4PD4D

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
248
structure length
248
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 62
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4pd4D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4pd4D02
1CSUA 1GKSA 1NIRA 3WFEC 1ZRTD 5CIFB 3MK7B 4FA5A 1A2SA 3RN1A 1KV9A 2OZ1B 4WQCA 2LIRA 4H0KA 4K3IA 1L0ND 4Q5PA 1FHBA 3H1ID 1I6EA 3DMIA 1RZ6A 3ZOYA 1I55A 2JTIB 1QL4A 2CE1A 1K3GA 1RZ5A 1L0LD 1DW2A 3CU4A 4JCGA 5CIGB 4N0KA 3RN0A 4WQ9A 2EXVA 1LC2A 1VYDA 1CRJA 1E2RA 1SQXD 4MU8A 1LC1A 3L70D 3TDKA 1YEBA 3WU2V 5CIDB 3TGUD 1CSXA 1CCRA 1F1FA 4L3HA 3L4OA 1HCMA 1M60A 3O5CA 3PTZA 1DIQC 1GU2A 4GEDB 3O20A 1HJ3A 4FA9A 3VMAA 5H2FV 1N50A 2C1VA 2JWAA 3SVWA 1CTJA 3H1HD 2FWLA 3CX5D 3NWVA 1EZVD 3OA8A 5KAIV 1MZ4A 1CEDA 1EB7A 3KHUA 3M97X 4O1WA 5KKZB 3H1JD 2FYUD 3WFCC 1E8EA 1SQPD 2N18C 1KX2A 5CYTR 5KLVD 1OCDA 1BL9A 2ZXYA 5DJQC 3ZOWA 4UB6V 4AANA 1S5LV 1CRIA 3SJLA 3HQ7A 5CICB 1QN2A 1AKKA 1L9JC 1QKSA 2C1DA 4EDFA 1R0QA 1IRVA 2BGVX 1YIQA 4NFGB 1IQCA 5KAFV 2YIUB 2ZZS1 3MK7C 1HZVA 2OZ1A 1SQVD 3H1KD 4V2KA 5TJHA 1SQQD 2AI5A 4EIFA 2C1DB 3HQ6A 4J20A 2CA3B 3RMZA 2Y0EA 1N15A 4FA1A 3ZOOA 1E29A 1CORA 1MG3D 2N3YA 2KS1A 1CNOA 155CA 1DVVA 1IRWA 1LMSA 1AOFA 3ZOXA 2QG4A 1C2NA 4WQ7A 5KLIB 3DP5A 1A56A 3PH2B 1MG2D 2O3JA 2C2CA 2B10B 1JDLA 3A9FA 4WQ8A 3O0RC 2CE0A 1CRYA 1C52A 1CIHA 1DW0A 3DR0A 2K9JB 4RJTA 2D0SA 4DY9A 3FWLA 3WUIA 3PRJA 4IL6V 1NTKD 1I54A 1KYOW 4FA4A 1RAPA 2ORLA 3ZBMA 1HJ4A 1HROA 1NU1D 1CSVA 1U75B 3VYMA 1CXAA 1CXCA 1I8OA 1CCHA 1AYGA 2BH5X 1CC5A 451CA 2DGEA 4PW9B 1WEJF 4Y5RA 1YICA 4AX3A 1ZZHA 1CRGA 3WFBC 2BCNB 1HH7A 4FAVA 4A7PA 4L3GA 2BCCD 1IZL0 2BLFB 3SLEA 5IY51 1HRCA 1KB0A 5DF5A 1C6OA 1FI3A 2Y0DA 4P4QB 3O1YA 1NNOA 2GC4D 1KB9D 3NBTA 5CIBB 1I8PA 1KX7A 2C8SA 3JBTB 1C2RA 1YCCA 2C9XB 1YFCA 4WQBA 2QJKB 3L72D 4UB8V 1C6RA 1QL3A 4AAMA 5GTHV 1H31A 4WQAA 2BH4X 2B0ZB 1OAEA 1H32B 1NMIA 2Y0CA 3OCDA 1H9XA 4LJIA 1GQ1A 4L1QA 1DW3A 3CWBD 4PJ0V 2FYNB 2GIWA 1LFMA 3BCCD 2YCCA 3GG2A 1CHHA 1CIFA 2D0WA 1NTZD 3A0HV 4EIDA 1K3HA 1C6SA 4GYDA 4QAOA 3CYTI 1H9YA 1H33B 4EIEA 1KIBA 1HZUA 1BE3D 3L4MA 1H31B 1BGYD 3PXWA 1YTCA 1CTYA 2AIUA 3CX5W 3SXTA 2LITA 1FI9A 4RSZA 2BPBB 1CRCA 2QJPB 2XTSB 3OCDB 1CO6A 1CYIA 1L9BC 2AXTV 1DT1A 4AALA 1PP9D 4PD4D 3CP5A 1FJ0A 3VNWA 2PACA 2KNCB 3PLNA 1CSWA 1H1OA 5E79V 1IO3A 1I5TA 1FOCA 3CXHD 3HQ8A 3ZIYA 5GTIV 2I8FA 4WQEA 3L71D 3ZCFA 5DFSA 1NMLA 351CA 1COTA 3RLMA 1M6ZA 1DIIC 5TISV 2B11B 3HQ9A 3ORVA 2L4DA 2MTAC 2B12B 5B66V 2B4ZA 1QYZA 2JQRA 3GW6A 1J3SA 1U74B 1CHIA 2GC7D 3KZIV 2IBZD 5CIHB 3H1LD 4D6TD 3PXTA 1LS9A 3L73D 4FANA 1YEAA 4O1QA 2ZBOA 3NBSA 5CIEB 2QJYB 2N3BA 3X39A 1BCCD 1CYCA 1ETPA 2C1UA 2MHMA 1F1CA 1I6DA 2L91A 1CYJA 5B5EV 2PCCB 3PXSA 1H32A 1DW1A 1CIGA 2FRCA 3CXHW 1B7VA 1SQBD 4PWAA 1M70A 2N9YB 1N90A 1GIWA 2N9IA 1YNRA 3TF5A 5C0ZA 4EICA 1WVEC 1GJQA 1CHJA 2GB8B 1H33A 2A06D 3C2CA 3L74D 2YQBA 4XYDB 3SWSA 1PPJD 1CRHA 3VRDA 2CA4B 1CIEA 3TYIA 1C75A 2HV4A 3OA8B 5C9MA 1W2LA 1C7MA 5EXQA 1FCDC 2YK3A 2V07A 2N9JA 3WFDC 1P84D 4AAOA 2ZONG 2RMZA 1DVHA 2CXBA 2N18B 3ITKA 1AOQA 1HJ5A 2VHDA 5B6QA 1NTMD 3PHLA 1A8CA 1N9CA 1W5CT 1FI7A 1KYOD 4YE1A 5DJQB 2PCBB 2ZOOA 1S6VB 1GDVA 3WC8A 1RAQA 5AURA 2Q3EA 4U3FD 2V08A 4XXLA 2DVHA 2RN0A 3A0BV 1CTZA 4KMGA 4H0JA 4WQDA 3L75D 4FB1A
chains in the Genus database with same CATH superfamily
