3H1ID

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 63
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1iD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1iD02
5TJHA 2A06D 5CIDB 3NWVA 1KIBA 2PCCB 3C2CA 5C0ZA 2EXVA 1EZVD 1SQQD 5DJQC 1AOQA 1FOCA 1F1FA 3ZOYA 3O0RC 1DVVA 4EIDA 2JTIB 3WC8A 2BH4X 2BH5X 2LITA 3CWBD 4JCGA 3L70D 1CXCA 1I6DA 2N18B 1NTZD 1P84D 1CNOA 1NTKD 2FYNB 1I8OA 1N15A 2VHDA 3DR0A 2IBZD 1L9JC 5DF5A 2AIUA 4UB8V 1AYGA 1YEAA 3H1ID 1CIFA 3A0BV 3L72D 1CRYA 4EIEA 1CIHA 1NNOA 4AX3A 2CE1A 1BCCD 1HJ4A 1BE3D 4O1QA 3DMIA 4PJ0V 4AAMA 2ORLA 2FRCA 1CRIA 4DY9A 1RZ5A 5H2FV 1KV9A 1CIGA 4Y5RA 3ITKA 2N9IA 2QJPB 5KAFV 3OA8A 3TDKA 3RMZA 3CX5W 3SVWA 1SQPD 351CA 1HROA 1GIWA 3L74D 1KYOW 3VYMA 2C9XB 1HJ5A 1M60A 1HCMA 3GW6A 3RN0A 5AURA 3ZBMA 3VMAA 4PWAA 1I6EA 1H9XA 4WQ7A 1QKSA 1QL3A 1MG3D 1SQBD 1W5CT 4QAOA 3PH2B 3CX5D 1CO6A 4N0KA 2CA4B 1L0LD 2N9YB 2I8FA 3TGUD 1IRVA 1DW1A 1E29A 1WEJF 1NMIA 1AKKA 3CXHW 1M70A 4P4QB 5CIEB 3HQ9A 1CTJA 5B66V 3PRJA 4L1QA 1GQ1A 5KAIV 1H31B 3PXSA 4WQ8A 1OAEA 5C9MA 2ZOOA 4FANA 2OZ1B 2D0WA 1YICA 1C52A 1K3GA 3KZIV 1IO3A 2BPBB 3WFEC 2N18C 1N90A 3TF5A 1CORA 4RJTA 2XTSB 4AALA 4RSZA 1DIQC 2GB8B 1H32B 1CHHA 4WQAA 2PCBB 3OCDB 4WQBA 1LFMA 1L0ND 3A9FA 2BCCD 1E8EA 1I8PA 2GC7D 4D6TD 5CIGB 1CRGA 1CXAA 3JBTB 1IZL0 3SWSA 4U3FD 3L4MA 3ORVA 2V07A 1CSVA 1ZRTD 5CIBB 2Y0CA 2N3YA 1FCDC 4H0KA 1IQCA 2C8SA 1YCCA 1S5LV 1YFCA 1PP9D 1RAQA 1C6RA 3BCCD 1SQXD 3MK7C 1LS9A 2ZZS1 4IL6V 1COTA 5IY51 1W2LA 1F1CA 3PXTA 3X39A 2ZONG 1CRHA 1S6VB 3VRDA 3O5CA 155CA 1VYDA 3MK7B 2N3BA 3FWLA 2DGEA 4EIFA 1RZ6A 2AXTV 4AAOA 3RN1A 1KB0A 2ZBOA 2FYUD 1ETPA 2C1UA 1FJ0A 1YEBA 1J3SA 1KB9D 4FA5A 2YK3A 1BGYD 3HQ7A 3PXWA 2JQRA 1I54A 4GYDA 5CYTR 1C7MA 1N50A 1QYZA 2Y0EA 3VNWA 2BGVX 1CSXA 1I5TA 4YE1A 3L4OA 4MU8A 3L75D 3WFDC 1U75B 5GTIV 3DP5A 1H31A 5KLVD 1H33B 3O20A 1GU2A 5DFSA 3GG2A 2OZ1A 1DT1A 1I55A 1KYOD 3M97X 4FA4A 1N9CA 1HZUA 1FI9A 2Y0DA 1C6OA 1C2NA 2YIUB 1KX2A 3ZOWA 2L4DA 3H1HD 3WU2V 5CIHB 3O1YA 1DVHA 1H9YA 4XYDB 4FB1A 1CIEA 1QN2A 2QG4A 4FA9A 4J20A 4FA1A 1H32A 3OCDA 2C1DA 2KS1A 1NU1D 3WFBC 1SQVD 1BL9A 1M6ZA 3CYTI 1GDVA 1MG2D 4A7PA 1A2SA 3CXHD 3CP5A 2PACA 5B6QA 1RAPA 1R0QA 1A56A 3ZOXA 1CYIA 3H1LD 2JWAA 2GC4D 3H1KD 4EICA 4LJIA 1DW2A 4WQDA 2O3JA 1JDLA 3NBTA 3ZOOA 1CRCA 3ZIYA 2C1DB 1EB7A 1NIRA 5B5EV 5KKZB 1CRJA 2YCCA 3KHUA 1L9BC 2HV4A 1HZVA 1LC2A 3H1JD 2FWLA 4WQEA 1C75A 4AANA 5TISV 4KMGA 1B7VA 1YNRA 1H1OA 4NFGB 2D0SA 1C6SA 1PPJD 1KX7A 5EXQA 3NBSA 1U74B 1IRWA 1CSWA 1FHBA 5DJQB 4O1WA 4V2KA 2YQBA 1HRCA 1CHJA 2GIWA 4PD4D 3TYIA 4FAVA 1AOFA 1YTCA 1CTZA 1NMLA 3WFCC 4Q5PA 2N9JA 1DW0A 3PHLA 3ZCFA 4WQCA 451CA 2B0ZB 1FI7A 2C2CA 1H33A 1CC5A 3L73D 4UB6V 1CYCA 1FI3A 1CCHA 1A8CA 2ZXYA 2B4ZA 2RN0A 1E2RA 2QJKB 3HQ6A 2DVHA 4L3GA 1LMSA 1HJ3A 2MTAC 1LC1A 1ZZHA 1GKSA 2L91A 1CHIA 1DW3A 5CIFB 1GJQA 5CICB 4EDFA 3WUIA 3SJLA 1CEDA 1CSUA 1OCDA 5E79V 2AI5A 3RLMA 5KLIB 4WQ9A 3SLEA 2CXBA 3L71D 1YIQA 1C2RA 1HH7A 2BCNB 3OA8B 2V08A 3PLNA 2Q3EA 3HQ8A 2QJYB 1CCRA 2C1VA 1WVEC 1MZ4A 1DIIC 4K3IA 2MHMA 4H0JA 1NTMD 1CTYA 4PW9B 2B10B 2K9JB 2CA3B 2BLFB 1QL4A 2B12B 2LIRA 5GTHV 2RMZA 4L3HA 2KNCB 4XXLA 3CU4A 1CYJA 3A0HV 4GEDB 3PTZA 3SXTA 1K3HA 2B11B 2CE0A
chains in the Genus database with same CATH superfamily
1J1EC 2A06D 5CIDB 3V2RA 3NWVA 3L4FA 2GM4A 3KXDA 1SQQD 5AVQB 5DJQC 4W80A 1FOCA 1F1FA 2YKPA 3HRNA 2QEXP 2V7QH 2Z5IA 1IO4A 1N86A 5KLVE 3MUDA 2BH5X 3O8ZA 4C7NA 1FZCA 3L70D 1IFJA 2J58A 2P58A 2BCCG 1LTAC 3KYQA 4D6TG 2HG5D 3NTNA 1L9JC 2O01J 2AIUA 2HPCB 1URQC 1AYGA 3P32A 1FOSE 2HYNA 3VP8A 4NPEA 5BU5A 3A0BV 3L72D 3FX0A 4PV1B 5KAIE 2GUSA 1L0NJ 1SQXG 3BCCG 1NTMK 1SQVE 3V2NA 3HUSC 1FDOA 3L72G 3V6IA 3DMIA 1XTGB 2CK3H 2WPVB 4IFDK 3H1LE 3H1JJ 1HH0A 4WVZA 2XU6A 3CPWO 2NZ2A 2QJPB 3TDKA 1PP9J 1CW5A 3CX5W 3HUSB 351CA 1RF0C 2Q1KA 1X79B 4H44D 1BGYG 4IFMA 3ZBMA 1VQ9P 2OTKE 1QL3A 1SQBD 2OGUA 1W5CT 1K9MQ 4QAOA 2JWDA 5CCGD 2XV5A 3AE7C 2CA4B 3A2AA 1P84E 4H0LC 1NTZK 2CPBA 3JCUE 4IL6E 2N9BA 2MKVA 4N78D 1NO4A 1E29A 1VQ7P 1WEJF 1S72P 3HQ9A 2POHA 3PRJA 4L1QA 1KQGB 1OVRA 1N7LA 3L75J 3PXSA 1PFIA 1OAEA 5AW9B 2OZ1B 1YIJP 5GTHH 1C52A 2CPSA 3KZIV 3G4SP 3WFEC 1JUNA 1NU1G 3SFEC 2N1TA 1N90A 4AALA 2K37A 1M90Q 4LGDE 2ZXXA 4WQBA 3LIEA 3A9FA 3L37A 2KS1B 3H1KG 1CXAA 3JBTB 1R5SA 1M1JC 1CSVA 1NAFA 2Y0CA 1HGVA 1FS0E 1RE4A 1KILA 1IFDA 2C8SA 1SFCA 1OWAA 3OW2O 1JMMA 2GA1A 4BRYA 2WVRA 3CD6P 5KJ7A 1L4AA 1LWUC 3UIAA 1S6VB 3Q5SA 1L4AD 3VRDA 3P7KA 1SQQJ 2OYHC 1QVGO 4IOIH 2ZBOA 1MZ9A 2WTYA 1GL2A 1YITP 1MV8A 2FY8A 2A06E 3A0HE 1JMBA 3L70J 1RQVA 2M5AA 2WZ7A 5KAFH 4H44C 1C7MA 1N50A 1SQQE 3L73G 5B5EE 2YO2A 3WFDC 2IFMA 3AE4C 3DP5A 1H31A 5CCGC 1H33B 1GU2A 1GK4A 4HB1A 1I55A 2FYZA 2FFDC 2Y0DA 3TNUB 1OMIA 2XNXA 1KX2A 3H1HD 3O1YA 1DVHA 1GMJA 1SQXE 2C9NY 4XYDB 5CCHD 5K5GB 5AVSB 2QG4A 2KZJA 3L72E 4EOTA 1H32A 3H1HG 3VTPC 2KB7P 1EDJA 1H8AA 2FFDB 3WFBC 5KAIH 3PJSK 4XFJA 1GDVA 4EYYQ 2AEJA 3C1LA 2PACA 5B6QA 1R0QA 3CI9A 2QIWA 1A56A 1QVFO 1CYIA 2O01H 4EICA 2V4HA 2FYUK 2Q9IA 1CRCA 4O9BA 1H0TA 1ZW0A 1NIRA 1CRJA 1P84I 2SPZA 1NTMJ 1LT9A 5E79E 5APXA 1SQBE 4KMGA 1B7VA 1LTSC 3S1KA 1YJNP 1H1OA 1N7SA 2D0SA 2W27A 1C6SA 5KLVK 1X8YA 4N78E 1N8RQ 2Z5HA 2KSEA 3MIWA 3HE4A 4FAVA 1AOFA 1AVYA 1L4AC 4IL6H 1TU3F 3A0BH 1NWQA 1CTZA 4PD4H 1NTKG 1UIXA 3RK3D 2E74D 3I5CA 2E43A 4Q5PA 3HD7A 3PHLA 1ZR4A 2B0ZB 1RHZB 1FI7A 3L36A 