5KAFV

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 44
structure length 137
sequence length 137
chains with identical sequence v
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kafV00
1NNOA 5EXQA 2ZZS1 3DR0A 3WU2V 4EIFA 5KLIB 1YNRA 4WQAA 1DW3A 3ORVA 3L73D 2CA4B 1QYZA 1M70A 2D0SA 1LC1A 3HQ8A 4K3IA 3ZCFA 4D6TD 1YIQA 1AKKA 2C1UA 3ZOYA 1HCMA 2N9IA 3CXHD 1NTMD 1YEBA 1I6EA 2XTSB 4Q5PA 1E29A 1CRJA 3SVWA 5CIHB 1YFCA 4J20A 1IQCA 1FJ0A 3NBSA 1CNOA 5DF5A 1SQXD 1FHBA 5H2FV 1I5TA 4AALA 2C9XB 3OA8B 1ZRTD 1QL3A 2CE0A 2LIRA 1CYIA 2MHMA 2HV4A 2IBZD 1COTA 1KX2A 1H32A 2JTIB 4EIEA 4L1QA 1I8PA 5CIBB 4UB6V 1L9JC 1LMSA 3H1KD 155CA 3L75D 2FYUD 4N0KA 5DJQC 5IY51 5KKZB 5C9MA 1H9XA 1KV9A 1W2LA 4WQ9A 2N18C 3H1HD 3PXWA 1H31B 1N50A 4WQCA 5DFSA 1YCCA 4XYDB 5GTHV 2AI5A 2DVHA 1ETPA 1HJ4A 4FA1A 5C0ZA 2B10B 1FI7A 1U74B 3SWSA 4LJIA 1OAEA 1C6OA 4WQBA 5KAIV 2GC7D 1RAPA 2N18B 3ZOOA 1NTKD 1KYOW 5B5EV 4Y5RA 4H0KA 1CC5A 4AAOA 1KX7A 1CRYA 1GKSA 3MK7B 2EXVA 5CYTR 3CX5W 3HQ9A 1JDLA 2BGVX 4O1WA 4EICA 1F1CA 1KB0A 2AXTV 4GEDB 1AOQA 1FOCA 1MG2D 3H1ID 4YE1A 1CIGA 1GDVA 3DP5A 1SQBD 3A0HV 3L72D 3RN1A 1QKSA 1RAQA 3OA8A 1BCCD 5CIFB 5CICB 4L3GA 1KB9D 3PXSA 1M6ZA 3H1LD 2B0ZB 5GTIV 5KAFV 3L4OA 1S5LV 2CE1A 1BGYD 3L71D 4FAVA 1LS9A 4FANA 5CIGB 1NTZD 1AOFA 1DIQC 3BCCD 1DW1A 1F1FA 1YEAA 3WFEC 1NMIA 1IRVA 4PWAA 2YK3A 4AAMA 4P4QB 3WUIA 3O5CA 1GQ1A 2ZBOA 1CSXA 3OCDB 1N9CA 1MG3D 351CA 1CEDA 2B11B 4UB8V 3H1JD 4FA4A 1GIWA 2BCCD 1CYCA 1H1OA 1LC2A 1B7VA 3SLEA 1C6RA 4O1QA 1J3SA 1PP9D 2CXBA 1DW0A 1BL9A 2AIUA 1DVVA 1C6SA 1SQPD 1MZ4A 1A8CA 1CSWA 1HROA 4XXLA 5CIDB 1AYGA 1HRCA 4KMGA 3A9FA 1E8EA 1IO3A 3M97X 4H0JA 4WQEA 1FI9A 1A2SA 3MK7C 4RSZA 2C8SA 1N15A 3TYIA 1DIIC 2CA3B 1BE3D 1HZUA 1KIBA 3JBTB 1FI3A 2YIUB 4WQ8A 1CTYA 2OZ1B 3SJLA 1HJ5A 2DGEA 2ORLA 3RMZA 1H9YA 1QL4A 1QN2A 1L9BC 2BH5X 1A56A 1FCDC 1K3HA 2PACA 2JQRA 2N3BA 1H32B 1CTJA 3VNWA 3CP5A 1CHJA 4FB1A 1NIRA 3CXHW 4WQDA 1P84D 1IZL0 1L0ND 4PJ0V 3DMIA 1C2NA 1CXCA 4MU8A 2GIWA 1DT1A 4QAOA 1K3GA 1CHHA 4NFGB 1SQQD 1CCRA 2VHDA 4AANA 1HZVA 2D0WA 2B12B 3OCDA 2YQBA 3CWBD 1HJ3A 1CRHA 1YICA 4GYDA 2MTAC 1YTCA 3ZBMA 1EB7A 3CU4A 3WFCC 1CRCA 1CIHA 5CIEB 1I8OA 1R0QA 1GU2A 1CIEA 3HQ7A 2C2CA 3KZIV 3HQ6A 1HH7A 1KYOD 1S6VB 1VYDA 1H31A 3WFBC 2PCBB 1LFMA 1H33B 2C1DB 2L4DA 3WC8A 2ZXYA 3CX5D 4L3HA 2V07A 1IRWA 1C2RA 3TGUD 1CIFA 5E79V 5B6QA 2OZ1A 2QJYB 5TISV 1I55A 1W5CT 1EZVD 3CYTI 2FYNB 1U75B 1CORA 1GJQA 1CTZA 2ZOOA 2BH4X 5B66V 1PPJD 2YCCA 1N90A 2FWLA 3O1YA 4FA9A 2C1VA 1CO6A 1CXAA 3VYMA 1L0LD 3SXTA 3A0BV 2QJPB 3ZOXA 2GC4D 4PW9B 5KLVD 2N9JA 2BCNB 3RN0A 2N3YA 3NBTA 4FA5A 4AX3A 1DW2A 1NMLA 1C75A 3O0RC 1OCDA 1CSUA 3X39A 1M60A 1C52A 3O20A 4WQ7A 5DJQB 3ZOWA 1CHIA 1CCHA 451CA 1CRGA 4IL6V 1I54A 4JCGA 3PXTA 3L70D 3PH2B 2BLFB 3L4MA 1C7MA 3C2CA 1CRIA 1E2RA 1DVHA 1RZ6A 1CYJA 4U3FD 2QJKB 5AURA 2A06D 3RLMA 2LITA 1CSVA 4V2KA 1RZ5A 2I8FA 2BPBB 2GB8B 3NWVA 1WEJF 1H33A 1NU1D 1SQVD 2C1DA 2V08A 1ZZHA 1WVEC 3L74D 4EIDA 2B4ZA 3VRDA 2PCCB 4DY9A 3ZIYA 2ZONG 4PD4D 2FRCA 1I6DA 3WFDC