1GKSA 3VN0A 3AEGC 2UWJE 4UB6H 1T3JA 1LTJC 1A2SA 3O8ZA 3M9QA 4WQCA 2LIRA 3CWBE 4K3IA 3H1ID 2XNDH 2WSEH 1NTZE 1AVYA 1W2BO 4L74A 1QL4A 1NJIQ 1K3GA 5AVUB 4WBAA 1AQTA 3M9HA 3G71P 1DW2A 3CU4A 4JCGA 1DEBA 3RN0A 4LGDE 1VYDA 2WSCJ 5AVQB 1LC1A 3L70D 1G1IA 3WU2V 1URQB 5AVXB 4Y99B 1K9MQ 2YKPA 3L75J 2HPCB 1DH3A 4GEDB 1LTTC 1RY3A 2JEEA 1FAVA 3B5NC 3C1LA 5H2FV 1S5LX 2I1KA 1N7SC 5KTBA 3CCRP 1KV4A 1LGHB 3H1HD 1G2CA 3CX5D 5KAIV 2FYNC 5KJ7C 4DOJA 1Z56A 1MV8A 3H1JD 4PD4I 2FYUD 2OTJP 2FFDA 1E8EA 2N1TB 1M56D 1KILB 1ZOYC 1KX2A 5CCHA 1YITP 5KLVD 1JOCA 3FXEA 1Q90D 1VQPP 1L2PA 3RK2C 4YXDC 1QLED 1PIXA 2ZXYA 1LWUB 1D7MA 1NTKJ 2FFDB 2CPSA 1L9JC 3M91A 1GW4A 2HYNA 4EDFA 1JB0J 2E74D 3JCUH 3MIWA 4H13C 4IFDK 4BXLA 4NFGB 2FXPA 2ZZS1 5AW9B 1S9KD 1HZVA 1VF5D 3D6ZA 1JMMA 1IFDA 1FC2C 1AVOA 2NPSD 3H1JJ 3A2AA 1DD3A 3F5HA 3B71A 2FYZA 4J20A 3QH9A 1PPJE 1NU1G 4IL6X 1IC2A 2HLOA 2KS1A 1CNOA 1DVVA 2LKMA 1IRWA 1Q2NA 3OJAB 1AOFA 5AVRB 1E79H 4Y99C 2FKWB 3LW5J 4HKZH 1WT6A 2O3JA 2MKVA 1YYCA 2W8ZA 1JDLA 2C0XA 1L0LK 1VL2A 3PH0A 1KYOE 3AEFC 1WRGA 3L37A 2O01H 3CD6P 1CIHA 3DR0A 4OGQB 3AEAC 2WT7B 2N1TC 1G1JA 1KYOW 3L74G 1E5WA 3ABVC 3ZBMA 2J5UA 3SFDC 3VYMA 2E5TA 2YKQA 1KMIZ 4CPGA 2KI7B 4UB6E 3CWBG 1CC5A 2Q9IA 4BWNA 4Y5RA 1NTZG 1LWUC 3L71J 1NKZB 2B89A 2FFDC 3P8MC 2BCCD 1HRCA 3CXHI 1KB9H 5CCHC 2QM7A 1FI3A 3GHGB 3O1YA 3S9OA 4L73A 1EDKA 1N86A 3NBTA 5CIBB 2ZAEB 1KX7A 3RK2D 3JBTB 1YCCA 1PL5A 1MFZA 2C9XB 4WQBA 2QJKB 3L72D 1OW8A 1SFCA 1YHQP 4Z1MH 5GTHV 1YQ3C 2D2CC 1H32B 1NMIA 1OVUA 2AXTE 4YPCA 3D70A 1H9XA 1LTIC 4YTPC 1DW3A 5CBNA 3BCCD 3GG2A 1EZVE 5AW8B 2D0WA 2WZ7A 1K05A 3SWFA 3V2QA 1C6SA 1H9YA 2BCCJ 1OVRA 1SQPE 1HZUA 3CPWO 1BE3D 2IZ1A 3FGAD 2KLVA 5APXA 1SQQK 2JWDA 2BPBB 1FDIA 4AALA 1DT1A 1PP9D 4PD4D 2PAJA 3CXHH 2ZYAA 3PLNA 1CSWA 4PV1B 5E79V 1JY3O 3SWYA 4OGQC 3L72J 1URQD 4WQEA 1NMLA 3RLMA 3OAKA 1Q7YQ 1DIIC 3HQ9A 3JCUE 1H88A 3BCCJ 3H1HG 4KJMA 5B66V 1ZN5A 1OIPA 1SQVE 3H1KE 1ZV8A 3GW6A 1J3SA 3V2NA 2FYUG 2O01N 5CIHB 3H1LD 5KLVG 3L73D 2N1TD 3GHGC 4FANA 1PPJG 1KILD 2ZBOA 1PP9J 4TT3H 2WWWA 3M0AA 1QL1A 4DCKA 2QJYB 2R32A 3A0BH 1BCCD 2QM8A 1JCCA 4NPEA 1F1CA 2K9YA 1I6DA 2L91A 1WMKA 2QJKC 1FJPA 2GA1A 2V7QJ 3BRTB 3PXSA 1FZCA 3HRNA 3NTNA 1NGMB 1MFTA 1LP1A 3A5TA 2YIUC 2N9YB 2G8YA 4I7ZC 1RQUA 1FZAA 4C7NA 2WPRA 1W2EA 3A7OA 4L75A 1SFCC 2A06D 3C2CA 3H1LJ 3Q5RA 3CCVP 1KQSO 2QIWA 4N6JA 3VRDA 2FY8A 3GLMA 2HV4A 3TGUJ 1GU5A 3MUDA 1FCDC 2YK3A 2KNCA 4PV1C 1P84D 2ZONG 4WY4A 3Q2YA 3SFEC 4WWIA 3O6QB 3PHLA 2BASA 4L76A 1N9CA 1KQLA 1FI7A 1KB9E 2QSIA 2NPSA 2PCBB 4N3YB 5AVWB 2W27A 3CX5I 2E74B 4WY4B 4FB1A 1OVVA 1RE4A 1NIRA 3RK3B 1GL2B 1ZRTD 3VMZA 5CIFB 1IZNB 1FOSE 1T3UA 1LT1A 3HUSB 1BDDA 2Q5UA 1KV9A 4H0KA 3CCMP 2AEJA 4TLFA 2IYPA 1EZVG 1X8YA 2QJYC 2WITA 2BEZF 1YJ9P 2CE1A 1BSNA 2Q1KA 5CJ0A 1HF9A 4W80A 1RZ5A 2P67A 1SQPG 1SLQA 1L0LD 1EDJA 4ASVA 1L4AD 5CIGB 1QVGO 4WQ9A 1LC2A 1SQXD 4WB4A 1TU3F 2E42A 3TDKA 3JSVC 3MGNA 3EFFK 5CIDB 4W7YA 1CCRA 5M1BA 3CXHE 3L4OA 3V6IA 1DIQC 4EYYQ 1Q82Q 3BASA 1N50A 2C1VA 1FZCC 3SVWA 1OMIA 3KDPB 1N73A 5AW2B 2ITAA 3TSIA 3NWVA 3OA8A 1GDTA 1CEDA 1NH4A 5KKZB 1LNQA 3KYQA 4XFJA 1H8AA 1Q81Q 2Y9YA 1L0LJ 1BE3G 3TNUA 3D6YA 1OCDA 5KAFE 4D6TE 1KQFB 1UIIA 3ZOWA 1NAYA 4UB6V 2WVRA 2H89C 3MUDC 1FU1A 4AANA 4HB1A 1CRIA 1NYHA 4MN4C 3H6PA 3HQ7A 4PV1D 1QN2A 1YTZI 2E74C 4WY4C 1M90Q 1FZFA 2H7HA 1NU1J 1R0QA 5CJ4A 1IRVA 2BGVX 3RK3C 1IQCA 1VF5C 4HH2A 3G4SP 1HUCA 1NTMK 1SQBE 2NPSC 4AQRD 3P8CE 1KFMA 3CC4P 2ZT9B 3Q5PA 1M8OB 1K04A 1SQQD 1SQVK 1AA0A 2AI5A 3HQ6A 1YBKA 2CA3B 2KB7P 1RE4C 3L73G 4FA1A 2J58A 1N2DC 1Y8AA 2AXCA 2OARA 5AW3B 5BU5A 4R4LA 1MG3D 2KOGA 1URQA 3CCUP 4IOIH 4WQ7A 5AW1B 1L0NK 1GW3A 1GK6A 2ZJSE 3PH2B 2HPCA 4K3AA 2FXOA 2SPZA 1MZ9A 3U59A 3USSA 2K9JB 1M57D 3VOPA 4DY9A 4JF7A 3FWLA 4N78E 1SQQJ 5KKZC 1DIPA 1NTKD 1I54A 2A06G 2N1TA 1EQ7A 3L75E 2AXTH 1KILA 4FA4A 2ORLA 3F89A 2K1AA 1CSVA 1I8OA 1JNMA 3RL0B 5GTIH 1N73C 2YKOA 3CL3D 3H1IE 