2N9JA

Solution structure of oxidized human cytochrome c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c
publication title Investigation of the redox-dependent modulation of structure and dynamics in human cytochrome c.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2n9jA00
1QYZA 3CX5W 3ZCFA 3ZOOA 2L4DA 2YIUB 3ZIYA 1J3SA 2C1UA 1W5CT 4FB1A 2B11B 1C7MA 1I6DA 1GU2A 2N18B 3CP5A 1CCRA 1M6ZA 4AANA 2C1DA 3OA8A 2B0ZB 3WFCC 2ORLA 1GDVA 1C6RA 1CTZA 4H0KA 1DIQC 4EICA 1HCMA 1I8OA 2N9JA 3MK7C 1SQVD 2BH4X 1LC2A 1RZ6A 2V07A 5CICB 5B66V 3NBSA 1FI3A 3H1JD 1CYCA 1CC5A 4KMGA 1JDLA 1W2LA 1NIRA 4GEDB 1RAQA 1VYDA 4Y5RA 4JCGA 1L0LD 2AIUA 1YFCA 1F1FA 4H0JA 1KB9D 1BGYD 1K3HA 1ZZHA 4WQDA 1A56A 3WUIA 4WQ8A 1DVVA 3VYMA 1YNRA 1NNOA 4O1QA 3A0BV 1CIEA 3SVWA 1OCDA 3HQ9A 1FOCA 2QJKB 2OZ1B 5CIDB 1WEJF 3H1ID 1M60A 1LC1A 5GTIV 3DMIA 4WQ7A 4N0KA 5KLIB 1LS9A 1MZ4A 2N3BA 1QN2A 4MU8A 3L71D 1YICA 5KLVD 3SXTA 2BPBB 1CTYA 1CIFA 2C1DB 2N18C 3OA8B 5B5EV 4GYDA 3OCDA 1ZRTD 2A06D 5CIFB 1CNOA 3L74D 1N50A 2N3YA 3WU2V 5CIEB 5GTHV 3O0RC 3CU4A 1SQXD 3HQ7A 3BCCD 1FHBA 1I6EA 3NWVA 1NTZD 1RZ5A 2GIWA 3X39A 1YIQA 3ORVA 5KKZB 1K3GA 1R0QA 1C6SA 1CXCA 3A9FA 5CYTR 2QJYB 1EZVD 3RMZA 1CHJA 1H32A 1CRYA 3PXWA 1YEBA 1CYJA 2BCNB 1NTMD 1KYOW 1H9YA 2CA4B 4FA5A 1CSWA 4DY9A 5H2FV 1GKSA 3SJLA 4D6TD 1GQ1A 1H33A 1HZUA 4AAOA 3CX5D 1QKSA 1COTA 2XTSB 1M70A 5TISV 1CCHA 2BH5X 3CXHW 4PW9B 1YEAA 1IRWA 2ZXYA 3VRDA 3VNWA 3DR0A 2FWLA 451CA 3PXSA 4V2KA 2GC4D 4LJIA 3RN1A 1I5TA 1ETPA 4XYDB 1P84D 2HV4A 1KX7A 1KV9A 1FI7A 2IBZD 1DW3A 4AAMA 3PXTA 3H1HD 3DP5A 1CSVA 4NFGB 4WQEA 2VHDA 2LITA 2V08A 1CRGA 1GIWA 1NMIA 4U3FD 2ZBOA 3RLMA 2AI5A 1CRJA 2ZZS1 351CA 1HJ3A 1E29A 5DF5A 4PJ0V 2B10B 2AXTV 1CRCA 2B12B 2D0WA 2PACA 3HQ8A 1CXAA 4UB8V 1AOQA 1MG3D 3M97X 4XXLA 5DJQB 4L3GA 1E2RA 3ZBMA 4FA4A 1F1CA 5E79V 1CSXA 5C9MA 3KZIV 1BL9A 1YCCA 3H1LD 4YE1A 5C0ZA 1C2NA 1KX2A 1CIGA 2YCCA 1NMLA 1YTCA 3RN0A 3L72D 2BCCD 4EIEA 1DVHA 1KIBA 3WFEC 1IQCA 3CYTI 1H1OA 1FJ0A 4UB6V 2CA3B 2PCCB 1S6VB 2FRCA 1PP9D 4FAVA 4QAOA 5CIGB 1AYGA 2BLFB 4L1QA 3PH2B 4WQCA 1L9BC 1A8CA 1IZL0 2GB8B 1L9JC 4FANA 1B7VA 5EXQA 1NU1D 1AOFA 1U74B 2DGEA 1C75A 2MTAC 5AURA 2EXVA 2D0SA 1H31A 1CEDA 1I54A 155CA 3O20A 5IY51 4AALA 1I55A 2YK3A 3TGUD 1CO6A 4RSZA 1KYOD 1CRHA 3O1YA 1HJ4A 3C2CA 1CHHA 1N9CA 4EIDA 1S5LV 1SQQD 2ZOOA 2I8FA 1BE3D 4O1WA 5DJQC 1CSUA 1CORA 1OAEA 1RAPA 3SWSA 5KAIV 1QL3A 3CXHD 3L4MA 4PWAA 1EB7A 1SQPD 2C2CA 1MG2D 3HQ6A 1CTJA 1U75B 3OCDB 2FYUD 2JTIB 3L4OA 1KB0A 2FYNB 1NTKD 5B6QA 2BGVX 3ZOXA 2PCBB 4FA1A 1PPJD 1HZVA 1DW1A 2CE0A 1DW2A 1CIHA 5CIHB 3WC8A 1A2SA 5CIBB 1FI9A 1HRCA 1H9XA 3JBTB 1DT1A 1GJQA 2LIRA 1HH7A 4L3HA 2C8SA 1C2RA 2DVHA 1CHIA 3MK7B 1H32B 1N90A 3CWBD 3WFBC 5DFSA 4IL6V 3ZOWA 4EIFA 2GC7D 5KAFV 1HJ5A 1QL4A 4PD4D 3NBTA 4Q5PA 1AKKA 2JQRA 1H33B 1DIIC 2ZONG 3WFDC 2YQBA 1H31B 1DW0A 2N9IA 3L73D 4WQ9A 1L0ND 1SQBD 4WQBA 1LMSA 4FA9A 1LFMA 3H1KD 3ZOYA 2CE1A 2C9XB 1I8PA 1WVEC 4AX3A 1FCDC 3A0HV 2CXBA 1C52A 1BCCD 2MHMA 2QJPB 4J20A 1IRVA 3O5CA 2B4ZA 3TYIA 2OZ1A 4WQAA 1CYIA 3SLEA 3L75D 1IO3A 1C6OA 3L70D 1N15A 4K3IA 1CRIA 1E8EA 2C1VA 4P4QB 1HROA