chains in the Genus database with same CATH superfamily
1NNOA 5EXQA 2ZZS1 3DR0A 3WU2V 4EIFA 5KLIB 1YNRA 4WQAA 1DW3A 3ORVA 3L73D 2CA4B 1QYZA 1M70A 2D0SA 1LC1A 3HQ8A 4K3IA 3ZCFA 4D6TD 1YIQA 1AKKA 2C1UA 3ZOYA 1HCMA 2N9IA 3CXHD 1NTMD 1YEBA 1I6EA 2XTSB 4Q5PA 1E29A 1CRJA 3SVWA 5CIHB 1YFCA 4J20A 1IQCA 1FJ0A 3NBSA 1CNOA 5DF5A 1SQXD 1FHBA 5H2FV 1I5TA 4AALA 2C9XB 3OA8B 1ZRTD 1QL3A 2CE0A 2LIRA 1CYIA 2MHMA 2HV4A 2IBZD 1COTA 1KX2A 1H32A 2JTIB 4EIEA 4L1QA 1I8PA 5CIBB 4UB6V 1L9JC 1LMSA 3H1KD 155CA 3L75D 2FYUD 4N0KA 5DJQC 5IY51 5KKZB 5C9MA 1H9XA 1KV9A 1W2LA 4WQ9A 2N18C 3H1HD 3PXWA 1H31B 1N50A 4WQCA 5DFSA 1YCCA 4XYDB 5GTHV 2AI5A 2DVHA 1ETPA 1HJ4A 4FA1A 5C0ZA 2B10B 1FI7A 1U74B 3SWSA 4LJIA 1OAEA 1C6OA 4WQBA 5KAIV 2GC7D 1RAPA 2N18B 3ZOOA 1NTKD 1KYOW 5B5EV 4Y5RA 4H0KA 1CC5A 4AAOA 1KX7A 1CRYA 1GKSA 3MK7B 2EXVA 5CYTR 3CX5W 3HQ9A 1JDLA 2BGVX 4O1WA 4EICA 1F1CA 1KB0A 2AXTV 4GEDB 1AOQA 1FOCA 1MG2D 3H1ID 4YE1A 1CIGA 1GDVA 3DP5A 1SQBD 3A0HV 3L72D 3RN1A 1QKSA 1RAQA 3OA8A 1BCCD 5CIFB 5CICB 4L3GA 1KB9D 3PXSA 1M6ZA 3H1LD 2B0ZB 5GTIV 5KAFV 3L4OA 1S5LV 2CE1A 1BGYD 3L71D 4FAVA 1LS9A 4FANA 5CIGB 1NTZD 1AOFA 1DIQC 3BCCD 1DW1A 1F1FA 1YEAA 3WFEC 1NMIA 1IRVA 4PWAA 2YK3A 4AAMA 4P4QB 3WUIA 3O5CA 1GQ1A 2ZBOA 1CSXA 3OCDB 1N9CA 1MG3D 351CA 1CEDA 2B11B 4UB8V 3H1JD 4FA4A 1GIWA 2BCCD 1CYCA 1H1OA 1LC2A 1B7VA 3SLEA 1C6RA 4O1QA 1J3SA 1PP9D 2CXBA 1DW0A 1BL9A 2AIUA 1DVVA 1C6SA 1SQPD 1MZ4A 1A8CA 1CSWA 1HROA 4XXLA 5CIDB 1AYGA 1HRCA 4KMGA 3A9FA 1E8EA 1IO3A 3M97X 4H0JA 4WQEA 1FI9A 1A2SA 3MK7C 4RSZA 2C8SA 1N15A 3TYIA 1DIIC 2CA3B 3D0WA 1BE3D 1HZUA 1KIBA 3JBTB 1FI3A 2YIUB 4WQ8A 1CTYA 2OZ1B 3SJLA 1HJ5A 2DGEA 2ORLA 3RMZA 1H9YA 1QL4A 1QN2A 1L9BC 2BH5X 1A56A 1FCDC 1K3HA 2PACA 2JQRA 2N3BA 1H32B 1CTJA 3VNWA 3CP5A 1CHJA 4FB1A 1NIRA 3CXHW 4WQDA 1P84D 1IZL0 1L0ND 4PJ0V 3DMIA 1C2NA 1CXCA 4MU8A 2GIWA 1DT1A 4QAOA 1K3GA 1CHHA 4NFGB 1SQQD 1CCRA 2VHDA 4AANA 1HZVA 2D0WA 2B12B 3OCDA 2YQBA 3CWBD 1HJ3A 1CRHA 1YICA 4GYDA 2MTAC 1YTCA 3ZBMA 1EB7A 3CU4A 3WFCC 1CRCA 1CIHA 5CIEB 1I8OA 1R0QA 1GU2A 1CIEA 3HQ7A 2C2CA 3KZIV 3HQ6A 1HH7A 1KYOD 1S6VB 1VYDA 1H31A 3WFBC 2PCBB 1LFMA 1H33B 2C1DB 2L4DA 3WC8A 2ZXYA 3CX5D 4L3HA 2V07A 1IRWA 1C2RA 3TGUD 1CIFA 5E79V 5B6QA 2OZ1A 2QJYB 5TISV 1I55A 1W5CT 1EZVD 3CYTI 2FYNB 1U75B 1CORA 1GJQA 1CTZA 2ZOOA 2BH4X 5B66V 1PPJD 2YCCA 1N90A 2FWLA 3O1YA 4FA9A 2C1VA 1CO6A 1CXAA 3VYMA 1L0LD 3SXTA 3A0BV 