1NU1E 3H1IG 4C7RA 1SQVK 3B5NA 4M3LA 1NTZJ 2ZXYA 3Q1MA 1KMIZ 3WUTA 1BCCG 2P10A 2DVHA 2KI7B 4L3GA 2BEQD 3R2PA 3H1KE 4WBAA 2JDIH 2OTJP 1CHIA 5CIFB 5CBOA 3CMAP 3M9QA 3A7OA 3SJLA 1CEDA 1CSUA 1PIXA 5BVZA 1OCDA 2E5YA 3AE8C 1QX8A 4WQ9A 1BE3J 1W2BO 4TLFA 4ZNCA 1YIQA 4KT0J 5CCHC 2Q6QA 4K35A 2QJYB 1CI6A 1WVEC 4UB8E 3WU2H 2MHMA 3RBZA 1LTBC 4WY4B 1YQ4C 3GHGB 1YQ3C 4OH8B 1Y8AA 4PW9B 1IFMA 4DZOA 1IZNB 2K9JB 2PRRA 2D2CD 1X22A 1QL4A 2QE7H 2B12B 5GTHV 4NPFX 2RMZA 1EDLA 2JO1A 4PJ0E 2KNCB 2W6JH 4XXLA 3B71A 3WUUA 4GEDB 3KZIH 5H2FE 1GU5A 1K3HA 2B11B 5AW8B 1DIPA 1KIBA 3RL0g 2PCCB 3TGUJ 2EXVA 1VDFA 1OW6A 1JCDA 3V2QA 2HPCA 1JM0A 1DVVA 5B5EH 1Q81Q 2B88A 2JTIB 2RKLA 5M1BA 1MUUA 1T3JA 2LITA 4JCGA 1LT1A 1CXCA 1LTJB 3BASA 4WWIA 5TISH 2N18B 1P84D 2FYNB 4PV1D 1L0NG 1VF5B 4OVNF 2VHDA 1NKZB 3DR0A 3H1HE 3G9RA 3RK3C 2E74C 3AE6C 5B66E 1CIFA 1CRYA 5AVWB 4EIEA 4I6MC 1OZHA 1PP9G 3HUSA 1KB9I 2W90A 3M0AA 3AEDC 4O1QA 3K5BA 3F5HA 1SLQA 3Q2YA 1RZ5A 3W68A 4Y5RA 3ITKA 5APVA 5KAFV 3OA8A 5APQA 4C46A 1KV4A 4LLHA 3RMZA 3SFDC 1RF0A 1KTMA 1SQPD 1H88A 3M06A 1YTZI 4L75A 1ZOYC 3LW5J 3SWFA 2YKOA 3ABVC 1A02J 3RK2D 1H9XA 1RF1C 2B87B 1QKSA 4I1LA 1G1JA 3C9IA 5E79H 1JTHB 2DW3A 3HE5A 2FKWB 3L75G 2FYUJ 1CO6A 2WT7B 3AECC 1L0LD 2N9YB 3VMXA 1NMIA 1AKKA 3CXHW 1RF1B 2Z4EA 1M70A 2XKMA 3GF7A 2D2CC 1CTJA 3D0WA 3CXHI 1FOSF 1GQ1A 1SQXK 5KAIV 4WQ8A 4JF7A 1FU1A 5AVXB 1BCCE 5KLVJ 2WQYC 1N73C 1K3GA 2D2CB 5DJTB 1IFIA 2BPBB 4JYCA 2PGDA 1EZVI 3HTKA 5DJUB 2PAJA 3MP7B 2Y9YA 3SSUA 1DIQC 1SVFA 1CHHA 1QEXA 2PCBB 3OCDB 1N73B 3CC2P 2BCCD 5AW1B 3CCEP 1E8EA 5CBNA 1W5CE 1M1JA 4D6TD 5CIGB 1CRGA 1HGZA 3JSVC 4PV1C 3SWSA 4U3FD 3LIDA 1EDKA 1SQVJ 2QM7A 5CIBB 1Y47A 1U57A 1FCDC 5APSA 1EQ7A 4U3FG 1YCCA 3O6QB 1YFCA 1SQBK 2KOGA 3H1LJ 3BCCD 1SQXD 1T6AA 2J59M 3V2PA 3KDPB 4IL6V 4GDOA 3CCSP 3H32B 1LWUA 3ZDMA 2OYIB 2QJPC 4OGQD 1W2LA 4AYCA 1L2PA 1PPJG 3QWOC 1Q86Q 1CRHA 3O5CA 2MJZA 2JR8A 2OYHA 4KHXA 3BRTB 3FWLA 2DGEA 3A5TA 2E5TA 3RN1A 1U7JA 4JQ0D 1ETPA 1IC2A 1N2DC 2C1UA 1YEBA 1J3SA 1KB9D 1NU1K 4FA5A 1DEBA 2HODB 2NPSD 3CCRP 1OIPA 2YK3A 3U1CA 1BGYD 5H2FH 2XZRA 3FXEA 2VRSA 1JB0J 1DEEG 1ZN5A 4GYDA 3CL3D 4JPZB 1BDCA 1QYZA 4BXLA 1CSXA 3RK2C 1I5TA 4MU8A 1WRGA 1U75B 2WITA 5CCGA 1S3JA 5AW0B 2FFDA 1NYHA 3CX5H 3M97X 3RK2B 1FI9A 2G8YA 3WU2V 5CIHB 1YYCA 5AW3B 1H9YA 2E76D 2M8RA 1QN2A 1DH3A 1QLED 4FA9A 2LR2A 2IZ0A 2A45H 2OARA 2P2UA 2IPPA 1NU1D 1SQPJ 1MFTA 1SS1A 3WMM0 1RY3A 5CHXA 1MG2D 1A2SA 5KKZC 3CXHD 1NTMG 3PP5A 1RAPA 4UB6E 2W8ZA 4RESB 2QM8A 2GC4D 3H1KD 3CC7P 2M3BA 2JKVA 1PZQA 3VN0A 2IDBA 2O3JA 3GF3A 3NBTA 1K04A 1SQPE 3CCUP 3ZIYA 3TYYA 5B5EV 5KKZB 1S4XA 1W2EA 2JEEA 3KHUA 1L9BC 2HV4A 2PFXA 2QRXA 1C75A 5TISV 2RH0A 1YNRA 1EZVG 2I1JA 2I1KA 2R5BA 2YXQB 5EXQA 1L0LE 1HWTC 4OGQC 1IRWA 1CSWA 1KYOE 1S5LH 4V2KA 3AEGC 1G1IA 3CWBG 3TYIA 3LW5H 1E5WA 1YTCA 1NTZG 3WFCC 2IYOA 3IF4A 1QL2A 1DW0A 2IBZG 4OGQB 4WQCA 3Q5RA 4C7NB 1OFCX 1FZCB 2NPSC 2C2CA 2R3SA 1KFMA 3L73D 1CCHA 1GW4A 2AXTH 1YJ9P 2ZYAA 2QJKB 1J2JB 1LMSA 1BE3G 2MTAC 1LC1A 1ZZHA 1Y9BA 3S9OA 2IYPA 2NPSB 1DW3A 1SQXJ 1PV3A 1JO5A 2BCCE 1LTGC 4EI2A 1DX7A 3L72J 4D6TE 4U3FE 5E79V 2GUVA 3R4YA 4WB4A 2Y9ZA 2B9BA 3SLEA 4WY4D 3L74G 3L71D 2KLVA 5CCHA 5CJ4A 1C2RA 1HH7A 3EWKA 2KYVA 2E76C 3BCCE 2V08A 3AEBC 2Q3EA 3HQ8A 3L71G 3Q5PA 4K3IA 3MGNA 5APWA 4HJGH 1BGYJ 1G2CA 3BATA 2C0XA 4ASWA 2B10B 4DT0A 3S4RA 2CA3B 5AW6B 3W67A 2E76B 2BLFB 3TGUG 1LP1A 1PGPA 1EXJA 4L3HA 3CMEP 4L73A 1T3UA 3E1RA 3PTZA 1SQBJ 3SXTA 2ZT9B 1HJ0A 3AE9C 3C8VA 4B86A 1KB9E 4N6JA 2CE0A 2YNYA 4XE5B 5TJHA 1BGYE 3JC22 3C2CA 2QSIA 3AE5C 1M1KQ 3ZOYA 4LC1A 3O0RC 1VF5D 2L5GB 4GOEA 3CCJP 2WWWA 2BH4X 2ZYDA 3PH0A 2E75B 5AVZB 3CCMP 3NMDA 4W7YA 4ZKUA 2QA4P 2W83C 1NU1J 1CNOA 1NTKD 1KD1Q 1I8OA 1N15A 1IFNA 4PD4I 1P84H 2N1TB 2ZVNB 3F89A 3JCUH 4GT1A 3L35A 2G3AA 4RKUJ 4UB8V 3VMZA 2OTLP 3H1ID 3H1KJ 1NNOA 4AX3A 1DD4A 1BCCD 3IN6A 1Q90D 3CXHE 4PJ0V 2ORLA 2LXCB 2YMKA 5H2FV 1GU4A 1KV9A 1SFCB 1BDDA 2B87A 4YTPC 1S9KD 2XNDH 1JTHA 4YXDC 4GIFA 2QJYC 1XTCC 1HROA 1GIWA 2FYUG 1EDIA 1KYOW 3VYMA 2C9XB 1M60A 1EZVE 1KYOI 3V4QA 1RF1A 4WY4C 3GHGC 3VMAA 4PWAA 4Z1MH 4WQ7A 4GODA 3G3ZA 1MG3D 1WT6A 1GL2B 3NXSA 1IK7A 2YKQA 2BASA 2Q3IA 1EXIA 2R44A 4ZMDA 1Z56A 3L73J 5KLVG 1IRVA 3D6YA 2IBZE 4CPGA 1OVVA 5B66V 2KZIA 5AVVB 4R4MA 2AEFA 1H31B 2KK7A 2D0WA 1N73A 3L73E 1VL2A 1NJIQ 2ZXEB 3A0HH 1LTJC 2N18C 1IJDB 2KSJA 3M91A 2FYNC 2H89C 1CORA 1SQVG 5BU8B 1VF5C 3H1HJ 4RSZA 3IFMA 2GB8B 1H32B 2OYOA 3TSIA 4WQAA 3MD0A 1LFMA 1L0ND 1FZBA 5GTIE 1SQPK 5APTA 1I8PA 3V4WA 3GMAA 3H25A 1K73Q 3ORVA 2V07A 1ZRTD 3L71E 1PGQA 1JNMA 1S5LV 1FJKA 1PP9D 1JY2P 1C6RA 1HF9A 3MK7C 1LS9A 1LTTC 3H1JG 2ZZS1 1COTA 1FZAA 1BSHA 3CCQP 1H0TB 3M9HA 1OVUA 1L0LK 2HODA 1A02F 1JY3P 4AQRD 4IL6X 4L74A 3A3YB 1LT9B 2IX7C 1VQ4P 155CA 1VYDA 3MK7B 2N3BA 1VQ8P 1NOHA 1T8ZA 1N7SB 1HVVA 1RZ6A 2AXTV 1T2KD 5GTHE 5AW4B 2UWJE 2WSEJ 2YO3A 3HQ7A 3PXWA 3RBXA 3HE4B 2JQRA 3IAOA 1X0TA 2WPSA 2WPQA 3VOPA 3L4OA 5AW5B 3L75D 1FE6A 2YIUC 3HD7B 1YJWP 5DFSA 3B5NB 2OZ1A 1NTKE 3FWNA 1BCCJ 5CMZA 1DT1A 1KYOD 1FZGA 1N9CA 2WSFJ 1HZUA 5C39A 1C2NA 2YIUB 3ZOWA 4KJMA 1M7LA 1R5LA 3H1IE 4H13B 1CIEA 1M56D 4FA1A 1KC8Q 1GW3A 2B89A 3B4SA 2LXBA 2FXOA 2W6BA 1AA0A 1HJBA 5AVTB 1GDTA 2KS1A 4HKZH 2K1AA 1BL9A 1M6ZA 3CYTI 1LNQA 1M57D 3CXHH 3ZOXA 2JWAA 2K88A 1S9KE 1CI6B 4WQDA 3D6ZA 3ZOOA 3M0DC 5KAFE 2C1DB 1GTWA 1HUCA 4R4LA 2WSSH 4Y99C 5AVYB 