3H1ID

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 63
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1iD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1iD02
1F1FA 1NTZD 3OA8A 4WQ7A 3KZIV 3C2CA 2CE1A 1CSXA 3DMIA 5CICB 3A0BV 2K9JB 3WFCC 1H31B 3PH2B 1PPJD 3RN1A 2JWAA 5GTIV 1FOCA 1CRGA 1FJ0A 5TJHA 4WQDA 4U3FD 1I55A 1H32B 2VHDA 2RMZA 3TF5A 1OCDA 4XXLA 3H1LD 3WC8A 4KMGA 3CX5W 3O1YA 1GU2A 2B12B 1BE3D 4K3IA 5AURA 1N90A 3HQ7A 1FI3A 3O0RC 1LC2A 4RSZA 3ZOYA 1YICA 3L4OA 1CTJA 3ZBMA 1QKSA 3PTZA 2GC4D 2QJPB 3HQ9A 4V2KA 1C6RA 1I5TA 3SJLA 1NIRA 1QN2A 4WQEA 3PXWA 1RAPA 2JTIB 3ZCFA 1I8PA 2N18B 3H1KD 2YK3A 4LJIA 2OZ1A 1IZL0 4RJTA 1C75A 2C1DA 2ZZS1 1OAEA 3OCDA 1KYOW 5DJQB 2XTSB 1RZ5A 1CORA 1CRYA 1K3HA 3L75D 1CCHA 1SQPD 1S5LV 1U75B 1NMLA 2FWLA 3HQ8A 1NTKD 1CIGA 1IO3A 2ZOOA 1HRCA 3M97X 5C0ZA 4EIFA 3SLEA 2JQRA 1WVEC 1W5CT 3VRDA 2QG4A 1YCCA 2EXVA 5KAIV 4PW9B 3RLMA 1M60A 2ZBOA 3KHUA 4FA1A 2V07A 1C2NA 3PLNA 1RZ6A 5CYTR 4IL6V 1CYIA 3L72D 1CHIA 4WQ9A 1CHHA 1HJ4A 1QL3A 1YEAA 1DW1A 1JDLA 1R0QA 1RAQA 1A56A 1ZRTD 2PCBB 4GEDB 5B5EV 3TGUD 2N18C 1AOQA 1KYOD 1CC5A 1GQ1A 1NTMD 3PRJA 5B6QA 3CWBD 3PXTA 5DJQC 3WU2V 1CRHA 4UB6V 2BCNB 3TDKA 4PWAA 2B0ZB 1MG2D 1W2LA 2N9IA 2YCCA 4L3HA 4WQ8A 3MK7B 2N3BA 1A2SA 1H33A 2GC7D 2B10B 4FAVA 1BL9A 2KS1A 1WEJF 4P4QB 1I54A 1CYJA 3H1HD 1CCRA 5CIBB 4A7PA 5EXQA 1DIQC 4O1WA 1C6OA 2N9JA 1NNOA 4FA4A 1BGYD 2BCCD 2GIWA 5IY51 2ZONG 3SWSA 1AKKA 1YTCA 4FA9A 5E79V 4Q5PA 1CSUA 4D6TD 3L74D 1KX7A 3ZOOA 3OA8B 1E29A 1QYZA 1L9JC 4EICA 5H2FV 1IRVA 1CRCA 1HJ3A 1N50A 4WQBA 3MK7C 1GJQA 5B66V 4H0KA 1HROA 3DR0A 2L91A 1CIFA 1CIEA 2GB8B 1DT1A 2BLFB 1KIBA 4MU8A 5KLIB 1SQBD 3A0HV 3VYMA 4GYDA 2PACA 4DY9A 2QJYB 4FB1A 2C8SA 2CA4B 1CIHA 4UB8V 1FI9A 1CSWA 4AALA 2AI5A 5KAFV 1KB0A 1M70A 1COTA 5DF5A 1NU1D 1KB9D 2C1VA 1I6EA 1BCCD 1F1CA 4O1QA 2ZXYA 3CXHW 4AX3A 2Y0EA 5CIHB 1H9YA 1QL4A 2Q3EA 1LS9A 2AIUA 2N9YB 3O20A 1CRIA 1C52A 2KNCB 3TYIA 2B4ZA 1P84D 1YNRA 1E2RA 1HZUA 4WQAA 1DVHA 2FYNB 1LFMA 1M6ZA 1SQXD 5CIGB 2OZ1B 1KX2A 5KLVD 1DIIC 2V08A 4QAOA 3WFDC 3WUIA 1N9CA 2C1DB 3NBSA 3OCDB 2ORLA 1H31A 2CXBA 1LMSA 1CXAA 1GDVA 4NFGB 2C2CA 2BPBB 4EDFA 1DW0A 1IRWA 2C1UA 2LIRA 1GKSA 1H32A 1AYGA 1HH7A 2BGVX 5CIEB 2FYUD 4AAOA 3CXHD 1CRJA 3PHLA 1L0LD 3RMZA 4FA5A 1YEBA 3HQ6A 3VMAA 3ZOXA 2DGEA 351CA 1SQVD 3O5CA 1I6DA 5C9MA 3JBTB 1ETPA 1CO6A 2LITA 3SXTA 3X39A 3WFEC 2C9XB 1H9XA 1DW3A 1GIWA 2YQBA 2D0WA 1LC1A 1CXCA 1YFCA 3ORVA 1B7VA 3GW6A 2D0SA 2BH4X 1S6VB 1CYCA 3NBTA 4PJ0V 2IBZD 4L3GA 5GTHV 3FWLA 1FI7A 4JCGA 3DP5A 1DW2A 4L1QA 1NMIA 2L4DA 1H1OA 2BH5X 2I8FA 4EIDA 5KKZB 2MHMA 1H33B 1CTZA 1EB7A 1N15A 4AAMA 1CTYA 3L70D 5CIFB 2CE0A 2MTAC 2QJKB 4N0KA 1J3SA 1C7MA 1AOFA 3ZIYA 1HJ5A 4J20A 3BCCD 3H1ID 155CA 1HZVA 3ITKA 3ZOWA 1VYDA 2Y0DA 1C6SA 2PCCB 3L73D 3CX5D 3VNWA 1KV9A 3RN0A 4Y5RA 1I8OA 1CHJA 2HV4A 3GG2A 1DVVA 1C2RA 1E8EA 1PP9D 4FANA 4AANA 3A9FA 4YE1A 4EIEA 1FCDC 1SQQD 2B11B 3CP5A 1MG3D 5CIDB 1L9BC 1CSVA 2FRCA 2YIUB 4WQCA 1U74B 4XYDB 5DFSA 3CYTI 2AXTV 1ZZHA 2A06D 1IQCA 1K3GA 5TISV 3H1JD 2DVHA 2O3JA 3PXSA 1A8CA 451CA 4PD4D 3WFBC 3SVWA 1CEDA 1L0ND 2CA3B 1EZVD 4H0JA 1HCMA 1FHBA 3L71D 2Y0CA 3CU4A 1MZ4A 1CNOA 2RN0A 2N3YA 1YIQA 3NWVA 3L4MA
chains in the Genus database with same CATH superfamily
3KZIV 2A45H 2CE1A 2IFMA 1NTKJ 1OW8A 1PPJD 2JWAA 5GTIV 5TJHA 4U3FD 2L5GB 1H32B 1FDMA 1R5LA 3L72J 2JKVA 1VQ7P 1S9KE 3WC8A 4IFFA 2JO1A 3CL3D 3FXEA 4K3IA 4DOJA 2Z5IA 1NTKE 2XNDH 5CBOA 1JMBA 1GL2B 4RSZA 3MD0A 3O8ZA 3ZBMA 2D2CC 1S5LE 3HQ9A 3WUUA 3VMYA 4IOIH 3L72E 3HTKB 4WQEA 3PXWA 2JTIB 3P8MC 1I8PA 4EYYQ 5APQA 4LJIA 1SQQK 1IZL0 2FBWC 4H13B 5KLVE 2JR8A 1JCDA 4RJTA 2IFNA 1M90Q 4HYTB 2ZZS1 2NPSA 5APVA 1OAEA 3V4WA 2I8DA 1KYOW 4KJMA 1PL5A 5B5EE 1CCHA 1SQPD 1S5LV 1U75B 3AEEC 1RF1C 2NPSD 4OWFA 2KXPB 2AXTH 2ZOOA 2QA4P 3SLEA 5AVTB 1W5CT 2QG4A 1YCCA 2P1JA 3WU2E 5AVSB 3CMAP 2XDJA 1C2NA 4WY4C 3M0AA 1S4XA 5DJTB 1CHHA 1JY2P 2P58A 2P7JA 5APXA 1DW1A 4PV1D 1R0QA 1VF5D 1NTZK 1ZRTD 5B5EV 1AFOA 2N18C 3AE8C 3M9HA 3L70J 1FDIA 2AEJA 5AVXB 3GMAA 4UB6H 4IFDK 1AVYA 3CCLP 1N73A 5B6QA 3CWBD 3NXSA 3WU2V 1CRHA 1GW4A 1BSNA 5GTIH 2N9IA 1N7LA 3H6PA 1MFTA 5E79E 3H1IJ 1FU1A 4WQ8A 3Q5RA 2N1TC 1BL9A 1EZVI 2KS1A 3IAOA 1GD2E 3L70E 1FOSF 1K9MQ 1C6OA 1HJ0A 2W8ZA 1NTKG 3L36A 1NNOA 2Q9IA 1FBMA 3NFQA 1Q82Q 1PGPA 1NU1G 1BGYD 2BCCD 2GIWA 3HUSB 1LJ2A 1IK9A 2B87B 2WZ7A 1R5SA 5APWA 3Q2YA 4Z1MH 3M9BA 1KILC 1AKKA 1YTCA 4Y28J 3RK2D 5E79V 5H2FH 3L72G 3H1IE 3L74D 1EQ7A 4UB8E 5KLVG 4WWIA 5B66H 3H1JJ 1IFIA 1ZMEC 3R4YA 1L9JC 1WT6A 5APYA 2CPBA 1CZQA 3P7KA 1N50A 4I6MC 2FYUJ 1AA0A 1L0NJ 4N3YB 2WTYA 1ZR2A 3DR0A 1CIEA 1DT1A 4MU8A 5KLIB 5CCGC 3RL0B 5KAFH 4FB1A 2C8SA 4YXWH 2CA4B 4UB8V 2E76C 1P84H 2WITA 1FI9A 3H1JE 1CSWA 4EOTA 1KB0A 1M70A 2VRSA 4AQRD 1NU1D 2I1KA 4EI2A 2FYUE 1F1CA 1LWUB 1L0NE 1HGVA 1EZVE 2K37A 3O20A 2W83C 3HD7B 3CX5I 3TYIA 2WPQA 2B4ZA 1P84D 3P8CD 1S3JA 3D6YA 2IX7C 3GLMA 1X9VA 2QEXP 5KLVD 2V08A 1RQVA 3WU2H 3WUIA 4CPGA 1OMIA 2K9JA 3OCDB 3VMXA 2RKLA 2Q5UA 4DT0A 1YBKA 2D2CD 3CD6P 1VQLP 2IBZE 2CXBA 1LMSA 1JTHB 4DZOA 2C2CA 2QJYC 1SLQA 1IFPA 1JCCA 4BRYB 1IRWA 1VPCA 3E7KA 4XA4A 3L70G 2BGVX 4ZKUA 4W7ZA 1BDCA 1SP4A 3RK3C 1RF1A 1MUUA 1USDA 1ZV8A 1EXIA 3O5CA 5C9MA 3H1IG 2LKMA 3Q1MA 2FYNC 5GTHH 1GIWA 4WY4A 1BSHA 1LC1A 3TK1A 5AVZB 2AEFA 3GW6A 3HE4A 2D0SA 4OGQC 1J1DB 1CYCA 1LT9C 1X8YA 1LTBC 