2QJPB 3ZOXA 2GC4D 4PW9B 5KLVD 2N9JA 2BCNB 3RN0A 2N3YA 3NBTA 4FA5A 4AX3A 1DW2A 1NMLA 1C75A 3O0RC 1OCDA 1CSUA 3X39A 1M60A 1C52A 3O20A 4WQ7A 5DJQB 3ZOWA 1CHIA 1CCHA 451CA 1CRGA 4IL6V 1I54A 4JCGA 3PXTA 3L70D 3PH2B 2BLFB 3L4MA 1C7MA 3C2CA 1CRIA 1E2RA 1DVHA 1RZ6A 1CYJA 4U3FD 2QJKB 5AURA 2A06D 3RLMA 2LITA 1CSVA 4V2KA 1RZ5A 2I8FA 2BPBB 2GB8B 3NWVA 1WEJF 1H33A 1NU1D 1SQVD 2C1DA 2V08A 1ZZHA 1WVEC 3L74D 4EIDA 2B4ZA 3VRDA 2PCCB 4DY9A 3ZIYA 2ZONG 4PD4D 2FRCA 1I6DA 3WFDC
chains in the Genus database with same CATH topology
1NNOA 5EXQA 2ZZS1 3DR0A 3WU2V 4EIFA 5KLIB 1YNRA 4WQAA 1DW3A 3ORVA 3L73D 2CA4B 1QYZA 1M70A 2D0SA 1LC1A 3HQ8A 4K3IA 3ZCFA 4D6TD 1YIQA 1AKKA 2C1UA 3ZOYA 1HCMA 2N9IA 3CXHD 1NTMD 1YEBA 1I6EA 2XTSB 4Q5PA 1E29A 1CRJA 3SVWA 5CIHB 1YFCA 4J20A 1IQCA 1FJ0A 3NBSA 1CNOA 5DF5A 1SQXD 1FHBA 5H2FV 1I5TA 4AALA 2C9XB 3OA8B 1ZRTD 1QL3A 2CE0A 2LIRA 1CYIA 2MHMA 2HV4A 2IBZD 1COTA 1KX2A 1H32A 2JTIB 4EIEA 4L1QA 1I8PA 5CIBB 4UB6V 1L9JC 1LMSA 3H1KD 155CA 3L75D 2FYUD 4N0KA 5DJQC 5IY51 5KKZB 5C9MA 1H9XA 1KV9A 1W2LA 4WQ9A 2N18C 3H1HD 3PXWA 1H31B 1N50A 4WQCA 5DFSA 1YCCA 4XYDB 5GTHV 2AI5A 2DVHA 1ETPA 1HJ4A 4FA1A 5C0ZA 2B10B 1FI7A 1U74B 3SWSA 4LJIA 1OAEA 1C6OA 4WQBA 5KAIV 2GC7D 1RAPA 2N18B 3ZOOA 1NTKD 1KYOW 5B5EV 4Y5RA 4H0KA 1CC5A 4AAOA 1KX7A 1CRYA 1GKSA 3MK7B 2EXVA 5CYTR 3CX5W 3HQ9A 1JDLA 2BGVX 4O1WA 4EICA 1F1CA 1KB0A 2AXTV 4GEDB 1AOQA 1FOCA 1MG2D 3H1ID 4YE1A 1CIGA 1GDVA 3DP5A 1SQBD 3A0HV 3L72D 3RN1A 1QKSA 1RAQA 3OA8A 1BCCD 5CIFB 5CICB 4L3GA 1KB9D 3PXSA 1M6ZA 3H1LD 2B0ZB 5GTIV 5KAFV 3L4OA 1S5LV 2CE1A 1BGYD 3L71D 4FAVA 1LS9A 4FANA 5CIGB 1NTZD 1AOFA 1DIQC 3BCCD 1DW1A 1F1FA 1YEAA 3WFEC 1NMIA 1IRVA 4PWAA 2YK3A 4AAMA 4P4QB 3WUIA 3O5CA 1GQ1A 2ZBOA 1CSXA 3OCDB 1N9CA 1MG3D 351CA 1CEDA 2B11B 4UB8V 3H1JD 4FA4A 1GIWA 2BCCD 1CYCA 1H1OA 1LC2A 1B7VA 3SLEA 1C6RA 4O1QA 1J3SA 1PP9D 2CXBA 1DW0A 1BL9A 2AIUA 1DVVA 1C6SA 1SQPD 1MZ4A 1A8CA 1CSWA 1HROA 4XXLA 5CIDB 1AYGA 1HRCA 4KMGA 3A9FA 1E8EA 1IO3A 3M97X 4H0JA 4WQEA 1FI9A 1A2SA 3MK7C 4RSZA 2C8SA 1N15A 3TYIA 1DIIC 2CA3B 1BE3D 1HZUA 1KIBA 3JBTB 1FI3A 2YIUB 4WQ8A 1CTYA 2OZ1B 3SJLA 1HJ5A 2DGEA 2ORLA 3RMZA 1H9YA 1QL4A 1QN2A 1L9BC 2BH5X 1A56A 1FCDC 1K3HA 2PACA 2JQRA 2N3BA 1H32B 1CTJA 3VNWA 3CP5A 1CHJA 4FB1A 1NIRA 3CXHW 4WQDA 1P84D 1IZL0 1L0ND 4PJ0V 3DMIA 1C2NA 1CXCA 4MU8A 2GIWA 1DT1A 4QAOA 1K3GA 1CHHA 4NFGB 1SQQD 1CCRA 2VHDA 4AANA 1HZVA 2D0WA 2B12B 3OCDA 2YQBA 3CWBD 1HJ3A 1CRHA 1YICA 4GYDA 2MTAC 1YTCA 3ZBMA 1EB7A 3CU4A 3WFCC 1CRCA 1CIHA 5CIEB 1I8OA 1R0QA 1GU2A 1CIEA 3HQ7A 2C2CA 3KZIV 3HQ6A 1HH7A 1KYOD 1S6VB 1VYDA 1H31A 3WFBC 2PCBB 1LFMA 1H33B 2C1DB 2L4DA 3WC8A 2ZXYA 3CX5D 4L3HA 2V07A 1IRWA 1C2RA 3TGUD 1CIFA 5E79V 5B6QA 2OZ1A 2QJYB 