2OYIC 2KXPB 4OWFA 2A06G 1HZVA 1NKNA 3WUVA 2HFED 2IBZI 2K3RA 2FWLA 3MZWB 2FXMA 4AANA 2IFNA 1SQQG 1J1EB 1IFPA 1PPJD 2KP8A 4Y99B 1PL5A 3M9BA 3P8CE 2KLUA 3KPEA 1FHBA 4K3AA 5DJQB 4RO0A 4UB8H 2GIWA 1VQ6P 3L70G 3OAKA 1USDA 1QGKB 1T2KC 2N9JA 2NPSA 3ZCFA 2O01N 1S1CX 1BSNA 451CA 4PJ0H 2ZAEB 1H33A 4MN4C 1CC5A 1VQOP 4UB6V 1CYCA 1FI3A 1EC5A 1NAYA 1URQB 3TNUA 1RE3C 5KLIC 1UIIA 2L91A 3U1AA 1IK9A 1L0NE 4EDFA 2IZ1A 2JP3A 3CX5I 2P1JA 1VQKP 5GTIH 3RLMA 2H88C 1ZRTE 5KLIB 3H1JE 2CXBA 2BEZF 2AXCA 1VPCA 1PP9E 1FAVA 2BCNB 3OA8B 4DJGA 3D71A 1AVOA 5APUA 1D7MA 2A45I 3I55P 3T97B 1DIIC 1SQBG 5B66H 4H0JA 2YMYA 1NTMD 2ZT9D 1WMKA 2YXRB 3A0BE 1CTYA 4PD4E 1ZLLA 2P7JA 5CJ0A 1K05A 3KQGA 3HE5B 3A0HV 4H0LB 4I2LC 3AE3C 1H89A 1L0LJ 2E75D 1KZUB 1KQFB 3VYIA 5C0ZA 1NH4A 1EZVD 1AOQA 3L75E 2N1TD 3D70A 4ASVA 1KORA 3I56P 4EIDA 3WC8A 1JOCA 3CWBD 3MUDC 1I6DA 2WPRA 1NTZD 2WSEH 1GK6A 1FZCC 3AE2C 1X9VA 2K9YA 1Q7YQ 3HTKB 2R3CA 2IBZD 3AE1C 4HYTB 2M3EA 3OA7A 5DF5A 1KN7A 2ZVOB 2HR3A 2QJKC 1HBWA 1FC2C 1KILD 1YEAA 2Q5UA 3WU2E 4I7ZC 1SFCD 1M1JB 1CIHA 1QL1A 2CE1A 2BCCJ 3Q3DA 1HJ4A 4D6TJ 1BE3D 2E42A 4HH2A 5KJ7D 4U3FJ 4AAMA 2WSFH 2FRCA 1OX3A 3KZIE 1CRIA 4DY9A 4I7ZB 3E1IA 1CIGA 2N9IA 3BCCJ 1LWUB 3SVWA 3VP9A 1GL2D 1FDMA 3L74D 3CLQA 1HJ5A 4JYBA 4WY4A 1ZR2A 1HCMA 3GHGA 3GW6A 2OYHB 3RN0A 5AURA 2Q7CA 2K9JA 1I6EA 2LKMA 2KNCA 1PPJE 5TISE 4EIJA 3L70E 3PH2B 3CX5D 4N0KA 4H44B 1VQ5P 2WSCJ 1OW7A 1CSBA 1NTKK 2ZT9C 2I8FA 3TGUD 1DW1A 1E79H 4P4QB 5CIEB 4N3YB 1R8EA 3VMYA 1NGMB 2C0WA 5C9MA 1ZP0C 2ZOOA 1U7MA 1FDIA 4FANA 1YICA 1NVOA 2A45G 1LTJA 2E75C 1IO3A 4W7ZA 2P67A 1ZMEC 3TF5A 3MTUE 4RJTA 2XTSB 2ZYGA 1YI2P 2N1TC 2KIKA 3AEAC 3BRVB 1Q82Q 4ZKPA 4Y28J 2C9LY 2GC7D 1IZL0 4GKGA 3L4MA 2R32A 2PP6A 2N3YA 5AVUB 4H0KA 3P8MC 1FZFA 1IQCA 1RAQA 1LJ2A 1RE4C 1KILC 3EFFK 2H43A 1VQPP 1SFCC 3FXDA 3EFGA 5EFWB 1N7SD 1S5LX 5IY51 1SP4A 1NTME 1F1CA 3PXTA 5KJ7C 1AV1A 3X39A 1HTLC 2ZONG 1YHQP 1KILB 3IR9A 2V7QJ 5AW7B 4YXWH 2KUBA 3OJAB 4EIFA 4AAOA 4UB6H 1KB0A 2FYUD 4BRYB 2I8DA 1FJ0A 3HD7D 1GL2C 1KFNA 3CWBJ 1VQMP 2WT7A 1L4AB 1I54A 1FBMA 5CYTR 3B5ND 1PGJA 2Y0EA 3VNWA 2BGVX 5L8RJ 4YE1A 1JCCA 2H8PD 3BVHA 1USEA 2O1KA 5GTIV 4U7JA 1S2EA 1CZQA 1L0NK 4XA4A 5KLVD 4L76A 3CWBE 3O20A 4H13D 1KQLA 3N7NA 1JY2N 1NTZE 3GG2A 2NRGA 2M5AB 2M0BA 3P8CD 3RGUA 4FA4A 3TK1A 1OXZA 1C6OA 3NFQA 1K8AQ 2OQQA 1AJYA 1LTIC 2XDJA 1KYOH 2L4DA 1J1DC 1JY3N 3U59A 2W6AA 1KILE 3EQ2A 1YTZT 4FB1A 4J20A 3N4XA 1AFOA 1MKMA 2HLOA 3OCDA 2C1DA 1JEKA 3CCLP 2O1JA 1SQVD 1BE3E 3L74J 1RH5B 3RL0D 1GZLA 1J1DB 4A7PA 2WMMA 3CP5A 2ZJSE 3H1LD 3L71J 3H6PA 1JY2O 3II6A 3O6QA 4LJIA 1KQSO 1DW2A 3M0DA 1VQNP 1JDLA 2AEMA 3CCVP 3H1LG 4IFFA 3H32A 1G2CB 3L74E 1EB7A 2J5UA 1JY3O 2OYIA 2YCCA 1LP1B 1NHLA 1LC2A 3H1JD 4WQEA 3V5BA 1LT9C 4NFGB 1KX7A 3CX5E 3NBSA 3FGAD 1N7SC 5AW2B 1U74B 4DCKA 3G71P 3TGUE 1GD2E 3SWKA 4O1WA 2YQBA 1HRCA 1CHJA 4PD4D 4AUWA 1URQA 3MHVA 5APYA 1NMLA 1VQLP 2H7HA 5AVRB 1URQD 1Q2NA 3HD7C 4YPCA 4DOJA 1DD3A 3SWYA 4BWNA 1AQTA 1LGHB 1A8CA 2WSCH 1KB9H 4NPDA 3RK3B 2B4ZA 2E74B 1NTKJ 2RN0A 1RE3A 3B5NC 1E2RA 1MFZA 3HQ6A 3AEFC 1HJ3A 1RQUA 1GKSA 4GOFA 2ITAA 2JJLA 1GJQA 3H1IJ 3B8EB 5CICB 1AQ5A 4QMAA 3T97A 4H13C 3WUIA 2FXPA 2FBWC 3CC4P 1FZEA 2AI5A 1SQQK 2QVAA 1SQPG 2ZFCA 5KTBA 1FJPA 3GLMA 3AEEC 4JBZA 1YBKA 3PLNA 3QH9A 4TT3H 1ZV8A 1CCRA 2C1VA 1S5LE 1MZ4A 2R5DA 4H0LD 3RL0C 3G6EP 3USSA 1M8OB 1ZXGA 1L0LG 3RK3E 2LIRA 3E7KA 3CU4A 1CYJA 2FYUE 1OW8A 1PGOA 2AXTE 3RL0B
chains in the Genus database with same CATH topology
5TJHA 2A06D 5CIDB 3NWVA 1KIBA 2PCCB 3C2CA 5C0ZA 2EXVA 1EZVD 1SQQD 5DJQC 1AOQA 1FOCA 1F1FA 3ZOYA 3O0RC 1DVVA 4EIDA 2JTIB 3WC8A 2BH4X 2BH5X 2LITA 3CWBD 4JCGA 3L70D 1CXCA 1I6DA 2N18B 1NTZD 1P84D 1CNOA 1NTKD 2FYNB 1I8OA 1N15A 2VHDA 3DR0A 2IBZD 1L9JC 5DF5A 2AIUA 4UB8V 1AYGA 1YEAA 3H1ID 1CIFA 3A0BV 3L72D 1CRYA 4EIEA 1CIHA 1NNOA 4AX3A 2CE1A 1BCCD 1HJ4A 1BE3D 4O1QA 3DMIA 4PJ0V 4AAMA 2ORLA 2FRCA 1CRIA 4DY9A 1RZ5A 5H2FV 1KV9A 1CIGA 4Y5RA 3ITKA 2N9IA 2QJPB 5KAFV 3OA8A 3TDKA 3RMZA 3CX5W 3SVWA 1SQPD 351CA 1HROA 1GIWA 3L74D 1KYOW 3VYMA 2C9XB 1HJ5A 1M60A 1HCMA 3GW6A 3RN0A 5AURA 3ZBMA 3VMAA 4PWAA 1I6EA 1H9XA 4WQ7A 1QKSA 1QL3A 1MG3D 1SQBD 1W5CT 4QAOA 3PH2B 3CX5D 1CO6A 4N0KA 2CA4B 1L0LD 2N9YB 2I8FA 3TGUD 1IRVA 1DW1A 1E29A 1WEJF 1NMIA 1AKKA 3CXHW 1M70A 4P4QB 5CIEB 3HQ9A 1CTJA 5B66V 3PRJA 4L1QA 1GQ1A 5KAIV 1H31B 3PXSA 4WQ8A 1OAEA 5C9MA 2ZOOA 4FANA 2OZ1B 2D0WA 1YICA 1C52A 1K3GA 3KZIV 1IO3A 2BPBB 3WFEC 2N18C 1N90A 3TF5A 1CORA 4RJTA 2XTSB 4AALA 4RSZA 1DIQC 2GB8B 1H32B 1CHHA 4WQAA 2PCBB 3OCDB 4WQBA 1LFMA 1L0ND 3A9FA 2BCCD 1E8EA 1I8PA 2GC7D 4D6TD 5CIGB 1CRGA 1CXAA 3JBTB 1IZL0 3SWSA 4U3FD 3L4MA 3ORVA 2V07A 1CSVA 1ZRTD 5CIBB 2Y0CA 2N3YA 1FCDC 4H0KA 1IQCA 2C8SA 1YCCA 1S5LV 1YFCA 1PP9D 1RAQA 1C6RA 3BCCD 1SQXD 3MK7C 1LS9A 2ZZS1 4IL6V 1COTA 5IY51 1W2LA 1F1CA 3PXTA 3X39A 2ZONG 1CRHA 1S6VB 3VRDA 3O5CA 155CA 1VYDA 3MK7B 2N3BA 3FWLA 2DGEA 4EIFA 1RZ6A 2AXTV 4AAOA 3RN1A 1KB0A 2ZBOA 2FYUD 1ETPA 2C1UA 1FJ0A 1YEBA 1J3SA 1KB9D 4FA5A 2YK3A 1BGYD 3HQ7A 3PXWA 2JQRA 1I54A 4GYDA 5CYTR 1C7MA 1N50A 1QYZA 2Y0EA 3VNWA 2BGVX 1CSXA 1I5TA 4YE1A 3L4OA 4MU8A 3L75D 3WFDC 1U75B 5GTIV 3DP5A 1H31A 5KLVD 1H33B 3O20A 1GU2A 5DFSA 3GG2A 2OZ1A 1DT1A 1I55A 1KYOD 3M97X 4FA4A 1N9CA 1HZUA 1FI9A 2Y0DA 1C6OA 1C2NA 2YIUB 1KX2A 3ZOWA 2L4DA 3H1HD 3WU2V 5CIHB 3O1YA 1DVHA 1H9YA 4XYDB 4FB1A 1CIEA 1QN2A 