2ZYAA 4L3GA 1RQUA 2P67A 4WY4D 1DW2A 1KQSO 1NMIA 2WSFH 3AE7C 2ZYGA 2C9NY 1AVOA 1H1OA 2E75D 2WSEH 3CX5E 5KKZB 1H33B 2YXQB 2HODB 2A45I 3LW5J 1CTYA 3H1JG 3L70D 2O01H 2RH0A 3CC4P 4UB8H 1NTMJ 1FZAA 2QJKB 4N0KA 4B86A 2N1TA 3NTNA 2FYUG 1L0NG 2HPCB 1EZVG 1X79B 1AOFA 2KNCA 3L71G 4NPFX 1KD1Q 1FZCC 2A06E 1HJ5A 4J20A 2N1TD 1KQFB 3ZDMA 2BEQD 3H1ID 3V6IA 5BVZA 1HZVA 1NYHA 3ZOWA 2Y0DA 1C6SA 1KILA 3H1HJ 1PGOA 1S5LX 4Y5RA 1NTME 4NPEA 3AEFC 3H25A 1KILD 3USSA 1PP9D 3G71P 4I1LA 2Q6QA 4YE1A 2IZ1A 1M1JB 2PGDA 3WMM0 2B11B 2YIUB 2E5YA 3CYTI 1Q81Q 1PPJE 1IQCA 3H1HE 5TISV 3H1JD 4KHXA 3SFDC 3HE5B 5CCGA 3UIAA 2HFED 2QVAA 2W6AA 451CA 3WFBC 1CEDA 1EDJA 1L0ND 3NMDA 2FXMA 1EZVD 1QVFO 1M57D 2WVRA 3L71D 5CCGD 2HG5D 3FWNA 3M0DC 1K04A 2E76D 1FZFA 4I7ZC 4H44C 3H1KG 3FXDA 2C0WA 4WQ7A 1SQPJ 2KI7B 1HF9A 2PFXA 3A0BV 3CLQA 2YKOA 1EC5A 3WFCC 3CXHI 1H31B 3RN1A 2ZT9C 4L76A 3AE3C 3RGUA 3IF4A 1CW5A 4XXLA 1FJPA 4KMGA 1SQXJ 2B12B 3JC22 2A06G 1SQPE 5AURA 1N90A 2Q3IA 1FI3A 1GMJA 1LC2A 1LNQA 3CWBJ 3ZOYA 5AW6B 1CTJA 1QKSA 4R4LA 1U57A 3PTZA 1I5TA 1NTMG 1NIRA 1D7MA 1ZLLA 5AVRB 2KUBA 3H1KD 1SQXE 3GHGC 1CSBA 2AXTE 3JCUH 1ZRTE 1C75A 2UWJE 2C1DA 1LT9A 5DJQB 1VQ9P 1CORA 2SPZA 3U1CA 1BGYJ 2BCCJ 3CWBE 1PPJG 1GZLA 3H1HG 1NMLA 3E1IA 3HQ8A 1U7MA 1JY3P 2G8YA 3AECC 1HRCA 2O1JA 2OYHC 2FFDB 4IL6H 1HH0A 4Y99C 3CXHE 5TISH 2EXVA 4PW9B 4AYCA 4BXLA 1NVOA 1RY3A 3F5HA 2A45G 3L74J 1M60A 2ZBOA 1J2JB 3B4SA 1HGZA 5AVYB 5M1BA 1X22A 1VL2A 5C39A 4UB6E 3LIDA 1CYIA 1ZN5A 1HJ4A 1VQNP 1R8EA 2PCBB 1BGYE 1PV3A 2BCCE 1HJBA 1H0TB 1FZCA 2B88A 1A02J 1GQ1A 1LTGC 1NTMD 3PRJA 2Q1KA 3PXTA 1LTJC 3A0BH 3L74E 4UB6V 1IJDB 1SFCC 2BCNB 2B0ZB 1L4AC 1MG2D 3M9QA 4GIFA 2ITAA 2YCCA 2WT7B 1YTZT 2N3BA 2ZXXA 3BASA 3LIEA 1NU1J 2GC7D 1I54A 3H1HD 1SQPG 4A7PA 1JO5A 5H2FE 2WPVB 1L2PA 4QMAA 2KOGA 3S1KA 1J1EB 5B66E 4RESB 2K1AA 1M7LA 2ZONG 2WPSA 5KLVJ 5AW3B 3VOPA 1QVGO 3HTKA 1JUNA 5AVQB 1N2DC 3B5NC 1SQXG 1NU1E 2YMKA 1QYZA 1KC8Q 5H2FV 4EICA 2JJLA 3M0DA 4H0LC 5KAFE 3Q5PA 1HJ3A 4GOEA 5AW8B 4WQBA 3MK7C 1RE3C 3CWBG 1NTKK 5B66V 3A0HH 1DEBA 1P84E 3P8CE 4H0KA 1VQPP 3FGAD 5CJ0A 3D70A 1W2BO 3CCEP 2GB8B 3SWFA 2B9BA 1KIBA 4RO0A 3A7OA 4XE5B 1SQBD 4H44D 1A02F 1NOHA 1L0LG 4DY9A 1G2CA 4AALA 1J1DC 2AI5A 5KAFV 2ZT9D 1COTA 5AVWB 3V5BA 3GF3A 2YKQA 3D71A 1BGYG 4AX3A 2BCCG 5CIHB 1H9YA 2OARA 1C52A 5CMZA 1IFMA 4WB4A 1FOSE 4L75A 1HTLC 4YTPC 3G4SP 1YNRA 1E2RA 4HKZH 2PP6A 1M6ZA 1SQXD 3L74G 3CXHH 1EXJA 1KX2A 1DIIC 2WQYC 3GF7A 1N9CA 2M5AA 3NBSA 4IFMA 3TYYA 1KFNA 3I56P 2NPSB 1N8RQ 2QJKC 2WSFJ 5K5GB 3AEGC 2P2UA 3EWKA 3GHGA 1CXAA 2WSEJ 3F89A 3MUDC 1NAYA 4ASWA 1IFDA 3A3YB 3CXHD 2JWDA 5GTHE 1L0LD 4PV1B 1VF5B 3WUTA 2O01J 1YEBA 3HQ6A 1DH3A 4N78D 3VMAA 1KFMA 2R32A 1BE3E 2WSSH 2OYHA 2R3CA 1KORA 1ZR4A 1SQVD 3EFGA 3X39A 1URQC 2OGUA 1IZNB 1YJNP 1PP9J 5APTA 2NZ2A 3ORVA 2N9BA 1B7VA 2E43A 1USEA 2BH4X 1CI6A 3NBTA 1N73B 2IZ0A 1SVFA 5GTHV 1OW7A 1MV8A 1YITP 4U7JA 2L4DA 2WSCH 1SQQG 1EDLA 4EIDA 4MN4C 3BRTB 1LTJA 4HB1A 1KILE 1SFCA 2KS1B 1NGMB 1L4AA 4AAMA 1PP9E 3L71J 3C1LA 2ZVNB 2XZRA 3CCQP 4K35A 2CE0A 2MTAC 2YKPA 3RK2B 1SFCD 1ZOYC 1L4AD 1YI2P 2KZJA 3RBXA 3PH0A 1N7SC 1JM0A 4JBZA 4K3AA 2KK7A 1OFCX 1LTSC 2PCCB 5APSA 2V7QH 3IN6A 3L71E 3KXDA 2YMYA 3B5NA 1DVVA 4ZMDA 4BRYA 2Z4EA 2FKWB 4FANA 3A9FA 2FYUK 5AW9B 1JMMA 1SQQD 5CIDB 3B5ND 1CSVA 1Y47A 1UIXA 3CC7P 2R44A 1RE3A 4WQCA 2OYIC 3C8VA 4H0LD 1BE3G 2XV5A 1VDFA 1FS0E 3QH9A 1YIJP 1AV1A 1ZP0C 3C9IA 3WUVA 3O6QA 2CA3B 3CCRP 3H1KJ 2J59M 1CNOA 2C0XA 4C7NA 5CBNA 2LXCB 3L4MA 4JYCA 1F1FA 2D2CB 1NTZD 3OA8A 3C2CA 5BU5A 2W6BA 2K9JB 3PH2B 1TU3F 3AE2C 3L75G 1FOCA 1CRGA 3RK3E 4DCKA 4WQDA 4C46A 1PGJA 1PP9G 2ZAEB 3H1KE 2RMZA 1OCDA 1VQMP 2JEEA 2KP8A 1JY3O 1ZW0A 3CX5W 1Q2NA 2POHA 3G6EP 1PZQA 1RF1B 1QL2A 3MUDA 1BE3D 4L74A 2E74C 3O0RC 3SFEC 3V4QA 1YICA 3JCUE 3TGUG 4WY4B 3L35A 3V2PA 2GC4D 2QJPB 3HE4B 1FZEA 1QN2A 2E75B 1URQA 1RAPA 5KAIE 3ZCFA 2N18B 2OZ1A 2JDIH 4IL6E 3CC2P 1URQD 5TISE 1GK6A 2BEZF 3V2NA 1H88A 1J1EC 3L75D 1NH4A 5AVVB 2FWLA 1IO3A 2DW3A 3M97X 5C0ZA 3CMEP 1FZGA 1WVEC 3VRDA 2N1TB 5KAIV 3RLMA 1GL2C 4I2LC 1NTMK 1WMKA 3PLNA 2E42A 4C7RA 4IL6V 3CCVP 3EFFK 1CHIA 1QL3A 3TNUA 3I5CA 1RAQA 3A0BE 1A56A 2IPPA 4HJGH 4GEDB 1WRGA 1KILB 3TGUD 1AOQA 3B8EB 4H13C 5DJUB 1N7SA 3II6A 2MJZA 3OJAB 4YXDC 1CC5A 4JQ0D 1SQBJ 3KDPB 2AXCA 4ASVA 1MZ9A 1N7SD 2GUVA 2ZVOB 3S9OA 3TDKA 4PWAA 5L8RJ 1W2LA 1KZUB 3BCCJ 4L3HA 2QE7H 3VMZA 3MZWB 4PD4I 1T3JA 1OVRA 3AE6C 2LXBA 1NKNA 3L73J 2B10B 4FAVA 1WEJF 4P4QB 1CYJA 1CCRA 1IFJA 1DIQC 4O1WA 3KYQA 2N9JA 3M91A 4FA4A 1T2KC 1SQBE 2OYIA 1BCCG 4LGDE 2E76B 1YYCA 1OX3A 3SWSA 4FA9A 1NWQA 1XTGB 3T97A 3BCCE 3VYIA 4D6TD 2I1JA 3A0HE 1G1JA 3ZOOA 2CPSA 1JY2O 3L73E 1XTCC 3VTPC 3SWYA 3H32A 1AQTA 3CCJP 1IRVA 1CRCA 1SQPK 2ZYDA 1GJQA 3RK3D 1L0LJ 1HROA 1KB9H 1FDOA 5AW0B 3CPWO 2B89A 1SQVJ 3MP7B 3A0HV 1JNMA 4LLHA 1DIPA 2QJYB 3HUSC 1KQGB 5AVUB 5KAIH 4OGQD 1Y9BA 1BDDA 1KB9D 4BWNA 1BCCD 2HLOA 2ZXYA 3CXHW 2Y0EA 2BASA 3E1RA 1L0LE 2Q3EA 3PP5A 1M1KQ 2AIUA 1CRIA 4N78E 1YJ9P 2K88A 1SQVE 1LP1A 4WQAA 5AW2B 2FYNB 1LFMA 2E74D 1VQOP 4QAOA 2C1DB 3U59A 1LT9B 2KIKA 2WT7A 5KLIC 1Z56A 1OZHA 3RL0C 2WSCJ 2KSEA 1GDVA 2BPBB 2O1KA 4EDFA 1DW0A 1PIXA 2C1UA 2LIRA 1GKSA 3VN0A 1H32A 1AYGA 1HH7A 2XU6A 5CIEB 4AAOA 1H8AA 1YHQP 1CRJA 2Z5HA 1SQBG 3A2AA 3AEBC 1K73Q 2M3EA 1LWUC 3S4RA 4TLFA 3ZOXA 1KYOI 351CA 1G1IA 3MIWA 2OQQA 3HD7C 3BCCG 3JBTB 1GL2A 