5TISV 1I55A 1W5CT 1EZVD 3CYTI 2FYNB 1U75B 1CORA 1GJQA 1CTZA 2ZOOA 2BH4X 5B66V 1PPJD 2YCCA 1N90A 2FWLA 3O1YA 4FA9A 2C1VA 1CO6A 1CXAA 3VYMA 1L0LD 3SXTA 3A0BV 2QJPB 3ZOXA 2GC4D 4PW9B 5KLVD 2N9JA 2BCNB 3RN0A 2N3YA 3NBTA 4FA5A 4AX3A 1DW2A 1NMLA 1C75A 3O0RC 1OCDA 1CSUA 3X39A 1M60A 1C52A 3O20A 4WQ7A 5DJQB 3ZOWA 1CHIA 1CCHA 451CA 1CRGA 4IL6V 1I54A 4JCGA 3PXTA 3L70D 3PH2B 2BLFB 3L4MA 1C7MA 3C2CA 1CRIA 1E2RA 1DVHA 1RZ6A 1CYJA 4U3FD 2QJKB 5AURA 2A06D 3RLMA 2LITA 1CSVA 4V2KA 1RZ5A 2I8FA 2BPBB 2GB8B 3NWVA 1WEJF 1H33A 1NU1D 1SQVD 2C1DA 2V08A 1ZZHA 1WVEC 3L74D 4EIDA 2B4ZA 3VRDA 2PCCB 4DY9A 3ZIYA 2ZONG 4PD4D 2FRCA 1I6DA 3WFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNO A;  5EXQ A;  2ZZS 1;  3DR0 A;  3WU2 V;  4EIF A;  5KLI B;  1YNR A;  4WQA A;  1DW3 A;  3ORV A;  3L73 D;  2CA4 B;  1QYZ A;  1M70 A;  2D0S A;  1LC1 A;  3HQ8 A;  4K3I A;  3ZCF A;  4D6T D;  1YIQ A;  1AKK A;  2C1U A;  3ZOY A;  1HCM A;  2N9I A;  3CXH D;  1NTM D;  1YEB A;  1I6E A;  2XTS B;  4Q5P A;  1E29 A;  1CRJ A;  3SVW A;  5CIH B;  1YFC A;  4J20 A;  1IQC A;  1FJ0 A;  3NBS A;  1CNO A;  5DF5 A;  1SQX D;  1FHB A;  5H2F V;  1I5T A;  4AAL A;  2C9X B;  3OA8 B;  1ZRT D;  1QL3 A;  2CE0 A;  2LIR A;  1CYI A;  2MHM A;  2HV4 A;  2IBZ D;  1COT A;  1KX2 A;  1H32 A;  2JTI B;  4EIE A;  4L1Q A;  1I8P A;  5CIB B;  4UB6 V;  1L9J C;  1LMS A;  3H1K D;  155C A;  3L75 D;  2FYU D;  4N0K A;  5DJQ C;  5IY5 1;  5KKZ B;  5C9M A;  1H9X A;  1KV9 A;  1W2L A;  4WQ9 A;  2N18 C;  3H1H D;  3PXW A;  1H31 B;  1N50 A;  4WQC A;  5DFS A;  1YCC A;  4XYD B;  5GTH V;  2AI5 A;  2DVH A;  1ETP A;  1HJ4 A;  4FA1 A;  5C0Z A;  2B10 B;  1FI7 A;  1U74 B;  3SWS A;  4LJI A;  1OAE A;  1C6O A;  4WQB A;  5KAI V;  2GC7 D;  1RAP A;  2N18 B;  3ZOO A;  1NTK D;  1KYO W;  5B5E V;  4Y5R A;  4H0K A;  1CC5 A;  4AAO A;  1KX7 A;  1CRY A;  1GKS A;  3MK7 B;  2EXV A;  5CYT R;  3CX5 W;  3HQ9 A;  1JDL A;  2BGV X;  4O1W A;  4EIC A;  1F1C A;  1KB0 A;  2AXT V;  4GED B;  1AOQ A;  1FOC A;  1MG2 D;  3H1I D;  4YE1 A;  1CIG A;  1GDV A;  3DP5 A;  1SQB D;  3A0H V;  3L72 D;  3RN1 A;  1QKS A;  1RAQ A;  3OA8 A;  1BCC D;  5CIF B;  5CIC B;  4L3G A;  1KB9 D;  3PXS A;  1M6Z A;  3H1L D;  2B0Z B;  5GTI V;  5KAF V;  3L4O A;  1S5L V;  2CE1 A;  1BGY D;  3L71 D;  4FAV A;  1LS9 A;  4FAN A;  5CIG B;  1NTZ D;  1AOF A;  1DIQ C;  3BCC D;  1DW1 A;  1F1F A;  1YEA A;  3WFE C;  1NMI A;  1IRV A;  4PWA A;  2YK3 A;  4AAM A;  4P4Q B;  3WUI A;  3O5C A;  1GQ1 A;  2ZBO A;  1CSX A;  3OCD B;  1N9C A;  1MG3 D;  351C A;  1CED A;  2B11 B;  4UB8 V;  3H1J D;  4FA4 A;  1GIW A;  2BCC D;  1CYC A;  1H1O A;  1LC2 A;  1B7V A;  3SLE A;  1C6R A;  4O1Q A;  1J3S A;  1PP9 D;  2CXB A;  1DW0 A;  1BL9 A;  2AIU