2QG4A 4FA9A 4J20A 4FA1A 1H32A 3OCDA 2C1DA 2KS1A 1NU1D 3WFBC 1SQVD 1BL9A 1M6ZA 3CYTI 1GDVA 1MG2D 4A7PA 1A2SA 3CXHD 3CP5A 2PACA 5B6QA 1RAPA 1R0QA 1A56A 3ZOXA 1CYIA 3H1LD 2JWAA 2GC4D 3H1KD 4EICA 4LJIA 1DW2A 4WQDA 2O3JA 1JDLA 3NBTA 3ZOOA 1CRCA 3ZIYA 2C1DB 1EB7A 1NIRA 5B5EV 5KKZB 1CRJA 2YCCA 3KHUA 1L9BC 2HV4A 1HZVA 1LC2A 3H1JD 2FWLA 4WQEA 1C75A 4AANA 5TISV 4KMGA 1B7VA 1YNRA 1H1OA 4NFGB 2D0SA 1C6SA 1PPJD 1KX7A 5EXQA 3NBSA 1U74B 1IRWA 1CSWA 1FHBA 5DJQB 4O1WA 4V2KA 2YQBA 1HRCA 1CHJA 2GIWA 4PD4D 3TYIA 4FAVA 1AOFA 1YTCA 1CTZA 1NMLA 3WFCC 4Q5PA 2N9JA 1DW0A 3PHLA 3ZCFA 4WQCA 451CA 2B0ZB 1FI7A 2C2CA 1H33A 1CC5A 3L73D 4UB6V 1CYCA 1FI3A 1CCHA 1A8CA 2ZXYA 2B4ZA 2RN0A 1E2RA 2QJKB 3HQ6A 2DVHA 4L3GA 1LMSA 1HJ3A 2MTAC 1LC1A 1ZZHA 1GKSA 2L91A 1CHIA 1DW3A 5CIFB 1GJQA 5CICB 4EDFA 3WUIA 3SJLA 1CEDA 1CSUA 1OCDA 5E79V 2AI5A 3RLMA 5KLIB 4WQ9A 3SLEA 2CXBA 3L71D 1YIQA 1C2RA 1HH7A 2BCNB 3OA8B 2V08A 3PLNA 2Q3EA 3HQ8A 2QJYB 1CCRA 2C1VA 1WVEC 1MZ4A 1DIIC 4K3IA 2MHMA 4H0JA 1NTMD 1CTYA 4PW9B 2B10B 2K9JB 2CA3B 2BLFB 1QL4A 2B12B 2LIRA 5GTHV 2RMZA 4L3HA 2KNCB 4XXLA 3CU4A 1CYJA 3A0HV 4GEDB 3PTZA 3SXTA 1K3HA 2B11B 2CE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJH A;  2A06 D;  5CID B;  3NWV A;  1KIB A;  2PCC B;  3C2C A;  5C0Z A;  2EXV A;  1EZV D;  1SQQ D;  5DJQ C;  1AOQ A;  1FOC A;  1F1F A;  3ZOY A;  3O0R C;  1DVV A;  4EID A;  2JTI B;  3WC8 A;  2BH4 X;  2BH5 X;  2LIT A;  3CWB D;  4JCG A;  3L70 D;  1CXC A;  1I6D A;  2N18 B;  1NTZ D;  1P84 D;  1CNO A;  1NTK D;  2FYN B;  1I8O A;  1N15 A;  2VHD A;  3DR0 A;  2IBZ D;  1L9J C;  5DF5 A;  2AIU A;  4UB8 V;  1AYG A;  1YEA A;  3H1I D;  1CIF A;  3A0B V;  3L72 D;  1CRY A;  4EIE A;  1CIH A;  1NNO A;  4AX3 A;  2CE1 A;  1BCC D;  1HJ4 A;  1BE3 D;  4O1Q A;  3DMI A;  4PJ0 V;  4AAM A;  2ORL A;  2FRC A;  1CRI A;  4DY9 A;  1RZ5 A;  5H2F V;  1KV9 A;  1CIG A;  4Y5R A;  3ITK A;  2N9I A;  2QJP B;  5KAF V;  3OA8 A;  3TDK A;  3RMZ A;  3CX5 W;  3SVW A;  1SQP D;  351C A;  1HRO A;  1GIW A;  3L74 D;  1KYO W;  3VYM A;  2C9X B;  1HJ5 A;  1M60 A;  1HCM A;  3GW6 A;  3RN0 A;  5AUR A;  3ZBM A;  3VMA A;  4PWA A;  1I6E A;  1H9X A;  4WQ7 A;  1QKS A;  1QL3 A;  1MG3 D;  1SQB D;  1W5C T;  4QAO A;  3PH2 B;  3CX5 D;  1CO6 A;  4N0K A;  2CA4 B;  1L0L D;  2N9Y B;  2I8F A;  3TGU D;  1IRV A;  1DW1 A;  1E29 A;  1WEJ F;  1NMI A;  1AKK A;  3CXH W;  1M70 A;  4P4Q B;  5CIE B;  3HQ9 A;  1CTJ A;  5B66 V;  3PRJ A;  4L1Q A;  1GQ1 A;  5KAI V;  1H31 B;  3PXS A;  4WQ8 A;  1OAE A;  5C9M A;  2ZOO A;  4FAN A;  2OZ1 B;  2D0W A;  1YIC A;  1C52 A;  1K3G A;  3KZI V;  1IO3 A;  2BPB B;  3WFE C;  2N18 C;  1N90 A;  3TF5 A;  1COR A;  4RJT A;  2XTS B;  4AAL A;  4RSZ A;  1DIQ C;  2GB8 B;  1H32 B;  1CHH A;  4WQA A;  2PCB B;  3OCD B;  4WQB A;  1LFM A;  1L0N D;  3A9F A;  2BCC D;  1E8E A;  1I8P A;  2GC7 D;  4D6T D;  5CIG B;  1CRG A;  1CXA A;  3JBT B;  1IZL 0;  3SWS A;  4U3F D;  3L4M A;  3ORV A;  2V07 A;  1CSV A;  1ZRT D;  5CIB B;  2Y0C A;  2N3Y A;  1FCD C;  4H0K A;  1IQC A;  2C8S A;  1YCC A;  1S5L V;  1YFC A;  1PP9 D;  1RAQ A;  1C6R A;  3BCC D;  1SQX D;  3MK7 C;  1LS9 A;  2ZZS 1;  4IL6 V;  1COT A;  5IY5 1;  1W2L A;  1F1C A;  3PXT A;  3X39 A;  2ZON G;  1CRH A;  1S6V B;  3VRD A;  3O5C A;  155C A;  1VYD A;  3MK7 B;  2N3B A;  3FWL A;  2DGE A;  4EIF A;  1RZ6 A;  2AXT V;  4AAO A;  3RN1 A;  1KB0 A;  2ZBO A;  2FYU D;  1ETP A;  2C1U A;  1FJ0 A;  1YEB A;  1J3S A;  1KB9 D;  4FA5 A;  2YK3 A;  1BGY D;  3HQ7 A;  3PXW A;  2JQR A;  1I54 A;  4GYD A;  5CYT R;  1C7M A;  1N50 A;  1QYZ A;  2Y0E A;  3VNW A;  2BGV X;  1CSX A;  1I5T A;  4YE1 A;  3L4O A;  4MU8 A;  3L75 D;  3WFD C;  1U75 B;  5GTI V;  3DP5 A;  1H31 A;  5KLV D;  1H33 B;  3O20 A;  1GU2 A;  5DFS A;  3GG2 A;  2OZ1 A;  1DT1 A;  1I55 A;  1KYO D;  3M97 X;  4FA4 A;  1N9C A;  1HZU A;  1FI9 A;  2Y0D A;  1C6O A;  1C2N A;  2YIU B;  1KX2 A;  3ZOW A;  2L4D A;  3H1H D;  3WU2 V;  5CIH B;  3O1Y A;  1DVH A;  1H9Y A;  4XYD B;  4FB1 A;  1CIE A;  1QN2 A;  2QG4 A;  4FA9 A;  4J20 A;  4FA1 A;  1H32 A;  3OCD A;  2C1D A;  2KS1 A;  1NU1 D;  3WFB C;  1SQV D;  1BL9 A;  1M6Z A;  3CYT I;  1GDV A;  1MG2 D;  4A7P A;  1A2S A;  3CXH D;  3CP5 A;  2PAC A;  5B6Q A;  1RAP A;  1R0Q A;  1A56 A;  3ZOX A;  1CYI A;  3H1L D;  2JWA A;  2GC4 D;  3H1K D;  4EIC A;  4LJI A;  1DW2 A;  4WQD A;  2O3J A;  1JDL A;  3NBT A;  3ZOO A;  1CRC A;  3ZIY A;  2C1D B;  1EB7 A;  1NIR A;  5B5E V;  5KKZ B;  1CRJ A;  2YCC A;  3KHU A;  1L9B C;  2HV4 A;  1HZV A;  1LC2 A;  3H1J D;  2FWL A;  4WQE A;  1C75 A;  4AAN A;  5TIS V;  4KMG A;  1B7V A;  1YNR A;  1H1O A;  4NFG B;  2D0S A;  1C6S A;  1PPJ D;  1KX7 A;  5EXQ A;  3NBS A;  1U74 B;  1IRW A;  1CSW A;  1FHB A;  5DJQ B;  4O1W A;  4V2K A;  2YQB A;  1HRC A;  1CHJ A;  2GIW A;  4PD4 D;  3TYI A;  4FAV A;  1AOF A;  1YTC A;  1CTZ A;  1NML A;  3WFC C;  4Q5P A;  2N9J A;  1DW0 A;  3PHL A;  3ZCF A;  4WQC A;  451C A;  2B0Z B;  1FI7 A;  2C2C A;  1H33 A;  1CC5 A;  3L73 D;  4UB6 V;  1CYC A;  1FI3 A;  1CCH A;  1A8C A;  2ZXY A;  2B4Z A;  2RN0 A;  1E2R A;  2QJK B;  3HQ6 A;  2DVH A;  4L3G A;  1LMS A;  1HJ3 A;  2MTA C;  1LC1 A;  1ZZH A;  1GKS A;  2L91 A;  1CHI A;  1DW3 A;  5CIF B;  1GJQ A;  5CIC B;  4EDF A;  3WUI A;  3SJL A;  1CED A;  1CSU A;  1OCD A;  5E79 V;  2AI5 A;  3RLM A;  5KLI B;  4WQ9 A;  3SLE A;  2CXB A;  3L71 D;  1YIQ A;  1C2R A;  1HH7 A;  2BCN B;  3OA8 B;  2V08 A;  3PLN A;  2Q3E A;  3HQ8 A;  2QJY B;  1CCR A;  2C1V A;  1WVE C;  1MZ4 A;  1DII C;  4K3I A;  2MHM A;  4H0J A;  1NTM D;  1CTY A;  4PW9 B;  2B10 B;  2K9J B;  2CA3 B;  2BLF B;  1QL4 A;  2B12 B;  2LIR A;  5GTH V;  2RMZ A;  4L3H A;  2KNC B;  4XXL A;  3CU4 A;  1CYJ A;  3A0H V;  4GED B;  3PTZ A;  3SXT A;  1K3H A;  2B11 B;  2CE0 A; 