3SXTA 4PJ0H 3WFEC 2C9XB 3L73G 2YQBA 1HBWA 1FE6A 3AE4C 1FZCB 2WWWA 1CXCA 1S6VB 1GL2D 1NHLA 1SQQJ 3A5TA 3FWLA 1FI7A 1M8OB 3DP5A 2V7QJ 2W6JH 1M56D 1GK4A 1YQ4C 2H8PD 2CK3H 1VQKP 4YPCA 3KQGA 2V4HA 4H13D 1CTZA 4HH2A 1NJIQ 2E5TA 3N7NA 2R5DA 1EB7A 4WVZA 1FC2C 5CIFB 1NU1K 4JYBA 1FJKA 1SQQE 4ZKPA 1VQ6P 2YO2A 2ZFCA 1J3SA 2K3RA 4JPZB 5AW4B 1C7MA 3ZIYA 2Q7CA 1NTZJ 2Y9ZA 1U7JA 1DX7A 2H43A 2W27A 3BCCD 2QSIA 1SQVG 155CA 4W80A 2W90A 5KLVK 1DD3A 1VYDA 3L73D 3BATA 1T2KD 1KYOE 1KV9A 1LT1A 2Y9YA 1I8OA 1KN7A 2HV4A 4I7ZB 4H44B 1PFIA 5KKZC 1C2RA 2IYOA 1E8EA 1RF0C 1JOCA 3B71A 4PD4H 4AANA 4EIEA 1NTZE 1BE3J 1FCDC 1IO4A 1MG3D 3H1LG 1OVVA 4IL6X 2ZT9B 1U74B 3FX0A 1ZZHA 1YTZI 2QJPC 1G2CB 1HVVA 2O3JA 3N4XA 3AE5C 2E75C 1A8CA 1VQ8P 2WPRA 4PD4D 2IYPA 2PAJA 1E79H 3SVWA 3HUSA 4OVNF 2B87A 2JP3A 1HCMA 3VP8A 1FAVA 1T8ZA 3KZIH 2GA1A 1RE4C 2QIWA 1IK7A 2GUSA 3L75J 2KYVA 1CSXA 3DMIA 2M5AB 5CICB 1M1JC 4L73A 2KLUA 3GHGB 2YIUC 1FJ0A 1QLED 3ABVC 1S1CX 2G3AA 1I55A 2VHDA 1SS1A 3TF5A 1VQ4P 3H1LD 1KV4A 1NKZB 3O1YA 3MTUE 1GU2A 3KPEA 3L75E 3TGUJ 2OYHB 1YQ3C 3RL0D 1JEKA 2WMMA 3HQ7A 4Y99B 2IBZI 2XKMA 3AEDC 3RBZA 1LWUA 3L4OA 1N86A 2K9YA 1S2EA 3CCMP 1CI6B 1HUCA 4V2KA 3HD7A 1C6RA 2FYZA 3SJLA 1OVUA 3TSIA 2YK3A 3HD7D 1NTZG 3TGUE 1S5LH 1S9KD 2KLVA 3OCDA 4GODA 1LTJB 2XTSB 1RZ5A 1CRYA 1K3HA 1QL1A 1JTHA 1SFCB 1NAFA 1L4AB 1NTKD 1CIGA 5EFWB 1KQLA 1HWTC 4EIFA 1YJWP 1L0NK 2JQRA 1Q86Q 3D6ZA 1KYOH 4D6TJ 2KZIA 1KB9I 3KHUA 1KTMA 4FA1A 2M3BA 2V07A 5B5EH 1QX8A 1RZ6A 5CYTR 3L72D 4WQ9A 2R5BA 1YEAA 1JDLA 2HYNA 3K5BA 3QWOC 1KYOD 3MGNA 2IDBA 3B5NB 5DJQC 3OW2O 3U1AA 4D6TE 1W5CE 3PJSK 1QEXA 2FXPA 4H0LB 4R4MA 1QGKB 5KTBA 4KT0J 3P32A 2FFDC 3MK7B 1A2SA 1H33A 2FY8A 1BCCJ 1RF0A 2HODA 1JY3N 5CIBB 4WBAA 2H7HA 5EXQA 2LR2A 3AEAC 5E79H 5APUA 1Y8AA 2C9LY 5IY51 4O9BA 2HPCA 3O6QB 2OTKE 3Q5SA 3Q3DA 4C7NB 4Q5PA 1CSUA 1GU4A 1KX7A 1KB9E 2MKVA 1PGQA 3OA8B 1BCCE 1OXZA 1E29A 1Q7YQ 1EDKA 1RE4A 3VP9A 3L37A 3OAKA 1AQ5A 4TT3H 1LTAC 2AEMA 1OW6A 3CI9A 1IFNA 2L91A 5KJ7C 1CIFA 2P10A 1RHZB 5BU8B 2BLFB 1M1JA 3V2RA 5CCHC 3I55P 3MHVA 3VYMA 1EDIA 4GYDA 2PACA 3RL0g 4GKGA 1CIHA 5CHXA 1IC2A 1T6AA 2YO3A 3CCSP 1MFZA 2ZXEB 3HE5A 5DF5A 2ZJSE 2QM7A 2C1VA 1I6EA 4O1QA 4U3FJ 1QL4A 1GDTA 5AW1B 1LS9A 2N9YB 2KNCB 2IBZG 4GOFA 1GU5A 3AE9C 1URQB 1HZUA 2KSJA 1DVHA 3R2PA 4D6TG 3OA7A 5CIGB 2OZ1B 3V2QA 2H89C 4W7YA 4GDOA 3WFDC 1LTIC 2ORLA 4GT1A 1LGHB 1Q90D 3D0WA 1H31A 5AW5B 4NFGB 1VQ5P 4U3FE 2NRGA 3IR9A 2FYUD 1GTWA 4PJ0E 3PHLA 3RMZA 4FA5A 2GM4A 2QRXA 3L4FA 5AW7B 2DGEA 1UIIA 3TNUB 1I6DA 2H88C 4N6JA 4EIJA 3W67A 1ETPA 1CO6A 2LITA 2QM8A 2M8RA 1H9XA 2J58A 1DW3A 4RKUJ 2D0WA 2OYOA 4M3LA 1YFCA 1N7SB 1H89A 3W68A 1FZBA 1T3UA 2NPSC 4PJ0V 2IBZD 1JY2N 1DEEG 4JCGA 1RH5B 2OTLP 4L1QA 1NO4A 2PRRA 1SQBK 2HR3A 2M0BA 2O01N 2BH5X 2I8FA 4AUWA 3M06A 2MHMA 3G9RA 1KMIZ 4PV1C 1VF5C 2R3SA 2XNXA 1N15A 3AE1C 4DJGA 1MKMA 2FXOA 2FFDA 3CX5H 2OYIB 3BVHA 1K05A 3HRNA 3JSVC 5CJ4A 3T97B 1SQXK 2YNYA 1N73C 3ITKA 1JB0J 1OIPA 4PD4E 1ZXGA 1H0TA 4LC1A 3RK3B 3CX5D 3H32B 1E5WA 3VNWA 3RN0A 1K8AQ 2J5UA 3H1LJ 1CHJA 3GG2A 3EQ2A 2KB7P 4U3FG 3G3ZA 4XFJA 4ZNCA 1S72P 3CP5A 3LW5H 3SSUA 4OGQB 1L0LK 1L9BC 2FRCA 4XYDB 3RK2C 5DFSA 3CCUP 2OTJP 2AXTV 3SWKA 3IFMA 4OH8B 2A06D 1DD4A 1SQVK 3BRVB 5KJ7A 1K3GA 3KZIE 2DVHA 5CCHA 1AJYA 3PXSA 1GW3A 4JF7A 1P84I 3H1LE 5KJ7D 1LTTC 5GTIE 1OWAA 2YXRB 4H0JA 5CCHD 1FHBA 2Y0CA 3CU4A 1MZ4A 2E74B 1X0TA 2RN0A 2N3YA 1W2EA 4NPDA 1YIQA 1LP1B 3NWVA
chains in the Genus database with same CATH topology
1F1FA 1NTZD 3OA8A 4WQ7A 3KZIV 3C2CA 2CE1A 1CSXA 3DMIA 5CICB 3A0BV 2K9JB 3WFCC 1H31B 3PH2B 1PPJD 3RN1A 2JWAA 5GTIV 1FOCA 1CRGA 1FJ0A 5TJHA 4WQDA 4U3FD 1I55A 1H32B 2VHDA 2RMZA 3TF5A 1OCDA 4XXLA 3H1LD 3WC8A 4KMGA 3CX5W 3O1YA 1GU2A 2B12B 1BE3D 4K3IA 5AURA 1N90A 3HQ7A 1FI3A 3O0RC 1LC2A 4RSZA 3ZOYA 1YICA 3L4OA 1CTJA 3ZBMA 1QKSA 3PTZA 2GC4D 2QJPB 3HQ9A 4V2KA 1C6RA 1I5TA 3SJLA 1NIRA 1QN2A 4WQEA 3PXWA 1RAPA 2JTIB 3ZCFA 1I8PA 2N18B 3H1KD 2YK3A 4LJIA 2OZ1A 1IZL0 4RJTA 1C75A 2C1DA 2ZZS1 1OAEA 3OCDA 1KYOW 5DJQB 2XTSB 1RZ5A 1CORA 1CRYA 1K3HA 3L75D 1CCHA 1SQPD 1S5LV 1U75B 1NMLA 2FWLA 3HQ8A 1NTKD 1CIGA 1IO3A 2ZOOA 1HRCA 3M97X 5C0ZA 4EIFA 3SLEA 2JQRA 1WVEC 1W5CT 3VRDA 2QG4A 1YCCA 2EXVA 5KAIV 4PW9B 3RLMA 1M60A 2ZBOA 3KHUA 4FA1A 2V07A 1C2NA 3PLNA 1RZ6A 5CYTR 4IL6V 1CYIA 3L72D 1CHIA 4WQ9A 1CHHA 1HJ4A 1QL3A 1YEAA 1DW1A 1JDLA 1R0QA 1RAQA 1A56A 1ZRTD 2PCBB 4GEDB 5B5EV 3TGUD 2N18C 1AOQA 1KYOD 1CC5A 1GQ1A 1NTMD 3PRJA 5B6QA 3CWBD 3PXTA 5DJQC 3WU2V 1CRHA 4UB6V 2BCNB 3TDKA 4PWAA 2B0ZB 1MG2D 1W2LA 2N9IA 2YCCA 4L3HA 4WQ8A 3MK7B 2N3BA 1A2SA 1H33A 2GC7D 2B10B 4FAVA 1BL9A 2KS1A 1WEJF 4P4QB 1I54A 1CYJA 3H1HD 1CCRA 5CIBB 4A7PA 5EXQA 1DIQC 4O1WA 1C6OA 2N9JA 1NNOA 4FA4A 1BGYD 2BCCD 2GIWA 5IY51 2ZONG 3SWSA 1AKKA 1YTCA 4FA9A 5E79V 4Q5PA 1CSUA 4D6TD 3L74D 1KX7A 3ZOOA 3OA8B 1E29A 1QYZA 1L9JC 4EICA 5H2FV 1IRVA 1CRCA 1HJ3A 1N50A 4WQBA 3MK7C 1GJQA 5B66V 4H0KA 1HROA 3DR0A 2L91A 1CIFA 1CIEA 2GB8B 1DT1A 2BLFB 1KIBA 4MU8A 5KLIB 1SQBD 3A0HV 3VYMA 4GYDA 2PACA 4DY9A 2QJYB 4FB1A 2C8SA 2CA4B 1CIHA 4UB8V 1FI9A 1CSWA 4AALA 2AI5A 5KAFV 1KB0A 1M70A 1COTA 5DF5A 1NU1D 1KB9D 2C1VA 1I6EA 1BCCD 1F1CA 4O1QA 2ZXYA 3CXHW 4AX3A 2Y0EA 5CIHB 1H9YA 1QL4A 2Q3EA 1LS9A 2AIUA 2N9YB 3O20A 1CRIA 1C52A 2KNCB 3TYIA 2B4ZA 1P84D 1YNRA 1E2RA 1HZUA 4WQAA 1DVHA 2FYNB 1LFMA 1M6ZA 1SQXD 5CIGB 2OZ1B 1KX2A 5KLVD 