3H1ID

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 63
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1iD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1iD02
3HQ8A 1H1OA 1VYDA 1GU2A 4XXLA 3DMIA 2YQBA 2OZ1B 4WQ8A 2N9YB 3C2CA 3OA8A 2C1DA 1YFCA 1J3SA 1C6SA 3DR0A 2FYNB 451CA 3H1JD 3WU2V 1FCDC 3WFDC 1CIFA 1HJ5A 2YCCA 3L70D 1M60A 1ZZHA 1CHHA 2RN0A 1CCRA 2B0ZB 3L4MA 5TJHA 4MU8A 3TGUD 2N9IA 4K3IA 1NIRA 1SQBD 1CIHA 3OA8B 2Y0CA 2C1DB 1F1FA 5H2FV 1C6OA 3WFCC 1SQVD 1CEDA 1B7VA 1BE3D 2CXBA 4FA5A 1I55A 2N9JA 3O20A 1CCHA 5E79V 1GKSA 1U75B 4FB1A 1YCCA 4N0KA 1I54A 3ORVA 3CX5W 3RMZA 1W5CT 5CIHB 1MG3D 4XYDB 2PCBB 3MK7C 5CYTR 1CYIA 2D0SA 2FYUD 4WQCA 4EIDA 4PW9B 2JTIB 1NMIA 2B4ZA 3RN1A 2HV4A 1I5TA 1QL4A 3VYMA 4UB6V 2ZOOA 3H1LD 5KLVD 2VHDA 2BCCD 3X39A 2QG4A 1I6DA 5CIFB 1KX2A 1FI3A 1M6ZA 4FA4A 1CYJA 3PXTA 4YE1A 4RJTA 1H33A 2BPBB 3RLMA 3CXHW 3VNWA 2O3JA 1ZRTD 1NTKD 2L91A 1BCCD 1AKKA 1KIBA 2V07A 2N18B 3VRDA 2GC7D 3H1HD 4AAMA 1YIQA 1C52A 1CIEA 2B10B 4EIFA 2Y0EA 4P4QB 1H9YA 4AX3A 1H33B 2C1VA 1E29A 5KAIV 1W2LA 1L0LD 4O1WA 5CIBB 1CTZA 1LMSA 2JWAA 2XTSB 1CHJA 1HCMA 1MG2D 2AXTV 4NFGB 3KHUA 3H1KD 1GJQA 1KV9A 3SJLA 5CIGB 1R0QA 2PCCB 3TYIA 1DW1A 1FJ0A 1CIGA 1LS9A 4AAOA 1YNRA 2QJYB 2BLFB 1ETPA 3NBSA 1YEAA 4PWAA 3NWVA 4WQEA 3VMAA 1IZL0 2LIRA 2GC4D 5B6QA 3PH2B 4JCGA 5C0ZA 1K3GA 2PACA 1GQ1A 3L75D 2BCNB 2IBZD 3FWLA 4FANA 2L4DA 1FOCA 1PP9D 2C9XB 3L73D 1IRVA 1E8EA 5EXQA 3TF5A 3SLEA 1M70A 1HROA 4WQAA 1EB7A 4EICA 4KMGA 2I8FA 3ZCFA 2GIWA 3ZIYA 3JBTB 1FHBA 1RZ6A 1KYOD 2KNCB 1CRGA 4LJIA 2BGVX 5DF5A 3A0BV 1CSVA 3GW6A 2ZBOA 5AURA 1N9CA 3PHLA 3RN0A 2YIUB 5IY51 4PD4D 4EDFA 4FA9A 1HJ4A 2LITA 1QL3A 2CA4B 3CU4A 1RZ5A 4AALA 1N90A 2DGEA 1HH7A 1QYZA 1CNOA 1N50A 3H1ID 1KB9D 1A8CA 2JQRA 4U3FD 1NTMD 1E2RA 2C8SA 2CE0A 1HZVA 3SXTA 2AIUA 1C2RA 1C75A 5TISV 3NBTA 4GYDA 3SWSA 1K3HA 2QJPB 1KX7A 1C6RA 1A56A 1YICA 3WC8A 3GG2A 3HQ9A 1CRJA 4A7PA 2C1UA 3ZOWA 3L72D 3CYTI 2N18C 2BH5X 4UB8V 1FI9A 1DIQC 3SVWA 4RSZA 1CHIA 1DW0A 3O1YA 2EXVA 1BGYD 3HQ7A 2N3BA 4GEDB 2K9JB 3DP5A 1SQPD 2ORLA 2QJKB 1AYGA 2ZONG 1CTJA 2N3YA 1RAQA 3L71D 3PRJA 3WFEC 5KLIB 3ZOOA 1U74B 1YTCA 3ZOYA 1CTYA 2B12B 1OAEA 1MZ4A 1H31A 1CSUA 2ZZS1 4J20A 3ZBMA 1CYCA 3CWBD 1DIIC 4WQ9A 2CE1A 1I6EA 3PLNA 1QN2A 3O5CA 5DJQB 2B11B 1CRIA 2AI5A 3M97X 1DT1A 1EZVD 1H31B 1N15A 1PPJD 3OCDA 4EIEA 1C7MA 3CX5D 1LC2A 351CA 1DW3A 3WFBC 5B66V 3A0HV 1DVHA 1CSWA 5GTHV 1L9BC 1I8PA 1CXAA 1H32A 4V2KA 2CA3B 1CXCA 4L3HA 1BL9A 2ZXYA 2Q3EA 2KS1A 1NNOA 1F1CA 1CC5A 1SQXD 2DVHA 3L4OA 3OCDB 4H0JA 1S5LV 4QAOA 3CP5A 4WQBA 1WEJF 3ZOXA 2YK3A 5GTIV 1SQQD 4IL6V 3CXHD 1DVVA 3TDKA 2BH4X 155CA 1COTA 1S6VB 2FWLA 2MHMA 1CRHA 1DW2A 1H32B 1LFMA 2FRCA 1NMLA 2C2CA 4L1QA 1I8OA 3PTZA 4Q5PA 1GDVA 1GIWA 3PXSA 4AANA 1CORA 2V08A 5KKZB 1L0ND 3KZIV 3WUIA 1IO3A 1OCDA 1IRWA 4H0KA 1CRYA 1CSXA 1HRCA 3BCCD 1RAPA 1QKSA 3PXWA 1FI7A 4FAVA 4PJ0V 1KYOW 3MK7B 2A06D 1L9JC 4D6TD 4O1QA 1AOFA 5B5EV 1LC1A 2RMZA 4Y5RA 4FA1A 2GB8B 1P84D 5CIDB 2D0WA 3O0RC 3HQ6A 4DY9A 5DFSA 1A2SA 5C9MA 1CRCA 5CIEB 1C2NA 1YEBA 1AOQA 1HZUA 1NTZD 4L3GA 3L74D 2MTAC 5KAFV 1H9XA 1KB0A 2OZ1A 4WQ7A 1WVEC 2Y0DA 1HJ3A 1CO6A 3ITKA 3A9FA 5CICB 1IQCA 5DJQC 1JDLA 4WQDA 1NU1D
chains in the Genus database with same CATH superfamily
4R4LA 1U7JA 1VYDA 2WITA 2WVRA 1GU2A 2H8PD 3DMIA 2OZ1B 1T2KC 1YFCA 1LT9B 3D6YA 1L0LJ 3L71J 4TT3H 451CA 4BRYA 1FCDC 4GT1A 2YCCA 1M60A 2G3AA 2GA1A 4Z1MH 1G1IA 2KLUA 1WT6A 2FYUE 1SQXG 2N1TB 1VQ7P 2AEJA 1C6OA 2IDBA 1PV3A 1SQQG 4IFDK 1OZHA 1JO5A 4O9BA 1PP9J 1FC2C 4FA5A 1GKSA 1VQOP 3LW5H 4FB1A 1FBMA 1NTKE 2E75B 3KZIE 4N3YB 1BCCE 3HE4B 1GK6A 2HYNA 4GODA 5CCGD 1H8AA 3IR9A 3C8VA 2XU6A 1SQVK 2Q5UA 4PW9B 2JTIB 1UIXA 2ZT9B 3FXEA 4AQRD 1KILC 1I5TA 1MFTA 4PD4I 1QL4A 1W2BO 4PD4H 2JWDA 3VYMA 1MUUA 4JBZA 2KLVA 4FA4A 1DEEG 1CYJA 3PXTA 2KZIA 4RJTA 4WBAA 1H33A 2BPBB 3RLMA 2LXBA 3CCSP 2C0XA 3GLMA 2O1JA 3VRDA 2H88C 3H6PA 2B10B 2GM4A 1Q81Q 4EIFA 1HH0A 4CPGA 4AX3A 4YXDC 1JY2O 3M91A 3AE6C 3QH9A 1EQ7A 3NMDA 3SWKA 2K37A 4O1WA 1LMSA 1VQ4P 1KFMA 1RF1B 1MG2D 2AXTV 4NFGB 3H1KD 4OGQD 1GJQA 1ZV8A 4Y28J 1PZQA 3W68A 1DW1A 1CIGA 2J5UA 4AAOA 1EDKA 3CCEP 1YNRA 2BLFB 2FYNC 3NBSA 4HYTB 3NWVA 4WQEA 2QM7A 3A0HE 1IZL0 5APVA 5B6QA 4JCGA 5EFWB 1L0LK 2QIWA 4FANA 2L4DA 1FOCA 2XNDH 1VQPP 3HE5A 3H1IE 3TF5A 1M70A 4U3FE 1FDMA 1HROA 1NTME 3RK2D 2K3RA 3Q5PA 2Z4EA 1AQ5A 2I8FA 4JPZB 5KAFH 1PL5A 2B89A 2KNCB 1GZLA 2KXPB 1CW5A 4LJIA 2BGVX 2OGUA 1J1EB 3A0BV 5KAIH 1CSVA 1R8EA 2FBWC 4DJGA 1K9MQ 4PD4D 3L72E 2QSIA 1HJ4A 2LITA 2W27A 2NPSD 2GUSA 2MJZA 1DX7A 2A45I 1HH7A 1QYZA 3AE2C 2A45H 4I1LA 1EDJA 3AE3C 2NPSA 1SQXJ 4H13D 1JOCA 1W2EA 3D0WA 3SWSA 2ZVNB 1R5SA 2L5GB 2WPVB 1C6RA 1SQQJ 2QVAA 2QEXP 3L71E 1N73A 3WC8A 3CC7P 1HF9A 1CRJA 4A7PA 4ZMDA 1L4AB 2E74B 1DD3A 4C7RA 1YTZI 1FDOA 3SVWA 2Z5HA 4EI2A 1N86A 3HQ7A 1M1JC 5AVRB 3DP5A 1SQPD 2ORLA 4EIJA 1FOSF 1AYGA 2H7HA 1NO4A 1EZVE 1VF5B 3ZOOA 1T2KD 1ZW0A 3GMAA 3ZOYA 1LTIC 4K35A 2B12B 2ZZS1 3ZBMA 3CWBD 1K73Q 4WQ9A 2PRRA 2N1TD 4OVNF 1QN2A 2QA4P 1KQLA 2KIKA 3OW2O 3M97X 1DT1A 5AW8B 2KOGA 1PPJG 1H31B 1PPJD 3OCDA 1C7MA 5H2FE 5AVVB 3WFBC 1IFDA 3A0HV 2JDIH 1CSWA 1SLQA 5CMZA 5AVSB 2A45G 5KTBA 1I8PA 1S5LX 4RKUJ 5CCHD 1CXAA 1H32A 4I2LC 2CA3B 2HPCA 3CCVP 1OMIA 1BL9A 5AVXB 1ZMEC 3OAKA 2Q3EA 3E1IA 3Q1MA 4Y99C 2OARA 3G9RA 1YJNP 4QAOA 5AW4B 3D6ZA 2A06E 1D7MA 1YJWP 