#chains in the Genus database with same CATH topology
 1J1E C;  2A06 D;  5CID B;  3V2R A;  3NWV A;  3L4F A;  2GM4 A;  3KXD A;  1SQQ D;  5AVQ B;  5DJQ C;  4W80 A;  1FOC A;  1F1F A;  2YKP A;  3HRN A;  2QEX P;  2V7Q H;  2Z5I A;  1IO4 A;  1N86 A;  5KLV E;  3MUD A;  2BH5 X;  3O8Z A;  4C7N A;  1FZC A;  3L70 D;  1IFJ A;  2J58 A;  2P58 A;  2BCC G;  1LTA C;  3KYQ A;  4D6T G;  2HG5 D;  3NTN A;  1L9J C;  2O01 J;  2AIU A;  2HPC B;  1URQ C;  1AYG A;  3P32 A;  1FOS E;  2HYN A;  3VP8 A;  4NPE A;  5BU5 A;  3A0B V;  3L72 D;  3FX0 A;  4PV1 B;  5KAI E;  2GUS A;  1L0N J;  1SQX G;  3BCC G;  1NTM K;  1SQV E;  3V2N A;  3HUS C;  1FDO A;  3L72 G;  3V6I A;  3DMI A;  1XTG B;  2CK3 H;  2WPV B;  4IFD K;  3H1L E;  3H1J J;  1HH0 A;  4WVZ A;  2XU6 A;  3CPW O;  2NZ2 A;  2QJP B;  3TDK A;  1PP9 J;  1CW5 A;  3CX5 W;  3HUS B;  351C A;  1RF0 C;  2Q1K A;  1X79 B;  4H44 D;  1BGY G;  4IFM A;  3ZBM A;  1VQ9 P;  2OTK E;  1QL3 A;  1SQB D;  2OGU A;  1W5C T;  1K9M Q;  4QAO A;  2JWD A;  5CCG D;  2XV5 A;  3AE7 C;  2CA4 B;  3A2A A;  1P84 E;  4H0L C;  1NTZ K;  2CPB A;  3JCU E;  4IL6 E;  2N9B A;  2MKV A;  4N78 D;  1NO4 A;  1E29 A;  1VQ7 P;  1WEJ F;  1S72 P;  3HQ9 A;  2POH A;  3PRJ A;  4L1Q A;  1KQG B;  1OVR A;  1N7L A;  3L75 J;  3PXS A;  1PFI A;  1OAE A;  5AW9 B;  2OZ1 B;  1YIJ P;  5GTH H;  1C52 A;  2CPS A;  3KZI V;  3G4S P;  3WFE C;  1JUN A;  1NU1 G;  3SFE C;  2N1T A;  1N90 A;  4AAL A;  2K37 A;  1M90 Q;  4LGD E;  2ZXX A;  4WQB A;  3LIE A;  3A9F A;  3L37 A;  2KS1 B;  3H1K G;  1CXA A;  3JBT B;  1R5S A;  1M1J C;  1CSV A;  1NAF A;  2Y0C A;  1HGV A;  1FS0 E;  1RE4 A;  1KIL A;  1IFD A;  2C8S A;  1SFC A;  1OWA A;  3OW2 O;  1JMM A;  2GA1 A;  4BRY A;  2WVR A;  3CD6 P;  5KJ7 A;  1L4A A;  1LWU C;  3UIA A;  1S6V B;  3Q5S A;  1L4A D;  3VRD A;  3P7K A;  1SQQ J;  2OYH C;  1QVG O;  4IOI H;  2ZBO A;  1MZ9 A;  2WTY A;  1GL2 A;  1YIT P;  1MV8 A;  2FY8 A;  2A06 E;  3A0H E;  1JMB A;  3L70 J;  1RQV A;  2M5A A;  2WZ7 A;  5KAF H;  4H44 C;  1C7M A;  1N50 A;  1SQQ E;  3L73 G;  5B5E E;  2YO2 A;  3WFD C;  2IFM A;  3AE4 C;  3DP5 A;  1H31 A;  5CCG C;  1H33 B;  1GU2 A;  1GK4 A;  4HB1 A;  1I55 A;  2FYZ A;  2FFD C;  2Y0D A;  3TNU B;  1OMI A;  2XNX A;  1KX2 A;  3H1H D;  3O1Y A;  1DVH A;  1GMJ A;  1SQX E;  2C9N Y;  4XYD B;  5CCH D;  5K5G B;  5AVS B;  2QG4 A;  2KZJ A;  3L72 E;  4EOT A;  1H32 A;  3H1H G;  3VTP C;  2KB7 P;  1EDJ A;  1H8A A;  2FFD B;  3WFB C;  5KAI H;  3PJS K;  4XFJ A;  1GDV A;  4EYY Q;  2AEJ A;  3C1L A;  2PAC A;  5B6Q A;  1R0Q A;  3CI9 A;  2QIW A;  1A56 A;  1QVF O;  1CYI A;  2O01 H;  4EIC A;  2V4H A;  2FYU K;  2Q9I A;  1CRC A;  4O9B A;  1H0T A;  1ZW0 A;  1NIR A;  1CRJ A;  1P84 I;  2SPZ A;  1NTM J;  1LT9 A;  5E79 E;  5APX A;  1SQB E;  4KMG A;  1B7V A;  1LTS C;  3S1K A;  1YJN P;  1H1O A;  1N7S A;  2D0S A;  2W27 A;  1C6S A;  5KLV K;  1X8Y A;  4N78 E;  1N8R Q;  2Z5H A;  2KSE A;  3MIW A;  3HE4 A;  4FAV A;  1AOF A;  1AVY A;  1L4A C;  4IL6 H;  1TU3 F;  3A0B H;  1NWQ A;  1CTZ A;  4PD4 H;  1NTK G;  1UIX A;  3RK3 D;  2E74 D;  3I5C A;  2E43 A;  4Q5P A;  3HD7 A;  3PHL A;  1ZR4 A;  2B0Z B;  1RHZ B;  1FI7 A;  3L36 A;  1NU1 E;  3H1I G;  4C7R A;  1SQV K;  3B5N A;  4M3L A;  1NTZ J;  2ZXY A;  3Q1M A;  1KMI Z;  3WUT A;  1BCC G;  2P10 A;  2DVH A;  2KI7 B;  4L3G A;  2BEQ D;  3R2P A;  3H1K E;  4WBA A;  2JDI H;  2OTJ P;  1CHI A;  5CIF B;  5CBO A;  3CMA P;  3M9Q A;  3A7O A;  3SJL A;  1CED A;  1CSU A;  1PIX A;  5BVZ A;  1OCD A;  2E5Y A;  3AE8 C;  1QX8 A;  4WQ9 A;  1BE3 J;  1W2B O;  4TLF A;  4ZNC A;  1YIQ A;  4KT0 J;  5CCH C;  2Q6Q A;  4K35 A;  2QJY B;  1CI6 A;  1WVE C;  4UB8 E;  3WU2 H;  2MHM A;  3RBZ A;  1LTB C;  4WY4 B;  1YQ4 C;  3GHG B;  1YQ3 C;  4OH8 B;  1Y8A A;  4PW9 B;  1IFM A;  4DZO A;  1IZN B;  2K9J B;  2PRR A;  2D2C D;  1X22 A;  1QL4 A;  2QE7 H;  2B12 B;  5GTH V;  4NPF X;  2RMZ A;  1EDL A;  2JO1 A;  4PJ0 E;  2KNC B;  2W6J H;  4XXL A;  3B71 A;  3WUU A;  4GED B;  3KZI H;  5H2F E;  1GU5 A;  1K3H A;  2B11 B;  5AW8 B;  1DIP A;  1KIB A;  3RL0 g;  2PCC B;  3TGU J;  2EXV A;  1VDF A;  1OW6 A;  1JCD A;  3V2Q A;  2HPC A;  1JM0 A;  1DVV A;  5B5E H;  1Q81 Q;  2B88 A;  2JTI B;  2RKL A;  5M1B A;  1MUU A;  1T3J A;  2LIT A;  4JCG A;  1LT1 A;  1CXC A;  1LTJ B;  3BAS A;  4WWI A;  5TIS H;  2N18 B;  1P84 D;  2FYN B;  4PV1 D;  1L0N G;  1VF5 B;  4OVN F;  2VHD A;  1NKZ B;  3DR0 A;  3H1H E;  3G9R A;  3RK3 C;  2E74 C;  3AE6 C;  5B66 E;  1CIF A;  1CRY A;  5AVW B;  4EIE A;  4I6M C;  1OZH A;  1PP9 G;  3HUS A;  1KB9 I;  2W90 A;  3M0A A;  3AED C;  4O1Q A;  3K5B A;  3F5H A;  1SLQ A;  3Q2Y A;  1RZ5 A;  3W68 A;  4Y5R A;  3ITK A;  5APV A;  5KAF V;  3OA8 A;  5APQ A;  4C46 A;  1KV4 A;  4LLH A;  3RMZ A;  3SFD C;  1RF0 A;  1KTM A;  1SQP D;  1H88 A;  3M06 A;  1YTZ I;  4L75 A;  1ZOY C;  3LW5 J;  3SWF A;  2YKO A;  3ABV C;  1A02 J;  3RK2 D;  1H9X A;  1RF1 C;  2B87 B;  1QKS A;  4I1L A;  1G1J A;  3C9I A;  5E79 