1DIIC 2V08A 4QAOA 3WFDC 3WUIA 1N9CA 2C1DB 3NBSA 3OCDB 2ORLA 1H31A 2CXBA 1LMSA 1CXAA 1GDVA 4NFGB 2C2CA 2BPBB 4EDFA 1DW0A 1IRWA 2C1UA 2LIRA 1GKSA 1H32A 1AYGA 1HH7A 2BGVX 5CIEB 2FYUD 4AAOA 3CXHD 1CRJA 3PHLA 1L0LD 3RMZA 4FA5A 1YEBA 3HQ6A 3VMAA 3ZOXA 2DGEA 351CA 1SQVD 3O5CA 1I6DA 5C9MA 3JBTB 1ETPA 1CO6A 2LITA 3SXTA 3X39A 3WFEC 2C9XB 1H9XA 1DW3A 1GIWA 2YQBA 2D0WA 1LC1A 1CXCA 1YFCA 3ORVA 1B7VA 3GW6A 2D0SA 2BH4X 1S6VB 1CYCA 3NBTA 4PJ0V 2IBZD 4L3GA 5GTHV 3FWLA 1FI7A 4JCGA 3DP5A 1DW2A 4L1QA 1NMIA 2L4DA 1H1OA 2BH5X 2I8FA 4EIDA 5KKZB 2MHMA 1H33B 1CTZA 1EB7A 1N15A 4AAMA 1CTYA 3L70D 5CIFB 2CE0A 2MTAC 2QJKB 4N0KA 1J3SA 1C7MA 1AOFA 3ZIYA 1HJ5A 4J20A 3BCCD 3H1ID 155CA 1HZVA 3ITKA 3ZOWA 1VYDA 2Y0DA 1C6SA 2PCCB 3L73D 3CX5D 3VNWA 1KV9A 3RN0A 4Y5RA 1I8OA 1CHJA 2HV4A 3GG2A 1DVVA 1C2RA 1E8EA 1PP9D 4FANA 4AANA 3A9FA 4YE1A 4EIEA 1FCDC 1SQQD 2B11B 3CP5A 1MG3D 5CIDB 1L9BC 1CSVA 2FRCA 2YIUB 4WQCA 1U74B 4XYDB 5DFSA 3CYTI 2AXTV 1ZZHA 2A06D 1IQCA 1K3GA 5TISV 3H1JD 2DVHA 2O3JA 3PXSA 1A8CA 451CA 4PD4D 3WFBC 3SVWA 1CEDA 1L0ND 2CA3B 1EZVD 4H0JA 1HCMA 1FHBA 3L71D 2Y0CA 3CU4A 1MZ4A 1CNOA 2RN0A 2N3YA 1YIQA 3NWVA 3L4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1F A;  1NTZ D;  3OA8 A;  4WQ7 A;  3KZI V;  3C2C A;  2CE1 A;  1CSX A;  3DMI A;  5CIC B;  3A0B V;  2K9J B;  3WFC C;  1H31 B;  3PH2 B;  1PPJ D;  3RN1 A;  2JWA A;  5GTI V;  1FOC A;  1CRG A;  1FJ0 A;  5TJH A;  4WQD A;  4U3F D;  1I55 A;  1H32 B;  2VHD A;  2RMZ A;  3TF5 A;  1OCD A;  4XXL A;  3H1L D;  3WC8 A;  4KMG A;  3CX5 W;  3O1Y A;  1GU2 A;  2B12 B;  1BE3 D;  4K3I A;  5AUR A;  1N90 A;  3HQ7 A;  1FI3 A;  3O0R C;  1LC2 A;  4RSZ A;  3ZOY A;  1YIC A;  3L4O A;  1CTJ A;  3ZBM A;  1QKS A;  3PTZ A;  2GC4 D;  2QJP B;  3HQ9 A;  4V2K A;  1C6R A;  1I5T A;  3SJL A;  1NIR A;  1QN2 A;  4WQE A;  3PXW A;  1RAP A;  2JTI B;  3ZCF A;  1I8P A;  2N18 B;  3H1K D;  2YK3 A;  4LJI A;  2OZ1 A;  1IZL 0;  4RJT A;  1C75 A;  2C1D A;  2ZZS 1;  1OAE A;  3OCD A;  1KYO W;  5DJQ B;  2XTS B;  1RZ5 A;  1COR A;  1CRY A;  1K3H A;  3L75 D;  1CCH A;  1SQP D;  1S5L V;  1U75 B;  1NML A;  2FWL A;  3HQ8 A;  1NTK D;  1CIG A;  1IO3 A;  2ZOO A;  1HRC A;  3M97 X;  5C0Z A;  4EIF A;  3SLE A;  2JQR A;  1WVE C;  1W5C T;  3VRD A;  2QG4 A;  1YCC A;  2EXV A;  5KAI V;  4PW9 B;  3RLM A;  1M60 A;  2ZBO A;  3KHU A;  4FA1 A;  2V07 A;  1C2N A;  3PLN A;  1RZ6 A;  5CYT R;  4IL6 V;  1CYI A;  3L72 D;  1CHI A;  4WQ9 A;  1CHH A;  1HJ4 A;  1QL3 A;  1YEA A;  1DW1 A;  1JDL A;  1R0Q A;  1RAQ A;  1A56 A;  1ZRT D;  2PCB B;  4GED B;  5B5E V;  3TGU D;  2N18 C;  1AOQ A;  1KYO D;  1CC5 A;  1GQ1 A;  1NTM D;  3PRJ A;  5B6Q A;  3CWB D;  3PXT A;  5DJQ C;  3WU2 V;  1CRH A;  4UB6 V;  2BCN B;  3TDK A;  4PWA A;  2B0Z B;  1MG2 D;  1W2L A;  2N9I A;  2YCC A;  4L3H A;  4WQ8 A;  3MK7 B;  2N3B A;  1A2S A;  1H33 A;  2GC7 D;  2B10 B;  4FAV A;  1BL9 A;  2KS1 A;  1WEJ F;  4P4Q B;  1I54 A;  1CYJ A;  3H1H D;  1CCR A;  5CIB B;  4A7P A;  5EXQ A;  1DIQ C;  4O1W A;  1C6O A;  2N9J A;  1NNO A;  4FA4 A;  1BGY D;  2BCC D;  2GIW A;  5IY5 1;  2ZON G;  3SWS A;  1AKK A;  1YTC A;  4FA9 A;  5E79 V;  4Q5P A;  1CSU A;  4D6T D;  3L74 D;  1KX7 A;  3ZOO A;  3OA8 B;  1E29 A;  1QYZ A;  1L9J C;  4EIC A;  5H2F V;  1IRV A;  1CRC A;  1HJ3 A;  1N50 A;  4WQB A;  3MK7 C;  1GJQ A;  5B66 V;  4H0K A;  1HRO A;  3DR0 A;  2L91 A;  1CIF A;  1CIE A;  2GB8 B;  1DT1 A;  2BLF B;  1KIB A;  4MU8 A;  5KLI B;  1SQB D;  3A0H V;  3VYM A;  4GYD A;  2PAC A;  4DY9 A;  2QJY B;  4FB1 A;  2C8S A;  2CA4 B;  1CIH A;  4UB8 V;  1FI9 A;  1CSW A;  4AAL A;  2AI5 A;  5KAF V;  1KB0 A;  1M70 A;  1COT A;  5DF5 A;  1NU1 D;  1KB9 D;  2C1V A;  1I6E A;  1BCC D;  1F1C A;  4O1Q A;  2ZXY A;  3CXH W;  4AX3 A;  2Y0E A;  5CIH B;  1H9Y A;  1QL4 A;  2Q3E A;  1LS9 A;  2AIU A;  2N9Y B;  3O20 A;  1CRI A;  1C52 A;  2KNC B;  3TYI A;  2B4Z A;  1P84 D;  1YNR A;  1E2R A;  1HZU A;  4WQA A;  1DVH A;  2FYN B;  1LFM A;  1M6Z A;  1SQX D;  5CIG B;  2OZ1 B;  1KX2 A;  5KLV D;  1DII C;  2V08 A;  4QAO A;  3WFD C;  3WUI A;  1N9C A;  2C1D B;  3NBS A;  3OCD B;  2ORL A;  1H31 A;  2CXB A;  1LMS A;  1CXA A;  1GDV A;  4NFG B;  2C2C A;  2BPB B;  4EDF A;  1DW0 A;  1IRW A;  2C1U A;  2LIR A;  1GKS A;  1H32 A;  1AYG A;  1HH7 A;  2BGV X;  5CIE B;  2FYU D;  4AAO A;  3CXH D;  1CRJ A;  3PHL A;  1L0L D;  3RMZ A;  4FA5 A;  1YEB A;  3HQ6 A;  3VMA A;  3ZOX A;  2DGE A;  351C A;  1SQV D;  3O5C A;  1I6D A;  5C9M A;  3JBT B;  1ETP A;  1CO6 A;  2LIT A;  3SXT A;  3X39 A;  3WFE C;  2C9X B;  1H9X A;  1DW3 A;  1GIW A;  2YQB A;  2D0W A;  1LC1 A;  1CXC A;  1YFC A;  3ORV A;  1B7V A;  3GW6 A;  2D0S A;  2BH4 X;  1S6V B;  1CYC A;  3NBT A;  4PJ0 V;  2IBZ D;  4L3G A;  5GTH V;  3FWL A;  1FI7 A;  4JCG A;  3DP5 A;  1DW2 A;  4L1Q A;  1NMI A;  2L4D A;  1H1O A;  2BH5 X;  2I8F A;  4EID A;  5KKZ B;  2MHM A;  1H33 B;  1CTZ A;  1EB7 A;  1N15 A;  4AAM A;  1CTY A;  3L70 D;  5CIF B;  2CE0 A;  2MTA C;  2QJK B;  4N0K A;  1J3S A;  1C7M A;  1AOF A;  3ZIY A;  1HJ5 A;  4J20 A;  3BCC D;  3H1I D;  155C A;  1HZV A;  3ITK A;  3ZOW A;  1VYD A;  2Y0D A;  1C6S A;  2PCC B;  3L73 D;  3CX5 D;  3VNW A;  1KV9 A;  3RN0 A;  4Y5R A;  1I8O A;  1CHJ A;  2HV4 A;  3GG2 A;  1DVV A;  1C2R A;  1E8E A;  1PP9 D;  4FAN A;  4AAN A;  3A9F A;  4YE1 A;  4EIE A;  1FCD C;  1SQQ D;  2B11 B;  3CP5 A;  1MG3 D;  5CID B;  1L9B C;  1CSV A;  2FRC A;  2YIU B;  4WQC A;  1U74 B;  4XYD B;  5DFS A;  3CYT I;  2AXT V;  1ZZH A;  2A06 D;  1IQC A;  1K3G A;  5TIS V;  3H1J D;  2DVH A;  2O3J A;  3PXS A;  1A8C A;  451C A;  4PD4 D;  3WFB C;  3SVW A;  1CED A;  1L0N D;  2CA3 B;  1EZV D;  4H0J A;  1HCM A;  1FHB A;  3L71 D;  2Y0C A;  3CU4 A;  1MZ4 A;  1CNO A;  2RN0 A;  2N3Y A;  1YIQ A;  3NWV A;  3L4M A; 