1E5WA 4NPDA 1KILD 155CA 1COTA 3H1IG 2BASA 4U3FG 1NTMG 1N7SB 5BU8B 5TISE 1JY3P 1SQBJ 1GIWA 2UWJE 2P1JA 4UB6E 1CORA 1KILA 1PGPA 5AVTB 1KV4A 1SQXK 1L0ND 2ZYAA 1USDA 1FZBA 4KHXA 1SQQK 3HRNA 5BU5A 1CSXA 1RAPA 1QL2A 3L72G 3AECC 1J1DB 1XTCC 1KYOW 1KORA 2YKOA 2XZRA 5CCGC 1K04A 1LC1A 2AEMA 4LC1A 3HTKA 4W7ZA 2QJKC 1NU1E 1JY2N 2D0WA 3AE5C 2JO1A 1N8RQ 5KLIC 1S5LH 4DY9A 1K05A 1A2SA 1CRCA 3M9HA 1X8YA 5GTIH 1NTZG 2ZAEB 1NTZD 4L3GA 2MTAC 4JYCA 3HD7C 1LWUC 2QE7H 2Y0DA 3AEEC 1FDIA 3FGAD 1KQSO 5DJTB 3TNUB 3BATA 3NFQA 4GOEA 1BSHA 1K8AQ 3QWOC 1FJPA 2WT7B 4W80A 3HQ8A 2WQYC 4R4MA 1EZVG 1LP1A 3L37A 2OYIB 4C7NA 2C1DA 5B5EH 4OGQC 1AVYA 3O6QA 5GTHE 3VP9A 3WFDC 1CIFA 1RQUA 3L70D 1ZZHA 1S3JA 2B0ZB 3TGUG 3TGUD 2N9IA 4K3IA 2YKQA 3H25A 2ZYGA 1NIRA 1N2DC 2C9NY 2Y0CA 3OA8B 1F1FA 5H2FV 1JTHA 5BVZA 1JNMA 1GW4A 2AEFA 2IBZI 2IPPA 3WFCC 2WPRA 1B7VA 3RK2C 1BE3D 1GU5A 2Z5IA 3CD6P 1FAVA 3H32B 2E5YA 2CK3H 1NHLA 2Q9IA 5KKZC 3I56P 3II6A 1HJ0A 2WTYA 1IO4A 1SQBK 1KQFB 1I54A 3ORVA 3MUDA 3CX5W 1W5CT 4L73A 3L4FA 3A7OA 1MG3D 2PCBB 1YI2P 1OIPA 2D0SA 2K88A 2M5AB 1OXZA 1FU1A 4WQCA 4EIDA 2O01J 2A06G 1OW6A 1BDDA 1BSNA 1FE6A 1CZQA 2HV4A 1VQ8P 4UB6V 5KLVG 3H1LD 5KLVD 2V7QH 1VF5D 4L75A 2JKVA 1FI3A 3H1IJ 1USEA 3H1KE 4YE1A 4U3FJ 1NTMJ 4H13C 1M1JA 3CXHW 2O3JA 3MTUE 3RL0C 2FYUK 1KIBA 4KT0J 2V07A 1JUNA 2XKMA 2ZXEB 1EXJA 1CIEA 2LXCB 2LKMA 3NXSA 4P4QB 3L72J 4YPCA 3F5HA 1NTKK 1CTZA 1S2EA 2JWAA 3BRTB 1NU1G 3FX0A 2W8ZA 3KYQA 1KV9A 2WSSH 5AW2B 4JF7A 1QVGO 4PJ0H 1LT9C 1RE3C 5APTA 2QJYB 3CC4P 1YEAA 3V5BA 2WSEJ 3VMAA 2GC4D 1NTZJ 3PH2B 4PD4E 5AW1B 1FZCB 3L75D 4QMAA 2BCNB 1S4XA 2IBZD 2IZ1A 3FWLA 2C9XB 3B5ND 1HWTC 3L73D 3TYYA 2N1TC 5M1BA 3CI9A 2FXOA 1OW8A 1AQTA 3RBXA 1LTJB 4YTPC 2CPBA 4TLFA 3B5NA 1FHBA 5DJUB 3KPEA 2J59M 1H89A 2O01N 4N78D 1CRGA 3VMYA 3IFMA 2XDJA 2WMMA 2KI7B 3GW6A 2E75C 1TU3F 2YIUB 5IY51 1YBKA 4GDOA 4ASVA 5CCHC 4EDFA 3P8MC 1ZN5A 2AXTH 3CU4A 1JY3N 4D6TE 1N90A 1SFCB 1N50A 2ZT9C 1OW7A 1OX3A 2CE0A 2IFNA 3SXTA 1C75A 2WPSA 1SQPE 3WU2H 5AVQB 3RBZA 1AV1A 1Y8AA 4GYDA 1KX7A 5CCGA 3HUSA 1YICA 4WY4B 1HVVA 1QVFO 3ZOWA 1FOSE 1NTMK 3HD7D 1CI6B 2BH5X 3GF3A 3CWBE 1T8ZA 3CPWO 3KDPB 2EXVA 5KAFE 1BGYD 3A0BH 2HODB 1G2CA 5E79H 4GEDB 2K9JB 2KK7A 3HD7A 2IZ0A 2D2CD 1LWUA 1JMBA 5KAIE 4LGDE 1GL2B 1RF1C 1RAQA 1PPJE 2ZJSE 1WMKA 2MKVA 5KLVJ 3H1KG 5AVWB 1P84I 1YTZT 1OVUA 1MZ4A 1P84H 3UIAA 3U1CA 1HJBA 2CE1A 3I55P 2JR8A 5APSA 2WSCH 3RK3B 3PLNA 2OQQA 5DJQB 3LIDA 3GF7A 2B11B 2VRSA 2AI5A 2FY8A 1KILE 2J58A 4H44B 1NAFA 2XV5A 1HUCA 1IJDB 1N15A 2RKLA 3GHGB 3SFDC 4HJGH 1DVHA 2I1KA 1NU1J 1NJIQ 1J1EC 1L0NE 2H43A 2B87A 2R44A 4OWFA 3CMAP 1F1CA 1H0TB 2DVHA 1RHZB 3CP5A 1WEJF 3ZOXA 2GUVA 3P32A 1EXIA 1IFMA 3B71A 4M3LA 2MHMA 1ZOYC 4L1QA 1Q82Q 3PTZA 3LIEA 1IZNB 2OYHB 1IFJA 2WSFH 1EDIA 4HH2A 3V6IA 3ZDMA 2KS1B 1S72P 1Y47A 3MUDC 3RL0D 3KZIV 2Q6QA 4XE5B 3WUIA 1NTZE 3IF4A 1VQKP 1OCDA 1L4AC 3BCCD 2ITAA 3PJSK 4GKGA 2E74C 1QKSA 3MK7B 2YMYA 4D6TG 1RE4C 4D6TD 2RMZA 3V4WA 3VYIA 3M9QA 1URQD 2Q7CA 1P84D 3MHVA 1SQPG 3O0RC 1AJYA 5L8RJ 3AEGC 3G71P 1VF5C 2FFDB 3JCUH 1YEBA 4WWIA 3T97B 1URQA 3L74D 4L74A 1X0TA 3S9OA 5KAFV 3R2PA 3L70E 2OZ1A 3WUVA 1WVEC 3MP7B 3CWBG 2M0BA 1LT9A 1RE3A 3ITKA 3A9FA 3TGUE 1JDLA 2W83C 3Q5RA 1H1OA 4DZOA 4H0LB 4XXLA 1ZXGA 4UB8H 2N1TA 4WQ8A 2N9YB 3C2CA 1BE3E 1LNQA 2Y9ZA 1GTWA 5CJ0A 2E75D 2E76B 1JB0J 3H1KJ 4W7YA 2P7JA 1NU1K 3CMEP 1CHHA 2RN0A 3V2PA 2ZT9D 1QGKB 1S5LE 1CIHA 3HE4A 4ZNCA 5CCHA 5GTIE 3B5NC 3MD0A 1LT1A 1IC2A 4BRYB 1AA0A 3H1LE 5KLVE 1SQVG 1SQVD 4WY4D 5K5GB 1CEDA 3ABVC 2KSJA 3O20A 2I1JA 1PIXA 3LW5J 4NPFX 1U75B 2QJPC 1SP4A 1YCCA 3EFGA 4Y99B 1L0NG 3NTNA 3RMZA 1JY3O 3IAOA 1J1DC 1KYOH 2E42A 2M8RA 2YXRB 1NMIA 1M8OB 2B4ZA 3RN1A 5B66H 4MN4C 5B5EE 5AW6B 1GL2D 3VOPA 3HUSC 2BCCD 1HGZA 2QG4A 1M6ZA 1RY3A 2B88A 1KB9H 1ZRTD 2IFMA 5APQA 1AKKA 1IK9A 1MV8A 1RF1A 2N18B 3H1HG 3RK3D 3H1HD 1SS1A 3N7NA 4K3AA 1YIQA 3A3YB 2P2UA 3L75E 3U1AA 2IBZE 2Y0EA 1H9YA 1JCDA 3L73E 1H33B 1FZFA 2C1VA 1UIIA 1NWQA 4ASWA 5AVZB 4D6TJ 1L0LD 5CHXA 1X79B 1CHJA 1HCMA 2D2CC 1LGHB 3SJLA 1DIPA 2PCCB 2OYIC 1FJ0A 1SQPJ 4N78E 1ETPA 4PWAA 2XNXA 4BWNA 2PACA 2I8DA 2KNCA 1QL1A 3L70G 1KMIZ 3AEDC 2FYZA 3AEBC 1PP9D 1G1JA 4XA4A 1IRVA 1E8EA 5EXQA 1KFNA 3CWBJ 3AEFC 1ZP0C 1RF0C 4KJMA 1EB7A 4KMGA 2OTKE 4EYYQ 4IL6E 1VQ6P 4B86A 2GIWA 3ZIYA 2B9BA 1YHQP 1RZ6A 1KYOD 3K5BA 1BE3G 1M56D 5DF5A 2CPSA 2ZBOA 3HE5B 1DH3A 1L4AD 2E74D 3CX5H 2Y9YA 1QL3A 2CA4B 1RZ5A 1ZR2A 1CNOA 4HKZH 1KB9D 1HBWA 1A8CA 2JQRA 1FZEA 1L4AA 1E2RA 2WSFJ 1BGYE 3PH0A 4PJ0E 1C2RA 3G4SP 3AE9C 5TISV 4PV1B 3SWYA 1RE4A 1K3HA 4NPEA 1MKMA 3H1LG 2KP8A 3CCJP 3Q3DA 3Q5SA 3CXHI 3A2AA 4DT0A 3CXHH 1SQVJ 3HQ9A 5KJ7D 1OFCX 1S9KD 2V4HA 3B4SA 1FI9A 2NPSB 1DIQC 4RSZA 1DW0A 1L0NJ 2KSEA 3O1YA 2E43A 1N73B 1BDCA 2YKPA 4H0LD 1NOHA 1PGJA 2N3YA 4I7ZB 3AE4C 1URQC 2Q3IA 1YTCA 1LTGC 2QJYC 3SFEC 1H31A 3CCRP 2ZXXA 2YNYA 1DIIC 1GU4A 1SQPK 1FZCC 4XFJA 2C9LY 3E1RA 3USSA 3WU2E 1I6EA 1GD2E 3L75G 2IBZG 4ZKPA 2R32A 1CRIA 3CL3D 3BVHA 3L73G 5AVYB 2W90A 3P8CD 2BEZF 3SSUA 1VQLP 2K9YA 1ZLLA 2WWWA 1N7SD 4EIEA 1LTJC 3CX5D 1NYHA 1DW3A 5GTHV 1DEBA 4V2KA 2ZYDA 1OVRA 4BXLA 1CXCA 1N7SA 4OH8B 2YIUC 5CJ4A 4L3HA 3A0BE 5E79E 2ZXYA 3V2NA 3L35A 3BCCE 1U57A 1VQNP 1NNOA 1CC5A 1SQXD 3OCDB 4I6MC 4WQBA 1SFCC 2YK3A 1SQQD 4IL6V 3CXHD 1DVVA 1T3JA 2BH4X 3L70J 2FWLA 1S6VB 1DW2A 1H32B 1NMLA 1YJ9P 2HLOA 1I8OA 2HPCB 2YXQB 1P84E 