4AX3A 1LWUA 2E76B 2BCNB 4JQ0D 5IY51 1QX8A 1KB0A 4H0LB 4RESB 4P4QB 1KN7A 2KSJA 1T2KD 1J1EC 2LXBA 3L70E 3GF3A 4XA4A 5AVZB 1NAFA 3FWNA 2WSFJ 1PV3A 2KSEA 2YXQB 1H31A 2WPVB 4WY4D 2WPSA 3V4WA 1YJWP 2OYIB 4L1QA 3LIEA 3CC7P 2GIWA 1GL2D 1RE3A 3H1HE 1LFMA 3RBZA 3RK3D 3CX5E 1VQNP 4I1LA 1CHHA 3H25A 1DX7A 1USDA 1XTGB 4EIDA 1ZR2A 4GYDA 4QAOA 3CYTI 3H1JE 2FYUE 1YJNP 4I6MC 2Z4EA 2JDIH 2PRRA 5AVVB 3AEBC 2OGUA 3AE6C 1H31B 1BGYD 3AE3C 1YTCA 5KLVE 1CTYA 3CX5W 4D6TG 1FI9A 4PD4H 1GMJA 1CRCA 1CO6A 1SQXG 3M06A 1HJ0A 1JCDA 1MUUA 4NPDA 1URQC 3KXDA 5K5GB 3JC22 1RHZB 1YTZT 2I8FA 2YXRB 3L71D 3ZCFA 2V7QH 2WT7A 2HODB 2MJZA 1JUNA 1RQVA 2KZJA 1M6ZA 2MTAC 2B12B 1S9KE 3RL0C 1SQBG 1Q86Q 1X22A 2JQRA 1U74B 2JKVA 5BU8B 1JM0A 5B5EE 1FE6A 1L4AA 2IBZD 2WPQA 1BGYJ 2AEMA 2Q7CA 1KILC 1P84I 2O1JA 3HD7A 3GHGA 4H0LC 5EFWB 1A02F 5CIEB 2N3BA 1NU1K 5AW5B 2ZYDA 2MHMA 1LT9B 4ASWA 1L4AB 1VQ5P 1GD2E 3WUTA 2PCCB 3HD7B 4KT0J 2HG5D 2P1JA 3NFQA 1H32A 1B7VA 4JYBA 1GIWA 2N9IA 1IFJA 1KFNA 2WSEJ 1ZP0C 1RH5B 3RBXA 1ZLLA 2GB8B 1CHJA 3TYYA 3L75G 2ZT9D 3SWSA 4JYCA 3IR9A 1X9VA 2CA4B 2M5AB 3TYIA 1C75A 1RE3C 3H1IG 2V07A 3E1IA 2R5DA 5GTIE 1QGKB 3WFDC 2RMZA 1DVHA 2CXBA 1NTZK 3PP5A 2BCCE 1KC8Q 1NTMD 3ZDMA 1A8CA 3E1RA 1W5CT 5DJQB 2ZVNB 5L8RJ 3L70G 2YMKA 1GDVA 4U3FD 2XKMA 4IFFA 2V08A 2DVHA 3L72E 1RF0A 3A0BV 1VQ8P 4KMGA 3AECC 4H0JA 1NTKG 1KORA 4NPFX 3WFEC 3TK1A 2XU6A 3AE9C 4FA5A 4M3LA 3WU2E 3RN1A 1IK7A 1S5LH 2OZ1B 2R3CA 3MP7B 1L0ND 1A02J 1MKMA 4Q5PA 3BCCE 1SS1A 1RZ6A 3ZOYA 3MHVA 1I55A 3RL0D 1HVVA 3L4FA 1Y9BA 3H1JG 5DJUB 4C46A 1JY2O 5KAFH 1L4AC 3Q1MA 3B8EB 1NTMJ 3FXDA 1BE3E 2OQQA 2E76D 3HD7C 1EC5A 2IZ0A 1YQ4C 1NKNA 3HE4B 4H0LD 1PP9E 1SQVJ 3H1KJ 1YEBA 4PD4E 3TGUD 1F1FA 4U3FJ 4B86A 1LJ2A 2J59M 1HCMA 1GTWA 1GU2A 2P58A 3O20A 2HFED 1W5CE 4R4MA 4WVZA 1FOSF 4Y28J 1JTHB 3E7KA 1IFMA 2B87A 3AE2C 1L0NJ 3AE8C 2FWLA 4HJGH 1HTLC 1EB7A 2Z5IA 3KHUA 1PGPA 3M97X 4O1WA 3V2RA 2IFMA 2P10A 5AVYB 5CYTR 2FYUK 2JO1A 3L36A 3H1LE 3O6QA 2NRGA 3L73E 1BL9A 1KILE 2B87B 5KLVK 5AVTB 4AYCA 5DJQC 2IFNA 4IL6H 2W6AA 1HWTC 2O01J 1BCCE 1J1DB 3SSUA 2LXCB 5CICB 3OW2O 1AKKA 3L71G 5CBOA 1BDCA 1QKSA 1FS0E 2XNXA 1KQGB 1QVFO 1GL2A 2WSCH 1EXJA 3V5BA 3CMAP 3HUSA 1USEA 4H44D 1LTBC 3WUVA 2GUVA 1NO4A 1S3JA 5TJHA 1VQ7P 3CI9A 4KHXA 1VQLP 1RF0C 4EIFA 2A06E 3AE4C 3RMZA 2Y0EA 1OFCX 2N9BA 4LLHA 1NWQA 1AFOA 1YI2P 2ZFCA 3S4RA 3ZOOA 3NXSA 1LTAC 1E29A 2XV5A 2M3BA 4UB8H 1OWAA 3ZOXA 1C2NA 1T6AA 1P84E 5APSA 1U57A 3DP5A 2BEQD 1A56A 4W7ZA 1MG2D 2BCCG 2B10B 4PJ0H 2QEXP 3A9FA 2VRSA 4WQ8A 3O0RC 3A0HH 3HD7D 2OTKE 1CRYA 2IYOA 3WMM0 1C52A 1M1JA 1DW0A 1T8ZA 4GDOA 3WUIA 1IK9A 3PRJA 3GF7A 3L72G 3CCLP 4EIJA 1RAPA 3G3ZA 1LTJB 1HJ4A 1NU1D 1ZRTE 2H88C 1EDLA 1CXAA 3CX5H 1JEKA 1CSBA 3I5CA 1M1JB 451CA 3BCCG 4PW9B 1S5LE 1YICA 4DZOA 1CRGA 2H8PD 1J1DC 1ZW0A 3LIDA 3WFBC 5GTHE 3P7KA 2BLFB 1IZL0 2WQYC 2YMYA 3P32A 5TISH 1L0LE 5DF5A 1T2KC 3FX0A 2Y0DA 1SQPK 1NNOA 1I8PA 1SQXE 1PP9G 1JMBA 3KZIH 2C8SA 2V4HA 1C2RA 3M0DA 1H89A 2YNYA 3EFGA 3LW5H 4I2LC 1C6RA 2BH4X 2B0ZB 1N7SB 2FBWC 2IBZI 1GL2C 1LTSC 3S1KA 4LJIA 5APYA 3CWBD 2FYNB 2R44A 2RH0A 5E79E 3HUSC 1HGZA 2R5BA 2I1JA 1NTZD 5B5EH 1AQ5A 4OVNF 4U7JA 1HH0A 3AE1C 1R8EA 2KIKA 1H33B 4EIEA 1KIBA 3L4MA 2IDBA 3PXWA 5AW4B 3W68A 2QE7H 2AIUA 2M8RA 3H1LG 5APVA 4RSZA 1SQBJ 2Y9ZA 2XTSB 1FJKA 3AE7C 5AW7B 4GKGA 1L9BC 2PFXA 2AXTV 1PZQA 1FJ0A 3VNWA 2JP3A 3VMYA 1H1OA 2FXMA 4BRYA 1FZBA 1I5TA 2K9JA 1FOCA 1BCCG 5GTIV 3ZIYA 4IL6E 4GIFA 3L74J 5DFSA 4H13B 3I56P 3B4SA 4ZKPA 351CA 1COTA 2W6JH 3CWBJ 2R3SA 2L4DA 3C9IA 1NTZJ 1M1JC 2XZRA 2B4ZA 4XE5B 1QYZA 4BRYB 1KTMA 1CHIA 2GC7D 1SQQE 1ZXGA 1ZR4A 3C8VA 1IFIA 4O9BA 1KD1Q 2KXPB 