#chains in the Genus database with same CATH topology
 3KZI V;  2A45 H;  2CE1 A;  2IFM A;  1NTK J;  1OW8 A;  1PPJ D;  2JWA A;  5GTI V;  5TJH A;  4U3F D;  2L5G B;  1H32 B;  1FDM A;  1R5L A;  3L72 J;  2JKV A;  1VQ7 P;  1S9K E;  3WC8 A;  4IFF A;  2JO1 A;  3CL3 D;  3FXE A;  4K3I A;  4DOJ A;  2Z5I A;  1NTK E;  2XND H;  5CBO A;  1JMB A;  1GL2 B;  4RSZ A;  3MD0 A;  3O8Z A;  3ZBM A;  2D2C C;  1S5L E;  3HQ9 A;  3WUU A;  3VMY A;  4IOI H;  3L72 E;  3HTK B;  4WQE A;  3PXW A;  2JTI B;  3P8M C;  1I8P A;  4EYY Q;  5APQ A;  4LJI A;  1SQQ K;  1IZL 0;  2FBW C;  4H13 B;  5KLV E;  2JR8 A;  1JCD A;  4RJT A;  2IFN A;  1M90 Q;  4HYT B;  2ZZS 1;  2NPS A;  5APV A;  1OAE A;  3V4W A;  2I8D A;  1KYO W;  4KJM A;  1PL5 A;  5B5E E;  1CCH A;  1SQP D;  1S5L V;  1U75 B;  3AEE C;  1RF1 C;  2NPS D;  4OWF A;  2KXP B;  2AXT H;  2ZOO A;  2QA4 P;  3SLE A;  5AVT B;  1W5C T;  2QG4 A;  1YCC A;  2P1J A;  3WU2 E;  5AVS B;  3CMA P;  2XDJ A;  1C2N A;  4WY4 C;  3M0A A;  1S4X A;  5DJT B;  1CHH A;  1JY2 P;  2P58 A;  2P7J A;  5APX A;  1DW1 A;  4PV1 D;  1R0Q A;  1VF5 D;  1NTZ K;  1ZRT D;  5B5E V;  1AFO A;  2N18 C;  3AE8 C;  3M9H A;  3L70 J;  1FDI A;  2AEJ A;  5AVX B;  3GMA A;  4UB6 H;  4IFD K;  1AVY A;  3CCL P;  1N73 A;  5B6Q A;  3CWB D;  3NXS A;  3WU2 V;  1CRH A;  1GW4 A;  1BSN A;  5GTI H;  2N9I A;  1N7L A;  3H6P A;  1MFT A;  5E79 E;  3H1I J;  1FU1 A;  4WQ8 A;  3Q5R A;  2N1T C;  1BL9 A;  1EZV I;  2KS1 A;  3IAO A;  1GD2 E;  3L70 E;  1FOS F;  1K9M Q;  1C6O A;  1HJ0 A;  2W8Z A;  1NTK G;  3L36 A;  1NNO A;  2Q9I A;  1FBM A;  3NFQ A;  1Q82 Q;  1PGP A;  1NU1 G;  1BGY D;  2BCC D;  2GIW A;  3HUS B;  1LJ2 A;  1IK9 A;  2B87 B;  2WZ7 A;  1R5S A;  5APW A;  3Q2Y A;  4Z1M H;  3M9B A;  1KIL C;  1AKK A;  1YTC A;  4Y28 J;  3RK2 D;  5E79 V;  5H2F H;  3L72 G;  3H1I E;  3L74 D;  1EQ7 A;  4UB8 E;  5KLV G;  4WWI A;  5B66 H;  3H1J J;  1IFI A;  1ZME C;  3R4Y A;  1L9J C;  1WT6 A;  5APY A;  2CPB A;  1CZQ A;  3P7K A;  1N50 A;  4I6M C;  2FYU J;  1AA0 A;  1L0N J;  4N3Y B;  2WTY A;  1ZR2 A;  3DR0 A;  1CIE A;  1DT1 A;  4MU8 A;  5KLI B;  5CCG C;  3RL0 B;  5KAF H;  4FB1 A;  2C8S A;  4YXW H;  2CA4 B;  4UB8 V;  2E76 C;  1P84 H;  2WIT A;  1FI9 A;  3H1J E;  1CSW A;  4EOT A;  1KB0 A;  1M70 A;  2VRS A;  4AQR D;  1NU1 D;  2I1K A;  4EI2 A;  2FYU E;  1F1C A;  1LWU B;  1L0N E;  1HGV A;  1EZV E;  2K37 A;  3O20 A;  2W83 C;  3HD7 B;  3CX5 I;  3TYI A;  2WPQ A;  2B4Z A;  1P84 D;  3P8C D;  1S3J A;  3D6Y A;  2IX7 C;  3GLM A;  1X9V A;  2QEX P;  5KLV D;  2V08 A;  1RQV A;  3WU2 H;  3WUI A;  4CPG A;  1OMI A;  2K9J A;  3OCD B;  3VMX A;  2RKL A;  2Q5U A;  4DT0 A;  1YBK A;  2D2C D;  3CD6 P;  1VQL P;  2IBZ E;  2CXB A;  1LMS A;  1JTH B;  4DZO A;  2C2C A;  2QJY C;  1SLQ A;  1IFP A;  1JCC A;  4BRY B;  1IRW A;  1VPC A;  3E7K A;  4XA4 A;  3L70 G;  2BGV X;  4ZKU A;  4W7Z A;  1BDC A;  1SP4 A;  3RK3 C;  1RF1 A;  1MUU A;  1USD A;  1ZV8 A;  1EXI A;  3O5C A;  5C9M A;  3H1I G;  2LKM A;  3Q1M A;  2FYN C;  5GTH H;  1GIW A;  4WY4 A;  1BSH A;  1LC1 A;  3TK1 A;  5AVZ B;  2AEF A;  3GW6 A;  3HE4 A;  2D0S A;  4OGQ C;  1J1D B;  1CYC A;  1LT9 C;  1X8Y A;  1LTB C;  2ZYA A;  4L3G A;  1RQU A;  2P67 A;  4WY4 D;  1DW2 A;  1KQS O;  1NMI A;  2WSF H;  3AE7 C;  2ZYG A;  2C9N Y;  1AVO A;  1H1O A;  2E75 D;  2WSE H;  3CX5 E;  5KKZ B;  1H33 B;  2YXQ B;  2HOD B;  2A45 I;  3LW5 J;  1CTY A;  3H1J G;  3L70 D;  2O01 H;  2RH0 A;  3CC4 P;  4UB8 H;  1NTM J;  1FZA A;  2QJK B;  4N0K A;  4B86 A;  2N1T A;  3NTN A;  2FYU G;  1L0N G;  2HPC B;  1EZV G;  1X79 B;  1AOF A;  2KNC A;  3L71 G;  4NPF X;  1KD1 Q;  1FZC C;  2A06 E;  1HJ5 A;  4J20 A;  2N1T D;  1KQF B;  3ZDM A;  2BEQ D;  3H1I D;  3V6I A;  5BVZ A;  1HZV A;  1NYH A;  3ZOW A;  2Y0D A;  1C6S A;  1KIL A;  3H1H J;  1PGO A;  1S5L X;  4Y5R A;  1NTM E;  4NPE A;  3AEF C;  3H25 A;  1KIL D;  3USS A;  1PP9 D;  3G71 P;  4I1L A;  2Q6Q A;  4YE1 A;  2IZ1 A;  1M1J B;  2PGD A;  3WMM 0;  2B11 B;  2YIU B;  2E5Y A;  3CYT I;  1Q81 Q;  1PPJ E;  1IQC A;  3H1H E;  5TIS V;  3H1J D;  4KHX A;  3SFD C;  3HE5 B;  5CCG A;  3UIA A;  2HFE D;  2QVA A;  2W6A A;  451C A;  3WFB C;  1CED A;  1EDJ A;  1L0N D;  3NMD A;  2FXM A;  1EZV D;  1QVF O;  1M57 D;  2WVR A;  3L71 D;  5CCG D;  2HG5 D;  3FWN A;  3M0D C;  1K04 A;  2E76 D;  1FZF A;  4I7Z C;  4H44 C;  3H1K G;  3FXD A;  2C0W A;  4WQ7 A;  1SQP J;  2KI7 B;  1HF9 A;  2PFX A;  3A0B V;  3CLQ A;  2YKO A;  1EC5 A;  3WFC C;  3CXH I;  1H31 B;  3RN1 A;  2ZT9 C;  4L76 A;  3AE3 C;  3RGU A;  3IF4 A;  1CW5 A;  4XXL A;  1FJP A;  4KMG A;  1SQX J;  2B12 B;  3JC2 2;  2A06 G;  1SQP E;  5AUR A;  1N90 A;  2Q3I A;  1FI3 A;  1GMJ A;  1LC2 A;  1LNQ A;  3CWB J;  3ZOY A;  5AW6 B;  1CTJ A;  1QKS A;  4R4L A;  1U57 A;  3PTZ A;  1I5T A;  1NTM G;  1NIR A;  1D7M A;  1ZLL A;  5AVR B;  2KUB A;  3H1K D;  1SQX E;  3GHG C;  1CSB A;  2AXT E;  3JCU H;  1ZRT E;  1C75 A;  2UWJ E;  2C1D A;  1LT9 A;  5DJQ B;  1VQ9 