3TGUJ 4Q5PA 3D71A 1CSBA 1GDVA 4AANA 1WRGA 4DCKA 2V08A 4WY4C 2ZFCA 4N6JA 1H88A 4WB4A 1IO3A 1IRWA 1OVVA 3L74E 3KQGA 3PP5A 1BE3J 2K1AA 3PXWA 1KZUB 4PJ0V 4DOJA 1R5LA 4RESB 1AOFA 3D70A 1KILB 1M57D 1EDLA 4Y5RA 2PGDA 1JM0A 1L0NK 2GB8B 2YO2A 1BGYG 3CC2P 2N9BA 1GL2C 3TNUA 1A02F 1HZUA 3H1LJ 1JY2P 2WT7A 2R3SA 1IK7A 4ZKUA 3CLQA 2G8YA 1H9XA 2H89C 1KB0A 2P10A 2SPZA 3HTKB 2OYIA 3RK3C 1YIJP 1PGQA 3KZIH 5DJQC 3OA7A 5APYA 4WQDA 4H44C 1QX8A 1NTZK 3GHGC 2AXCA 2KZJA 1YQ4C 1SQVE 1E79H 1GK4A 2YQBA 3OA8A 1VQMP 1DD4A 1C6SA 1J3SA 1RF0A 1S1CX 3DR0A 3O8ZA 2FYNB 3H1JG 3V4QA 1L2PA 3H1JD 3WU2V 1HJ5A 3MGNA 1VQ5P 3H32A 1CCRA 3L4MA 5TJHA 4MU8A 3C9IA 1LP1B 1SQBG 1SQBD 5AW3B 1QLED 4PV1D 4C7NB 2C1DB 2W6JH 3JCUE 3O6QB 3L75J 1VQ9P 2LR2A 2OYHC 2PAJA 2M5AA 2PP6A 2BCCE 3L73J 1LTTC 5APWA 2CXBA 1I55A 2N9JA 3MIWA 1CCHA 5E79V 1IFNA 1ZRTE 3S1KA 4N0KA 5CBOA 1JTHB 2KUBA 5CIHB 3RK3E 3H1HE 4XYDB 3BCCG 3MK7C 5CYTR 2FYUG 1CYIA 2FYUD 1U7MA 2HFED 3A0HH 4UB8E 1NKNA 5C39A 1M1KQ 1KC8Q 2O01H 2DW3A 2V7QJ 1AVOA 2ZOOA 1X9VA 2VHDA 1L0LE 1ZR4A 3VP8A 1RH5B 3X39A 2R5BA 1I6DA 5CIFB 1KX2A 1Q7YQ 3N4XA 2FFDC 3VNWA 1NTKG 3P7KA 1NTKD 1BCCG 2L91A 3SWFA 1BCCD 2IX7C 2PFXA 1Q86Q 5KJ7C 3WMM0 3L74G 3L36A 2GC7D 4AAMA 4IFMA 2E5TA 5KLVK 1C52A 3TK1A 1PP9E 1LJ2A 1M1JB 1E29A 5KAIV 1W2LA 1VDFA 1FZGA 1YQ3C 1FZCA 5CIBB 2C0WA 2XTSB 4H0LC 3KHUA 2ZVOB 5CIGB 1R0QA 3TYIA 1BGYJ 2HR3A 4IOIH 1KYOE 1LS9A 3MZWB 2WZ7A 3EFFK 2FKWB 3M0DC 1LTJA 2E76C 2O1KA 5B66E 2R5DA 2LIRA 2WSEH 5C0ZA 1K3GA 1RQVA 1GQ1A 3I5CA 2M3EA 1SFCD 2NRGA 2IYOA 4U7JA 2QRXA 1A02J 3E7KA 3SLEA 1KB9E 1HGVA 5CBNA 4WQAA 4EICA 3M9BA 3ZCFA 1SFCA 5AW9B 2FXMA 1HTLC 3JBTB 3WUUA 1N7SC 3EQ2A 1M90Q 3FXDA 3VMZA 1EZVI 5AURA 2WPQA 1N9CA 3PHLA 4AUWA 1OWAA 2RH0A 3RN0A 4YXWH 1IFPA 1S9KE 3CCUP 4FA9A 4C46A 1FS0E 3CCLP 3H1JJ 4AALA 4WY4A 4AYCA 3R4YA 3BASA 2DGEA 2BEQD 1KYOI 3B5NB 3C1LA 3H1ID 1KQGB 2OTLP 4U3FD 1NTMD 2C8SA 3CCQP 1HZVA 1CI6A 2AIUA 2YMKA 1LTSC 2W6BA 4LLHA 3NBTA 1T3UA 4L76A 2POHA 5APUA 3JC22 2QJPB 3AEAC 2BCCG 1A56A 4JYBA 3FWNA 2HODA 3GG2A 1FJKA 2K9JA 2JP3A 3B8EB 5AVUB 5APXA 1KB9I 2C1UA 3L72D 3CYTI 2JEEA 1GL2A 4GOFA 1NKZB 5H2FH 2N18C 1MZ9A 2QM8A 4UB8V 1YYCA 4JQ0D 1CHIA 1PGOA 1KN7A 3WUTA 3EWKA 3HUSB 3BCCJ 2N3BA 1IFIA 2FYUJ 3G6EP 4H44D 2QJKB 3P8CE 2ZONG 1CTJA 1NGMB 1L0LG 3L71G 3L71D 3CX5E 3WFEC 5KLIB 3PRJA 1U74B 4WVZA 2JJLA 1PFIA 1CTYA 2YO3A 1Z56A 3M0AA 1OAEA 1JMMA 5AW7B 4J20A 1CSUA 3GHGA 5TISH 1G2CB 1CYCA 1Y9BA 2FXPA 1SVFA 1NTKJ 3HD7B 4EOTA 2OTJP 1LWUB 1BCCJ 2WSCJ 3CCMP 4UB6H 3F89A 1VL2A 3V2QA 1Q90D 1KTMA 3L74J 1SQXE 3O5CA 4RO0A 1T6AA 1LTAC 1PP9G 1SQQE 3CXHE 3OJAB 2P67A 1EC5A 2D2CB 1EZVD 3U59A 1H0TA 2IYPA 1LC2A 351CA 1NVOA 5B66V 3BRVB 1L9BC 4OGQB 4IL6X 1QEXA 2OYHA 3W67A 2KS1A 1YITP 3VMXA 3CX5I 4H0JA 1GMJA 3L4OA 1S5LV 3AE8C 5GTIV 3TDKA 1AFOA 1CRHA 1LFMA 2FRCA 1NH4A 2C2CA 3VN0A 4PV1C 3Q2YA 4IFFA 2B87B 3RK2B 3PXSA 5AW0B 3RGUA 5KKZB 2R3CA 3JSVC 4H0KA 1CRYA 1NAYA 2P58A 1HRCA 2Q1KA 1VPCA 2NPSC 1FI7A 2FFDA 3V2RA 4FAVA 3VTPC 1N7LA 2A06D 1L9JC 5GTHH 3T97A 3AE7C 4O1QA 1Q2NA 5B5EV 1JEKA 2KB7P 1N73C 5KJ7A 4FA1A 4GIFA 1X22A 3AE1C 5CIDB 1XTGB 2KYVA 4I7ZC 1LTBC 3G3ZA 1KD1Q 3RL0g 3HQ6A 5DFSA 2NZ2A 1J2JB 4H13B 3S4RA 5C9MA 5CIEB 1JCCA 4HB1A 1C2NA 4IL6H 1W5CE 1AOQA 2HG5D 3RL0B 1FZAA 2AXTE 2BCCJ 3A5TA 2E76D 3H1JE 1M7LA 5AW5B 2M3BA 3KXDA 3TSIA 4WQ7A 1HJ3A 3IN6A 1CO6A 5CICB 2W6AA 1IQCA 3M0DA 1GW3A 1GDTA 1SQBE 1MFZA 3H1HJ 3M06A 1NU1D 2OYOA 1URQB
chains in the Genus database with same CATH topology
3HQ8A 1H1OA 1VYDA 1GU2A 4XXLA 3DMIA 2YQBA 2OZ1B 4WQ8A 2N9YB 3C2CA 3OA8A 2C1DA 1YFCA 1J3SA 1C6SA 3DR0A 2FYNB 451CA 3H1JD 3WU2V 1FCDC 3WFDC 1CIFA 1HJ5A 2YCCA 3L70D 1M60A 1ZZHA 1CHHA 2RN0A 1CCRA 2B0ZB 3L4MA 5TJHA 4MU8A 3TGUD 2N9IA 4K3IA 1NIRA 1SQBD 1CIHA 3OA8B 2Y0CA 2C1DB 1F1FA 5H2FV 1C6OA 3WFCC 1SQVD 1CEDA 1B7VA 1BE3D 2CXBA 4FA5A 1I55A 2N9JA 3O20A 1CCHA 5E79V 1GKSA 1U75B 4FB1A 1YCCA 4N0KA 1I54A 3ORVA 3CX5W 3RMZA 1W5CT 5CIHB 1MG3D 4XYDB 2PCBB 3MK7C 5CYTR 1CYIA 2D0SA 2FYUD 4WQCA 4EIDA 4PW9B 2JTIB 1NMIA 2B4ZA 3RN1A 2HV4A 1I5TA 1QL4A 3VYMA 4UB6V 2ZOOA 3H1LD 5KLVD 2VHDA 2BCCD 3X39A 2QG4A 1I6DA 5CIFB 1KX2A 1FI3A 1M6ZA 4FA4A 1CYJA 3PXTA 4YE1A 4RJTA 1H33A 2BPBB 3RLMA 3CXHW 3VNWA 2O3JA 1ZRTD 1NTKD 2L91A 1BCCD 1AKKA 1KIBA 2V07A 2N18B 3VRDA 2GC7D 3H1HD 4AAMA 1YIQA 1C52A 1CIEA 2B10B 4EIFA 2Y0EA 4P4QB 1H9YA 4AX3A 1H33B 2C1VA 1E29A 5KAIV 1W2LA 1L0LD 4O1WA 5CIBB 1CTZA 1LMSA 2JWAA 2XTSB 1CHJA 1HCMA 1MG2D 2AXTV 4NFGB 3KHUA 3H1KD 1GJQA 1KV9A 3SJLA 5CIGB 1R0QA 2PCCB 3TYIA 1DW1A 1FJ0A 1CIGA 1LS9A 4AAOA 1YNRA 2QJYB 2BLFB 1ETPA 3NBSA 1YEAA 4PWAA 3NWVA 4WQEA 3VMAA 1IZL0 2LIRA 2GC4D 5B6QA 3PH2B 4JCGA 5C0ZA 1K3GA 2PACA 1GQ1A 3L75D 2BCNB 2IBZD 3FWLA 4FANA 2L4DA 1FOCA 1PP9D 2C9XB 3L73D 1IRVA 1E8EA 5EXQA 3TF5A 3SLEA 1M70A 1HROA 4WQAA 1EB7A 4EICA 4KMGA 2I8FA 3ZCFA 2GIWA 3ZIYA 3JBTB 1FHBA 1RZ6A 1KYOD 2KNCB 1CRGA 4LJIA 2BGVX 5DF5A 3A0BV 1CSVA 3GW6A 2ZBOA 5AURA 1N9CA 3PHLA 3RN0A 2YIUB 5IY51 4PD4D 4EDFA 4FA9A 1HJ4A 2LITA 1QL3A 2CA4B 3CU4A 1RZ5A 4AALA 1N90A 2DGEA 1HH7A 1QYZA 1CNOA 1N50A 3H1ID 1KB9D 1A8CA 2JQRA 4U3FD 1NTMD 1E2RA 2C8SA 2CE0A 1HZVA 3SXTA 2AIUA 1C2RA 1C75A 5TISV 3NBTA 4GYDA 3SWSA 1K3HA 2QJPB 1KX7A 1C6RA 1A56A 1YICA 3WC8A 3GG2A 3HQ9A 1CRJA 4A7PA 2C1UA 3ZOWA 3L72D 3CYTI 2N18C 2BH5X 4UB8V 1FI9A 1DIQC 3SVWA 4RSZA 1CHIA 1DW0A 3O1YA 2EXVA 1BGYD 3HQ7A 2N3BA 