ0 V;  3WU2 V;  2C9X B;  1QYZ A;  2JQR A;  1H9X A;  2CA4 B;  4AX3 A;  1N90 A;  1NTM D;  1CSX A;  4AAM A;  3WFD C;  2BCN B;  2K9J B;  1CRY A;  1WVE C;  3NBS A;  3GG2 A;  2OZ1 A;  3MK7 B;  1NNO A;  4IL6 V;  1QL4 A;  3FWL A;  1DT1 A;  3H1H D;  1YEA A;  2ZXY A;  1GU2 A;  2PCC B;  3TDK A;  4AAL A;  1KB0 A;  2BH4 X;  1DW0 A;  1OCD A;  5EXQ A;  1HZV A;  1ETP A;  1COT A;  1HH7 A;  1CSW A;  3M97 X;  3O1Y A;  2C2C A;  2GC4 D;  1FI9 A;  2CE0 A;  3HQ9 A;  1MZ4 A;  1SQX D;  1LFM A;  1CRH A;  3SWS A;  1KB9 D;  4GYD A;  1AOQ A;  4WQC A;  4PD4 D;  1IO3 A;  2YCC A;  5KAI V;  1N15 A;  1CTY A;  1DIQ C;  1NTZ D;  2ZBO A;  1CCR A;  3ZCF A;  2IBZ D;  5GTI V;  2YIU B;  2CE1 A;  1I6D A;  5CYT R;  2N18 B;  1DW2 A;  1N9C A;  1CIG A;  1H9Y A;  1CIF A;  3H1K D;  1F1C A;  1L9B C;  5E79 V;  3TF5 A;  1CHH A;  2BH5 X;  1I6E A;  3ITK A;  2C1D A;  1C2N A;  2D0S A;  2D0W A;  1DVH A;  1W5C T;  1CHJ A;  2N18 C;  2HV4 A;  1S6V B;  2ORL A;  3RN0 A;  3X39 A;  4AAO A;  1IQC A;  1QKS A;  1GKS A;  1FOC A;  351C A;  3DP5 A;  3HQ8 A;  1YIC A;  3OCD B;  1CCH A;  4L3G A;  1P84 D;  2N3B A;  1E29 A;  3H1L D;  1CSU A;  5KLI B;  2AI5 A;  2KNC B;  4KMG A;  1RAQ A;  1KYO D;  1FI7 A;  4NFG B;  3SLE A;  1PPJ D;  1CTJ A;  2RMZ A;  1QL3 A;  1FCD C;  1N50 A;  1LC1 A;  1FI3 A;  5CIH B;  1PP9 D;  2PAC A;  4FA5 A;  2B4Z A;  3CU4 A;  3WUI A;  3L73 D;  1HZU A;  1S5L V;  1FHB A;  1A56 A;  1C6S A;  5DFS A;  1ZRT D;  5CID B;  3WFC C;  1EZV D;  1BCC D;  1IRV A;  3HQ6 A;  4H0K A;  2B11 B;  3A0B V;  1NIR A;  1K3G A;  1F1F A;  2AXT V;  4EIF A;  2DVH A;  1KX2 A;  2QJK B;  5GTH V;  1C7M A;  3L71 D;  3L72 D;  1CC5 A;  1GQ1 A;  1NU1 D;  4MU8 A;  4EDF A;  4YE1 A;  2I8F A;  2OZ1 B;  1NMI A;  4JCG A;  1H32 A;  1NTK D;  5B6Q A;  1LC2 A;  3JBT B;  1BL9 A;  3OA8 A;  3VRD A;  3PHL A;  2LIR A;  1E2R A;  3SVW A;  2N9J A;  4L3H A;  5C9M A;  5C0Z A;  3L74 D;  2FWL A;  1CRJ A;  1LMS A;  1NML A;  3H1I D;  2FYU D;  4L1Q A;  1AYG A;  1AOF A;  1YIQ A;  4UB8 V;  2JWA A;  1I8O A;  1ZZH A;  1CNO A;  3RLM A;  1YTC A;  4U3F D;  3OA8 B;  3A0H V;  1DII