P;  1COR A;  2SPZ A;  3U1C A;  1BGY J;  2BCC J;  3CWB E;  1PPJ G;  1GZL A;  3H1H G;  1NML A;  3E1I A;  3HQ8 A;  1U7M A;  1JY3 P;  2G8Y A;  3AEC C;  1HRC A;  2O1J A;  2OYH C;  2FFD B;  4IL6 H;  1HH0 A;  4Y99 C;  3CXH E;  5TIS H;  2EXV A;  4PW9 B;  4AYC A;  4BXL A;  1NVO A;  1RY3 A;  3F5H A;  2A45 G;  3L74 J;  1M60 A;  2ZBO A;  1J2J B;  3B4S A;  1HGZ A;  5AVY B;  5M1B A;  1X22 A;  1VL2 A;  5C39 A;  4UB6 E;  3LID A;  1CYI A;  1ZN5 A;  1HJ4 A;  1VQN P;  1R8E A;  2PCB B;  1BGY E;  1PV3 A;  2BCC E;  1HJB A;  1H0T B;  1FZC A;  2B88 A;  1A02 J;  1GQ1 A;  1LTG C;  1NTM D;  3PRJ A;  2Q1K A;  3PXT A;  1LTJ C;  3A0B H;  3L74 E;  4UB6 V;  1IJD B;  1SFC C;  2BCN B;  2B0Z B;  1L4A C;  1MG2 D;  3M9Q A;  4GIF A;  2ITA A;  2YCC A;  2WT7 B;  1YTZ T;  2N3B A;  2ZXX A;  3BAS A;  3LIE A;  1NU1 J;  2GC7 D;  1I54 A;  3H1H D;  1SQP G;  4A7P A;  1JO5 A;  5H2F E;  2WPV B;  1L2P A;  4QMA A;  2KOG A;  3S1K A;  1J1E B;  5B66 E;  4RES B;  2K1A A;  1M7L A;  2ZON G;  2WPS A;  5KLV J;  5AW3 B;  3VOP A;  1QVG O;  3HTK A;  1JUN A;  5AVQ B;  1N2D C;  3B5N C;  1SQX G;  1NU1 E;  2YMK A;  1QYZ A;  1KC8 Q;  5H2F V;  4EIC A;  2JJL A;  3M0D A;  4H0L C;  5KAF E;  3Q5P A;  1HJ3 A;  4GOE A;  5AW8 B;  4WQB A;  3MK7 C;  1RE3 C;  3CWB G;  1NTK K;  5B66 V;  3A0H H;  1DEB A;  1P84 E;  3P8C E;  4H0K A;  1VQP P;  3FGA D;  5CJ0 A;  3D70 A;  1W2B O;  3CCE P;  2GB8 B;  3SWF A;  2B9B A;  1KIB A;  4RO0 A;  3A7O A;  4XE5 B;  1SQB D;  4H44 D;  1A02 F;  1NOH A;  1L0L G;  4DY9 A;  1G2C A;  4AAL A;  1J1D C;  2AI5 A;  5KAF V;  2ZT9 D;  1COT A;  5AVW B;  3V5B A;  3GF3 A;  2YKQ A;  3D71 A;  1BGY G;  4AX3 A;  2BCC G;  5CIH B;  1H9Y A;  2OAR A;  1C52 A;  5CMZ A;  1IFM A;  4WB4 A;  1FOS E;  4L75 A;  1HTL C;  4YTP C;  3G4S P;  1YNR A;  1E2R A;  4HKZ H;  2PP6 A;  1M6Z A;  1SQX D;  3L74 G;  3CXH H;  1EXJ A;  1KX2 A;  1DII C;  2WQY C;  3GF7 A;  1N9C A;  2M5A A;  3NBS A;  4IFM A;  3TYY A;  1KFN A;  3I56 P;  2NPS B;  1N8R Q;  2QJK C;  2WSF J;  5K5G B;  3AEG C;  2P2U A;  3EWK A;  3GHG A;  1CXA A;  2WSE J;  3F89 A;  3MUD C;  1NAY A;  4ASW A;  1IFD A;  3A3Y B;  3CXH D;  2JWD A;  5GTH E;  1L0L D;  4PV1 B;  1VF5 B;  3WUT A;  2O01 J;  1YEB A;  3HQ6 A;  1DH3 A;  4N78 D;  3VMA A;  1KFM A;  2R32 A;  1BE3 E;  2WSS H;  2OYH A;  2R3C A;  1KOR A;  1ZR4 A;  1SQV D;  3EFG A;  3X39 A;  1URQ C;  2OGU A;  1IZN B;  1YJN P;  1PP9 J;  5APT A;  2NZ2 A;  3ORV A;  2N9B A;  1B7V A;  2E43 A;  1USE A;  2BH4 X;  1CI6 A;  3NBT A;  1N73 B;  2IZ0 A;  1SVF A;  5GTH V;  1OW7 A;  1MV8 A;  1YIT P;  4U7J A;  2L4D A;  2WSC H;  1SQQ G;  1EDL A;  4EID A;  4MN4 C;  3BRT B;  1LTJ A;  4HB1 A;  1KIL E;  1SFC A;  2KS1 B;  1NGM B;  1L4A A;  4AAM A;  1PP9 E;  3L71 J;  3C1L A;  2ZVN B;  2XZR A;  3CCQ P;  4K35 A;  2CE0 A;  2MTA C;  2YKP A;  3RK2 B;  1SFC D;  1ZOY C;  1L4A D;  1YI2 P;  2KZJ A;  3RBX A;  3PH0 A;  1N7S C;  1JM0 A;  4JBZ A;  4K3A A;  2KK7 A;  1OFC X;  1LTS C;  2PCC B;  5APS A;  2V7Q H;  3IN6 A;  3L71 E;  3KXD A;  2YMY A;  3B5N A;  1DVV A;  4ZMD A;  4BRY A;  2Z4E A;  2FKW B;  4FAN A;  3A9F A;  2FYU K;  5AW9 B;  1JMM A;  1SQQ D;  5CID B;  3B5N D;  1CSV A;  1Y47 A;  1UIX A;  3CC7 P;  2R44 A;  1RE3 A;  4WQC A;  2OYI C;  3C8V A;  4H0L D;  1BE3 G;  2XV5 A;  1VDF A;  1FS0 E;  3QH9 A;  1YIJ P;  1AV1 A;  1ZP0 C;  3C9I A;  3WUV A;  3O6Q A;  2CA3 B;  3CCR P;  3H1K J;  2J59 M;  1CNO A;  2C0X A;  4C7N A;  5CBN A;  2LXC B;  3L4M A;  4JYC A;  1F1F A;  2D2C B;  1NTZ D;  3OA8 A;  3C2C A;  5BU5 A;  2W6B A;  2K9J B;  3PH2 B;  1TU3 F;  3AE2 C;  3L75 G;  1FOC A;  1CRG A;  3RK3 E;  4DCK A;  4WQD A;  4C46 A;  1PGJ A;  1PP9 G;  2ZAE B;  3H1K E;  2RMZ A;  1OCD A;  1VQM P;  2JEE A;  2KP8 A;  1JY3 O;  1ZW0 A;  3CX5 W;  1Q2N A;  2POH A;  3G6E P;  1PZQ A;  1RF1 B;  1QL2 A;  3MUD A;  1BE3 D;  4L74 A;  2E74 C;  3O0R C;  3SFE C;  3V4Q A;  1YIC A;  3JCU E;  3TGU G;  4WY4 B;  3L35 A;  3V2P A;  2GC4 D;  2QJP B;  3HE4 B;  1FZE A;  1QN2 A;  2E75 B;  1URQ A;  1RAP A;  5KAI E;  3ZCF A;  2N18 B;  2OZ1 A;  2JDI H;  4IL6 E;  3CC2 P;  1URQ D;  5TIS E;  1GK6 A;  2BEZ F;  3V2N A;  1H88 A;  1J1E C;  3L75 D;  1NH4 A;  5AVV B;  2FWL A;  1IO3 A;  2DW3 A;  3M97 X;  5C0Z A;  3CME P;  1FZG A;  1WVE C;  3VRD A;  2N1T B;  5KAI V;  3RLM A;  1GL2 C;  4I2L C;  1NTM K;  1WMK A;  3PLN A;  2E42 A;  4C7R A;  4IL6 V;  3CCV P;  3EFF K;  1CHI A;  1QL3 A;  3TNU A;  3I5C A;  1RAQ A;  3A0B E;  1A56 A;  2IPP A;  4HJG H;  4GED B;  1WRG A;  1KIL B;  3TGU D;  1AOQ A;  3B8E B;  4H13 C;  5DJU B;  1N7S A;  3II6 A;  2MJZ A;  3OJA B;  4YXD C;  1CC5 A;  4JQ0 D;  1SQB J;  3KDP B;  2AXC A;  4ASV A;  1MZ9 A;  1N7S D;  2GUV A;  2ZVO B;  3S9O A;  3TDK A;  4PWA A;  5L8R J;  1W2L A;  1KZU B;  3BCC J;  4L3H A;  2QE7 H;  3VMZ A;  3MZW B;  4PD4 I;  1T3J A;  1OVR A;  3AE6 C;  2LXB A;  1NKN A;  3L73 J;  2B10 B;  4FAV A;  1WEJ F;  4P4Q B;  1CYJ A;  1CCR A;  1IFJ A;  1DIQ C;  4O1W A;  3KYQ A;  2N9J A;  3M91 A;  4FA4 A;  1T2K C;  1SQB E;  2OYI A;  1BCC G;  4LGD E;  2E76 B;  1YYC A;  1OX3 A;  3SWS A;  4FA9 A;  1NWQ A;  1XTG B;  3T97 A;  3BCC E;  3VYI A;  4D6T D;  2I1J A;  3A0H E;  1G1J A;  3ZOO A;  2CPS A;  1JY2 O;  3L73 E;  1XTC C;  3VTP C;  3SWY A;  3H32 A;  1AQT A;  3CCJ P;  1IRV A;  1CRC A;  1SQP K;  2ZYD A;  1GJQ A;  3RK3 D;  1L0L J;  1HRO A;  1KB9 