4GEDB 2K9JB 3DP5A 1SQPD 2ORLA 2QJKB 1AYGA 2ZONG 1CTJA 2N3YA 1RAQA 3L71D 3PRJA 3WFEC 5KLIB 3ZOOA 1U74B 1YTCA 3ZOYA 1CTYA 2B12B 1OAEA 1MZ4A 1H31A 1CSUA 2ZZS1 4J20A 3ZBMA 1CYCA 3CWBD 1DIIC 4WQ9A 2CE1A 1I6EA 3PLNA 1QN2A 3O5CA 5DJQB 2B11B 1CRIA 2AI5A 3M97X 1DT1A 1EZVD 1H31B 1N15A 1PPJD 3OCDA 4EIEA 1C7MA 3CX5D 1LC2A 351CA 1DW3A 3WFBC 5B66V 3A0HV 1DVHA 1CSWA 5GTHV 1L9BC 1I8PA 1CXAA 1H32A 4V2KA 2CA3B 1CXCA 4L3HA 1BL9A 2ZXYA 2Q3EA 2KS1A 1NNOA 1F1CA 1CC5A 1SQXD 2DVHA 3L4OA 3OCDB 4H0JA 1S5LV 4QAOA 3CP5A 4WQBA 1WEJF 3ZOXA 2YK3A 5GTIV 1SQQD 4IL6V 3CXHD 1DVVA 3TDKA 2BH4X 155CA 1COTA 1S6VB 2FWLA 2MHMA 1CRHA 1DW2A 1H32B 1LFMA 2FRCA 1NMLA 2C2CA 4L1QA 1I8OA 3PTZA 4Q5PA 1GDVA 1GIWA 3PXSA 4AANA 1CORA 2V08A 5KKZB 1L0ND 3KZIV 3WUIA 1IO3A 1OCDA 1IRWA 4H0KA 1CRYA 1CSXA 1HRCA 3BCCD 1RAPA 1QKSA 3PXWA 1FI7A 4FAVA 4PJ0V 1KYOW 3MK7B 2A06D 1L9JC 4D6TD 4O1QA 1AOFA 5B5EV 1LC1A 2RMZA 4Y5RA 4FA1A 2GB8B 1P84D 5CIDB 2D0WA 3O0RC 3HQ6A 4DY9A 5DFSA 1A2SA 5C9MA 1CRCA 5CIEB 1C2NA 1YEBA 1AOQA 1HZUA 1NTZD 4L3GA 3L74D 2MTAC 5KAFV 1H9XA 1KB0A 2OZ1A 4WQ7A 1WVEC 2Y0DA 1HJ3A 1CO6A 3ITKA 3A9FA 5CICB 1IQCA 5DJQC 1JDLA 4WQDA 1NU1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQ8 A;  1H1O A;  1VYD A;  1GU2 A;  4XXL A;  3DMI A;  2YQB A;  2OZ1 B;  4WQ8 A;  2N9Y B;  3C2C A;  3OA8 A;  2C1D A;  1YFC A;  1J3S A;  1C6S A;  3DR0 A;  2FYN B;  451C A;  3H1J D;  3WU2 V;  1FCD C;  3WFD C;  1CIF A;  1HJ5 A;  2YCC A;  3L70 D;  1M60 A;  1ZZH A;  1CHH A;  2RN0 A;  1CCR A;  2B0Z B;  3L4M A;  5TJH A;  4MU8 A;  3TGU D;  2N9I A;  4K3I A;  1NIR A;  1SQB D;  1CIH A;  3OA8 B;  2Y0C A;  2C1D B;  1F1F A;  5H2F V;  1C6O A;  3WFC C;  1SQV D;  1CED A;  1B7V A;  1BE3 D;  2CXB A;  4FA5 A;  1I55 A;  2N9J A;  3O20 A;  1CCH A;  5E79 V;  1GKS A;  1U75 B;  4FB1 A;  1YCC A;  4N0K A;  1I54 A;  3ORV A;  3CX5 W;  3RMZ A;  1W5C T;  5CIH B;  1MG3 D;  4XYD B;  2PCB B;  3MK7 C;  5CYT R;  1CYI A;  2D0S A;  2FYU D;  4WQC A;  4EID A;  4PW9 B;  2JTI B;  1NMI A;  2B4Z A;  3RN1 A;  2HV4 A;  1I5T A;  1QL4 A;  3VYM A;  4UB6 V;  2ZOO A;  3H1L D;  5KLV D;  2VHD A;  2BCC D;  3X39 A;  2QG4 A;  1I6D A;  5CIF B;  1KX2 A;  1FI3 A;  1M6Z A;  4FA4 A;  1CYJ A;  3PXT A;  4YE1 A;  4RJT A;  1H33 A;  2BPB B;  3RLM A;  3CXH W;  3VNW A;  2O3J A;  1ZRT D;  1NTK D;  2L91 A;  1BCC D;  1AKK A;  1KIB A;  2V07 A;  2N18 B;  3VRD A;  2GC7 D;  3H1H D;  4AAM A;  1YIQ A;  1C52 A;  1CIE A;  2B10 B;  4EIF A;  2Y0E A;  4P4Q B;  1H9Y A;  4AX3 A;  1H33 B;  2C1V A;  1E29 A;  5KAI V;  1W2L A;  1L0L D;  4O1W A;  5CIB B;  1CTZ A;  1LMS A;  2JWA A;  2XTS B;  1CHJ A;  1HCM A;  1MG2 D;  2AXT V;  4NFG B;  3KHU A;  3H1K D;  1GJQ A;  1KV9 A;  3SJL A;  5CIG B;  1R0Q A;  2PCC B;  3TYI A;  1DW1 A;  1FJ0 A;  1CIG A;  1LS9 A;  4AAO A;  1YNR A;  2QJY B;  2BLF B;  1ETP A;  3NBS A;  1YEA A;  4PWA A;  3NWV A;  4WQE A;  3VMA A;  1IZL 0;  2LIR A;  2GC4 D;  5B6Q A;  3PH2 B;  4JCG A;  5C0Z A;  1K3G A;  2PAC A;  1GQ1 A;  3L75 D;  2BCN B;  2IBZ D;  3FWL A;  4FAN A;  2L4D A;  1FOC A;  1PP9 D;  2C9X B;  3L73 D;  1IRV A;  1E8E A;  5EXQ A;  3TF5 A;  3SLE A;  1M70 A;  1HRO A;  4WQA A;  1EB7 A;  4EIC A;  4KMG A;  2I8F A;  3ZCF A;  2GIW A;  3ZIY A;  3JBT B;  1FHB A;  1RZ6 A;  1KYO D;  2KNC B;  1CRG A;  4LJI A;  2BGV X;  5DF5 A;  3A0B V;  1CSV A;  3GW6 A;  2ZBO A;  5AUR A;  1N9C A;  3PHL A;  3RN0 A;  2YIU B;  5IY5 1;  4PD4 D;  4EDF A;  4FA9 A;  1HJ4 A;  2LIT A;  1QL3 A;  2CA4 B;  3CU4 A;  1RZ5 A;  4AAL A;  1N90 A;  2DGE A;  1HH7 A;  1QYZ A;  1CNO A;  1N50 A;  3H1I D;  1KB9 D;  1A8C A;  2JQR A;  4U3F D;  1NTM D;  1E2R A;  2C8S A;  2CE0 A;  1HZV A;  3SXT A;  2AIU A;  1C2R A;  1C75 A;  5TIS V;  3NBT A;  4GYD A;  3SWS A;  1K3H A;  2QJP B;  1KX7 A;  1C6R A;  1A56 A;  1YIC A;  3WC8 A;  3GG2 A;  3HQ9 A;  1CRJ A;  4A7P A;  2C1U A;  3ZOW A;  3L72 D;  3CYT I;  2N18 C;  2BH5 X;  4UB8 V;  1FI9 A;  1DIQ C;  3SVW A;  4RSZ A;  1CHI A;  1DW0 A;  3O1Y A;  2EXV A;  1BGY D;  3HQ7 A;  2N3B A;  4GED B;  2K9J B;  3DP5 A;  1SQP D;  2ORL A;  2QJK B;  1AYG A;  2ZON G;  1CTJ A;  2N3Y A;  1RAQ A;  3L71 D;  3PRJ A;  3WFE C;  5KLI B;  3ZOO A;  1U74 B;  1YTC A;  3ZOY A;  1CTY A;  2B12 B;  1OAE A;  1MZ4 A;  1H31 A;  1CSU A;  2ZZS 1;  4J20 A;  3ZBM A;  1CYC A;  3CWB D;  1DII C;  4WQ9 A;  2CE1 A;  1I6E A;  3PLN A;  1QN2 A;  3O5C A;  5DJQ B;  2B11 B;  1CRI A;  2AI5 A;  3M97 X;  1DT1 A;  1EZV D;  1H31 B;  1N15 A;  1PPJ D;  3OCD A;  4EIE A;  1C7M A;  3CX5 D;  1LC2 A;  351C A;  1DW3 A;  3WFB C;  5B66 V;  3A0H V;  1DVH A;  1CSW A;  5GTH V;  1L9B C;  1I8P A;  1CXA A;  1H32 A;  4V2K A;  2CA3 B;  1CXC A;  4L3H A;  1BL9 A;  2ZXY A;  2Q3E A;  2KS1 A;  1NNO A;  1F1C A;  1CC5 A;  1SQX D;  2DVH A;  3L4O A;  3OCD B;  4H0J A;  1S5L V;  4QAO A;  3CP5 A;  4WQB A;  1WEJ F;  3ZOX A;  2YK3 A;  5GTI V;  1SQQ D;  4IL6 V;  3CXH D;  1DVV A;  3TDK A;  2BH4 X;  155C A;  1COT A;  1S6V B;  2FWL A;  2MHM A;  1CRH A;  1DW2 A;  1H32 B;  1LFM A;  2FRC A;  1NML A;  2C2C A;  4L1Q A;  1I8O A;  3PTZ A;  4Q5P A;  1GDV A;  1GIW A;  3PXS A;  4AAN A;  1COR A;  2V08 A;  5KKZ B;  1L0N D;  3KZI V;  3WUI A;  1IO3 A;  1OCD A;  1IRW A;  4H0K A;  1CRY A;  1CSX A;  1HRC A;  3BCC D;  1RAP A;  1QKS A;  3PXW A;  1FI7 A;  4FAV A;  4PJ0 V;  1KYO W;  3MK7 B;  2A06 D;  1L9J C;  4D6T D;  4O1Q A;  1AOF A;  5B5E V;  1LC1 A;  2RMZ A;  4Y5R A;  4FA1 A;  2GB8 B;  1P84 D;  5CID B;  2D0W A;  3O0R C;  3HQ6 A;  4DY9 A;  5DFS A;  1A2S A;  5C9M A;  1CRC A;  5CIE B;  1C2N A;  1YEB A;  1AOQ A;  1HZU A;  1NTZ D;  4L3G A;  3L74 D;  2MTA C;  5KAF V;  1H9X A;  1KB0 A;  2OZ1 A;  4WQ7 A;  1WVE C;  2Y0D A;  1HJ3 A;  1CO6 A;  3ITK A;  3A9F A;  5CIC B;  1IQC A;  5DJQ C;  1JDL A;  4WQD A;  1NU1 D; 