A;  1DVV A;  1C6S A;  1SQP D;  1MZ4 A;  1A8C A;  1CSW A;  1HRO A;  4XXL A;  5CID B;  1AYG A;  1HRC A;  4KMG A;  3A9F A;  1E8E A;  1IO3 A;  3M97 X;  4H0J A;  4WQE A;  1FI9 A;  1A2S A;  3MK7 C;  4RSZ A;  2C8S A;  1N15 A;  3TYI A;  1DII C;  2CA3 B;  1BE3 D;  1HZU A;  1KIB A;  3JBT B;  1FI3 A;  2YIU B;  4WQ8 A;  1CTY A;  2OZ1 B;  3SJL A;  1HJ5 A;  2DGE A;  2ORL A;  3RMZ A;  1H9Y A;  1QL4 A;  1QN2 A;  1L9B C;  2BH5 X;  1A56 A;  1FCD C;  1K3H A;  2PAC A;  2JQR A;  2N3B A;  1H32 B;  1CTJ A;  3VNW A;  3CP5 A;  1CHJ A;  4FB1 A;  1NIR A;  3CXH W;  4WQD A;  1P84 D;  1IZL 0;  1L0N D;  4PJ0 V;  3DMI A;  1C2N A;  1CXC A;  4MU8 A;  2GIW A;  1DT1 A;  4QAO A;  1K3G A;  1CHH A;  4NFG B;  1SQQ D;  1CCR A;  2VHD A;  4AAN A;  1HZV A;  2D0W A;  2B12 B;  3OCD A;  2YQB A;  3CWB D;  1HJ3 A;  1CRH A;  1YIC A;  4GYD A;  2MTA C;  1YTC A;  3ZBM A;  1EB7 A;  3CU4 A;  3WFC C;  1CRC A;  1CIH A;  5CIE B;  1I8O A;  1R0Q A;  1GU2 A;  1CIE A;  3HQ7 A;  2C2C A;  3KZI V;  3HQ6 A;  1HH7 A;  1KYO D;  1S6V B;  1VYD A;  1H31 A;  3WFB C;  2PCB B;  1LFM A;  1H33 B;  2C1D B;  2L4D A;  3WC8 A;  2ZXY A;  3CX5 D;  4L3H A;  2V07 A;  1IRW A;  1C2R A;  3TGU D;  1CIF A;  5E79 V;  5B6Q A;  2OZ1 A;  2QJY B;  5TIS V;  1I55 A;  1W5C T;  1EZV D;  3CYT I;  2FYN B;  1U75 B;  1COR A;  1GJQ A;  1CTZ A;  2ZOO A;  2BH4 X;  5B66 V;  1PPJ D;  2YCC A;  1N90 A;  2FWL A;  3O1Y A;  4FA9 A;  2C1V A;  1CO6 A;  1CXA A;  3VYM A;  1L0L D;  3SXT A;  3A0B V;  2QJP B;  3ZOX A;  2GC4 D;  4PW9 B;  5KLV D;  2N9J A;  2BCN B;  3RN0 A;  2N3Y A;  3NBT A;  4FA5 A;  4AX3 A;  1DW2 A;  1NML A;  1C75 A;  3O0R C;  1OCD A;  1CSU A;  3X39 A;  1M60 A;  1C52 A;  3O20 A;  4WQ7 A;  5DJQ B;  3ZOW A;  1CHI A;  1CCH A;  451C A;  1CRG A;  4IL6 V;  1I54 A;  4JCG A;  3PXT A;  3L70 D;  3PH2 B;  2BLF B;  3L4M A;  1C7M A;  3C2C A;  1CRI A;  1E2R A;  1DVH A;  1RZ6 A;  1CYJ A;  4U3F D;  2QJK B;  5AUR A;  2A06 D;  3RLM A;  2LIT A;  1CSV A;  4V2K A;  1RZ5 A;  2I8F A;  2BPB B;  2GB8 B;  3NWV A;  1WEJ F;  1H33 A;  1NU1 D;  1SQV D;  2C1D A;  2V08 A;  1ZZH A;  1WVE C;  3L74 D;  4EID A;  2B4Z A;  3VRD A;  2PCC B;  4DY9 A;  3ZIY A;  2ZON G;  4PD4 D;  2FRC A;  1I6D A;  3WFD C; 
#chains in the Genus database with same CATH topology
 1NNO A;  5EXQ A;  2ZZS 1;  3DR0 A;  3WU2 V;  4EIF A;  5KLI B;  1YNR A;  4WQA A;  1DW3 A;  3ORV A;  3L73 D;  2CA4 B;  1QYZ A;  1M70 A;  2D0S A;  1LC1 A;  3HQ8 A;  4K3I A;  3ZCF A;  4D6T D;  1YIQ A;  1AKK A;  2C1U A;  3ZOY A;  1HCM A;  2N9I A;  3CXH D;  1NTM D;  1YEB A;  1I6E A;  2XTS B;  4Q5P A;  1E29 A;  1CRJ A;  3SVW A;  5CIH B;  1YFC A;  4J20 A;  1IQC A;  1FJ0 A;  3NBS A;  1CNO A;  5DF5 A;  1SQX D;  1FHB A;  5H2F