chains in the Genus database with same CATH superfamily
1QYZA 3CX5W 3ZCFA 3ZOOA 2L4DA 2YIUB 3ZIYA 1J3SA 2C1UA 1W5CT 4FB1A 2B11B 1C7MA 1I6DA 1GU2A 2N18B 3CP5A 1CCRA 1M6ZA 4AANA 2C1DA 3OA8A 2B0ZB 3WFCC 2ORLA 1GDVA 1C6RA 1CTZA 4H0KA 1DIQC 4EICA 1HCMA 1I8OA 2N9JA 3MK7C 1SQVD 2BH4X 1LC2A 1RZ6A 2V07A 5CICB 5B66V 3NBSA 1FI3A 3H1JD 1CYCA 1CC5A 4KMGA 1JDLA 1W2LA 1NIRA 4GEDB 1RAQA 1VYDA 4Y5RA 4JCGA 1L0LD 2AIUA 1YFCA 1F1FA 4H0JA 1KB9D 1BGYD 1K3HA 1ZZHA 4WQDA 1A56A 3WUIA 4WQ8A 1DVVA 3VYMA 1YNRA 1NNOA 4O1QA 3A0BV 1CIEA 3SVWA 1OCDA 3D0WA 1FOCA 2QJKB 3HQ9A 2OZ1B 5CIDB 1WEJF 3H1ID 1M60A 1LC1A 5GTIV 3DMIA 4WQ7A 4N0KA 5KLIB 1LS9A 1MZ4A 2N3BA 1QN2A 4MU8A 3L71D 1YICA 5KLVD 3SXTA 2BPBB 1CTYA 1CIFA 2C1DB 2N18C 3OA8B 5B5EV 4GYDA 3OCDA 1ZRTD 2A06D 5CIFB 1CNOA 3L74D 1N50A 2N3YA 3WU2V 5CIEB 5GTHV 3O0RC 3CU4A 1SQXD 3HQ7A 3BCCD 1FHBA 1I6EA 3NWVA 1NTZD 1RZ5A 2GIWA 3X39A 1YIQA 3ORVA 5KKZB 1K3GA 1R0QA 1C6SA 1CXCA 3A9FA 5CYTR 2QJYB 1EZVD 3RMZA 1CHJA 1H32A 1CRYA 3PXWA 1YEBA 1CYJA 2BCNB 1NTMD 1KYOW 1H9YA 2CA4B 4FA5A 1CSWA 4DY9A 5H2FV 1GKSA 3SJLA 4D6TD 1GQ1A 1H33A 1HZUA 4AAOA 3CX5D 1QKSA 1COTA 2XTSB 1M70A 5TISV 1CCHA 2BH5X 3CXHW 4PW9B 1YEAA 1IRWA 2ZXYA 3VRDA 3VNWA 3DR0A 2FWLA 451CA 3PXSA 4V2KA 2GC4D 4LJIA 3RN1A 1I5TA 1ETPA 4XYDB 1P84D 2HV4A 1KX7A 1KV9A 1FI7A 2IBZD 1DW3A 4AAMA 3PXTA 3H1HD 3DP5A 1CSVA 4NFGB 4WQEA 2VHDA 2LITA 2V08A 1CRGA 1GIWA 1NMIA 4U3FD 2ZBOA 3RLMA 2AI5A 1CRJA 2ZZS1 351CA 1HJ3A 1E29A 5DF5A 4PJ0V 2B10B 2AXTV 1CRCA 2B12B 2D0WA 2PACA 3HQ8A 1CXAA 4UB8V 1AOQA 1MG3D 3M97X 4XXLA 5DJQB 4L3GA 1E2RA 3ZBMA 4FA4A 1F1CA 5E79V 1CSXA 5C9MA 3KZIV 1BL9A 1YCCA 3H1LD 4YE1A 5C0ZA 1C2NA 1KX2A 1CIGA 2YCCA 1NMLA 1YTCA 3RN0A 3L72D 2BCCD 4EIEA 1DVHA 1KIBA 3WFEC 1IQCA 3CYTI 1H1OA 1FJ0A 4UB6V 2CA3B 2PCCB 1S6VB 2FRCA 1PP9D 4FAVA 4QAOA 5CIGB 1AYGA 2BLFB 4L1QA 3PH2B 4WQCA 1L9BC 1A8CA 1IZL0 2GB8B 1L9JC 4FANA 1B7VA 5EXQA 1NU1D 1AOFA 1U74B 2DGEA 1C75A 2MTAC 5AURA 2EXVA 2D0SA 1H31A 1CEDA 1I54A 155CA 3O20A 5IY51 4AALA 1I55A 2YK3A 3TGUD 1CO6A 4RSZA 1KYOD 1CRHA 3O1YA 1HJ4A 3C2CA 1CHHA 1N9CA 4EIDA 1S5LV 1SQQD 2ZOOA 2I8FA 1BE3D 4O1WA 5DJQC 1CSUA 1CORA 1OAEA 1RAPA 3SWSA 5KAIV 1QL3A 3CXHD 3L4MA 4PWAA 1EB7A 1SQPD 2C2CA 1MG2D 3HQ6A 1CTJA 1U75B 3OCDB 2FYUD 2JTIB 3L4OA 1KB0A 2FYNB 1NTKD 5B6QA 2BGVX 3ZOXA 2PCBB 4FA1A 1PPJD 1HZVA 1DW1A 