H;  1JTH B;  2DW3 A;  3HE5 A;  2FKW B;  3L75 G;  2FYU J;  1CO6 A;  2WT7 B;  3AEC C;  1L0L D;  2N9Y B;  3VMX A;  1NMI A;  1AKK A;  3CXH W;  1RF1 B;  2Z4E A;  1M70 A;  2XKM A;  3GF7 A;  2D2C C;  1CTJ A;  3D0W A;  3CXH I;  1FOS F;  1GQ1 A;  1SQX K;  5KAI V;  4WQ8 A;  4JF7 A;  1FU1 A;  5AVX B;  1BCC E;  5KLV J;  2WQY C;  1N73 C;  1K3G A;  2D2C B;  5DJT B;  1IFI A;  2BPB B;  4JYC A;  2PGD A;  1EZV I;  3HTK A;  5DJU B;  2PAJ A;  3MP7 B;  2Y9Y A;  3SSU A;  1DIQ C;  1SVF A;  1CHH A;  1QEX A;  2PCB B;  3OCD B;  1N73 B;  3CC2 P;  2BCC D;  5AW1 B;  3CCE P;  1E8E A;  5CBN A;  1W5C E;  1M1J A;  4D6T D;  5CIG B;  1CRG A;  1HGZ A;  3JSV C;  4PV1 C;  3SWS A;  4U3F D;  3LID A;  1EDK A;  1SQV J;  2QM7 A;  5CIB B;  1Y47 A;  1U57 A;  1FCD C;  5APS A;  1EQ7 A;  4U3F G;  1YCC A;  3O6Q B;  1YFC A;  1SQB K;  2KOG A;  3H1L J;  3BCC D;  1SQX D;  1T6A A;  2J59 M;  3V2P A;  3KDP B;  4IL6 V;  4GDO A;  3CCS P;  3H32 B;  1LWU A;  3ZDM A;  2OYI B;  2QJP C;  4OGQ D;  1W2L A;  4AYC A;  1L2P A;  1PPJ G;  3QWO C;  1Q86 Q;  1CRH A;  3O5C A;  2MJZ A;  2JR8 A;  2OYH A;  4KHX A;  3BRT B;  3FWL A;  2DGE A;  3A5T A;  2E5T A;  3RN1 A;  1U7J A;  4JQ0 D;  1ETP A;  1IC2 A;  1N2D C;  2C1U A;  1YEB A;  1J3S A;  1KB9 D;  1NU1 K;  4FA5 A;  1DEB A;  2HOD B;  2NPS D;  3CCR P;  1OIP A;  2YK3 A;  3U1C A;  1BGY D;  5H2F H;  2XZR A;  3FXE A;  2VRS A;  1JB0 J;  1DEE G;  1ZN5 A;  4GYD A;  3CL3 D;  4JPZ B;  1BDC A;  1QYZ A;  4BXL A;  1CSX A;  3RK2 C;  1I5T A;  4MU8 A;  1WRG A;  1U75 B;  2WIT A;  5CCG A;  1S3J A;  5AW0 B;  2FFD A;  1NYH A;  3CX5 H;  3M97 X;  3RK2 B;  1FI9 A;  2G8Y A;  3WU2 V;  5CIH B;  1YYC A;  5AW3 B;  1H9Y A;  2E76 D;  2M8R A;  1QN2 A;  1DH3 A;  1QLE D;  4FA9 A;  2LR2 A;  2IZ0 A;  2A45 H;  2OAR A;  2P2U A;  2IPP A;  1NU1 D;  1SQP J;  1MFT A;  1SS1 A;  3WMM 0;  1RY3 A;  5CHX A;  1MG2 D;  1A2S A;  5KKZ C;  3CXH D;  1NTM G;  3PP5 A;  1RAP A;  4UB6 E;  2W8Z A;  4RES B;  2QM8 A;  2GC4 D;  3H1K D;  3CC7 P;  2M3B A;  2JKV A;  1PZQ A;  3VN0 A;  2IDB A;  2O3J A;  3GF3 A;  3NBT A;  1K04 A;  1SQP E;  3CCU P;  3ZIY A;  3TYY A;  5B5E V;  5KKZ B;  1S4X A;  1W2E A;  2JEE A;  3KHU A;  1L9B C;  2HV4 A;  2PFX A;  2QRX A;  1C75 A;  5TIS V;  2RH0 A;  1YNR A;  1EZV G;  2I1J A;  2I1K A;  2R5B A;  2YXQ B;  5EXQ A;  1L0L E;  1HWT C;  4OGQ C;  1IRW A;  1CSW A;  1KYO E;  1S5L H;  4V2K A;  3AEG C;  1G1I A;  3CWB G;  3TYI A;  3LW5 H;  1E5W A;  1YTC A;  1NTZ G;  3WFC C;  2IYO A;  3IF4 A;  1QL2 A;  1DW0 A;  2IBZ G;  4OGQ B;  4WQC A;  3Q5R A;  4C7N B;  1OFC X;  1FZC B;  2NPS C;  2C2C A;  2R3S A;  1KFM A;  3L73 D;  1CCH A;  1GW4 A;  2AXT H;  1YJ9 P;  2ZYA A;  2QJK B;  1J2J B;  1LMS A;  1BE3 G;  2MTA C;  1LC1 A;  1ZZH A;  1Y9B A;  3S9O A;  2IYP A;  2NPS B;  1DW3 A;  1SQX J;  1PV3 A;  1JO5 A;  2BCC E;  1LTG C;  4EI2 A;  1DX7 A;  3L72 J;  4D6T E;  4U3F E;  5E79 V;  2GUV A;  3R4Y A;  4WB4 A;  2Y9Z A;  2B9B A;  3SLE A;  4WY4 D;  3L74 G;  3L71 D;  2KLV A;  5CCH A;  5CJ4 A;  1C2R A;  1HH7 A;  3EWK A;  2KYV A;  2E76 C;  3BCC E;  2V08 A;  3AEB C;  2Q3E A;  3HQ8 A;  3L71 G;  3Q5P A;  4K3I A;  3MGN A;  5APW A;  4HJG H;  1BGY J;  1G2C A;  3BAT A;  2C0X A;  4ASW A;  2B10 B;  4DT0 A;  3S4R A;  2CA3 B;  5AW6 B;  3W67 A;  2E76 B;  2BLF B;  3TGU G;  1LP1 A;  1PGP A;  1EXJ A;  4L3H A;  3CME P;  4L73 A;  1T3U A;  3E1R A;  3PTZ A;  1SQB J;  3SXT A;  2ZT9 B;  1HJ0 A;  3AE9 C;  3C8V A;  4B86 A;  1KB9 E;  4N6J A;  2CE0 A;  2YNY A;  4XE5 B;  5TJH A;  1BGY E;  3JC2 2;  3C2C A;  2QSI A;  3AE5 C;  1M1K Q;  3ZOY A;  4LC1 A;  3O0R C;  1VF5 D;  2L5G B;  4GOE A;  3CCJ P;  2WWW A;  2BH4 X;  2ZYD A;  3PH0 A;  2E75 B;  5AVZ B;  3CCM P;  3NMD A;  4W7Y A;  4ZKU A;  2QA4 P;  2W83 C;  1NU1 J;  1CNO A;  1NTK D;  1KD1 Q;  1I8O A;  1N15 A;  1IFN A;  4PD4 I;  1P84 H;  2N1T B;  2ZVN B;  3F89 A;  3JCU H;  4GT1 A;  3L35 A;  2G3A A;  4RKU J;  4UB8 V;  3VMZ A;  2OTL P;  3H1I D;  3H1K J;  1NNO A;  4AX3 A;  1DD4 A;  1BCC D;  3IN6 A;  1Q90 D;  3CXH E;  4PJ0 V;  2ORL A;  2LXC B;  2YMK A;  5H2F V;  1GU4 A;  1KV9 A;  1SFC B;  1BDD A;  2B87 A;  4YTP C;  1S9K D;  2XND H;  1JTH A;  4YXD C;  4GIF A;  2QJY C;  1XTC C;  1HRO A;  1GIW A;  2FYU G;  1EDI A;  1KYO W;  3VYM A;  2C9X B;  1M60 A;  1EZV E;  1KYO I;  3V4Q A;  1RF1 A;  4WY4 C;  3GHG C;  3VMA A;  4PWA A;  4Z1M H;  4WQ7 A;  4GOD A;  3G3Z A;  1MG3 D;  1WT6 A;  1GL2 B;  3NXS A;  1IK7 A;  2YKQ A;  2BAS A;  2Q3I A;  1EXI A;  2R44 A;  4ZMD A;  1Z56 A;  3L73 J;  5KLV G;  1IRV A;  3D6Y A;  2IBZ E;  4CPG A;  1OVV A;  5B66 V;  2KZI A;  5AVV B;  4R4M A;  2AEF A;  1H31 B;  2KK7 A;  2D0W A;  1N73 A;  3L73 E;  1VL2 A;  1NJI Q;  2ZXE B;  3A0H H;  1LTJ C;  2N18 C;  1IJD B;  2KSJ A;  3M91 A;  2FYN C;  2H89 C;  1COR A;  1SQV G;  5BU8 B;  1VF5 C;  3H1H J;  4RSZ A;  3IFM A;  2GB8 B;  1H32 B;  2OYO A;  3TSI A;  4WQA A;  3MD0 A;  1LFM A;  1L0N D;  1FZB A;  5GTI E;  1SQP K;  5APT A;  1I8P A;  3V4W A;  3GMA A;  3H25 A;  1K73 Q;  3ORV A;  2V07 A;  1ZRT D;  3L71 E;  1PGQ A;  1JNM A;  1S5L V;  1FJK A;  1PP9 D;  1JY2 P;  1C6R A;  1HF9 A;  3MK7 C;  1LS9 A;  1LTT C;  3H1J G;  2ZZS 1;  1COT A;  1FZA A;  1BSH A;  3CCQ P;  1H0T B;  3M9H A;  1OVU A;  1L0L K;  2HOD A;  1A02 F;  1JY3 P;  4AQR D;  4IL6 X;  4L74 A;  3A3Y B;  1LT9 B;  2IX7 C;  1VQ4 P;  155C A;  1VYD