#chains in the Genus database with same CATH topology
 4R4L A;  1U7J A;  1VYD A;  2WIT A;  2WVR A;  1GU2 A;  2H8P D;  3DMI A;  2OZ1 B;  1T2K C;  1YFC A;  1LT9 B;  3D6Y A;  1L0L J;  3L71 J;  4TT3 H;  451C A;  4BRY A;  1FCD C;  4GT1 A;  2YCC A;  1M60 A;  2G3A A;  2GA1 A;  4Z1M H;  1G1I A;  2KLU A;  1WT6 A;  2FYU E;  1SQX G;  2N1T B;  1VQ7 P;  2AEJ A;  1C6O A;  2IDB A;  1PV3 A;  1SQQ G;  4IFD K;  1OZH A;  1JO5 A;  4O9B A;  1PP9 J;  1FC2 C;  4FA5 A;  1GKS A;  1VQO P;  3LW5 H;  4FB1 A;  1FBM A;  1NTK E;  2E75 B;  3KZI E;  4N3Y B;  1BCC E;  3HE4 B;  1GK6 A;  2HYN A;  4GOD A;  5CCG D;  1H8A A;  3IR9 A;  3C8V A;  2XU6 A;  1SQV K;  2Q5U A;  4PW9 B;  2JTI B;  1UIX A;  2ZT9 B;  3FXE A;  4AQR D;  1KIL C;  1I5T A;  1MFT A;  4PD4 I;  1QL4 A;  1W2B O;  4PD4 H;  2JWD A;  3VYM A;  1MUU A;  4JBZ A;  2KLV A;  4FA4 A;  1DEE G;  1CYJ A;  3PXT A;  2KZI A;  4RJT A;  4WBA A;  1H33 A;  2BPB B;  3RLM A;  2LXB A;  3CCS P;  2C0X A;  3GLM A;  2O1J A;  3VRD A;  2H88 C;  3H6P A;  2B10 B;  2GM4 A;  1Q81 Q;  4EIF A;  1HH0 A;  4CPG A;  4AX3 A;  4YXD C;  1JY2 O;  3M91 A;  3AE6 C;  3QH9 A;  1EQ7 A;  3NMD A;  3SWK A;  2K37 A;  4O1W A;  1LMS A;  1VQ4 P;  1KFM A;  1RF1 B;  1MG2 D;  2AXT V;  4NFG B;  3H1K D;  4OGQ D;  1GJQ A;  1ZV8 A;  4Y28 J;  1PZQ A;  3W68 A;  1DW1 A;  1CIG A;  2J5U A;  4AAO A;  1EDK A;  3CCE P;  1YNR A;  2BLF B;  2FYN C;  3NBS A;  4HYT B;  3NWV A;  4WQE A;  2QM7 A;  3A0H E;  1IZL 0;  5APV A;  5B6Q A;  4JCG A;  5EFW B;  1L0L K;  2QIW A;  4FAN A;  2L4D A;  1FOC A;  2XND H;  1VQP P;  3HE5 A;  3H1I E;  3TF5 A;  1M70 A;  4U3F E;  1FDM A;  1HRO A;  1NTM E;  3RK2 D;  2K3R A;  3Q5P A;  2Z4E A;  1AQ5 A;  2I8F A;  4JPZ B;  5KAF H;  1PL5 A;  2B89 A;  2KNC B;  1GZL A;  2KXP B;  1CW5 A;  4LJI A;  2BGV X;  2OGU A;  1J1E B;  3A0B V;  5KAI H;  1CSV A;  1R8E A;  2FBW C;  4DJG A;  1K9M Q;  4PD4 D;  3L72 E;  2QSI A;  1HJ4 A;  2LIT A;  2W27 A;  2NPS D;  2GUS A;  2MJZ A;  1DX7 A;  2A45 I;  1HH7 A;  1QYZ A;  3AE2 C;  2A45 H;  4I1L A;  1EDJ A;  3AE3 C;  2NPS A;  1SQX J;  4H13 D;  1JOC A;  1W2E A;  3D0W A;  3SWS A;  2ZVN B;  1R5S A;  2L5G B;  2WPV B;  1C6R A;  1SQQ J;  2QVA A;  2QEX P;  3L71 E;  1N73 A;  3WC8 A;  3CC7 P;  1HF9 A;  1CRJ A;  4A7P A;  4ZMD A;  1L4A B;  2E74 B;  1DD3 A;  4C7R A;  1YTZ I;  1FDO A;  3SVW A;  2Z5H A;  4EI2 A;  1N86 A;  3HQ7 A;  1M1J C;  5AVR B;  3DP5 A;  1SQP D;  2ORL A;  4EIJ A;  1FOS F;  1AYG A;  2H7H A;  1NO4 A;  1EZV E;  1VF5 B;  3ZOO A;  1T2K D;  1ZW0 A;  3GMA A;  3ZOY A;  1LTI C;  4K35 A;  2B12 B;  2ZZS 1;  3ZBM A;  3CWB D;  1K73 Q;  4WQ9 A;  2PRR A;  2N1T D;  4OVN F;  1QN2 A;  2QA4 P;  1KQL A;  2KIK A;  3OW2 O;  3M97 X;  1DT1 A;  5AW8 B;  2KOG A;  1PPJ G;  1H31 B;  1PPJ D;  3OCD A;  1C7M A;  5H2F E;  5AVV B;  3WFB C;  1IFD A;  3A0H V;  2JDI H;  1CSW A;  1SLQ A;  5CMZ A;  5AVS B;  2A45 G;  5KTB A;  1I8P A;  1S5L X;  4RKU J;  5CCH D;  1CXA A;  1H32 A;  4I2L C;  2CA3 B;  2HPC A;  3CCV P;  1OMI A;  1BL9 A;  5AVX B;  1ZME C;  3OAK A;  2Q3E A;  3E1I A;  3Q1M A;  4Y99 C;  2OAR A;  3G9R A;  1YJN P;  4QAO A;  5AW4 B;  3D6Z A;  2A06 E;  1D7M A;  1YJW P;  1E5W A;  4NPD A;  1KIL D;  155C A;  1COT A;  3H1I G;  2BAS A;  4U3F G;  1NTM G;  1N7S B;  5BU8 B;  5TIS E;  1JY3 P;  1SQB J;  1GIW A;  2UWJ E;  2P1J A;  4UB6 E;  1COR A;  1KIL A;  1PGP A;  5AVT B;  1KV4 A;  1SQX K;  1L0N D;  2ZYA A;  1USD A;  1FZB A;  4KHX A;  1SQQ K;  3HRN A;  5BU5 A;  1CSX A;  1RAP A;  1QL2 A;  3L72 G;  3AEC C;  1J1D B;  1XTC C;  1KYO W;  1KOR A;  2YKO A;  2XZR A;  5CCG C;  1K04 A;  1LC1 A;  2AEM A;  4LC1 A;  3HTK A;  4W7Z A;  2QJK C;  1NU1 E;  1JY2 N;  2D0W A;  3AE5 C;  2JO1 A;  1N8R Q;  5KLI C;  1S5L H;  4DY9 A;  1K05 A;  1A2S A;  1CRC A;  3M9H A;  1X8Y A;  5GTI H;  1NTZ G;  2ZAE B;  1NTZ D;  4L3G A;  2MTA C;  4JYC A;  3HD7 C;  1LWU C;  2QE7 H;  2Y0D A;  3AEE C;  1FDI A;  3FGA D;  1KQS O;  5DJT B;  3TNU B;  3BAT A;  3NFQ A;  4GOE A;  1BSH A;  1K8A Q;  3QWO C;  1FJP A;  2WT7 B;  4W80 A;  3HQ8 A;  2WQY C;  4R4M A;  1EZV G;  1LP1 A;  3L37 A;  2OYI B;  4C7N A;  2C1D A;  5B5E H;  4OGQ C;  1AVY A;  3O6Q A;  5GTH E;  3VP9 A;  3WFD C;  1CIF A;  1RQU A;  3L70 D;  1ZZH A;  1S3J A;  2B0Z B;  3TGU G;  3TGU D;  2N9I A;  4K3I A;  2YKQ A;  3H25 A;  2ZYG A;  1NIR A;  1N2D C;  2C9N Y;  2Y0C A;  3OA8 B;  1F1F A;  5H2F V;  1JTH A;  5BVZ A;  1JNM A;  1GW4 A;  2AEF A;  2IBZ I;  2IPP A;  3WFC C;  2WPR A;  1B7V A;  3RK2 C;  1BE3 D;  1GU5 A;  2Z5I A;  3CD6 P;  1FAV A;  3H32 B;  2E5Y A;  2CK3 H;  1NHL A;  2Q9I A;  5KKZ C;  3I56 P;  3II6 A;  1HJ0 A;  2WTY A;  1IO4 A;  1SQB K;  1KQF B;  1I54 A;  3ORV A;  3MUD A;  3CX5 W;  1W5C T;  4L73 A;  3L4F A;  3A7O A;  1MG3 D;  2PCB B;  1YI2 P;  1OIP A;  2D0S A;  2K88 A;  2M5A B;  1OXZ A;  1FU1 A;  4WQC A;  4EID A;  2O01 J;  2A06 G;  1OW6 A;  1BDD A;  1BSN A;  1FE6 A;  1CZQ A;  2HV4 A;  1VQ8 P;  4UB6 V;  5KLV G;  3H1L