H;  1FDO A;  5AW0 B;  3CPW O;  2B89 A;  1SQV J;  3MP7 B;  3A0H V;  1JNM A;  4LLH A;  1DIP A;  2QJY B;  3HUS C;  1KQG B;  5AVU B;  5KAI H;  4OGQ D;  1Y9B A;  1BDD A;  1KB9 D;  4BWN A;  1BCC D;  2HLO A;  2ZXY A;  3CXH W;  2Y0E A;  2BAS A;  3E1R A;  1L0L E;  2Q3E A;  3PP5 A;  1M1K Q;  2AIU A;  1CRI A;  4N78 E;  1YJ9 P;  2K88 A;  1SQV E;  1LP1 A;  4WQA A;  5AW2 B;  2FYN B;  1LFM A;  2E74 D;  1VQO P;  4QAO A;  2C1D B;  3U59 A;  1LT9 B;  2KIK A;  2WT7 A;  5KLI C;  1Z56 A;  1OZH A;  3RL0 C;  2WSC J;  2KSE A;  1GDV A;  2BPB B;  2O1K A;  4EDF A;  1DW0 A;  1PIX A;  2C1U A;  2LIR A;  1GKS A;  3VN0 A;  1H32 A;  1AYG A;  1HH7 A;  2XU6 A;  5CIE B;  4AAO A;  1H8A A;  1YHQ P;  1CRJ A;  2Z5H A;  1SQB G;  3A2A A;  3AEB C;  1K73 Q;  2M3E A;  1LWU C;  3S4R A;  4TLF A;  3ZOX A;  1KYO I;  351C A;  1G1I A;  3MIW A;  2OQQ A;  3HD7 C;  3BCC G;  3JBT B;  1GL2 A;  3SXT A;  4PJ0 H;  3WFE C;  2C9X B;  3L73 G;  2YQB A;  1HBW A;  1FE6 A;  3AE4 C;  1FZC B;  2WWW A;  1CXC A;  1S6V B;  1GL2 D;  1NHL A;  1SQQ J;  3A5T A;  3FWL A;  1FI7 A;  1M8O B;  3DP5 A;  2V7Q J;  2W6J H;  1M56 D;  1GK4 A;  1YQ4 C;  2H8P D;  2CK3 H;  1VQK P;  4YPC A;  3KQG A;  2V4H A;  4H13 D;  1CTZ A;  4HH2 A;  1NJI Q;  2E5T A;  3N7N A;  2R5D A;  1EB7 A;  4WVZ A;  1FC2 C;  5CIF B;  1NU1 K;  4JYB A;  1FJK A;  1SQQ E;  4ZKP A;  1VQ6 P;  2YO2 A;  2ZFC A;  1J3S A;  2K3R A;  4JPZ B;  5AW4 B;  1C7M A;  3ZIY A;  2Q7C A;  1NTZ J;  2Y9Z A;  1U7J A;  1DX7 A;  2H43 A;  2W27 A;  3BCC D;  2QSI A;  1SQV G;  155C A;  4W80 A;  2W90 A;  5KLV K;  1DD3 A;  1VYD A;  3L73 D;  3BAT A;  1T2K D;  1KYO E;  1KV9 A;  1LT1 A;  2Y9Y A;  1I8O A;  1KN7 A;  2HV4 A;  4I7Z B;  4H44 B;  1PFI A;  5KKZ C;  1C2R A;  2IYO A;  1E8E A;  1RF0 C;  1JOC A;  3B71 A;  4PD4 H;  4AAN A;  4EIE A;  1NTZ E;  1BE3 J;  1FCD C;  1IO4 A;  1MG3 D;  3H1L G;  1OVV A;  4IL6 X;  2ZT9 B;  1U74 B;  3FX0 A;  1ZZH A;  1YTZ I;  2QJP C;  1G2C B;  1HVV A;  2O3J A;  3N4X A;  3AE5 C;  2E75 C;  1A8C A;  1VQ8 P;  2WPR A;  4PD4 D;  2IYP A;  2PAJ A;  1E79 H;  3SVW A;  3HUS A;  4OVN F;  2B87 A;  2JP3 A;  1HCM A;  3VP8 A;  1FAV A;  1T8Z A;  3KZI H;  2GA1 A;  1RE4 C;  2QIW A;  1IK7 A;  2GUS A;  3L75 J;  2KYV A;  1CSX A;  3DMI A;  2M5A B;  5CIC B;  1M1J C;  4L73 A;  2KLU A;  3GHG B;  2YIU C;  1FJ0 A;  1QLE D;  3ABV C;  1S1C X;  2G3A A;  1I55 A;  2VHD A;  1SS1 A;  3TF5 A;  1VQ4 P;  3H1L D;  1KV4 A;  1NKZ B;  3O1Y A;  3MTU E;  1GU2 A;  3KPE A;  3L75 E;  3TGU J;  2OYH B;  1YQ3 C;  3RL0 D;  1JEK A;  2WMM A;  3HQ7 A;  4Y99 B;  2IBZ I;  2XKM A;  3AED C;  3RBZ A;  1LWU A;  3L4O A;  1N86 A;  2K9Y A;  1S2E A;  3CCM P;  1CI6 B;  1HUC A;  4V2K A;  3HD7 A;  1C6R A;  2FYZ A;  3SJL A;  1OVU A;  3TSI A;  2YK3 A;  3HD7 D;  1NTZ G;  3TGU E;  1S5L H;  1S9K D;  2KLV A;  3OCD A;  4GOD A;  1LTJ B;  2XTS B;  1RZ5 A;  1CRY A;  1K3H A;  1QL1 A;  1JTH A;  1SFC B;  1NAF A;  1L4A B;  1NTK D;  1CIG A;  5EFW B;  1KQL A;  1HWT C;  4EIF A;  1YJW P;  1L0N K;  2JQR A;  1Q86 Q;  3D6Z A;  1KYO H;  4D6T J;  2KZI A;  1KB9 I;  3KHU A;  1KTM A;  4FA1 A;  2M3B A;  2V07 A;  5B5E H;  1QX8 A;  1RZ6 A;  5CYT R;  3L72 D;  4WQ9 A;  2R5B A;  1YEA A;  1JDL A;  2HYN A;  3K5B A;  3QWO C;  1KYO D;  3MGN A;  2IDB A;  3B5N B;  5DJQ C;  3OW2 O;  3U1A A;  4D6T E;  1W5C E;  3PJS K;  1QEX A;  2FXP A;  4H0L B;  4R4M A;  1QGK B;  5KTB A;  4KT0 J;  3P32 A;  2FFD C;  3MK7 B;  1A2S A;  1H33 A;  2FY8 A;  1BCC J;  1RF0 A;  2HOD A;  1JY3 N;  5CIB B;  4WBA A;  2H7H A;  5EXQ A;  2LR2 A;  3AEA C;  5E79 H;  5APU A;  1Y8A A;  2C9L Y;  5IY5 1;  4O9B A;  2HPC A;  3O6Q B;  2OTK E;  3Q5S A;  3Q3D A;  4C7N B;  4Q5P A;  1CSU A;  1GU4 A;  1KX7 A;  1KB9 E;  2MKV A;  1PGQ A;  3OA8 B;  1BCC E;  1OXZ A;  1E29 A;  1Q7Y Q;  1EDK A;  1RE4 A;  3VP9 A;  3L37 A;  3OAK A;  1AQ5 A;  4TT3 H;  1LTA C;  2AEM A;  1OW6 A;  3CI9 A;  1IFN A;  2L91 A;  5KJ7 C;  1CIF A;  2P10 A;  1RHZ B;  5BU8 B;  2BLF B;  1M1J A;  3V2R A;  5CCH C;  3I55 P;  3MHV A;  3VYM A;  1EDI A;  4GYD A;  2PAC A;  3RL0 g;  4GKG A;  1CIH A;  5CHX A;  1IC2 A;  1T6A A;  2YO3 A;  3CCS P;  1MFZ A;  2ZXE B;  3HE5 A;  5DF5 A;  2ZJS E;  2QM7 A;  2C1V A;  1I6E A;  4O1Q A;  4U3F J;  1QL4 A;  1GDT A;  5AW1 B;  1LS9 A;  2N9Y B;  2KNC B;  2IBZ G;  4GOF A;  1GU5 A;  3AE9 C;  1URQ B;  1HZU A;  2KSJ A;  1DVH A;  3R2P A;  4D6T G;  3OA7 A;  5CIG B;  2OZ1 B;  3V2Q A;  2H89 C;  4W7Y A;  4GDO A;  3WFD C;  1LTI C;  2ORL A;  4GT1 A;  1LGH B;  1Q90 D;  3D0W A;  1H31 A;  5AW5 B;  4NFG B;  1VQ5 P;  4U3F E;  2NRG A;  3IR9 A;  2FYU D;  1GTW A;  4PJ0 E;  3PHL A;  3RMZ A;  4FA5 A;  2GM4 A;  2QRX A;  3L4F A;  5AW7 B;  2DGE A;  1UII A;  3TNU B;  1I6D A;  2H88 C;  4N6J A;  4EIJ A;  3W67 A;  1ETP A;  1CO6 A;  2LIT A;  2QM8 A;  2M8R A;  1H9X A;  2J58 A;  1DW3 A;  4RKU J;  2D0W A;  2OYO A;  4M3L A;  1YFC A;  1N7S B;  1H89 A;  3W68 A;  1FZB A;  1T3U A;  2NPS C;  4PJ0 V;  2IBZ D;  1JY2 N;  1DEE G;  4JCG A;  1RH5 B;  2OTL P;  4L1Q A;  1NO4 A;  2PRR A;  1SQB K;  2HR3 A;  2M0B A;  2O01 N;  2BH5 X;  2I8F A;  4AUW A;  3M06 A;  2MHM A;  3G9R A;  1KMI Z;  4PV1 C;  1VF5 C;  2R3S A;  2XNX A;  1N15 A;  3AE1 C;  4DJG A;  1MKM A;  2FXO A;  2FFD A;  3CX5 H;  2OYI B;  3BVH A;  1K05 A;  3HRN A;  3JSV C;  5CJ4 A;  3T97 B;  1SQX K;  2YNY A;  1N73 C;  3ITK A;  1JB0 J;  1OIP A;  4PD4 E;  1ZXG A;  1H0T A;  4LC1 A;  3RK3 B;  3CX5 D;  3H32 B;  1E5W A;  3VNW A;  3RN0 A;  1K8A Q;  2J5U A;  3H1L J;  1CHJ A;  3GG2 A;  3EQ2 A;  2KB7 P;  4U3F G;  3G3Z A;  4XFJ A;  4ZNC A;  1S72 P;  3CP5 A;  3LW5 H;  3SSU A;  4OGQ B;  1L0L K;  1L9B C;  2FRC A;  4XYD B;  3RK2 C;  5DFS A;  3CCU P;  2OTJ P;  2AXT V;  3SWK A;  3IFM A;  4OH8 B;  2A06 D;  1DD4 A;  1SQV K;  3BRV B;  5KJ7 A;  1K3G A;  3KZI E;  2DVH A;  5CCH A;  1AJY A;  3PXS A;  1GW3 A;  4JF7 A;  1P84 I;  3H1L E;  5KJ7 D;  1LTT C;  5GTI E;  1OWA A;  2YXR B;  4H0J A;  5CCH D;  1FHB A;  2Y0C A;  3CU4 A;  1MZ4 A;  2E74 B;  1X0T A;  2RN0 A;  2N3Y A;  1W2E A;  4NPD A;  1YIQ A;  1LP1 B;  3NWV A; 