A;  3MK7 B;  2N3B A;  1VQ8 P;  1NOH A;  1T8Z A;  1N7S B;  1HVV A;  1RZ6 A;  2AXT V;  1T2K D;  5GTH E;  5AW4 B;  2UWJ E;  2WSE J;  2YO3 A;  3HQ7 A;  3PXW A;  3RBX A;  3HE4 B;  2JQR A;  3IAO A;  1X0T A;  2WPS A;  2WPQ A;  3VOP A;  3L4O A;  5AW5 B;  3L75 D;  1FE6 A;  2YIU C;  3HD7 B;  1YJW P;  5DFS A;  3B5N B;  2OZ1 A;  1NTK E;  3FWN A;  1BCC J;  5CMZ A;  1DT1 A;  1KYO D;  1FZG A;  1N9C A;  2WSF J;  1HZU A;  5C39 A;  1C2N A;  2YIU B;  3ZOW A;  4KJM A;  1M7L A;  1R5L A;  3H1I E;  4H13 B;  1CIE A;  1M56 D;  4FA1 A;  1KC8 Q;  1GW3 A;  2B89 A;  3B4S A;  2LXB A;  2FXO A;  2W6B A;  1AA0 A;  1HJB A;  5AVT B;  1GDT A;  2KS1 A;  4HKZ H;  2K1A A;  1BL9 A;  1M6Z A;  3CYT I;  1LNQ A;  1M57 D;  3CXH H;  3ZOX A;  2JWA A;  2K88 A;  1S9K E;  1CI6 B;  4WQD A;  3D6Z A;  3ZOO A;  3M0D C;  5KAF E;  2C1D B;  1GTW A;  1HUC A;  4R4L A;  2WSS H;  4Y99 C;  5AVY B;  2OYI C;  2KXP B;  4OWF A;  2A06 G;  1HZV A;  1NKN A;  3WUV A;  2HFE D;  2IBZ I;  2K3R A;  2FWL A;  3MZW B;  2FXM A;  4AAN A;  2IFN A;  1SQQ G;  1J1E B;  1IFP A;  1PPJ D;  2KP8 A;  4Y99 B;  1PL5 A;  3M9B A;  3P8C E;  2KLU A;  3KPE A;  1FHB A;  4K3A A;  5DJQ B;  4RO0 A;  4UB8 H;  2GIW A;  1VQ6 P;  3L70 G;  3OAK A;  1USD A;  1QGK B;  1T2K C;  2N9J A;  2NPS A;  3ZCF A;  2O01 N;  1S1C X;  1BSN A;  451C A;  4PJ0 H;  2ZAE B;  1H33 A;  4MN4 C;  1CC5 A;  1VQO P;  4UB6 V;  1CYC A;  1FI3 A;  1EC5 A;  1NAY A;  1URQ B;  3TNU A;  1RE3 C;  5KLI C;  1UII A;  2L91 A;  3U1A A;  1IK9 A;  1L0N E;  4EDF A;  2IZ1 A;  2JP3 A;  3CX5 I;  2P1J A;  1VQK P;  5GTI H;  3RLM A;  2H88 C;  1ZRT E;  5KLI B;  3H1J E;  2CXB A;  2BEZ F;  2AXC A;  1VPC A;  1PP9 E;  1FAV A;  2BCN B;  3OA8 B;  4DJG A;  3D71 A;  1AVO A;  5APU A;  1D7M A;  2A45 I;  3I55 P;  3T97 B;  1DII C;  1SQB G;  5B66 H;  4H0J A;  2YMY A;  1NTM D;  2ZT9 D;  1WMK A;  2YXR B;  3A0B E;  1CTY A;  4PD4 E;  1ZLL A;  2P7J A;  5CJ0 A;  1K05 A;  3KQG A;  3HE5 B;  3A0H V;  4H0L B;  4I2L C;  3AE3 C;  1H89 A;  1L0L J;  2E75 D;  1KZU B;  1KQF B;  3VYI A;  5C0Z A;  1NH4 A;  1EZV D;  1AOQ A;  3L75 E;  2N1T D;  3D70 A;  4ASV A;  1KOR A;  3I56 P;  4EID A;  3WC8 A;  1JOC A;  3CWB D;  3MUD C;  1I6D A;  2WPR A;  1NTZ D;  2WSE H;  1GK6 A;  1FZC C;  3AE2 C;  1X9V A;  2K9Y A;  1Q7Y Q;  3HTK B;  2R3C A;  2IBZ D;  3AE1 C;  4HYT B;  2M3E A;  3OA7 A;  5DF5 A;  1KN7 A;  2ZVO B;  2HR3 A;  2QJK C;  1HBW A;  1FC2 C;  1KIL D;  1YEA A;  2Q5U A;  3WU2 E;  4I7Z C;  1SFC D;  1M1J B;  1CIH A;  1QL1 A;  2CE1 A;  2BCC J;  3Q3D A;  1HJ4 A;  4D6T J;  1BE3 D;  2E42 A;  4HH2 A;  5KJ7 D;  4U3F J;  4AAM A;  2WSF H;  2FRC A;  1OX3 A;  3KZI E;  1CRI A;  4DY9 A;  4I7Z B;  3E1I A;  1CIG A;  2N9I A;  3BCC J;  1LWU B;  3SVW A;  3VP9 A;  1GL2 D;  1FDM A;  3L74 D;  3CLQ A;  1HJ5 A;  4JYB A;  4WY4 A;  1ZR2 A;  1HCM A;  3GHG A;  3GW6 A;  2OYH B;  3RN0 A;  5AUR A;  2Q7C A;  2K9J A;  1I6E A;  2LKM A;  2KNC A;  1PPJ E;  5TIS E;  4EIJ A;  3L70 E;  3PH2 B;  3CX5 D;  4N0K A;  4H44 B;  1VQ5 P;  2WSC J;  1OW7 A;  1CSB A;  1NTK K;  2ZT9 C;  2I8F A;  3TGU D;  1DW1 A;  1E79 H;  4P4Q B;  5CIE B;  4N3Y B;  1R8E A;  3VMY A;  1NGM B;  2C0W A;  5C9M A;  1ZP0 C;  2ZOO A;  1U7M A;  1FDI A;  4FAN A;  1YIC A;  1NVO A;  2A45 G;  1LTJ A;  2E75 C;  1IO3 A;  4W7Z A;  2P67 A;  1ZME C;  3TF5 A;  3MTU E;  4RJT A;  2XTS B;  2ZYG A;  1YI2 P;  2N1T C;  2KIK A;  3AEA C;  3BRV B;  1Q82 Q;  4ZKP A;  4Y28 J;  2C9L Y;  2GC7 D;  1IZL 0;  4GKG A;  3L4M A;  2R32 A;  2PP6 A;  2N3Y A;  5AVU B;  4H0K A;  3P8M C;  1FZF A;  1IQC A;  1RAQ A;  1LJ2 A;  1RE4 C;  1KIL C;  3EFF K;  2H43 A;  1VQP P;  1SFC C;  3FXD A;  3EFG A;  5EFW B;  1N7S D;  1S5L X;  5IY5 1;  1SP4 A;  1NTM E;  1F1C A;  3PXT A;  5KJ7 C;  1AV1 A;  3X39 A;  1HTL C;  2ZON G;  1YHQ P;  1KIL B;  3IR9 A;  2V7Q J;  5AW7 B;  4YXW H;  2KUB A;  3OJA B;  4EIF A;  4AAO A;  4UB6 H;  1KB0 A;  2FYU D;  4BRY B;  2I8D A;  1FJ0 A;  3HD7 D;  1GL2 C;  1KFN A;  3CWB J;  1VQM P;  2WT7 A;  1L4A B;  1I54 A;  1FBM A;  5CYT R;  3B5N D;  1PGJ A;  2Y0E A;  3VNW A;  2BGV X;  5L8R J;  4YE1 A;  1JCC A;  2H8P D;  3BVH A;  1USE A;  2O1K A;  5GTI V;  4U7J A;  1S2E A;  1CZQ A;  1L0N K;  4XA4 A;  5KLV D;  4L76 A;  3CWB E;  3O20 A;  4H13 D;  1KQL A;  3N7N A;  1JY2 N;  1NTZ E;  3GG2 A;  2NRG A;  2M5A B;  2M0B A;  3P8C D;  3RGU A;  4FA4 A;  3TK1 A;  1OXZ A;  1C6O A;  3NFQ A;  1K8A Q;  2OQQ A;  1AJY A;  1LTI C;  2XDJ A;  1KYO H;  2L4D A;  1J1D C;  1JY3 N;  3U59 A;  2W6A A;  1KIL E;  3EQ2 A;  1YTZ T;  4FB1 A;  4J20 A;  3N4X A;  1AFO A;  1MKM A;  2HLO A;  3OCD A;  2C1D A;  1JEK A;  3CCL P;  2O1J A;  1SQV D;  1BE3 E;  3L74 J;  1RH5 B;  3RL0 D;  1GZL A;  1J1D B;  4A7P A;  2WMM A;  3CP5 A;  2ZJS E;  3H1L D;  3L71 J;  3H6P A;  1JY2 O;  3II6 A;  3O6Q A;  4LJI A;  1KQS O;  1DW2 A;  3M0D A;  1VQN P;  1JDL A;  2AEM A;  3CCV P;  3H1L G;  4IFF A;  3H32 A;  1G2C B;  3L74 E;  1EB7 A;  2J5U A;  1JY3 O;  2OYI A;  2YCC A;  1LP1 B;  1NHL A;  1LC2 A;  3H1J D;  4WQE A;  3V5B A;  1LT9 C;  4NFG B;  1KX7 A;  3CX5 E;  3NBS A;  3FGA D;  1N7S C;  5AW2 B;  1U74 B;  4DCK A;  3G71 P;  3TGU E;  1GD2 E;  3SWK A;  4O1W A;  2YQB A;  1HRC A;  1CHJ A;  4PD4 D;  4AUW A;  1URQ A;  3MHV A;  5APY A;  1NML A;  1VQL P;  2H7H A;  5AVR B;  1URQ D;  1Q2N A;  3HD7 C;  4YPC A;  4DOJ A;  1DD3 A;  3SWY A;  4BWN A;  1AQT A;  1LGH B;  1A8C A;  2WSC H;  1KB9 H;  4NPD A;  3RK3 B;  2B4Z A;  2E74 B;  1NTK J;  2RN0 A;  1RE3 A;  3B5N C;  1E2R A;  1MFZ A;  3HQ6 A;  3AEF C;  1HJ3 A;  1RQU A;  1GKS A;  4GOF A;  2ITA A;  2JJL A;  1GJQ A;  3H1I J;  3B8E B;  5CIC B;  1AQ5 A;  4QMA A;  3T97 A;  4H13 C;  3WUI A;  2FXP A;  2FBW C;  3CC4 P;  1FZE A;  2AI5 A;  1SQQ K;  2QVA A;  1SQP G;  2ZFC A;  5KTB A;  1FJP A;  3GLM A;  3AEE C;  4JBZ A;  1YBK A;  3PLN A;  3QH9 A;  4TT3 H;  1ZV8 A;  1CCR A;  2C1V A;  1S5L E;  1MZ4 A;  2R5D A;  4H0L D;  3RL0 C;  3G6E P;  3USS A;  1M8O B;  1ZXG A;  1L0L G;  3RK3 E;  2LIR A;  3E7K A;  3CU4 A;  1CYJ A;  2FYU E;  1OW8 A;  1PGO A;  2AXT E;  3RL0 B; 