2CE0A 1DW2A 1CIHA 5CIHB 3WC8A 1A2SA 5CIBB 1FI9A 1HRCA 1H9XA 3JBTB 1DT1A 1GJQA 2LIRA 1HH7A 4L3HA 2C8SA 1C2RA 2DVHA 1CHIA 3MK7B 1H32B 1N90A 3CWBD 3WFBC 5DFSA 4IL6V 3ZOWA 4EIFA 2GC7D 5KAFV 1HJ5A 1QL4A 4PD4D 3NBTA 4Q5PA 1AKKA 2JQRA 1H33B 1DIIC 2ZONG 3WFDC 2YQBA 1H31B 1DW0A 2N9IA 3L73D 4WQ9A 1L0ND 1SQBD 4WQBA 1LMSA 4FA9A 1LFMA 3H1KD 3ZOYA 2CE1A 2C9XB 1I8PA 1WVEC 4AX3A 1FCDC 3A0HV 2CXBA 1C52A 1BCCD 2MHMA 2QJPB 4J20A 1IRVA 3O5CA 2B4ZA 3TYIA 2OZ1A 4WQAA 1CYIA 3SLEA 3L75D 1IO3A 1C6OA 3L70D 1N15A 4K3IA 1CRIA 1E8EA 2C1VA 4P4QB 1HROA
chains in the Genus database with same CATH topology
1QYZA 3CX5W 3ZCFA 3ZOOA 2L4DA 2YIUB 3ZIYA 1J3SA 2C1UA 1W5CT 4FB1A 2B11B 1C7MA 1I6DA 1GU2A 2N18B 3CP5A 1CCRA 1M6ZA 4AANA 2C1DA 3OA8A 2B0ZB 3WFCC 2ORLA 1GDVA 1C6RA 1CTZA 4H0KA 1DIQC 4EICA 1HCMA 1I8OA 2N9JA 3MK7C 1SQVD 2BH4X 1LC2A 1RZ6A 2V07A 5CICB 5B66V 3NBSA 1FI3A 3H1JD 1CYCA 1CC5A 4KMGA 1JDLA 1W2LA 1NIRA 4GEDB 1RAQA 1VYDA 4Y5RA 4JCGA 1L0LD 2AIUA 1YFCA 1F1FA 4H0JA 1KB9D 1BGYD 1K3HA 1ZZHA 4WQDA 1A56A 3WUIA 4WQ8A 1DVVA 3VYMA 1YNRA 1NNOA 4O1QA 3A0BV 1CIEA 3SVWA 1OCDA 3HQ9A 1FOCA 2QJKB 2OZ1B 5CIDB 1WEJF 3H1ID 1M60A 1LC1A 5GTIV 3DMIA 4WQ7A 4N0KA 5KLIB 1LS9A 1MZ4A 2N3BA 1QN2A 4MU8A 3L71D 1YICA 5KLVD 3SXTA 2BPBB 1CTYA 1CIFA 2C1DB 2N18C 3OA8B 5B5EV 4GYDA 3OCDA 1ZRTD 2A06D 5CIFB 1CNOA 3L74D 1N50A 2N3YA 3WU2V 5CIEB 5GTHV 3O0RC 3CU4A 1SQXD 3HQ7A 3BCCD 1FHBA 1I6EA 3NWVA 1NTZD 1RZ5A 2GIWA 3X39A 1YIQA 3ORVA 5KKZB 1K3GA 1R0QA 1C6SA 1CXCA 3A9FA 5CYTR 2QJYB 1EZVD 3RMZA 1CHJA 1H32A 1CRYA 3PXWA 1YEBA 1CYJA 2BCNB 1NTMD 1KYOW 1H9YA 2CA4B 4FA5A 1CSWA 4DY9A 5H2FV 1GKSA 3SJLA 4D6TD 1GQ1A 1H33A 1HZUA 4AAOA 3CX5D 1QKSA 1COTA 2XTSB 1M70A 5TISV 1CCHA 2BH5X 3CXHW 4PW9B 1YEAA 1IRWA 2ZXYA 3VRDA 3VNWA 3DR0A 2FWLA 451CA 3PXSA 4V2KA 2GC4D 4LJIA 3RN1A 1I5TA 1ETPA 4XYDB 1P84D 2HV4A 1KX7A 1KV9A 1FI7A 2IBZD 1DW3A 4AAMA 3PXTA 3H1HD 3DP5A 1CSVA 4NFGB 4WQEA 2VHDA 2LITA 2V08A 1CRGA 1GIWA 1NMIA 4U3FD 2ZBOA 3RLMA 2AI5A 1CRJA 2ZZS1 351CA 1HJ3A 1E29A 5DF5A 4PJ0V 2B10B 2AXTV 1CRCA 2B12B 2D0WA 2PACA 3HQ8A 1CXAA 4UB8V 1AOQA 1MG3D 3M97X 4XXLA 5DJQB 4L3GA 1E2RA 3ZBMA 4FA4A 1F1CA 5E79V 1CSXA 5C9MA 3KZIV 1BL9A 1YCCA 3H1LD 4YE1A 5C0ZA 1C2NA 1KX2A 1CIGA 2YCCA 1NMLA 1YTCA 3RN0A 3L72D 2BCCD 4EIEA 1DVHA 1KIBA 3WFEC 1IQCA 3CYTI 1H1OA 1FJ0A 4UB6V 2CA3B 2PCCB 1S6VB 2FRCA 1PP9D 4FAVA 4QAOA 5CIGB 1AYGA 2BLFB 4L1QA 3PH2B 4WQCA 1L9BC 1A8CA 1IZL0 2GB8B 1L9JC 4FANA 1B7VA 5EXQA 1NU1D 1AOFA 1U74B 2DGEA 1C75A 2MTAC 5AURA 2EXVA 2D0SA 1H31A 1CEDA 1I54A 155CA 3O20A 5IY51 4AALA 1I55A 2YK3A 3TGUD 1CO6A 4RSZA 1KYOD 1CRHA 3O1YA 1HJ4A 3C2CA 1CHHA 1N9CA 4EIDA 1S5LV 1SQQD 2ZOOA 2I8FA 1BE3D 4O1WA 5DJQC 1CSUA 1CORA 1OAEA 1RAPA 3SWSA 5KAIV 1QL3A 3CXHD 