D;  5KLV D;  2V7Q H;  1VF5 D;  4L75 A;  2JKV A;  1FI3 A;  3H1I J;  1USE A;  3H1K E;  4YE1 A;  4U3F J;  1NTM J;  4H13 C;  1M1J A;  3CXH W;  2O3J A;  3MTU E;  3RL0 C;  2FYU K;  1KIB A;  4KT0 J;  2V07 A;  1JUN A;  2XKM A;  2ZXE B;  1EXJ A;  1CIE A;  2LXC B;  2LKM A;  3NXS A;  4P4Q B;  3L72 J;  4YPC A;  3F5H A;  1NTK K;  1CTZ A;  1S2E A;  2JWA A;  3BRT B;  1NU1 G;  3FX0 A;  2W8Z A;  3KYQ A;  1KV9 A;  2WSS H;  5AW2 B;  4JF7 A;  1QVG O;  4PJ0 H;  1LT9 C;  1RE3 C;  5APT A;  2QJY B;  3CC4 P;  1YEA A;  3V5B A;  2WSE J;  3VMA A;  2GC4 D;  1NTZ J;  3PH2 B;  4PD4 E;  5AW1 B;  1FZC B;  3L75 D;  4QMA A;  2BCN B;  1S4X A;  2IBZ D;  2IZ1 A;  3FWL A;  2C9X B;  3B5N D;  1HWT C;  3L73 D;  3TYY A;  2N1T C;  5M1B A;  3CI9 A;  2FXO A;  1OW8 A;  1AQT A;  3RBX A;  1LTJ B;  4YTP C;  2CPB A;  4TLF A;  3B5N A;  1FHB A;  5DJU B;  3KPE A;  2J59 M;  1H89 A;  2O01 N;  4N78 D;  1CRG A;  3VMY A;  3IFM A;  2XDJ A;  2WMM A;  2KI7 B;  3GW6 A;  2E75 C;  1TU3 F;  2YIU B;  5IY5 1;  1YBK A;  4GDO A;  4ASV A;  5CCH C;  4EDF A;  3P8M C;  1ZN5 A;  2AXT H;  3CU4 A;  1JY3 N;  4D6T E;  1N90 A;  1SFC B;  1N50 A;  2ZT9 C;  1OW7 A;  1OX3 A;  2CE0 A;  2IFN A;  3SXT A;  1C75 A;  2WPS A;  1SQP E;  3WU2 H;  5AVQ B;  3RBZ A;  1AV1 A;  1Y8A A;  4GYD A;  1KX7 A;  5CCG A;  3HUS A;  1YIC A;  4WY4 B;  1HVV A;  1QVF O;  3ZOW A;  1FOS E;  1NTM K;  3HD7 D;  1CI6 B;  2BH5 X;  3GF3 A;  3CWB E;  1T8Z A;  3CPW O;  3KDP B;  2EXV A;  5KAF E;  1BGY D;  3A0B H;  2HOD B;  1G2C A;  5E79 H;  4GED B;  2K9J B;  2KK7 A;  3HD7 A;  2IZ0 A;  2D2C D;  1LWU A;  1JMB A;  5KAI E;  4LGD E;  1GL2 B;  1RF1 C;  1RAQ A;  1PPJ E;  2ZJS E;  1WMK A;  2MKV A;  5KLV J;  3H1K G;  5AVW B;  1P84 I;  1YTZ T;  1OVU A;  1MZ4 A;  1P84 H;  3UIA A;  3U1C A;  1HJB A;  2CE1 A;  3I55 P;  2JR8 A;  5APS A;  2WSC H;  3RK3 B;  3PLN A;  2OQQ A;  5DJQ B;  3LID A;  3GF7 A;  2B11 B;  2VRS A;  2AI5 A;  2FY8 A;  1KIL E;  2J58 A;  4H44 B;  1NAF A;  2XV5 A;  1HUC A;  1IJD B;  1N15 A;  2RKL A;  3GHG B;  3SFD C;  4HJG H;  1DVH A;  2I1K A;  1NU1 J;  1NJI Q;  1J1E C;  1L0N E;  2H43 A;  2B87 A;  2R44 A;  4OWF A;  3CMA P;  1F1C A;  1H0T B;  2DVH A;  1RHZ B;  3CP5 A;  1WEJ F;  3ZOX A;  2GUV A;  3P32 A;  1EXI A;  1IFM A;  3B71 A;  4M3L A;  2MHM A;  1ZOY C;  4L1Q A;  1Q82 Q;  3PTZ A;  3LIE A;  1IZN B;  2OYH B;  1IFJ A;  2WSF H;  1EDI A;  4HH2 A;  3V6I A;  3ZDM A;  2KS1 B;  1S72 P;  1Y47 A;  3MUD C;  3RL0 D;  3KZI V;  2Q6Q A;  4XE5 B;  3WUI A;  1NTZ E;  3IF4 A;  1VQK P;  1OCD A;  1L4A C;  3BCC D;  2ITA A;  3PJS K;  4GKG A;  2E74 C;  1QKS A;  3MK7 B;  2YMY A;  4D6T G;  1RE4 C;  4D6T D;  2RMZ A;  3V4W A;  3VYI A;  3M9Q A;  1URQ D;  2Q7C A;  1P84 D;  3MHV A;  1SQP G;  3O0R C;  1AJY A;  5L8R J;  3AEG C;  3G71 P;  1VF5 C;  2FFD B;  3JCU H;  1YEB A;  4WWI A;  3T97 B;  1URQ A;  3L74 D;  4L74 A;  1X0T A;  3S9O A;  5KAF V;  3R2P A;  3L70 E;  2OZ1 A;  3WUV A;  1WVE C;  3MP7 B;  3CWB G;  2M0B A;  1LT9 A;  1RE3 A;  3ITK A;  3A9F A;  3TGU E;  1JDL A;  2W83 C;  3Q5R A;  1H1O A;  4DZO A;  4H0L B;  4XXL A;  1ZXG A;  4UB8 H;  2N1T A;  4WQ8 A;  2N9Y B;  3C2C A;  1BE3 E;  1LNQ A;  2Y9Z A;  1GTW A;  5CJ0 A;  2E75 D;  2E76 B;  1JB0 J;  3H1K J;  4W7Y A;  2P7J A;  1NU1 K;  3CME P;  1CHH A;  2RN0 A;  3V2P A;  2ZT9 D;  1QGK B;  1S5L E;  1CIH A;  3HE4 A;  4ZNC A;  5CCH A;  5GTI E;  3B5N C;  3MD0 A;  1LT1 A;  1IC2 A;  4BRY B;  1AA0 A;  3H1L E;  5KLV E;  1SQV G;  1SQV D;  4WY4 D;  5K5G B;  1CED A;  3ABV C;  2KSJ A;  3O20 A;  2I1J A;  1PIX A;  3LW5 J;  4NPF X;  1U75 B;  2QJP C;  1SP4 A;  1YCC A;  3EFG A;  4Y99 B;  1L0N G;  3NTN A;  3RMZ A;  1JY3 O;  3IAO A;  1J1D C;  1KYO H;  2E42 A;  2M8R A;  2YXR B;  1NMI A;  1M8O B;  2B4Z A;  3RN1 A;  5B66 H;  4MN4 C;  5B5E E;  5AW6 B;  1GL2 D;  3VOP A;  3HUS C;  2BCC D;  1HGZ A;  2QG4 A;  1M6Z A;  1RY3 A;  2B88 A;  1KB9 H;  1ZRT D;  2IFM A;  5APQ A;  1AKK A;  1IK9 A;  1MV8 A;  1RF1 A;  2N18 B;  3H1H G;  3RK3 D;  3H1H D;  1SS1 A;  3N7N A;  4K3A A;  1YIQ A;  3A3Y B;  2P2U A;  3L75 E;  3U1A A;  2IBZ E;  2Y0E A;  1H9Y A;  1JCD A;  3L73 E;  1H33 B;  1FZF A;  2C1V A;  1UII A;  1NWQ A;  4ASW A;  5AVZ B;  4D6T J;  1L0L D;  5CHX A;  1X79 B;  1CHJ A;  1HCM A;  2D2C C;  1LGH B;  3SJL A;  1DIP A;  2PCC B;  2OYI C;  1FJ0 A;  1SQP J;  4N78 E;  1ETP A;  4PWA A;  2XNX A;  4BWN A;  2PAC A;  2I8D A;  2KNC A;  1QL1 A;  3L70 G;  1KMI Z;  3AED C;  2FYZ A;  3AEB C;  1PP9 D;  1G1J A;  4XA4 A;  1IRV A;  1E8E A;  5EXQ A;  1KFN A;  3CWB J;  3AEF C;  1ZP0 C;  1RF0 C;  4KJM A;  1EB7 A;  4KMG A;  2OTK E;  4EYY Q;  4IL6 E;  1VQ6 P;  4B86 A;  2GIW A;  3ZIY A;  2B9B A;  1YHQ P;  1RZ6 A;  1KYO D;  3K5B A;  1BE3 G;  1M56 D;  5DF5 A;  2CPS A;  2ZBO A;  3HE5 B;  1DH3 A;  1L4A D;  2E74 D;  3CX5 H;  2Y9Y A;  1QL3 A;  2CA4 B;  1RZ5 A;  1ZR2 A;  1CNO A;  4HKZ H;  1KB9 D;  1HBW A;  1A8C A;  2JQR A;  1FZE A;  1L4A A;  1E2R A;  2WSF J;  1BGY E;  3PH0 A;  4PJ0 E;  1C2R A;  3G4S P;  3AE9 C;  5TIS V;  4PV1 B;  3SWY A;  1RE4 A;  1K3H A;  4NPE A;  1MKM A;  3H1L G;  2KP8 A;  3CCJ P;  3Q3D A;  3Q5S A;  3CXH I;  3A2A A;  4DT0 A;  3CXH H;  1SQV J;  3HQ9 A;  5KJ7 D;  1OFC X;  1S9K D;  2V4H A;  3B4S A;  1FI9 A;  2NPS B;  1DIQ C;  4RSZ A;  1DW0 A;  1L0N J;  2KSE A;  3O1Y A;  2E43 A;  1N73 B;  1BDC A;  2YKP A;  4H0L D;  1NOH