V;  1I5T A;  4AAL A;  2C9X B;  3OA8 B;  1ZRT D;  1QL3 A;  2CE0 A;  2LIR A;  1CYI A;  2MHM A;  2HV4 A;  2IBZ D;  1COT A;  1KX2 A;  1H32 A;  2JTI B;  4EIE A;  4L1Q A;  1I8P A;  5CIB B;  4UB6 V;  1L9J C;  1LMS A;  3H1K D;  155C A;  3L75 D;  2FYU D;  4N0K A;  5DJQ C;  5IY5 1;  5KKZ B;  5C9M A;  1H9X A;  1KV9 A;  1W2L A;  4WQ9 A;  2N18 C;  3H1H D;  3PXW A;  1H31 B;  1N50 A;  4WQC A;  5DFS A;  1YCC A;  4XYD B;  5GTH V;  2AI5 A;  2DVH A;  1ETP A;  1HJ4 A;  4FA1 A;  5C0Z A;  2B10 B;  1FI7 A;  1U74 B;  3SWS A;  4LJI A;  1OAE A;  1C6O A;  4WQB A;  5KAI V;  2GC7 D;  1RAP A;  2N18 B;  3ZOO A;  1NTK D;  1KYO W;  5B5E V;  4Y5R A;  4H0K A;  1CC5 A;  4AAO A;  1KX7 A;  1CRY A;  1GKS A;  3MK7 B;  2EXV A;  5CYT R;  3CX5 W;  3HQ9 A;  1JDL A;  2BGV X;  4O1W A;  4EIC A;  1F1C A;  1KB0 A;  2AXT V;  4GED B;  1AOQ A;  1FOC A;  1MG2 D;  3H1I D;  4YE1 A;  1CIG A;  1GDV A;  3DP5 A;  1SQB D;  3A0H V;  3L72 D;  3RN1 A;  1QKS A;  1RAQ A;  3OA8 A;  1BCC D;  5CIF B;  5CIC B;  4L3G A;  1KB9 D;  3PXS A;  1M6Z A;  3H1L D;  2B0Z B;  5GTI V;  5KAF V;  3L4O A;  1S5L V;  2CE1 A;  1BGY D;  3L71 D;  4FAV A;  1LS9 A;  4FAN A;  5CIG B;  1NTZ D;  1AOF A;  1DIQ C;  3BCC D;  1DW1 A;  1F1F A;  1YEA A;  3WFE C;  1NMI A;  1IRV A;  4PWA A;  2YK3 A;  4AAM A;  4P4Q B;  3WUI A;  3O5C A;  1GQ1 A;  2ZBO A;  1CSX A;  3OCD B;  1N9C A;  1MG3 D;  351C A;  1CED A;  2B11 B;  4UB8 V;  3H1J D;  4FA4 A;  1GIW A;  2BCC D;  1CYC A;  1H1O A;  1LC2 A;  1B7V A;  3SLE A;  1C6R A;  4O1Q A;  1J3S A;  1PP9 D;  2CXB A;  1DW0 A;  1BL9 A;  2AIU A;  1DVV A;  1C6S A;  1SQP D;  1MZ4 A;  1A8C A;  1CSW A;  1HRO A;  4XXL A;  5CID B;  1AYG A;  1HRC A;  4KMG A;  3A9F A;  1E8E A;  1IO3 A;  3M97 X;  4H0J A;  4WQE A;  1FI9 A;  1A2S A;  3MK7 C;  4RSZ A;  2C8S A;  1N15 A;  3TYI A;  1DII C;  2CA3 B;  3D0W A;  1BE3 D;  1HZU A;  1KIB A;  3JBT B;  1FI3 A;  2YIU B;  4WQ8 A;  1CTY A;  2OZ1 B;  3SJL A;  1HJ5 A;  2DGE A;  2ORL A;  3RMZ A;  1H9Y A;  1QL4 A;  1QN2 A;  1L9B C;  2BH5 X;  1A56 A;  1FCD C;  1K3H A;  2PAC A;  2JQR A;  2N3B A;  1H32 B;  1CTJ A;  3VNW A;  3CP5 A;  1CHJ A;  4FB1 A;  1NIR A;  3CXH W;  4WQD A;  1P84 D;  1IZL 0;  1L0N D;  4PJ0 V;  3DMI A;  1C2N A;  1CXC A;  4MU8 A;  2GIW A;  1DT1 A;  4QAO A;  1K3G A;  1CHH A;  4NFG B;  1SQQ D;  1CCR A;  2VHD A;  4AAN A;  1HZV A;  2D0W A;  2B12 B;  3OCD A;  2YQB A;  3CWB D;  1HJ3 A;  1CRH A;  1YIC A;  4GYD A;  2MTA C;  1YTC A;  3ZBM A;  1EB7 A;  3CU4 A;  3WFC C;  1CRC A;  1CIH A;  5CIE B;  1I8O A;  1R0Q A;  1GU2 A;  1CIE A;  3HQ7 A;  2C2C A;  3KZI V;  3HQ6 A;  1HH7 A;  1KYO D;  1S6V B;  1VYD A;  1H31 A;  3WFB C;  2PCB B;  1LFM A;  1H33 B;  2C1D B;  2L4D A;  3WC8 A;  2ZXY