3L4MA 4PWAA 1EB7A 1SQPD 2C2CA 1MG2D 3HQ6A 1CTJA 1U75B 3OCDB 2FYUD 2JTIB 3L4OA 1KB0A 2FYNB 1NTKD 5B6QA 2BGVX 3ZOXA 2PCBB 4FA1A 1PPJD 1HZVA 1DW1A 2CE0A 1DW2A 1CIHA 5CIHB 3WC8A 1A2SA 5CIBB 1FI9A 1HRCA 1H9XA 3JBTB 1DT1A 1GJQA 2LIRA 1HH7A 4L3HA 2C8SA 1C2RA 2DVHA 1CHIA 3MK7B 1H32B 1N90A 3CWBD 3WFBC 5DFSA 4IL6V 3ZOWA 4EIFA 2GC7D 5KAFV 1HJ5A 1QL4A 4PD4D 3NBTA 4Q5PA 1AKKA 2JQRA 1H33B 1DIIC 2ZONG 3WFDC 2YQBA 1H31B 1DW0A 2N9IA 3L73D 4WQ9A 1L0ND 1SQBD 4WQBA 1LMSA 4FA9A 1LFMA 3H1KD 3ZOYA 2CE1A 2C9XB 1I8PA 1WVEC 4AX3A 1FCDC 3A0HV 2CXBA 1C52A 1BCCD 2MHMA 2QJPB 4J20A 1IRVA 3O5CA 2B4ZA 3TYIA 2OZ1A 4WQAA 1CYIA 3SLEA 3L75D 1IO3A 1C6OA 3L70D 1N15A 4K3IA 1CRIA 1E8EA 2C1VA 4P4QB 1HROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYZ A;  3CX5 W;  3ZCF A;  3ZOO A;  2L4D A;  2YIU B;  3ZIY A;  1J3S A;  2C1U A;  1W5C T;  4FB1 A;  2B11 B;  1C7M A;  1I6D A;  1GU2 A;  2N18 B;  3CP5 A;  1CCR A;  1M6Z A;  4AAN A;  2C1D A;  3OA8 A;  2B0Z B;  3WFC C;  2ORL A;  1GDV A;  1C6R A;  1CTZ A;  4H0K A;  1DIQ C;  4EIC A;  1HCM A;  1I8O A;  2N9J A;  3MK7 C;  1SQV D;  2BH4 X;  1LC2 A;  1RZ6 A;  2V07 A;  5CIC B;  5B66 V;  3NBS A;  1FI3 A;  3H1J D;  1CYC A;  1CC5 A;  4KMG A;  1JDL A;  1W2L A;  1NIR A;  4GED B;  1RAQ A;  1VYD A;  4Y5R A;  4JCG A;  1L0L D;  2AIU A;  1YFC A;  1F1F A;  4H0J A;  1KB9 D;  1BGY D;  1K3H A;  1ZZH A;  4WQD A;  1A56 A;  3WUI A;  4WQ8 A;  1DVV A;  3VYM A;  1YNR A;  1NNO A;  4O1Q A;  3A0B V;  1CIE A;  3SVW A;  1OCD A;  3HQ9 A;  1FOC A;  2QJK B;  2OZ1 B;  5CID B;  1WEJ F;  3H1I D;  1M60 A;  1LC1 A;  5GTI V;  3DMI A;  4WQ7 A;  4N0K A;  5KLI B;  1LS9 A;  1MZ4 A;  2N3B A;  1QN2 A;  4MU8 A;  3L71 D;  1YIC A;  5KLV D;  3SXT A;  2BPB B;  1CTY A;  1CIF A;  2C1D B;  2N18 C;  3OA8 B;  5B5E V;  4GYD A;  3OCD A;  1ZRT D;  2A06 D;  5CIF B;  1CNO A;  3L74 D;  1N50 A;  2N3Y A;  3WU2 V;  5CIE B;  5GTH V;  3O0R C;  3CU4 A;  1SQX D;  3HQ7 A;  3BCC D;  1FHB A;  1I6E A;  3NWV A;  1NTZ D;  1RZ5 A;  2GIW A;  3X39 A;  1YIQ A;  3ORV A;  5KKZ B;  1K3G A;  1R0Q A;  1C6S A;  1CXC A;  3A9F A;  5CYT R;  2QJY B;  1EZV D;  3RMZ A;  1CHJ A;  1H32 A;  1CRY A;  3PXW A;  1YEB A;  1CYJ A;  2BCN B;  1NTM D;  1KYO W;  1H9Y A;  2CA4 B;  4FA5 A;  1CSW A;  4DY9 A;  5H2F V;  1GKS A;  3SJL A;  4D6T D;  1GQ1 A;  1H33 A;  1HZU A;  4AAO A;  3CX5 D;  1QKS A;  1COT A;  2XTS B;  1M70 A;  5TIS V;  1CCH A;  2BH5 X;  3CXH W;  4PW9 B;  1YEA A;  1IRW A;  2ZXY A;  3VRD A;  3VNW A;  3DR0 A;  2FWL A;  451C A;  3PXS A;  4V2K A;  2GC4 D;  4LJI A;  3RN1 A;  1I5T A;  1ETP A;  4XYD B;  1P84 D;  2HV4 A;  1KX7 A;  1KV9 A;  1FI7 A;  2IBZ D;  1DW3 A;  4AAM A;  3PXT A;  3H1H D;  3DP5 A;  1CSV A;  4NFG B;  4WQE A;  2VHD A;  2LIT