#chains in the Genus database with same CATH homology
 1F1F A;  1NTZ D;  3OA8 A;  4WQ7 A;  3KZI V;  3C2C A;  2CE1 A;  1CSX A;  3DMI A;  5CIC B;  3A0B V;  2K9J B;  3WFC C;  1H31 B;  3PH2 B;  1PPJ D;  3RN1 A;  2JWA A;  5GTI V;  1FOC A;  1CRG A;  1FJ0 A;  5TJH A;  4WQD A;  4U3F D;  1I55 A;  1H32 B;  2VHD A;  2RMZ A;  3TF5 A;  1OCD A;  4XXL A;  3H1L D;  3WC8 A;  4KMG A;  3CX5 W;  3O1Y A;  1GU2 A;  2B12 B;  1BE3 D;  4K3I A;  5AUR A;  1N90 A;  3HQ7 A;  1FI3 A;  3O0R C;  1LC2 A;  4RSZ A;  3ZOY A;  1YIC A;  3L4O A;  1CTJ A;  3ZBM A;  1QKS A;  3PTZ A;  2GC4 D;  2QJP B;  3HQ9 A;  4V2K A;  1C6R A;  1I5T A;  3SJL A;  1NIR A;  1QN2 A;  4WQE A;  3PXW A;  1RAP A;  2JTI B;  3ZCF A;  1I8P A;  2N18 B;  3H1K D;  2YK3 A;  4LJI A;  2OZ1 A;  1IZL 0;  4RJT A;  1C75 A;  2C1D A;  2ZZS 1;  1OAE A;  3OCD A;  1KYO W;  5DJQ B;  2XTS B;  1RZ5 A;  1COR A;  1CRY A;  1K3H A;  3L75 D;  1CCH A;  1SQP D;  1S5L V;  1U75 B;  1NML A;  2FWL A;  3HQ8 A;  1NTK D;  1CIG A;  1IO3 A;  2ZOO A;  1HRC A;  3M97 X;  5C0Z A;  4EIF A;  3SLE A;  2JQR A;  1WVE C;  1W5C T;  3VRD A;  2QG4 A;  1YCC A;  2EXV A;  5KAI V;  4PW9 B;  3RLM A;  1M60 A;  2ZBO A;  3KHU A;  4FA1 A;  2V07 A;  1C2N A;  3PLN A;  1RZ6 A;  5CYT R;  4IL6 V;  1CYI A;  3L72 D;  1CHI A;  4WQ9 A;  1CHH A;  1HJ4 A;  1QL3 A;  1YEA A;  1DW1 A;  1JDL A;  1R0Q A;  1RAQ A;  1A56 A;  1ZRT D;  2PCB B;  4GED B;  5B5E V;  3TGU D;  2N18 C;  1AOQ A;  1KYO D;  1CC5 A;  1GQ1 A;  1NTM D;  3PRJ A;  5B6Q A;  3CWB D;  3PXT A;  5DJQ C;  3WU2 V;  1CRH A;  4UB6 V;  2BCN B;  3TDK A;  4PWA A;  2B0Z B;  1MG2 D;  1W2L A;  2N9I A;  2YCC A;  4L3H A;  4WQ8 A;  3MK7 B;  2N3B A;  1A2S A;  1H33 A;  2GC7 D;  2B10 B;  4FAV A;  1BL9 A;  2KS1 A;  1WEJ F;  4P4Q B;  1I54 A;  1CYJ A;  3H1H D;  1CCR A;  5CIB B;  4A7P A;  5EXQ A;  1DIQ C;  4O1W A;  1C6O A;  2N9J A;  1NNO A;  4FA4 A;  1BGY D;  2BCC D;  2GIW A;  5IY5 1;  2ZON G;  3SWS A;  1AKK A;  1YTC A;  4FA9 A;  5E79 V;  4Q5P A;  1CSU A;  4D6T D;  3L74 D;  1KX7 A;  3ZOO A;  3OA8 B;  1E29 A;  1QYZ A;  1L9J C;  4EIC A;  5H2F V;  1IRV A;  1CRC A;  1HJ3 A;  1N50 A;  4WQB A;  3MK7 C;  1GJQ A;  5B66 V;  4H0K A;  1HRO A;  3DR0 A;  2L91 A;  1CIF A;  1CIE A;  2GB8 B;  1DT1 A;  2BLF B;  1KIB A;  4MU8 A;  5KLI B;  1SQB D;  3A0H V;  3VYM A;  4GYD A;  2PAC A;  4DY9 A;  2QJY B;  4FB1 A;  2C8S A;  2CA4 B;  1CIH A;  4UB8 V;  1FI9 A;  1CSW A;  4AAL A;  2AI5 A;  5KAF V;  1KB0 A;  1M70 A;  1COT A;  5DF5 A;  1NU1 D;  1KB9 D;  2C1V A;  1I6E A;  1BCC D;  1F1C A;  4O1Q A;  2ZXY A;  3CXH W;  4AX3 A;  2Y0E A;  5CIH B;  1H9Y A;  1QL4 A;  2Q3E A;  1LS9 A;  2AIU A;  2N9Y B;  3O20 A;  1CRI A;  1C52 A;  2KNC B;  3TYI A;  2B4Z A;  1P84 D;  1YNR A;  1E2R A;  1HZU A;  4WQA A;  1DVH A;  2FYN B;  1LFM A;  1M6Z A;  1SQX D;  5CIG B;  2OZ1 B;  1KX2 A;  5KLV D;  1DII C;  2V08 A;  4QAO A;  3WFD C;  3WUI A;  1N9C A;  2C1D B;  3NBS A;  3OCD B;  2ORL A;  1H31 A;  2CXB A;  1LMS A;  1CXA A;  1GDV A;  4NFG B;  2C2C A;  2BPB B;  4EDF A;  1DW0 A;  1IRW A;  2C1U A;  2LIR A;  1GKS A;  1H32 A;  1AYG A;  1HH7 A;  2BGV X;  5CIE B;  2FYU D;  4AAO A;  3CXH D;  1CRJ A;  3PHL A;  1L0L D;  3RMZ A;  4FA5 A;  1YEB A;  3HQ6 A;  3VMA A;  3ZOX A;  2DGE A;  351C A;  1SQV D;  3O5C A;  1I6D A;  5C9M A;  3JBT B;  1ETP A;  1CO6 A;  2LIT A;  3SXT A;  3X39 A;  3WFE C;  2C9X B;  1H9X A;  1DW3 A;  1GIW A;  2YQB A;  2D0W A;  1LC1 A;  1CXC A;  1YFC A;  3ORV A;  1B7V A;  3GW6 A;  2D0S A;  2BH4 X;  1S6V B;  1CYC A;  3NBT A;  4PJ0 V;  2IBZ D;  4L3G A;  5GTH V;  3FWL A;  1FI7 A;  4JCG A;  3DP5 A;  1DW2 A;  4L1Q A;  1NMI A;  2L4D A;  1H1O A;  2BH5 X;  2I8F A;  4EID A;  5KKZ B;  2MHM A;  1H33 B;  1CTZ A;  1EB7 A;  1N15 A;  4AAM A;  1CTY A;  3L70 D;  5CIF B;  2CE0 A;  2MTA C;  2QJK B;  4N0K A;  1J3S A;  1C7M A;  1AOF A;  3ZIY A;  1HJ5 A;  4J20 A;  3BCC D;  3H1I D;  155C A;  1HZV A;  3ITK A;  3ZOW A;  1VYD A;  2Y0D A;  1C6S A;  2PCC B;  3L73 D;  3CX5 D;  3VNW A;  1KV9 A;  3RN0 A;  4Y5R A;  1I8O A;  1CHJ A;  2HV4 A;  3GG2 A;  1DVV A;  1C2R A;  1E8E A;  1PP9 D;  4FAN A;  4AAN A;  3A9F A;  4YE1 A;  4EIE A;  1FCD C;  1SQQ D;  2B11 B;  3CP5 A;  1MG3 D;  5CID B;  1L9B C;  1CSV A;  2FRC A;  2YIU B;  4WQC A;  1U74 B;  4XYD B;  5DFS A;  3CYT I;  2AXT V;  1ZZH A;  2A06 D;  1IQC A;  1K3G A;  5TIS V;  3H1J D;  2DVH A;  2O3J A;  3PXS A;  1A8C A;  451C A;  4PD4 D;  3WFB C;  3SVW A;  1CED A;  1L0N D;  2CA3 B;  1EZV D;  4H0J A;  1HCM A;  1FHB A;  3L71 D;  2Y0C A;  3CU4 A;  1MZ4 A;  1CNO A;  2RN0 A;  2N3Y A;  1YIQ A;  3NWV A;  3L4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...