A;  3CX5 D;  4L3H A;  2V07 A;  1IRW A;  1C2R A;  3TGU D;  1CIF A;  5E79 V;  5B6Q A;  2OZ1 A;  2QJY B;  5TIS V;  1I55 A;  1W5C T;  1EZV D;  3CYT I;  2FYN B;  1U75 B;  1COR A;  1GJQ A;  1CTZ A;  2ZOO A;  2BH4 X;  5B66 V;  1PPJ D;  2YCC A;  1N90 A;  2FWL A;  3O1Y A;  4FA9 A;  2C1V A;  1CO6 A;  1CXA A;  3VYM A;  1L0L D;  3SXT A;  3A0B V;  2QJP B;  3ZOX A;  2GC4 D;  4PW9 B;  5KLV D;  2N9J A;  2BCN B;  3RN0 A;  2N3Y A;  3NBT A;  4FA5 A;  4AX3 A;  1DW2 A;  1NML A;  1C75 A;  3O0R C;  1OCD A;  1CSU A;  3X39 A;  1M60 A;  1C52 A;  3O20 A;  4WQ7 A;  5DJQ B;  3ZOW A;  1CHI A;  1CCH A;  451C A;  1CRG A;  4IL6 V;  1I54 A;  4JCG A;  3PXT A;  3L70 D;  3PH2 B;  2BLF B;  3L4M A;  1C7M A;  3C2C A;  1CRI A;  1E2R A;  1DVH A;  1RZ6 A;  1CYJ A;  4U3F D;  2QJK B;  5AUR A;  2A06 D;  3RLM A;  2LIT A;  1CSV A;  4V2K A;  1RZ5 A;  2I8F A;  2BPB B;  2GB8 B;  3NWV A;  1WEJ F;  1H33 A;  1NU1 D;  1SQV D;  2C1D A;  2V08 A;  1ZZH A;  1WVE C;  3L74 D;  4EID A;  2B4Z A;  3VRD A;  2PCC B;  4DY9 A;  3ZIY A;  2ZON G;  4PD4 D;  2FRC A;  1I6D A;  3WFD C; 
#chains in the Genus database with same CATH homology
 1NNO A;  5EXQ A;  2ZZS 1;  3DR0 A;  3WU2 V;  4EIF A;  5KLI B;  1YNR A;  4WQA A;  1DW3 A;  3ORV A;  3L73 D;  2CA4 B;  1QYZ A;  1M70 A;  2D0S A;  1LC1 A;  3HQ8 A;  4K3I A;  3ZCF A;  4D6T D;  1YIQ A;  1AKK A;  2C1U A;  3ZOY A;  1HCM A;  2N9I A;  3CXH D;  1NTM D;  1YEB A;  1I6E A;  2XTS B;  4Q5P A;  1E29 A;  1CRJ A;  3SVW A;  5CIH B;  1YFC A;  4J20 A;  1IQC A;  1FJ0 A;  3NBS A;  1CNO A;  5DF5 A;  1SQX D;  1FHB A;  5H2F V;  1I5T A;  4AAL A;  2C9X B;  3OA8 B;  1ZRT D;  1QL3 A;  2CE0 A;  2LIR A;  1CYI A;  2MHM A;  2HV4 A;  2IBZ D;  1COT A;  1KX2 A;  1H32 A;  2JTI B;  4EIE A;  4L1Q A;  1I8P A;  5CIB B;  4UB6 V;  1L9J C;  1LMS A;  3H1K D;  155C A;  3L75 D;  2FYU D;  4N0K A;  5DJQ C;  5IY5 1;  5KKZ B;  5C9M A;  1H9X A;  1KV9 A;  1W2L A;  4WQ9 A;  2N18 C;  3H1H D;  3PXW A;  1H31 B;  1N50 A;  4WQC A;  5DFS A;  1YCC A;  4XYD B;  5GTH V;  2AI5 A;  2DVH A;  1ETP A;  1HJ4 A;  4FA1 A;  5C0Z A;  2B10 B;  1FI7 A;  1U74 B;  3SWS A;  4LJI A;  1OAE A;  1C6O A;  4WQB A;  5KAI V;  2GC7 D;  1RAP A;  2N18 B;  3ZOO A;  1NTK D;  1KYO W;  5B5E V;  4Y5R A;  4H0K A;  1CC5 A;  4AAO A;  1KX7 A;  1CRY A;  1GKS A;  3MK7 B;  2EXV A;  5CYT R;  3CX5 W;  3HQ9 A;  1JDL A;  2BGV X;  4O1W A;  4EIC A;  1F1C A;  1KB0 A;  2AXT V;  4GED B;  1AOQ A;  1FOC A;  1MG2 D;  3H1I D;  4YE1 A;  1CIG A;  1GDV A;  3DP5 A;  1SQB D;  3A0H V;  3L72 D;  3RN1 A;  1QKS A;  1RAQ A;  3OA8 A;  1BCC D;  5CIF B;  5CIC B;  4L3G A;  1KB9 D;  3PXS A;  1M6Z A;  3H1L D;  2B0Z B;  5GTI V;  5KAF V;  3L4O A;  1S5L V;  2CE1 A;  1BGY D;  3L71 