4O1QA 5CCGC 3IN6A 2B88A 2JR8A 1HBWA 3D71A 3Q5SA 3NBSA 3X39A 2QA4P 1ETPA 4AUWA 3W67A 4UB8E 2M0BA 3N4XA 2ZXEB 1EXIA 2A45I 3KPEA 3QWOC 1DW1A 2FRCA 2NZ2A 2GM4A 4PJ0E 2OYIA 3H1IJ 1M70A 2H43A 1YNRA 3A0HE 3TF5A 4EICA 3M0DC 1GJQA 2ZT9C 1NTKE 4XYDB 3WU2H 2K3RA 1PPJD 3L70J 1G2CB 2KK7A 3R4YA 1C7MA 4ZNCA 3WUUA 5H2FH 3Q3DA 2N18B 1OX3A 1X0TA 3ITKA 1AOQA 1HJ5A 2VHDA 1L0LG 1SVFA 2B9BA 2HODA 5KAIH 3HTKA 5TISE 1R5SA 3H1HJ 1KYOD 3CCJP 4YE1A 2CPBA 2ZOOA 1J2JB 1GZLA 2A45H 4RKUJ 2FYUJ 3K5BA 2Q3EA 3T97A 3KZIE 3U1CA 4XXLA 2RN0A 3I55P 5KLVJ 2D2CB 1CSUA 3H32A 2YO3A 2C9LY 3HTKB 3MK7B 4IFMA 1IJDB 4H44B 3RK3E 1PGOA 1FHBA 4RO0A 1I6EA 3DMIA 3G9RA 1KB9I 4YXWH 2JTIB 2K37A 3T97B 2P2UA 1LT9A 1M7LA 1OW6A 2KYVA 1XTCC 2E76C 1FDOA 1BGYE 2M3EA 3H32B 5APWA 4N0KA 2EXVA 2KLUA 1CRJA 1E2RA 3MZWB 1DD4A 4MU8A 2KS1B 4JPZB 3IFMA 5CCGD 5DJTB 1CSXA 1SQXK 4L3HA 1QL2A 1S2EA 1VQMP 2Z5HA 1M60A 3O5CA 3PTZA 3L71E 3V4QA 1HJ3A 4FA9A 3VYIA 3N7NA 3VMAA 1S4XA 3B5ND 2JWAA 2M5AA 4OWFA 4OH8B 1CTJA 2OYIC 2Q6QA 1N7SD 3M9BA 5AW6B 1EZVD 5APUA 1MZ4A 1OZHA 1S72P 2ZYGA 5AW0B 1SQBK 2E75B 2OTLP 5KJ7D 3MTUE 3WFCC 1SQPD 1SQQG 2IBZE 2N18C 1IFNA 1NOHA 3VTPC 2KP8A 1VQOP 1GK4A 1P84H 2E5YA 5APTA 1S5LV 3SJLA 1JY3P 1JY3N 2C1DA 1FZGA 1YIQA 5KAFV 2YIUB 4H13D 1AJYA 3MK7C 2W6BA 4I7ZB 2OZ1A 4H44C 1SQVD 3H1KD 1DEEG 5APQA 4V2KA 2XDJA 3VP9A 1R5LA 1SFCB 3II6A 1SQPJ 2IX7C 3AEDC 3RL0g 2C1DB 3EWKA 1PFIA 2Q3IA 1JY2P 1N15A 1JY2N 1FZEA 3NMDA 1CORA 4JBZA 2N3YA 3HE4A 2W83C 4QMAA 155CA 1VQ6P 1LMSA 1Y47A 2QG4A 5GTHH 1OW7A 2WMMA 5KLIB 1QEXA 1LT9C 3CCQP 2C2CA 5H2FE 2KUBA 1NTME 3CCSP 3SWKA 1JTHA 2POHA 2CE0A 5KAIE 2AEFA 4RJTA 2D0SA 2QRXA 4U3FE 2E75C 2P7JA 1K73Q 2G3AA 1IFPA 4IL6V 1BE3J 2HR3A 3PJSK 3V2PA 2I8DA 1NTKK 1HROA 3L35A 1U75B 5E79H 3MD0A 1CXCA 3EQ2A 1CCHA 2L5GB 3GMAA 1NVOA 1AYGA 1RF1A 2BH5X 1L0NE 1BSHA 2DGEA 1WEJF 1ZZHA 3BATA 1HH7A 4FAVA 4A7PA 4EOTA 4L3GA 3SLEA 3G6EP 1BGYG 1C6OA 3VMXA 2C9NY 5B66H 2GC4D 5CCHD 4EI2A 1N8RQ 1KB9D 1VPCA 1X79B 1RF1B 1VDFA 2KZIA 2YO2A 3TGUE 1U7JA 1YFCA 1VQ9P 4UB8V 1QL3A 4AAMA 4WQAA 3L73J 1OAEA 2WTYA 1FZCB 5CHXA 2WSSH 3AEEC 2QVAA 1LP1B 2Y0CA 3OCDA 1KZUB 2D2CD 3KQGA 1GQ1A 1S1CX 4PJ0V 2E43A 1BCCJ 2YCCA 4C7NB 1CIFA 2ZVOB 1HGVA 3A0HV 3VP8A 1K3HA 2ZXXA 1VQ4P 1YIJP 5KLIC 2PP6A 2IBZG 2O1KA 1VQKP 4C7RA 1HJBA 3CC2P 3SXTA 2LITA 2QJPB 3OCDB 4GOFA 1CYIA 5AVSB 3CP5A 2PACA 2KNCB 2K88A 1IO3A 2OYHA 1N7LA 3CXHD 3HQ8A 4HYTB 3OA7A 4OGQD 3CMEP 3D0WA 3HE5A 1VF5B 2W90A 1U7MA 3IF4A 1LTJA 5TISV 2B11B 3ORVA 2NPSB 1NHLA 1SP4A 2OYHB 2GUSA 2WSFH 4ZMDA 3IAOA 4K35A 2JJLA 3KZIV 2IPPA 1ZMEC 4GODA 2E75D 1IO4A 3HE5B 4D6TD 3PXTA 3AE5C 1LS9A 1YEAA 5CCGA 1M1KQ 1PGQA 3BVHA 1RF1C 3BRVB 5CMZA 1CYCA 1CZQA 2C1UA 2OYOA 1FBMA 1KYOI 2C0WA 1FDMA 1CYJA 5B5EV 3B5NA 3CLQA 1NTMG 1H0TA 1N7SA 5BVZA 1CIGA 3CXHW 1SQBD 4PWAA 3U1AA 1N90A 1GU4A 5KJ7A 3P8CD 1SQVG 3H1KG 5C0ZA 2PGDA 1WVEC 4U3FG 5C39A 2A45G 1H33A 3B5NB 3L74D 4D6TJ 1LTGC 2YQBA 1SFCD 2RKLA 4LC1A 4ZKUA 1H0TB 1SQXJ 1CRHA 1NU1E 1CW5A 1CIEA 1N73B 2QJPC 3OA8B 5C9MA 1W2LA 4GT1A 1CI6A 2LR2A 5EXQA 1L0NG 4GOEA 3RGUA 2N9JA 4DJGA 4AAOA 3A0BE 1OXZA 3TNUB 5B6QA 1JO5A 1KYOH 3R2PA 2CK3H 3RK2B 2DW3A 1J1EB 3A3YB 3UIAA 1PGJA 3CCEP 5B66E 1CI6B 1S6VB 1AV1A 3WC8A 1RAQA 5AURA 3TGUG 1K8AQ 2OYHC 4N78D 4DT0A 1EZVI 1CTZA 1EDIA 4WQDA 3L75D 1UIXA 3L74E
chains in the Genus database with same CATH topology