A;  1PGJ A;  2N3Y A;  4I7Z B;  3AE4 C;  1URQ C;  2Q3I A;  1YTC A;  1LTG C;  2QJY C;  3SFE C;  1H31 A;  3CCR P;  2ZXX A;  2YNY A;  1DII C;  1GU4 A;  1SQP K;  1FZC C;  4XFJ A;  2C9L Y;  3E1R A;  3USS A;  3WU2 E;  1I6E A;  1GD2 E;  3L75 G;  2IBZ G;  4ZKP A;  2R32 A;  1CRI A;  3CL3 D;  3BVH A;  3L73 G;  5AVY B;  2W90 A;  3P8C D;  2BEZ F;  3SSU A;  1VQL P;  2K9Y A;  1ZLL A;  2WWW A;  1N7S D;  4EIE A;  1LTJ C;  3CX5 D;  1NYH A;  1DW3 A;  5GTH V;  1DEB A;  4V2K A;  2ZYD A;  1OVR A;  4BXL A;  1CXC A;  1N7S A;  4OH8 B;  2YIU C;  5CJ4 A;  4L3H A;  3A0B E;  5E79 E;  2ZXY A;  3V2N A;  3L35 A;  3BCC E;  1U57 A;  1VQN P;  1NNO A;  1CC5 A;  1SQX D;  3OCD B;  4I6M C;  4WQB A;  1SFC C;  2YK3 A;  1SQQ D;  4IL6 V;  3CXH D;  1DVV A;  1T3J A;  2BH4 X;  3L70 J;  2FWL A;  1S6V B;  1DW2 A;  1H32 B;  1NML A;  1YJ9 P;  2HLO A;  1I8O A;  2HPC B;  2YXQ B;  1P84 E;  3TGU J;  4Q5P A;  3D71 A;  1CSB A;  1GDV A;  4AAN A;  1WRG A;  4DCK A;  2V08 A;  4WY4 C;  2ZFC A;  4N6J A;  1H88 A;  4WB4 A;  1IO3 A;  1IRW A;  1OVV A;  3L74 E;  3KQG A;  3PP5 A;  1BE3 J;  2K1A A;  3PXW A;  1KZU B;  4PJ0 V;  4DOJ A;  1R5L A;  4RES B;  1AOF A;  3D70 A;  1KIL B;  1M57 D;  1EDL A;  4Y5R A;  2PGD A;  1JM0 A;  1L0N K;  2GB8 B;  2YO2 A;  1BGY G;  3CC2 P;  2N9B A;  1GL2 C;  3TNU A;  1A02 F;  1HZU A;  3H1L J;  1JY2 P;  2WT7 A;  2R3S A;  1IK7 A;  4ZKU A;  3CLQ A;  2G8Y A;  1H9X A;  2H89 C;  1KB0 A;  2P10 A;  2SPZ A;  3HTK B;  2OYI A;  3RK3 C;  1YIJ P;  1PGQ A;  3KZI H;  5DJQ C;  3OA7 A;  5APY A;  4WQD A;  4H44 C;  1QX8 A;  1NTZ K;  3GHG C;  2AXC A;  2KZJ A;  1YQ4 C;  1SQV E;  1E79 H;  1GK4 A;  2YQB A;  3OA8 A;  1VQM P;  1DD4 A;  1C6S A;  1J3S A;  1RF0 A;  1S1C X;  3DR0 A;  3O8Z A;  2FYN B;  3H1J G;  3V4Q A;  1L2P A;  3H1J D;  3WU2 V;  1HJ5 A;  3MGN A;  1VQ5 P;  3H32 A;  1CCR A;  3L4M A;  5TJH A;  4MU8 A;  3C9I A;  1LP1 B;  1SQB G;  1SQB D;  5AW3 B;  1QLE D;  4PV1 D;  4C7N B;  2C1D B;  2W6J H;  3JCU E;  3O6Q B;  3L75 J;  1VQ9 P;  2LR2 A;  2OYH C;  2PAJ A;  2M5A A;  2PP6 A;  2BCC E;  3L73 J;  1LTT C;  5APW A;  2CXB A;  1I55 A;  2N9J A;  3MIW A;  1CCH A;  5E79 V;  1IFN A;  1ZRT E;  3S1K A;  4N0K A;  5CBO A;  1JTH B;  2KUB A;  5CIH B;  3RK3 E;  3H1H E;  4XYD B;  3BCC G;  3MK7 C;  5CYT R;  2FYU G;  1CYI A;  2FYU D;  1U7M A;  2HFE D;  3A0H H;  4UB8 E;  1NKN A;  5C39 A;  1M1K Q;  1KC8 Q;  2O01 H;  2DW3 A;  2V7Q J;  1AVO A;  2ZOO A;  1X9V A;  2VHD A;  1L0L E;  1ZR4 A;  3VP8 A;  1RH5 B;  3X39 A;  2R5B A;  1I6D A;  5CIF B;  1KX2 A;  1Q7Y Q;  3N4X A;  2FFD C;  3VNW A;  1NTK G;  3P7K A;  1NTK D;  1BCC G;  2L91 A;  3SWF A;  1BCC D;  2IX7 C;  2PFX A;  1Q86 Q;  5KJ7 C;  3WMM 0;  3L74 G;  3L36 A;  2GC7 D;  4AAM A;  4IFM A;  2E5T A;  5KLV K;  1C52 A;  3TK1 A;  1PP9 E;  1LJ2 A;  1M1J B;  1E29 A;  5KAI V;  1W2L A;  1VDF A;  1FZG A;  1YQ3 C;  1FZC A;  5CIB B;  2C0W A;  2XTS B;  4H0L C;  3KHU A;  2ZVO B;  5CIG B;  1R0Q A;  3TYI A;  1BGY J;  2HR3 A;  4IOI H;  1KYO E;  1LS9 A;  3MZW B;  2WZ7 A;  3EFF K;  2FKW B;  3M0D C;  1LTJ A;  2E76 C;  2O1K A;  5B66 E;  2R5D A;  2LIR A;  2WSE H;  5C0Z A;  1K3G A;  1RQV A;  1GQ1 A;  3I5C A;  2M3E A;  1SFC D;  2NRG A;  2IYO A;  4U7J A;  2QRX A;  1A02 J;  3E7K A;  3SLE A;  1KB9 E;  1HGV A;  5CBN A;  4WQA A;  4EIC A;  3M9B A;  3ZCF A;  1SFC A;  5AW9 B;  2FXM A;  1HTL C;  3JBT B;  3WUU A;  1N7S C;  3EQ2 A;  1M90 Q;  3FXD A;  3VMZ A;  1EZV I;  5AUR A;  2WPQ A;  1N9C A;  3PHL A;  4AUW A;  1OWA A;  2RH0 A;  3RN0 A;  4YXW H;  1IFP A;  1S9K E;  3CCU P;  4FA9 A;  4C46 A;  1FS0 E;  3CCL P;  3H1J J;  4AAL A;  4WY4 A;  4AYC A;  3R4Y A;  3BAS A;  2DGE A;  2BEQ D;  1KYO I;  3B5N B;  3C1L A;  3H1I D;  1KQG B;  2OTL P;  4U3F D;  1NTM D;  2C8S A;  3CCQ P;  1HZV A;  1CI6 A;  2AIU A;  2YMK A;  1LTS C;  2W6B A;  4LLH A;  3NBT A;  1T3U A;  4L76 A;  2POH A;  5APU A;  3JC2 2;  2QJP B;  3AEA C;  2BCC G;  1A56 A;  4JYB A;  3FWN A;  2HOD A;  3GG2 A;  1FJK A;  2K9J A;  2JP3 A;  3B8E B;  5AVU B;  5APX A;  1KB9 I;  2C1U A;  3L72 D;  3CYT I;  2JEE A;  1GL2 A;  4GOF A;  1NKZ B;  5H2F H;  2N18 C;  1MZ9 A;  2QM8 A;  4UB8 V;  1YYC A;  4JQ0 D;  1CHI A;  1PGO A;  1KN7 A;  3WUT A;  3EWK A;  3HUS B;  3BCC J;  2N3B A;  1IFI A;  2FYU J;  3G6E P;  4H44 D;  2QJK B;  3P8C E;  2ZON G;  1CTJ A;  1NGM B;  1L0L G;  3L71 G;  3L71 D;  3CX5 E;  3WFE C;  5KLI B;  3PRJ A;  1U74 B;  4WVZ A;  2JJL A;  1PFI A;  1CTY A;  2YO3 A;  1Z56 A;  3M0A A;  1OAE A;  1JMM A;  5AW7 B;  4J20 A;  1CSU A;  3GHG A;  5TIS H;  1G2C B;  1CYC A;  1Y9B A;  2FXP A;  1SVF A;  1NTK J;  3HD7 B;  4EOT A;  2OTJ P;  1LWU B;  1BCC J;  2WSC J;  3CCM P;  4UB6 H;  3F89 A;  1VL2 A;  3V2Q A;  1Q90 D;  1KTM A;  3L74 J;  1SQX E;  3O5C A;  4RO0 A;  1T6A A;  1LTA C;  1PP9 G;  1SQQ E;  3CXH E;  3OJA B;  2P67 A;  1EC5 A;  2D2C B;  1EZV D;  3U59 A;  1H0T A;  2IYP A;  1LC2 A;  351C A;  1NVO A;  5B66 V;  3BRV B;  1L9B C;  4OGQ B;  4IL6 X;  1QEX A;  2OYH A;  3W67 A;  2KS1 A;  1YIT P;  3VMX A;  3CX5 I;  4H0J A;  1GMJ A;  3L4O A;  1S5L V;  3AE8 C;  5GTI V;  3TDK A;  1AFO A;  1CRH A;  1LFM A;  2FRC A;  1NH4 A;  2C2C A;  3VN0 A;  4PV1 C;  3Q2Y A;  4IFF A;  2B87 B;  3RK2 B;  3PXS A;  5AW0 B;  3RGU A;  5KKZ B;  2R3C A;  3JSV C;  4H0K A;  1CRY A;  1NAY A;  2P58 A;  1HRC A;  2Q1K A;  1VPC A;  2NPS C;  1FI7 A;  2FFD A;  3V2R A;  4FAV A;  3VTP C;  1N7L A;  2A06 D;  1L9J C;  5GTH H;  3T97 A;  3AE7 C;  4O1Q A;  1Q2N A;  5B5E V;  1JEK A;  2KB7 P;  1N73 C;  5KJ7 A;  4FA1 A;  4GIF A;  1X22 A;  3AE1 C;  5CID B;  1XTG B;  2KYV A;  4I7Z C;  1LTB C;  3G3Z A;  1KD1 Q;  3RL0 g;  3HQ6 A;  5DFS A;  2NZ2 A;  1J2J B;  4H13 B;  3S4R A;  5C9M A;  5CIE B;  1JCC A;  4HB1 A;  1C2N A;  4IL6 H;  1W5C E;  1AOQ A;  2HG5 D;  3RL0 B;  1FZA A;  2AXT E;  2BCC J;  3A5T A;  2E76 D;  3H1J E;  1M7L A;  5AW5 B;  2M3B A;  3KXD A;  3TSI A;  4WQ7 A;  1HJ3 A;  3IN6 A;  1CO6 A;  5CIC B;  2W6A A;  1IQC A;  3M0D A;  1GW3 A;  1GDT A;  1SQB E;  1MFZ A;  3H1H J;  3M06 A;  1NU1 D;  2OYO A;  1URQ B; 