D;  4FAV A;  1LS9 A;  4FAN A;  5CIG B;  1NTZ D;  1AOF A;  1DIQ C;  3BCC D;  1DW1 A;  1F1F A;  1YEA A;  3WFE C;  1NMI A;  1IRV A;  4PWA A;  2YK3 A;  4AAM A;  4P4Q B;  3WUI A;  3O5C A;  1GQ1 A;  2ZBO A;  1CSX A;  3OCD B;  1N9C A;  1MG3 D;  351C A;  1CED A;  2B11 B;  4UB8 V;  3H1J D;  4FA4 A;  1GIW A;  2BCC D;  1CYC A;  1H1O A;  1LC2 A;  1B7V A;  3SLE A;  1C6R A;  4O1Q A;  1J3S A;  1PP9 D;  2CXB A;  1DW0 A;  1BL9 A;  2AIU A;  1DVV A;  1C6S A;  1SQP D;  1MZ4 A;  1A8C A;  1CSW A;  1HRO A;  4XXL A;  5CID B;  1AYG A;  1HRC A;  4KMG A;  3A9F A;  1E8E A;  1IO3 A;  3M97 X;  4H0J A;  4WQE A;  1FI9 A;  1A2S A;  3MK7 C;  4RSZ A;  2C8S A;  1N15 A;  3TYI A;  1DII C;  2CA3 B;  1BE3 D;  1HZU A;  1KIB A;  3JBT B;  1FI3 A;  2YIU B;  4WQ8 A;  1CTY A;  2OZ1 B;  3SJL A;  1HJ5 A;  2DGE A;  2ORL A;  3RMZ A;  1H9Y A;  1QL4 A;  1QN2 A;  1L9B C;  2BH5 X;  1A56 A;  1FCD C;  1K3H A;  2PAC A;  2JQR A;  2N3B A;  1H32 B;  1CTJ A;  3VNW A;  3CP5 A;  1CHJ A;  4FB1 A;  1NIR A;  3CXH W;  4WQD A;  1P84 D;  1IZL 0;  1L0N D;  4PJ0 V;  3DMI A;  1C2N A;  1CXC A;  4MU8 A;  2GIW A;  1DT1 A;  4QAO A;  1K3G A;  1CHH A;  4NFG B;  1SQQ D;  1CCR A;  2VHD A;  4AAN A;  1HZV A;  2D0W A;  2B12 B;  3OCD A;  2YQB A;  3CWB D;  1HJ3 A;  1CRH A;  1YIC A;  4GYD A;  2MTA C;  1YTC A;  3ZBM A;  1EB7 A;  3CU4 A;  3WFC C;  1CRC A;  1CIH A;  5CIE B;  1I8O A;  1R0Q A;  1GU2 A;  1CIE A;  3HQ7 A;  2C2C A;  3KZI V;  3HQ6 A;  1HH7 A;  1KYO D;  1S6V B;  1VYD A;  1H31 A;  3WFB C;  2PCB B;  1LFM A;  1H33 B;  2C1D B;  2L4D A;  3WC8 A;  2ZXY A;  3CX5 D;  4L3H A;  2V07 A;  1IRW A;  1C2R A;  3TGU D;  1CIF A;  5E79 V;  5B6Q A;  2OZ1 A;  2QJY B;  5TIS V;  1I55 A;  1W5C T;  1EZV D;  3CYT I;  2FYN B;  1U75 B;  1COR A;  1GJQ A;  1CTZ A;  2ZOO A;  2BH4 X;  5B66 V;  1PPJ D;  2YCC A;  1N90 A;  2FWL A;  3O1Y A;  4FA9 A;  2C1V A;  1CO6 A;  1CXA A;  3VYM A;  1L0L D;  3SXT A;  3A0B V;  2QJP B;  3ZOX A;  2GC4 D;  4PW9 B;  5KLV D;  2N9J A;  2BCN B;  3RN0 A;  2N3Y A;  3NBT A;  4FA5 A;  4AX3 A;  1DW2 A;  1NML A;  1C75 A;  3O0R C;  1OCD A;  1CSU A;  3X39 A;  1M60 A;  1C52 A;  3O20 A;  4WQ7 A;  5DJQ B;  3ZOW A;  1CHI A;  1CCH A;  451C A;  1CRG A;  4IL6 V;  1I54 A;  4JCG A;  3PXT A;  3L70 D;  3PH2 B;  2BLF B;  3L4M A;  1C7M A;  3C2C A;  1CRI A;  1E2R A;  1DVH A;  1RZ6 A;  1CYJ A;  4U3F D;  2QJK B;  5AUR A;  2A06 D;  3RLM A;  2LIT A;  1CSV A;  4V2K A;  1RZ5 A;  2I8F A;  2BPB B;  2GB8 B;  3NWV A;  1WEJ F;  1H33 A;  1NU1 D;  1SQV D;  2C1D A;  2V08 A;  1ZZH A;  1WVE C;  3L74 D;  4EID A;  2B4Z A;  3VRD A;  2PCC B;  4DY9 A;  3ZIY A;  2ZON G;  4PD4 D;  2FRC A;  1I6D A;  3WFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...