1CSUA 1GKSA 1NIRA 3WFEC 1ZRTD 5CIFB 3MK7B 4FA5A 1A2SA 3RN1A 1KV9A 2OZ1B 4WQCA 2LIRA 4H0KA 4K3IA 1L0ND 4Q5PA 1FHBA 3H1ID 1I6EA 3DMIA 1RZ6A 3ZOYA 1I55A 2JTIB 1QL4A 2CE1A 1K3GA 1RZ5A 1L0LD 1DW2A 3CU4A 4JCGA 5CIGB 4N0KA 3RN0A 4WQ9A 2EXVA 1LC2A 1VYDA 1CRJA 1E2RA 1SQXD 4MU8A 1LC1A 3L70D 3TDKA 1YEBA 3WU2V 5CIDB 3TGUD 1CSXA 1CCRA 1F1FA 4L3HA 3L4OA 1HCMA 1M60A 3O5CA 3PTZA 1DIQC 1GU2A 4GEDB 3O20A 1HJ3A 4FA9A 3VMAA 5H2FV 1N50A 2C1VA 2JWAA 3SVWA 1CTJA 3H1HD 2FWLA 3CX5D 3NWVA 1EZVD 3OA8A 5KAIV 1MZ4A 1CEDA 1EB7A 3KHUA 3M97X 4O1WA 5KKZB 3H1JD 2FYUD 3WFCC 1E8EA 1SQPD 2N18C 1KX2A 5CYTR 5KLVD 1OCDA 1BL9A 2ZXYA 5DJQC 3ZOWA 4UB6V 4AANA 1S5LV 1CRIA 3SJLA 3HQ7A 5CICB 1QN2A 1AKKA 1L9JC 1QKSA 2C1DA 4EDFA 1R0QA 1IRVA 2BGVX 1YIQA 4NFGB 1IQCA 5KAFV 2YIUB 2ZZS1 3MK7C 1HZVA 2OZ1A 1SQVD 3H1KD 4V2KA 5TJHA 1SQQD 2AI5A 4EIFA 2C1DB 3HQ6A 4J20A 2CA3B 3RMZA 2Y0EA 1N15A 4FA1A 3ZOOA 1E29A 1CORA 1MG3D 2N3YA 2KS1A 1CNOA 155CA 1DVVA 1IRWA 1LMSA 1AOFA 3ZOXA 2QG4A 1C2NA 4WQ7A 5KLIB 3DP5A 1A56A 3PH2B 1MG2D 2O3JA 2C2CA 2B10B 1JDLA 3A9FA 4WQ8A 3O0RC 2CE0A 1CRYA 1C52A 1CIHA 1DW0A 3DR0A 2K9JB 4RJTA 2D0SA 4DY9A 3FWLA 3WUIA 3PRJA 4IL6V 1NTKD 1I54A 1KYOW 4FA4A 1RAPA 2ORLA 3ZBMA 1HJ4A 1HROA 1NU1D 1CSVA 1U75B 3VYMA 1CXAA 1CXCA 1I8OA 1CCHA 1AYGA 2BH5X 1CC5A 451CA 2DGEA 4PW9B 1WEJF 4Y5RA 1YICA 4AX3A 1ZZHA 1CRGA 3WFBC 2BCNB 1HH7A 4FAVA 4A7PA 4L3GA 2BCCD 1IZL0 2BLFB 3SLEA 5IY51 1HRCA 1KB0A 5DF5A 1C6OA 1FI3A 2Y0DA 4P4QB 3O1YA 1NNOA 2GC4D 1KB9D 3NBTA 5CIBB 1I8PA 1KX7A 2C8SA 3JBTB 1C2RA 1YCCA 2C9XB 1YFCA 4WQBA 2QJKB 3L72D 4UB8V 1C6RA 1QL3A 4AAMA 5GTHV 1H31A 4WQAA 2BH4X 2B0ZB 1OAEA 1H32B 1NMIA 2Y0CA 3OCDA 1H9XA 4LJIA 1GQ1A 4L1QA 1DW3A 3CWBD 4PJ0V 2FYNB 2GIWA 1LFMA 3BCCD 2YCCA 3GG2A 1CHHA 1CIFA 2D0WA 1NTZD 3A0HV 4EIDA 1K3HA 1C6SA 4GYDA 4QAOA 3CYTI 1H9YA 1H33B 4EIEA 1KIBA 1HZUA 1BE3D 3L4MA 1H31B 1BGYD 3PXWA 1YTCA 1CTYA 2AIUA 3CX5W 3SXTA 2LITA 1FI9A 4RSZA 2BPBB 1CRCA 2QJPB 2XTSB 3OCDB 1CO6A 1CYIA 1L9BC 2AXTV 1DT1A 4AALA 1PP9D 4PD4D 3CP5A 1FJ0A 3VNWA 2PACA 2KNCB 3PLNA 1CSWA 1H1OA 5E79V 1IO3A 1I5TA 1FOCA 3CXHD 3HQ8A 3ZIYA 5GTIV 2I8FA 4WQEA 3L71D 3ZCFA 5DFSA 1NMLA 351CA 1COTA 3RLMA 1M6ZA 1DIIC 5TISV 2B11B 3HQ9A 3ORVA 2L4DA 2MTAC 2B12B 5B66V 2B4ZA 1QYZA 2JQRA 3GW6A 1J3SA 1U74B 1CHIA 2GC7D 3KZIV 2IBZD 5CIHB 3H1LD 4D6TD 3PXTA 1LS9A 3L73D 4FANA 1YEAA 4O1QA 2ZBOA 3NBSA 5CIEB 2QJYB 2N3BA 3X39A 1BCCD 1CYCA 1ETPA 2C1UA 2MHMA 1F1CA 1I6DA 2L91A 1CYJA 5B5EV 2PCCB 3PXSA 1H32A 1DW1A 1CIGA 2FRCA 3CXHW 1B7VA 1SQBD 4PWAA 1M70A 2N9YB 1N90A 1GIWA 2N9IA 1YNRA 3TF5A 5C0ZA 4EICA 1WVEC 1GJQA 1CHJA 2GB8B 1H33A 2A06D 3C2CA 3L74D 2YQBA 4XYDB 3SWSA 1PPJD 1CRHA 3VRDA 2CA4B 1CIEA 3TYIA 1C75A 2HV4A 3OA8B 5C9MA 1W2LA 1C7MA 5EXQA 1FCDC 2YK3A 2V07A 2N9JA 3WFDC 1P84D 4AAOA 2ZONG 2RMZA 1DVHA 2CXBA 2N18B 3ITKA 1AOQA 1HJ5A 2VHDA 5B6QA 1NTMD 3PHLA 1A8CA 1N9CA 1W5CT 1FI7A 1KYOD 4YE1A 5DJQB 2PCBB 2ZOOA 1S6VB 1GDVA 3WC8A 1RAQA 5AURA 2Q3EA 4U3FD 2V08A 4XXLA 2DVHA 2RN0A 3A0BV 1CTZA 4KMGA 4H0JA 4WQDA 3L75D 4FB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSU A;  1GKS A;  1NIR A;  3WFE C;  1ZRT D;  5CIF B;  3MK7 B;  4FA5 A;  1A2S A;  3RN1 A;  1KV9 A;  2OZ1 B;  4WQC A;  2LIR A;  4H0K A;  4K3I A;  1L0N D;  4Q5P A;  1FHB A;  3H1I D;  1I6E A;  3DMI A;  1RZ6 A;  3ZOY A;  1I55 A;  2JTI B;  1QL4 A;  2CE1 A;  1K3G A;  1RZ5 A;  1L0L D;  1DW2 A;  3CU4 A;  4JCG A;  5CIG B;  4N0K A;  3RN0 A;  4WQ9 A;  2EXV A;  1LC2 A;  1VYD A;  1CRJ A;  1E2R A;  1SQX D;  4MU8 A;  1LC1 A;  3L70 D;  3TDK A;  1YEB A;  3WU2 V;  5CID B;  3TGU D;  1CSX A;  1CCR A;  1F1F A;  4L3H A;  3L4O A;  1HCM A;  1M60 A;  3O5C A;  3PTZ A;  1DIQ C;  1GU2 A;  4GED B;  3O20 A;  1HJ3 A;  4FA9 A;  3VMA A;  5H2F V;  1N50 A;  2C1V A;  2JWA A;  3SVW A;  1CTJ A;  3H1H D;  2FWL A;  3CX5 D;  3NWV A;  1EZV D;  3OA8 A;  5KAI V;  1MZ4 A;  1CED A;  1EB7 A;  3KHU A;  3M97 X;  4O1W A;  5KKZ B;  3H1J D;  