#chains in the Genus database with same CATH homology
 5TJH A;  2A06 D;  5CID B;  3NWV A;  1KIB A;  2PCC B;  3C2C A;  5C0Z A;  2EXV A;  1EZV D;  1SQQ D;  5DJQ C;  1AOQ A;  1FOC A;  1F1F A;  3ZOY A;  3O0R C;  1DVV A;  4EID A;  2JTI B;  3WC8 A;  2BH4 X;  2BH5 X;  2LIT A;  3CWB D;  4JCG A;  3L70 D;  1CXC A;  1I6D A;  2N18 B;  1NTZ D;  1P84 D;  1CNO A;  1NTK D;  2FYN B;  1I8O A;  1N15 A;  2VHD A;  3DR0 A;  2IBZ D;  1L9J C;  5DF5 A;  2AIU A;  4UB8 V;  1AYG A;  1YEA A;  3H1I D;  1CIF A;  3A0B V;  3L72 D;  1CRY A;  4EIE A;  1CIH A;  1NNO A;  4AX3 A;  2CE1 A;  1BCC D;  1HJ4 A;  1BE3 D;  4O1Q A;  3DMI A;  4PJ0 V;  4AAM A;  2ORL A;  2FRC A;  1CRI A;  4DY9 A;  1RZ5 A;  5H2F V;  1KV9 A;  1CIG A;  4Y5R A;  3ITK A;  2N9I A;  2QJP B;  5KAF V;  3OA8 A;  3TDK A;  3RMZ A;  3CX5 W;  3SVW A;  1SQP D;  351C A;  1HRO A;  1GIW A;  3L74 D;  1KYO W;  3VYM A;  2C9X B;  1HJ5 A;  1M60 A;  1HCM A;  3GW6 A;  3RN0 A;  5AUR A;  3ZBM A;  3VMA A;  4PWA A;  1I6E A;  1H9X A;  4WQ7 A;  1QKS A;  1QL3 A;  1MG3 D;  1SQB D;  1W5C T;  4QAO A;  3PH2 B;  3CX5 D;  1CO6 A;  4N0K A;  2CA4 B;  1L0L D;  2N9Y B;  2I8F A;  3TGU D;  1IRV A;  1DW1 A;  1E29 A;  1WEJ F;  1NMI A;  1AKK A;  3CXH W;  1M70 A;  4P4Q B;  5CIE B;  3HQ9 A;  1CTJ A;  5B66 V;  3PRJ A;  4L1Q A;  1GQ1 A;  5KAI V;  1H31 B;  3PXS A;  4WQ8 A;  1OAE A;  5C9M A;  2ZOO A;  4FAN A;  2OZ1 B;  2D0W A;  1YIC A;  1C52 A;  1K3G A;  3KZI V;  1IO3 A;  2BPB B;  3WFE C;  2N18 C;  1N90 A;  3TF5 A;  1COR A;  4RJT A;  2XTS B;  4AAL A;  4RSZ A;  1DIQ C;  2GB8 B;  1H32 B;  1CHH A;  4WQA A;  2PCB B;  3OCD B;  4WQB A;  1LFM A;  1L0N D;  3A9F A;  2BCC D;  1E8E A;  1I8P A;  2GC7 D;  4D6T D;  5CIG B;  1CRG A;  1CXA A;  3JBT B;  1IZL 0;  3SWS A;  4U3F D;  3L4M A;  3ORV A;  2V07 A;  1CSV A;  1ZRT D;  5CIB B;  2Y0C A;  2N3Y A;  1FCD C;  4H0K A;  1IQC A;  2C8S A;  1YCC A;  1S5L V;  1YFC A;  1PP9 D;  1RAQ A;  1C6R A;  3BCC D;  1SQX D;  3MK7 C;  1LS9 A;  2ZZS 1;  4IL6 V;  1COT A;  5IY5 1;  1W2L A;  1F1C A;  3PXT A;  3X39 A;  2ZON G;  1CRH A;  1S6V B;  3VRD A;  3O5C A;  155C A;  1VYD A;  3MK7 B;  2N3B A;  3FWL A;  2DGE A;  4EIF A;  1RZ6 A;  2AXT V;  4AAO A;  3RN1 A;  1KB0 A;  2ZBO A;  2FYU D;  1ETP A;  2C1U A;  1FJ0 A;  1YEB A;  1J3S A;  1KB9 D;  4FA5 A;  2YK3 A;  1BGY D;  3HQ7 A;  3PXW A;  2JQR A;  1I54 A;  4GYD A;  5CYT R;  1C7M A;  1N50 A;  1QYZ A;  2Y0E A;  3VNW A;  2BGV X;  1CSX A;  1I5T A;  4YE1 A;  3L4O A;  4MU8 A;  3L75 D;  3WFD C;  1U75 B;  5GTI V;  3DP5 A;  1H31 A;  5KLV D;  1H33 B;  3O20 A;  1GU2 A;  5DFS A;  3GG2 A;  2OZ1 A;  1DT1 A;  1I55 A;  1KYO D;  3M97 X;  4FA4 A;  1N9C A;  1HZU A;  1FI9 A;  2Y0D A;  1C6O A;  1C2N A;  2YIU B;  1KX2 A;  3ZOW A;  2L4D A;  3H1H D;  3WU2 V;  5CIH B;  3O1Y A;  1DVH A;  1H9Y A;  4XYD B;  4FB1 A;  1CIE A;  1QN2 A;  2QG4 A;  4FA9 A;  4J20 A;  4FA1 A;  1H32 A;  3OCD A;  2C1D A;  2KS1 A;  1NU1 D;  3WFB C;  1SQV D;  1BL9 A;  1M6Z A;  3CYT I;  1GDV A;  1MG2 D;  4A7P A;  1A2S A;  3CXH D;  3CP5 A;  2PAC A;  5B6Q A;  1RAP A;  1R0Q A;  1A56 A;  3ZOX A;  1CYI A;  3H1L D;  2JWA A;  2GC4 D;  3H1K D;  4EIC A;  4LJI A;  1DW2 A;  4WQD A;  2O3J A;  1JDL A;  3NBT A;  3ZOO A;  1CRC A;  3ZIY A;  2C1D B;  1EB7 A;  1NIR A;  5B5E V;  5KKZ B;  1CRJ A;  2YCC A;  3KHU A;  1L9B C;  2HV4 A;  1HZV A;  1LC2 A;  3H1J D;  2FWL A;  4WQE A;  1C75 A;  4AAN A;  5TIS V;  4KMG A;  1B7V A;  1YNR A;  1H1O A;  4NFG B;  2D0S A;  1C6S A;  1PPJ D;  1KX7 A;  5EXQ A;  3NBS A;  1U74 B;  1IRW A;  1CSW A;  1FHB A;  5DJQ B;  4O1W A;  4V2K A;  2YQB A;  1HRC A;  1CHJ A;  2GIW A;  4PD4 D;  3TYI A;  4FAV A;  1AOF A;  1YTC A;  1CTZ A;  1NML A;  3WFC C;  4Q5P A;  2N9J A;  1DW0 A;  3PHL A;  3ZCF A;  4WQC A;  451C A;  2B0Z B;  1FI7 A;  2C2C A;  1H33 A;  1CC5 A;  3L73 D;  4UB6 V;  1CYC A;  1FI3 A;  1CCH A;  1A8C A;  2ZXY A;  2B4Z A;  2RN0 A;  1E2R A;  2QJK B;  3HQ6 A;  2DVH A;  4L3G A;  1LMS A;  1HJ3 A;  2MTA C;  1LC1 A;  1ZZH A;  1GKS A;  2L91 A;  1CHI A;  1DW3 A;  5CIF B;  1GJQ A;  5CIC B;  4EDF A;  3WUI A;  3SJL A;  1CED A;  1CSU A;  1OCD A;  5E79 V;  2AI5 A;  3RLM A;  5KLI B;  4WQ9 A;  3SLE A;  2CXB A;  3L71 D;  1YIQ A;  1C2R A;  1HH7 A;  2BCN B;  3OA8 B;  2V08 A;  3PLN A;  2Q3E A;  3HQ8 A;  2QJY B;  1CCR A;  2C1V A;  1WVE C;  1MZ4 A;  1DII C;  4K3I A;  2MHM A;  4H0J A;  1NTM D;  1CTY A;  4PW9 B;  2B10 B;  2K9J B;  2CA3 B;  2BLF B;  1QL4 A;  2B12 B;  2LIR A;  5GTH V;  2RMZ A;  4L3H A;  2KNC B;  4XXL A;  3CU4 A;  1CYJ A;  3A0H V;  4GED B;  3PTZ A;  3SXT A;  1K3H A;  2B11 B;  2CE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...