A;  2V08 A;  1CRG A;  1GIW A;  1NMI A;  4U3F D;  2ZBO A;  3RLM A;  2AI5 A;  1CRJ A;  2ZZS 1;  351C A;  1HJ3 A;  1E29 A;  5DF5 A;  4PJ0 V;  2B10 B;  2AXT V;  1CRC A;  2B12 B;  2D0W A;  2PAC A;  3HQ8 A;  1CXA A;  4UB8 V;  1AOQ A;  1MG3 D;  3M97 X;  4XXL A;  5DJQ B;  4L3G A;  1E2R A;  3ZBM A;  4FA4 A;  1F1C A;  5E79 V;  1CSX A;  5C9M A;  3KZI V;  1BL9 A;  1YCC A;  3H1L D;  4YE1 A;  5C0Z A;  1C2N A;  1KX2 A;  1CIG A;  2YCC A;  1NML A;  1YTC A;  3RN0 A;  3L72 D;  2BCC D;  4EIE A;  1DVH A;  1KIB A;  3WFE C;  1IQC A;  3CYT I;  1H1O A;  1FJ0 A;  4UB6 V;  2CA3 B;  2PCC B;  1S6V B;  2FRC A;  1PP9 D;  4FAV A;  4QAO A;  5CIG B;  1AYG A;  2BLF B;  4L1Q A;  3PH2 B;  4WQC A;  1L9B C;  1A8C A;  1IZL 0;  2GB8 B;  1L9J C;  4FAN A;  1B7V A;  5EXQ A;  1NU1 D;  1AOF A;  1U74 B;  2DGE A;  1C75 A;  2MTA C;  5AUR A;  2EXV A;  2D0S A;  1H31 A;  1CED A;  1I54 A;  155C A;  3O20 A;  5IY5 1;  4AAL A;  1I55 A;  2YK3 A;  3TGU D;  1CO6 A;  4RSZ A;  1KYO D;  1CRH A;  3O1Y A;  1HJ4 A;  3C2C A;  1CHH A;  1N9C A;  4EID A;  1S5L V;  1SQQ D;  2ZOO A;  2I8F A;  1BE3 D;  4O1W A;  5DJQ C;  1CSU A;  1COR A;  1OAE A;  1RAP A;  3SWS A;  5KAI V;  1QL3 A;  3CXH D;  3L4M A;  4PWA A;  1EB7 A;  1SQP D;  2C2C A;  1MG2 D;  3HQ6 A;  1CTJ A;  1U75 B;  3OCD B;  2FYU D;  2JTI B;  3L4O A;  1KB0 A;  2FYN B;  1NTK D;  5B6Q A;  2BGV X;  3ZOX A;  2PCB B;  4FA1 A;  1PPJ D;  1HZV A;  1DW1 A;  2CE0 A;  1DW2 A;  1CIH A;  5CIH B;  3WC8 A;  1A2S A;  5CIB B;  1FI9 A;  1HRC A;  1H9X A;  3JBT B;  1DT1 A;  1GJQ A;  2LIR A;  1HH7 A;  4L3H A;  2C8S A;  1C2R A;  2DVH A;  1CHI A;  3MK7 B;  1H32 B;  1N90 A;  3CWB D;  3WFB C;  5DFS A;  4IL6 V;  3ZOW A;  4EIF A;  2GC7 D;  5KAF V;  1HJ5 A;  1QL4 A;  4PD4 D;  3NBT A;  4Q5P A;  1AKK A;  2JQR A;  1H33 B;  1DII C;  2ZON G;  3WFD C;  2YQB A;  1H31 B;  1DW0 A;  2N9I A;  3L73 D;  4WQ9 A;  1L0N D;  1SQB D;  4WQB A;  1LMS A;  4FA9 A;  1LFM A;  3H1K D;  3ZOY A;  2CE1 A;  2C9X B;  1I8P A;  1WVE C;  4AX3 A;  1FCD C;  3A0H V;  2CXB A;  1C52 A;  1BCC D;  2MHM A;  2QJP B;  4J20 A;  1IRV A;  3O5C A;  2B4Z A;  3TYI A;  2OZ1 A;  4WQA A;  1CYI A;  3SLE A;  3L75 D;  1IO3 A;  1C6O A;  3L70 D;  1N15 A;  4K3I A;  1CRI A;  1E8E A;  2C1V A;  4P4Q B;  1HRO A; 
#chains in the Genus database with same CATH topology