2FYU D;  3WFC C;  1E8E A;  1SQP D;  2N18 C;  1KX2 A;  5CYT R;  5KLV D;  1OCD A;  1BL9 A;  2ZXY A;  5DJQ C;  3ZOW A;  4UB6 V;  4AAN A;  1S5L V;  1CRI A;  3SJL A;  3HQ7 A;  5CIC B;  1QN2 A;  1AKK A;  1L9J C;  1QKS A;  2C1D A;  4EDF A;  1R0Q A;  1IRV A;  2BGV X;  1YIQ A;  4NFG B;  1IQC A;  5KAF V;  2YIU B;  2ZZS 1;  3MK7 C;  1HZV A;  2OZ1 A;  1SQV D;  3H1K D;  4V2K A;  5TJH A;  1SQQ D;  2AI5 A;  4EIF A;  2C1D B;  3HQ6 A;  4J20 A;  2CA3 B;  3RMZ A;  2Y0E A;  1N15 A;  4FA1 A;  3ZOO A;  1E29 A;  1COR A;  1MG3 D;  2N3Y A;  2KS1 A;  1CNO A;  155C A;  1DVV A;  1IRW A;  1LMS A;  1AOF A;  3ZOX A;  2QG4 A;  1C2N A;  4WQ7 A;  5KLI B;  3DP5 A;  1A56 A;  3PH2 B;  1MG2 D;  2O3J A;  2C2C A;  2B10 B;  1JDL A;  3A9F A;  4WQ8 A;  3O0R C;  2CE0 A;  1CRY A;  1C52 A;  1CIH A;  1DW0 A;  3DR0 A;  2K9J B;  4RJT A;  2D0S A;  4DY9 A;  3FWL A;  3WUI A;  3PRJ A;  4IL6 V;  1NTK D;  1I54 A;  1KYO W;  4FA4 A;  1RAP A;  2ORL A;  3ZBM A;  1HJ4 A;  1HRO A;  1NU1 D;  1CSV A;  1U75 B;  3VYM A;  1CXA A;  1CXC A;  1I8O A;  1CCH A;  1AYG A;  2BH5 X;  1CC5 A;  451C A;  2DGE A;  4PW9 B;  1WEJ F;  4Y5R A;  1YIC A;  4AX3 A;  1ZZH A;  1CRG A;  3WFB C;  2BCN B;  1HH7 A;  4FAV A;  4A7P A;  4L3G A;  2BCC D;  1IZL 0;  2BLF B;  3SLE A;  5IY5 1;  1HRC A;  1KB0 A;  5DF5 A;  1C6O A;  1FI3 A;  2Y0D A;  4P4Q B;  3O1Y A;  1NNO A;  2GC4 D;  1KB9 D;  3NBT A;  5CIB B;  1I8P A;  1KX7 A;  2C8S A;  3JBT B;  1C2R A;  1YCC A;  2C9X B;  1YFC A;  4WQB A;  2QJK B;  3L72 D;  4UB8 V;  1C6R A;  1QL3 A;  4AAM A;  5GTH V;  1H31 A;  4WQA A;  2BH4 X;  2B0Z B;  1OAE A;  1H32 B;  1NMI A;  2Y0C A;  3OCD A;  1H9X A;  4LJI A;  1GQ1 A;  4L1Q A;  1DW3 A;  3CWB D;  4PJ0 V;  2FYN B;  2GIW A;  1LFM A;  3BCC D;  2YCC A;  3GG2 A;  1CHH A;  1CIF A;  2D0W A;  1NTZ D;  3A0H V;  4EID A;  1K3H A;  1C6S A;  4GYD A;  4QAO A;  3CYT I;  1H9Y A;  1H33 B;  4EIE A;  1KIB A;  1HZU A;  1BE3 D;  3L4M A;  1H31 B;  1BGY D;  3PXW A;  1YTC A;  1CTY A;  2AIU A;  3CX5 W;  3SXT A;  2LIT A;  1FI9 A;  4RSZ A;  2BPB B;  1CRC A;  2QJP B;  2XTS B;  3OCD B;  1CO6 A;  1CYI A;  1L9B C;  2AXT V;  1DT1 A;  4AAL A;  1PP9 D;  4PD4 D;  3CP5 A;  1FJ0 A;  3VNW A;  2PAC A;  2KNC B;  3PLN A;  1CSW A;  1H1O A;  5E79 V;  1IO3 A;  1I5T A;  1FOC A;  3CXH D;  3HQ8 A;  3ZIY A;  5GTI V;  2I8F A;  4WQE A;  3L71 D;  3ZCF A;  5DFS A;  1NML A;  351C A;  1COT A;  3RLM A;  1M6Z A;  1DII C;  5TIS V;  2B11 B;  3HQ9 A;  3ORV A;  2L4D A;  2MTA C;  2B12 B;  5B66 V;  2B4Z A;  1QYZ A;  2JQR A;  3GW6 A;  1J3S A;  1U74 B;  1CHI A;  2GC7 D;  3KZI V;  2IBZ D;  5CIH B;  3H1L D;  4D6T D;  3PXT A;  1LS9 A;  3L73 D;  4FAN A;  1YEA A;  4O1Q A;  2ZBO A;  3NBS A;  5CIE B;  2QJY B;  2N3B A;  3X39 A;  1BCC D;  1CYC A;  1ETP A;  2C1U A;  2MHM A;  1F1C A;  1I6D A;  2L91 A;  1CYJ A;  5B5E V;  2PCC B;  3PXS A;  1H32 A;  1DW1 A;  1CIG A;  2FRC A;  3CXH W;  1B7V A;  1SQB D;  4PWA A;  1M70 A;  2N9Y B;  1N90 A;  1GIW A;  2N9I A;  1YNR A;  3TF5 A;  5C0Z A;  4EIC A;  1WVE C;  1GJQ A;  1CHJ A;  2GB8 B;  1H33 A;  2A06 D;  3C2C A;  3L74 D;  2YQB A;  4XYD B;  3SWS A;  1PPJ D;  1CRH A;  3VRD A;  2CA4 B;  1CIE A;  3TYI A;  1C75 A;  2HV4 A;  3OA8 B;  5C9M A;  1W2L A;  1C7M A;  5EXQ A;  1FCD C;  2YK3 A;  2V07 A;  2N9J A;  3WFD C;  1P84 D;  4AAO A;  2ZON G;  2RMZ A;  1DVH A;  2CXB A;  2N18 B;  3ITK A;  1AOQ A;  1HJ5 A;  2VHD A;  5B6Q A;  1NTM D;  3PHL A;  1A8C A;  1N9C A;  1W5C T;  1FI7 A;  1KYO D;  4YE1 A;  5DJQ B;  2PCB B;  2ZOO A;  1S6V B;  1GDV A;  3WC8 A;  1RAQ A;  5AUR A;  2Q3E A;  4U3F D;  2V08 A;  4XXL A;  2DVH A;  2RN0 A;  3A0B V;  1CTZ A;  4KMG A;  4H0J A;  4WQD A;  3L75 D;  4FB1 A; 