C;  1C75 A;  1CRI A;  5H2F V;  3PXS A;  1CYJ A;  1GDV A;  1HJ5 A;  3ZBM A;  4V2K A;  4J20 A;  5AUR A;  5CIG B;  2BLF B;  4QAO A;  4D6T D;  2FYN B;  3L75 D;  4FAN A;  4H0J A;  1L0L D;  5KLV D;  1CSV A;  1CIH A;  1SQB D;  1SQP D;  2C1D B;  2KS1 A;  1I5T A;  3WFE C;  1CIE A;  1W2L A;  2DGE A;  2LIT A;  5KKZ B;  1IZL 0;  3KZI V;  1E8E A;  3CYT I;  2N9I A;  2GC7 D;  1J3S A;  1HCM A;  2FRC A;  5CIE B;  4UB6 V;  1M6Z A;  3CWB D;  1YEB A;  5B66 V;  3PTZ A;  2C1V A;  451C A;  4FB1 A;  1C6R A;  1RZ5 A;  2PCB B;  4WQE A;  2B10 B;  3O5C A;  4O1W A;  1HJ3 A;  1U74 B;  4EIC A;  1HJ4 A;  2C8S A;  1H31 A;  3CXH W;  1CRC A;  1KIB A;  4WQ9 A;  3WC8 A;  3A9F A;  3L4O A;  1DW3 A;  2B0Z B;  2CA3 B;  1IRW A;  4WQB A;  1EB7 A;  2CXB A;  3KHU A;  2BGV X;  5CIF B;  1C6O A;  1OAE A;  4K3I A;  3ZOW A;  3WFB C;  2XTS B;  3O0R C;  1AKK A;  1CTZ A;  1DVV A;  1JDL A;  1YNR A;  4PWA A;  1VYD A;  1GJQ A;  3ZOX A;  5IY5 1;  1C52 A;  3RMZ A;  3VMA A;  3PXW A;  4FA1 A;  1BE3 D;  3PRJ A;  3ZOO A;  4RSZ A;  2O3J A;  1CXA A;  2L4D A;  2AIU A;  4EIE A;  1K3H A;  1WEJ F;  4P4Q B;  3CP5 A;  3DMI A;  2BCC D;  4XXL A;  3NBT A;  2V08 A;  2YK3 A;  1GIW A;  3NWV A;  1FJ0 A;  2VHD A;  3MK7 C;  3C2C A;  3TYI A;  2Q3E A;  5CIC B;  1H32 B;  1HRO A;  2BPB B;  1QN2 A;  2Y0E A;  1H1O A;  1CXC A;  1H33 A;  2QJY B;  2ZOO A;  5DJQ B;  1I8P A;  4PW9 B;  1HRC A;  3VNW A;  2N3Y A;  1CYC A;  5DF5 A;  4GED B;  3HQ7 A;  2MTA C;  4LJI A;  3H1J D;  1BGY D;  2QG4 A;  3DR0 A;  2L91 A;  1L9J C;  2N9Y B;  2GB8 B;  1H33 B;  2MHM A;  1CRG A;  1CED A;  1R0Q A;  5DJQ C;  3BCC D;  4EID A;  1LS9 A;  1U75 B;  4WQ7 A;  5B5E V;  4DY9 A;  1MG3 D;  4FA4 A;  4RJT A;  4O1Q A;  5CIB B;  1M60 A;  1KX7 A;  1DW1 A;  1C2R A;  3OCD A;  5KAF V;  2YQB A;  1KV9 A;  1I54 A;  3SJL A;  2ZON G;  2B12 B;  3SXT A;  4AAN A;  3VYM A;  3L4M A;  3ORV A;  3L70 D;  1L0N D;  2C1U A;  4FA9 A;  1A8C A;  5TJH A;  5TIS V;  1KYO W;  3CX5 W;  1SQV D;  4Q5P A;  2A06 D;  4A7P A;  4Y5R A;  1MG2 D;  4WQA A;  2ZZS 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...