 1QYZ A;  3CX5 W;  3ZCF A;  3ZOO A;  2L4D A;  2YIU B;  3ZIY A;  1J3S A;  2C1U A;  1W5C T;  4FB1 A;  2B11 B;  1C7M A;  1I6D A;  1GU2 A;  2N18 B;  3CP5 A;  1CCR A;  1M6Z A;  4AAN A;  2C1D A;  3OA8 A;  2B0Z B;  3WFC C;  2ORL A;  1GDV A;  1C6R A;  1CTZ A;  4H0K A;  1DIQ C;  4EIC A;  1HCM A;  1I8O A;  2N9J A;  3MK7 C;  1SQV D;  2BH4 X;  1LC2 A;  1RZ6 A;  2V07 A;  5CIC B;  5B66 V;  3NBS A;  1FI3 A;  3H1J D;  1CYC A;  1CC5 A;  4KMG A;  1JDL A;  1W2L A;  1NIR A;  4GED B;  1RAQ A;  1VYD A;  4Y5R A;  4JCG A;  1L0L D;  2AIU A;  1YFC A;  1F1F A;  4H0J A;  1KB9 D;  1BGY D;  1K3H A;  1ZZH A;  4WQD A;  1A56 A;  3WUI A;  4WQ8 A;  1DVV A;  3VYM A;  1YNR A;  1NNO A;  4O1Q A;  3A0B V;  1CIE A;  3SVW A;  1OCD A;  3D0W A;  1FOC A;  2QJK B;  3HQ9 A;  2OZ1 B;  5CID B;  1WEJ F;  3H1I D;  1M60 A;  1LC1 A;  5GTI V;  3DMI A;  4WQ7 A;  4N0K A;  5KLI B;  1LS9 A;  1MZ4 A;  2N3B A;  1QN2 A;  4MU8 A;  3L71 D;  1YIC A;  5KLV D;  3SXT A;  2BPB B;  1CTY A;  1CIF A;  2C1D B;  2N18 C;  3OA8 B;  5B5E V;  4GYD A;  3OCD A;  1ZRT D;  2A06 D;  5CIF B;  1CNO A;  3L74 D;  1N50 A;  2N3Y A;  3WU2 V;  5CIE B;  5GTH V;  3O0R C;  3CU4 A;  1SQX D;  3HQ7 A;  3BCC D;  1FHB A;  1I6E A;  3NWV A;  1NTZ D;  1RZ5 A;  2GIW A;  3X39 A;  1YIQ A;  3ORV A;  5KKZ B;  1K3G A;  1R0Q A;  1C6S A;  1CXC A;  3A9F A;  5CYT R;  2QJY B;  1EZV D;  3RMZ A;  1CHJ A;  1H32 A;  1CRY A;  3PXW A;  1YEB A;  1CYJ A;  2BCN B;  1NTM D;  1KYO W;  1H9Y A;  2CA4 B;  4FA5 A;  1CSW A;  4DY9 A;  5H2F V;  1GKS A;  3SJL A;  4D6T D;  1GQ1 A;  1H33 A;  1HZU A;  4AAO A;  3CX5 D;  1QKS A;  1COT A;  2XTS B;  1M70 A;  5TIS V;  1CCH A;  2BH5 X;  3CXH W;  4PW9 B;  1YEA A;  1IRW A;  2ZXY A;  3VRD A;  3VNW A;  3DR0 A;  2FWL A;  451C A;  3PXS A;  4V2K A;  2GC4 D;  4LJI A;  3RN1 A;  1I5T A;  1ETP A;  4XYD B;  1P84 D;  2HV4 A;  1KX7 A;  1KV9 A;  1FI7 A;  2IBZ D;  1DW3 A;  4AAM A;  3PXT A;  3H1H D;  3DP5 A;  1CSV A;  4NFG B;  4WQE A;  2VHD A;  2LIT A;  2V08 A;  1CRG A;  1GIW A;  1NMI A;  4U3F D;  2ZBO A;  3RLM A;  2AI5 A;  1CRJ A;  2ZZS 1;  351C A;  1HJ3 A;  1E29 A;  5DF5 A;  4PJ0 V;  2B10 B;  2AXT V;  1CRC A;  2B12 B;  2D0W A;  2PAC A;  3HQ8 A;  1CXA A;  4UB8 V;  1AOQ A;  1MG3 D;  3M97 X;  4XXL A;  5DJQ B;  4L3G A;  1E2R A;  3ZBM A;  4FA4 A;  1F1C A;  5E79 V;  1CSX A;  5C9M A;  3KZI V;  1BL9 A;  1YCC A;  3H1L D;  4YE1 A;  5C0Z A;  1C2N A;  1KX2 A;  1CIG A;  2YCC A;  1NML A;  1YTC A;  3RN0 A;  3L72 D;  2BCC D;  4EIE A;  1DVH A;  1KIB A;  3WFE C;  1IQC A;  3CYT I;  1H1O A;  1FJ0 A;  4UB6 V;  2CA3 B;  2PCC B;  1S6V B;  2FRC A;  1PP9 D;  4FAV A;  4QAO A;  5CIG B;  1AYG A;  2BLF B;  4L1Q A;  3PH2 B;  4WQC A;  1L9B C;  1A8C A;  1IZL 0;  2GB8 B;  1L9J C;  4FAN A;  1B7V A;  5EXQ A;  1NU1 D;  1AOF A;  1U74 B;  2DGE A;  1C75 A;  2MTA C;  5AUR A;  2EXV A;  2D0S A;  1H31 A;  1CED A;  1I54 A;  155C A;  3O20 A;  5IY5 1;  4AAL A;  1I55 A;  2YK3 A;  3TGU D;  1CO6 A;  4RSZ A;  1KYO D;  1CRH A;  3O1Y A;  1HJ4 A;  3C2C A;  1CHH A;  1N9C A;  4EID A;  1S5L V;  1SQQ D;  2ZOO A;  2I8F A;  1BE3 D;  4O1W A;  5DJQ C;  1CSU A;  1COR A;  1OAE A;  