#chains in the Genus database with same CATH topology
 1GKS A;  3VN0 A;  3AEG C;  2UWJ E;  4UB6 H;  1T3J A;  1LTJ C;  1A2S A;  3O8Z A;  3M9Q A;  4WQC A;  2LIR A;  3CWB E;  4K3I A;  3H1I D;  2XND H;  2WSE H;  1NTZ E;  1AVY A;  1W2B O;  4L74 A;  1QL4 A;  1NJI Q;  1K3G A;  5AVU B;  4WBA A;  1AQT A;  3M9H A;  3G71 P;  1DW2 A;  3CU4 A;  4JCG A;  1DEB A;  3RN0 A;  4LGD E;  1VYD A;  2WSC J;  5AVQ B;  1LC1 A;  3L70 D;  1G1I A;  3WU2 V;  1URQ B;  5AVX B;  4Y99 B;  1K9M Q;  2YKP A;  3L75 J;  2HPC B;  1DH3 A;  4GED B;  1LTT C;  1RY3 A;  2JEE A;  1FAV A;  3B5N C;  3C1L A;  5H2F V;  1S5L X;  2I1K A;  1N7S C;  5KTB A;  3CCR P;  1KV4 A;  1LGH B;  3H1H D;  1G2C A;  3CX5 D;  5KAI V;  2FYN C;  5KJ7 C;  4DOJ A;  1Z56 A;  1MV8 A;  3H1J D;  4PD4 I;  2FYU D;  2OTJ P;  2FFD A;  1E8E A;  2N1T B;  1M56 D;  1KIL B;  1ZOY C;  1KX2 A;  5CCH A;  1YIT P;  5KLV D;  1JOC A;  3FXE A;  1Q90 D;  1VQP P;  1L2P A;  3RK2 C;  4YXD C;  1QLE D;  1PIX A;  2ZXY A;  1LWU B;  1D7M A;  1NTK J;  2FFD B;  2CPS A;  1L9J C;  3M91 A;  1GW4 A;  2HYN A;  4EDF A;  1JB0 J;  2E74 D;  3JCU H;  3MIW A;  4H13 C;  4IFD K;  4BXL A;  4NFG B;  2FXP A;  2ZZS 1;  5AW9 B;  1S9K D;  1HZV A;  1VF5 D;  3D6Z A;  1JMM A;  1IFD A;  1FC2 C;  1AVO A;  2NPS D;  3H1J J;  3A2A A;  1DD3 A;  3F5H A;  3B71 A;  2FYZ A;  4J20 A;  3QH9 A;  1PPJ E;  1NU1 G;  4IL6 X;  1IC2 A;  2HLO A;  2KS1 A;  1CNO A;  1DVV A;  2LKM A;  1IRW A;  1Q2N A;  3OJA B;  1AOF A;  5AVR B;  1E79 H;  4Y99 C;  2FKW B;  3LW5 J;  4HKZ H;  1WT6 A;  2O3J A;  2MKV A;  1YYC A;  2W8Z A;  1JDL A;  2C0X A;  1L0L K;  1VL2 A;  3PH0 A;  1KYO E;  3AEF C;  1WRG A;  3L37 A;  2O01 H;  3CD6 P;  1CIH A;  3DR0 A;  4OGQ B;  3AEA C;  2WT7 B;  2N1T C;  1G1J A;  1KYO W;  3L74 G;  1E5W A;  3ABV C;  3ZBM A;  2J5U A;  3SFD C;  3VYM A;  2E5T A;  2YKQ A;  1KMI Z;  4CPG A;  2KI7 B;  4UB6 E;  3CWB G;  1CC5 A;  2Q9I A;  4BWN A;  4Y5R A;  1NTZ G;  1LWU C;  3L71 J;  1NKZ B;  2B89 A;  2FFD C;  3P8M C;  2BCC D;  1HRC A;  3CXH I;  1KB9 H;  5CCH C;  2QM7 A;  1FI3 A;  3GHG B;  3O1Y A;  3S9O A;  4L73 A;  1EDK A;  1N86 A;  3NBT A;  5CIB B;  2ZAE B;  1KX7 A;  3RK2 D;  3JBT B;  1YCC A;  1PL5 A;  1MFZ A;  2C9X B;  4WQB A;  2QJK B;  3L72 D;  1OW8 A;  1SFC A;  1YHQ P;  4Z1M H;  5GTH V;  1YQ3 C;  2D2C C;  1H32 B;  1NMI A;  1OVU A;  2AXT E;  4YPC A;  3D70 A;  1H9X A;  1LTI C;  4YTP C;  1DW3 A;  5CBN A;  3BCC D;  3GG2 A;  1EZV E;  5AW8 B;  2D0W A;  2WZ7 A;  1K05 A;  3SWF A;  3V2Q A;  1C6S A;  1H9Y A;  2BCC J;  1OVR A;  1SQP E;  1HZU A;  3CPW O;  1BE3 D;  2IZ1 A;  3FGA D;  2KLV A;  5APX A;  1SQQ K;  2JWD A;  2BPB B;  1FDI A;  4AAL A;  1DT1 A;  1PP9 D;  4PD4 D;  2PAJ A;  3CXH H;  2ZYA A;  3PLN A;  1CSW A;  4PV1 B;  5E79 V;  1JY3 O;  3SWY A;  4OGQ C;  3L72 J;  1URQ D;  4WQE A;  1NML A;  3RLM A;  3OAK A;  1Q7Y Q;  1DII C;  3HQ9 A;  3JCU E;  1H88 A;  3BCC J;  3H1H G;  4KJM A;  5B66 V;  1ZN5 A;  1OIP A;  1SQV E;  3H1K E;  1ZV8 A;  3GW6 A;  1J3S A;  3V2N A;  2FYU G;  2O01 N;  5CIH B;  3H1L D;  5KLV G;  3L73 D;  2N1T D;  3GHG C;  4FAN A;  1PPJ G;  1KIL D;  2ZBO A;  1PP9 J;  4TT3 H;  2WWW A;  3M0A A;  1QL1 A;  4DCK A;  2QJY B;  2R32 A;  3A0B H;  1BCC D;  2QM8 A;  1JCC A;  4NPE A;  1F1C A;  2K9Y A;  1I6D A;  2L91 A;  1WMK A;  2QJK C;  1FJP A;  2GA1 A;  2V7Q J;  3BRT B;  3PXS A;  1FZC A;  3HRN A;  3NTN A;  1NGM B;  1MFT A;  1LP1 A;  3A5T A;  2YIU C;  2N9Y B;  2G8Y A;  4I7Z C;  1RQU A;  1FZA A;  4C7N A;  2WPR A;  1W2E A;  3A7O A;  4L75 A;  1SFC C;  2A06 D;  3C2C A;  3H1L J;  3Q5R A;  3CCV P;  