#chains in the Genus database with same CATH homology
 3HQ8 A;  1H1O A;  1VYD A;  1GU2 A;  4XXL A;  3DMI A;  2YQB A;  2OZ1 B;  4WQ8 A;  2N9Y B;  3C2C A;  3OA8 A;  2C1D A;  1YFC A;  1J3S A;  1C6S A;  3DR0 A;  2FYN B;  451C A;  3H1J D;  3WU2 V;  1FCD C;  3WFD C;  1CIF A;  1HJ5 A;  2YCC A;  3L70 D;  1M60 A;  1ZZH A;  1CHH A;  2RN0 A;  1CCR A;  2B0Z B;  3L4M A;  5TJH A;  4MU8 A;  3TGU D;  2N9I A;  4K3I A;  1NIR A;  1SQB D;  1CIH A;  3OA8 B;  2Y0C A;  2C1D B;  1F1F A;  5H2F V;  1C6O A;  3WFC C;  1SQV D;  1CED A;  1B7V A;  1BE3 D;  2CXB A;  4FA5 A;  1I55 A;  2N9J A;  3O20 A;  1CCH A;  5E79 V;  1GKS A;  1U75 B;  4FB1 A;  1YCC A;  4N0K A;  1I54 A;  3ORV A;  3CX5 W;  3RMZ A;  1W5C T;  5CIH B;  1MG3 D;  4XYD B;  2PCB B;  3MK7 C;  5CYT R;  1CYI A;  2D0S A;  2FYU D;  4WQC A;  4EID A;  4PW9 B;  2JTI B;  1NMI A;  2B4Z A;  3RN1 A;  2HV4 A;  1I5T A;  1QL4 A;  3VYM A;  4UB6 V;  2ZOO A;  3H1L D;  5KLV D;  2VHD A;  2BCC D;  3X39 A;  2QG4 A;  1I6D A;  5CIF B;  1KX2 A;  1FI3 A;  1M6Z A;  4FA4 A;  1CYJ A;  3PXT A;  4YE1 A;  4RJT A;  1H33 A;  2BPB B;  3RLM A;  3CXH W;  3VNW A;  2O3J A;  1ZRT D;  1NTK D;  2L91 A;  1BCC D;  1AKK A;  1KIB A;  2V07 A;  2N18 B;  3VRD A;  2GC7 D;  3H1H D;  4AAM A;  1YIQ A;  1C52 A;  1CIE A;  2B10 B;  4EIF A;  2Y0E A;  4P4Q B;  1H9Y A;  4AX3 A;  1H33 B;  2C1V A;  1E29 A;  5KAI V;  1W2L A;  1L0L D;  4O1W A;  5CIB B;  1CTZ A;  1LMS A;  2JWA A;  2XTS B;  1CHJ A;  1HCM A;  1MG2 D;  2AXT V;  4NFG B;  3KHU A;  3H1K D;  1GJQ A;  1KV9 A;  3SJL A;  5CIG B;  1R0Q A;  2PCC B;  3TYI A;  1DW1 A;  1FJ0 A;  1CIG A;  1LS9 A;  4AAO A;  1YNR A;  2QJY B;  2BLF B;  1ETP A;  3NBS A;  1YEA A;  4PWA A;  3NWV A;  4WQE A;  3VMA A;  1IZL 0;  2LIR A;  2GC4 D;  5B6Q A;  3PH2 B;  4JCG A;  5C0Z A;  1K3G A;  2PAC A;  1GQ1 A;  3L75 D;  2BCN B;  2IBZ D;  3FWL A;  4FAN A;  2L4D A;  1FOC A;  1PP9 D;  2C9X B;  3L73 D;  1IRV A;  1E8E A;  5EXQ A;  3TF5 A;  3SLE A;  1M70 A;  1HRO A;  4WQA A;  1EB7 A;  4EIC A;  4KMG A;  2I8F A;  3ZCF A;  2GIW A;  3ZIY A;  3JBT B;  1FHB A;  1RZ6 A;  1KYO D;  2KNC B;  1CRG A;  4LJI A;  2BGV X;  5DF5 A;  3A0B V;  1CSV A;  3GW6 A;  2ZBO A;  5AUR A;  1N9C A;  3PHL A;  3RN0 A;  2YIU B;  5IY5 1;  4PD4 D;  4EDF A;  4FA9 A;  1HJ4 A;  2LIT A;  1QL3 A;  2CA4 B;  3CU4 A;  1RZ5 A;  4AAL A;  1N90 A;  2DGE A;  1HH7 A;  1QYZ A;  1CNO A;  1N50 A;  3H1I D;  1KB9 D;  1A8C A;  2JQR A;  4U3F D;  1NTM D;  1E2R A;  2C8S A;  2CE0 A;  1HZV A;  3SXT A;  2AIU A;  1C2R A;  1C75 A;  5TIS V;  3NBT A;  4GYD A;  3SWS A;  1K3H A;  2QJP B;  1KX7 A;  1C6R A;  1A56 A;  1YIC A;  3WC8 A;  3GG2 A;  3HQ9 A;  1CRJ A;  4A7P A;  2C1U A;  3ZOW A;  3L72 D;  3CYT I;  2N18 C;  2BH5 X;  4UB8 V;  1FI9 A;  1DIQ C;  3SVW A;  4RSZ A;  1CHI A;  1DW0 A;  3O1Y A;  2EXV A;  1BGY D;  3HQ7 A;  2N3B A;  4GED B;  2K9J B;  3DP5 A;  1SQP D;  2ORL A;  2QJK B;  1AYG A;  2ZON G;  1CTJ A;  2N3Y A;  1RAQ A;  3L71 D;  3PRJ A;  3WFE C;  5KLI B;  3ZOO A;  1U74 B;  1YTC A;  3ZOY A;  1CTY A;  2B12 B;  1OAE A;  1MZ4 A;  1H31 A;  1CSU A;  2ZZS 1;  4J20 A;  3ZBM A;  1CYC A;  3CWB D;  1DII C;  4WQ9 A;  2CE1 A;  1I6E A;  3PLN A;  1QN2 A;  3O5C A;  5DJQ B;  2B11 B;  1CRI A;  2AI5 A;  3M97 X;  1DT1 A;  1EZV D;  1H31 B;  1N15 A;  1PPJ D;  3OCD A;  4EIE A;  1C7M A;  3CX5 D;  1LC2 A;  351C A;  1DW3 A;  3WFB C;  5B66 V;  3A0H V;  1DVH A;  1CSW A;  5GTH V;  1L9B C;  1I8P A;  1CXA A;  1H32 A;  4V2K A;  2CA3 B;  1CXC A;  4L3H A;  1BL9 A;  2ZXY A;  2Q3E A;  2KS1 A;  1NNO A;  1F1C A;  1CC5 A;  1SQX D;  2DVH A;  3L4O A;  3OCD B;  4H0J A;  1S5L V;  4QAO A;  3CP5 A;  4WQB A;  1WEJ F;  3ZOX A;  2YK3 A;  5GTI V;  1SQQ D;  4IL6 V;  3CXH D;  1DVV A;  3TDK A;  2BH4 X;  155C A;  1COT A;  1S6V B;  2FWL A;  2MHM A;  1CRH A;  1DW2 A;  1H32 B;  1LFM A;  2FRC A;  1NML A;  2C2C A;  4L1Q A;  1I8O A;  3PTZ A;  4Q5P A;  1GDV A;  1GIW A;  3PXS A;  4AAN A;  1COR A;  2V08 A;  5KKZ B;  1L0N D;  3KZI V;  3WUI A;  1IO3 A;  1OCD A;  1IRW A;  4H0K A;  1CRY A;  1CSX A;  1HRC A;  3BCC D;  1RAP A;  1QKS A;  3PXW A;  1FI7 A;  4FAV A;  4PJ0 V;  1KYO W;  3MK7 B;  2A06 D;  1L9J C;  4D6T D;  4O1Q A;  1AOF A;  5B5E V;  1LC1 A;  2RMZ A;  4Y5R A;  4FA1 A;  2GB8 B;  1P84 D;  5CID B;  2D0W A;  3O0R C;  3HQ6 A;  4DY9 A;  5DFS A;  1A2S A;  5C9M A;  1CRC A;  5CIE B;  1C2N A;  1YEB A;  1AOQ A;  1HZU A;  1NTZ D;  4L3G A;  3L74 D;  2MTA C;  5KAF V;  1H9X A;  1KB0 A;  2OZ1 A;  4WQ7 A;  1WVE C;  2Y0D A;  1HJ3 A;  1CO6 A;  3ITK A;  3A9F A;  5CIC B;  1IQC A;  5DJQ C;  1JDL A;  4WQD A;  1NU1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...