1RAP A;  3SWS A;  5KAI V;  1QL3 A;  3CXH D;  3L4M A;  4PWA A;  1EB7 A;  1SQP D;  2C2C A;  1MG2 D;  3HQ6 A;  1CTJ A;  1U75 B;  3OCD B;  2FYU D;  2JTI B;  3L4O A;  1KB0 A;  2FYN B;  1NTK D;  5B6Q A;  2BGV X;  3ZOX A;  2PCB B;  4FA1 A;  1PPJ D;  1HZV A;  1DW1 A;  2CE0 A;  1DW2 A;  1CIH A;  5CIH B;  3WC8 A;  1A2S A;  5CIB B;  1FI9 A;  1HRC A;  1H9X A;  3JBT B;  1DT1 A;  1GJQ A;  2LIR A;  1HH7 A;  4L3H A;  2C8S A;  1C2R A;  2DVH A;  1CHI A;  3MK7 B;  1H32 B;  1N90 A;  3CWB D;  3WFB C;  5DFS A;  4IL6 V;  3ZOW A;  4EIF A;  2GC7 D;  5KAF V;  1HJ5 A;  1QL4 A;  4PD4 D;  3NBT A;  4Q5P A;  1AKK A;  2JQR A;  1H33 B;  1DII C;  2ZON G;  3WFD C;  2YQB A;  1H31 B;  1DW0 A;  2N9I A;  3L73 D;  4WQ9 A;  1L0N D;  1SQB D;  4WQB A;  1LMS A;  4FA9 A;  1LFM A;  3H1K D;  3ZOY A;  2CE1 A;  2C9X B;  1I8P A;  1WVE C;  4AX3 A;  1FCD C;  3A0H V;  2CXB A;  1C52 A;  1BCC D;  2MHM A;  2QJP B;  4J20 A;  1IRV A;  3O5C A;  2B4Z A;  3TYI A;  2OZ1 A;  4WQA A;  1CYI A;  3SLE A;  3L75 D;  1IO3 A;  1C6O A;  3L70 D;  1N15 A;  4K3I A;  1CRI A;  1E8E A;  2C1V A;  4P4Q B;  1HRO A; 
#chains in the Genus database with same CATH homology
 1QYZ A;  3CX5 W;  3ZCF A;  3ZOO A;  2L4D A;  2YIU B;  3ZIY A;  1J3S A;  2C1U A;  1W5C T;  4FB1 A;  2B11 B;  1C7M A;  1I6D A;  1GU2 A;  2N18 B;  3CP5 A;  1CCR A;  1M6Z A;  4AAN A;  2C1D A;  3OA8 A;  2B0Z B;  3WFC C;  2ORL A;  1GDV A;  1C6R A;  1CTZ A;  4H0K A;  1DIQ C;  4EIC A;  1HCM A;  1I8O A;  2N9J A;  3MK7 C;  1SQV D;  2BH4 X;  1LC2 A;  1RZ6 A;  2V07 A;  5CIC B;  5B66 V;  3NBS A;  1FI3 A;  3H1J D;  1CYC A;  1CC5 A;  4KMG A;  1JDL A;  1W2L A;  1NIR A;  4GED B;  1RAQ A;  1VYD A;  4Y5R A;  4JCG A;  1L0L D;  2AIU A;  1YFC A;  1F1F A;  4H0J A;  1KB9 D;  1BGY D;  1K3H A;  1ZZH A;  4WQD A;  1A56 A;  3WUI A;  4WQ8 A;  1DVV A;  3VYM A;  1YNR A;  1NNO A;  4O1Q A;  3A0B V;  1CIE A;  3SVW A;  1OCD A;  3HQ9 A;  1FOC A;  2QJK B;  2OZ1 B;  5CID B;  1WEJ F;  3H1I D;  1M60 A;  1LC1 A;  5GTI V;  3DMI A;  4WQ7 A;  4N0K A;  5KLI B;  1LS9 A;  1MZ4 A;  2N3B A;  1QN2 A;  4MU8 A;  3L71 D;  1YIC A;  5KLV D;  3SXT A;  2BPB B;  1CTY A;  1CIF A;  2C1D B;  2N18 C;  3OA8 B;  5B5E V;  4GYD A;  3OCD A;  1ZRT D;  2A06 D;  5CIF B;  1CNO A;  3L74 D;  1N50 A;  2N3Y A;  3WU2 V;  5CIE B;  5GTH V;  3O0R C;  3CU4 A;  1SQX D;  3HQ7 A;  3BCC D;  1FHB A;  1I6E A;  3NWV A;  1NTZ D;  1RZ5 A;  2GIW A;  3X39 A;  1YIQ A;  3ORV A;  5KKZ B;  1K3G A;  1R0Q A;  1C6S A;  1CXC A;  3A9F A;  5CYT R;  2QJY B;  1EZV D;  3RMZ A;  1CHJ A;  1H32 A;  1CRY A;  3PXW A;  1YEB A;  1CYJ A;  2BCN B;  1NTM D;  1KYO W;  1H9Y A;  2CA4 B;  4FA5 A;  1CSW A;  4DY9 A;  5H2F V;  1GKS A;  3SJL A;  4D6T D;  1GQ1 A;  1H33 A;  1HZU A;  4AAO A;  3CX5 D;  1QKS A;  1COT A;  2XTS B;  1M70 A;  5TIS V;  1CCH A;  2BH5 X;  3CXH W;  4PW9 B;  1YEA A;  1IRW A;  2ZXY A;  3VRD A;  3VNW A;  3DR0 A;  2FWL A;  451C A;  3PXS A;  4V2K A;  2GC4 D;  4LJI A;  3RN1 A;  1I5T A;  1ETP A;  4XYD B;  1P84 D;  2HV4 A;  1KX7 A;  1KV9 A;  1FI7 A;  2IBZ D;  1DW3 A;  4AAM A;  3PXT A;  3H1H D;  3DP5 A;  1CSV A;  4NFG B;  4WQE A;  2VHD A;  2LIT A;  2V08 A;  1CRG A;  1GIW A;  1NMI A;  4U3F D;  2ZBO A;  3RLM A;  2AI5 A;  1CRJ A;  2ZZS 1;  351C A;  1HJ3 A;  1E29 A;  5DF5 A;  4PJ0 V;  2B10 B;  2AXT V;  1CRC A;  2B12 B;  2D0W A;  2PAC A;  3HQ8 A;  1CXA A;  4UB8 V;  1AOQ A;  1MG3 D;  3M97 X;  4XXL A;  5DJQ B;  4L3G A;  1E2R A;  3ZBM A;  4FA4 A;  1F1C A;  5E79 V;  1CSX A;  5C9M A;  3KZI V;  1BL9 A;  1YCC A;  3H1L D;  4YE1 A;  5C0Z A;  1C2N A;  1KX2 A;  1CIG A;  2YCC A;  1NML A;  1YTC A;  3RN0 A;  3L72 D;  2BCC D;  4EIE A;  1DVH A;  1KIB A;  3WFE C;  1IQC A;  3CYT I;  1H1O A;  1FJ0 A;  4UB6 V;  2CA3 B;  2PCC B;  1S6V B;  2FRC A;  1PP9 D;  4FAV A;  4QAO A;  5CIG B;  1AYG A;  2BLF B;  4L1Q A;  3PH2 B;  4WQC A;  1L9B C;  1A8C A;  1IZL 0;  2GB8 B;  1L9J C;  4FAN A;  1B7V A;  5EXQ A;  1NU1 D;  1AOF A;  1U74 B;  2DGE A;  1C75 A;  2MTA C;  5AUR A;  2EXV A;  2D0S A;  1H31 A;  1CED A;  1I54 A;  155C A;  3O20 A;  5IY5 1;  4AAL A;  1I55 A;  2YK3 A;  3TGU D;  1CO6 A;  4RSZ A;  1KYO D;  1CRH A;  3O1Y A;  1HJ4 A;  3C2C A;  1CHH A;  1N9C A;  4EID A;  1S5L V;  1SQQ D;  2ZOO A;  2I8F A;  1BE3 D;  4O1W A;  5DJQ C;  1CSU A;  1COR A;  1OAE A;  1RAP A;  3SWS A;  5KAI V;  1QL3 A;  3CXH D;  3L4M A;  4PWA A;  1EB7 A;  1SQP D;  2C2C A;  1MG2 D;  3HQ6 A;  1CTJ A;  1U75 B;  3OCD B;  2FYU D;  2JTI B;  3L4O A;  1KB0 A;  2FYN B;  1NTK D;  5B6Q A;  2BGV X;  3ZOX A;  2PCB B;  4FA1 A;  1PPJ D;  1HZV A;  1DW1 A;  2CE0 A;  1DW2 A;  1CIH A;  5CIH B;  3WC8 A;  1A2S A;  5CIB B;  1FI9 A;  1HRC A;  1H9X A;  3JBT B;  1DT1 A;  1GJQ A;  2LIR A;  1HH7 A;  4L3H A;  2C8S A;  1C2R A;  2DVH A;  1CHI A;  3MK7 B;  1H32 B;  1N90 A;  3CWB D;  3WFB C;  5DFS A;  4IL6 V;  3ZOW A;  4EIF A;  2GC7 D;  5KAF V;  1HJ5 A;  1QL4 A;  4PD4 D;  3NBT A;  4Q5P A;  1AKK A;  2JQR A;  1H33 B;  1DII C;  2ZON G;  3WFD C;  2YQB A;  1H31 B;  1DW0 A;  2N9I A;  3L73 D;  4WQ9 A;  1L0N D;  1SQB D;  4WQB A;  1LMS A;  4FA9 A;  1LFM A;  3H1K D;  3ZOY A;  2CE1 A;  2C9X B;  1I8P A;  1WVE C;  4AX3 A;  1FCD C;  3A0H V;  2CXB A;  1C52 A;  1BCC D;  2MHM A;  2QJP B;  4J20 A;  1IRV A;  3O5C A;  2B4Z A;  3TYI A;  2OZ1 A;  4WQA A;  1CYI A;  3SLE A;  3L75 D;  1IO3 A;  1C6O A;  3L70 D;  1N15 A;  4K3I A;  1CRI A;  1E8E A;  2C1V A;  4P4Q B;  1HRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...