1KQS O;  2QIW A;  4N6J A;  3VRD A;  2FY8 A;  3GLM A;  2HV4 A;  3TGU J;  1GU5 A;  3MUD A;  1FCD C;  2YK3 A;  2KNC A;  4PV1 C;  1P84 D;  2ZON G;  4WY4 A;  3Q2Y A;  3SFE C;  4WWI A;  3O6Q B;  3PHL A;  2BAS A;  4L76 A;  1N9C A;  1KQL A;  1FI7 A;  1KB9 E;  2QSI A;  2NPS A;  2PCB B;  4N3Y B;  5AVW B;  2W27 A;  3CX5 I;  2E74 B;  4WY4 B;  4FB1 A;  1OVV A;  1RE4 A;  1NIR A;  3RK3 B;  1GL2 B;  1ZRT D;  3VMZ A;  5CIF B;  1IZN B;  1FOS E;  1T3U A;  1LT1 A;  3HUS B;  1BDD A;  2Q5U A;  1KV9 A;  4H0K A;  3CCM P;  2AEJ A;  4TLF A;  2IYP A;  1EZV G;  1X8Y A;  2QJY C;  2WIT A;  2BEZ F;  1YJ9 P;  2CE1 A;  1BSN A;  2Q1K A;  5CJ0 A;  1HF9 A;  4W80 A;  1RZ5 A;  2P67 A;  1SQP G;  1SLQ A;  1L0L D;  1EDJ A;  4ASV A;  1L4A D;  5CIG B;  1QVG O;  4WQ9 A;  1LC2 A;  1SQX D;  4WB4 A;  1TU3 F;  2E42 A;  3TDK A;  3JSV C;  3MGN A;  3EFF K;  5CID B;  4W7Y A;  1CCR A;  5M1B A;  3CXH E;  3L4O A;  3V6I A;  1DIQ C;  4EYY Q;  1Q82 Q;  3BAS A;  1N50 A;  2C1V A;  1FZC C;  3SVW A;  1OMI A;  3KDP B;  1N73 A;  5AW2 B;  2ITA A;  3TSI A;  3NWV A;  3OA8 A;  1GDT A;  1CED A;  1NH4 A;  5KKZ B;  1LNQ A;  3KYQ A;  4XFJ A;  1H8A A;  1Q81 Q;  2Y9Y A;  1L0L J;  1BE3 G;  3TNU A;  3D6Y A;  1OCD A;  5KAF E;  4D6T E;  1KQF B;  1UII A;  3ZOW A;  1NAY A;  4UB6 V;  2WVR A;  2H89 C;  3MUD C;  1FU1 A;  4AAN A;  4HB1 A;  1CRI A;  1NYH A;  4MN4 C;  3H6P A;  3HQ7 A;  4PV1 D;  1QN2 A;  1YTZ I;  2E74 C;  4WY4 C;  1M90 Q;  1FZF A;  2H7H A;  1NU1 J;  1R0Q A;  5CJ4 A;  1IRV A;  2BGV X;  3RK3 C;  1IQC A;  1VF5 C;  4HH2 A;  3G4S P;  1HUC A;  1NTM K;  1SQB E;  2NPS C;  4AQR D;  3P8C E;  1KFM A;  3CC4 P;  2ZT9 B;  3Q5P A;  1M8O B;  1K04 A;  1SQQ D;  1SQV K;  1AA0 A;  2AI5 A;  3HQ6 A;  1YBK A;  2CA3 B;  2KB7 P;  1RE4 C;  3L73 G;  4FA1 A;  2J58 A;  1N2D C;  1Y8A A;  2AXC A;  2OAR A;  5AW3 B;  5BU5 A;  4R4L A;  1MG3 D;  2KOG A;  1URQ A;  3CCU P;  4IOI H;  4WQ7 A;  5AW1 B;  1L0N K;  1GW3 A;  1GK6 A;  2ZJS E;  3PH2 B;  2HPC A;  4K3A A;  2FXO A;  2SPZ A;  1MZ9 A;  3U59 A;  3USS A;  2K9J B;  1M57 D;  3VOP A;  4DY9 A;  4JF7 A;  3FWL A;  4N78 E;  1SQQ J;  5KKZ C;  1DIP A;  1NTK D;  1I54 A;  2A06 G;  2N1T A;  1EQ7 A;  3L75 E;  2AXT H;  1KIL A;  4FA4 A;  2ORL A;  3F89 A;  2K1A A;  1CSV A;  1I8O A;  1JNM A;  3RL0 B;  5GTI H;  1N73 C;  2YKO A;  3CL3 D;  3H1I E;  4AX3 A;  1LWU A;  2E76 B;  2BCN B;  4JQ0 D;  5IY5 1;  1QX8 A;  1KB0 A;  4H0L B;  4RES B;  4P4Q B;  1KN7 A;  2KSJ A;  1T2K D;  1J1E C;  2LXB A;  3L70 E;  3GF3 A;  4XA4 A;  5AVZ B;  1NAF A;  3FWN A;  2WSF J;  1PV3 A;  2KSE A;  2YXQ B;  1H31 A;  2WPV B;  4WY4 D;  2WPS A;  3V4W A;  1YJW P;  2OYI B;  4L1Q A;  3LIE A;  3CC7 P;  2GIW A;  1GL2 D;  1RE3 A;  3H1H E;  1LFM A;  3RBZ A;  3RK3 D;  3CX5 E;  1VQN P;  4I1L A;  1CHH A;  3H25 A;  1DX7 A;  1USD A;  1XTG B;  4EID A;  1ZR2 A;  4GYD A;  4QAO A;  3CYT I;  3H1J E;  2FYU E;  1YJN P;  4I6M C;  2Z4E A;  2JDI H;  2PRR A;  5AVV B;  3AEB C;  2OGU A;  3AE6 C;  1H31 B;  1BGY D;  3AE3 C;  1YTC A;  5KLV E;  1CTY A;  3CX5 W;  4D6T G;  1FI9 A;  4PD4 H;  1GMJ A;  1CRC A;  1CO6 A;  1SQX G;  3M06 A;  1HJ0 A;  1JCD A;  1MUU A;  4NPD A;  1URQ C;  3KXD A;  5K5G B;  3JC2 2;  1RHZ B;  1YTZ T;  2I8F A;  2YXR B;  3L71 D;  3ZCF A;  2V7Q H;  2WT7 A;  2HOD B;  2MJZ A;  1JUN A;  1RQV A;  2KZJ A;  1M6Z A;  2MTA C;  2B12 B;  1S9K E;  3RL0 C;  1SQB G;  1Q86 Q;  1X22 A;  2JQR A;  1U74 B;  2JKV A;  5BU8 B;  1JM0 A;  5B5E E;  1FE6 A;  1L4A A;  2IBZ D;  2WPQ A;  1BGY J;  2AEM A;  2Q7C A;  1KIL C;  1P84 I;  2O1J A;  3HD7 A;  3GHG A;  4H0L C;  5EFW B;  1A02 F;  5CIE B;  2N3B A;  1NU1 K;  5AW5 B;  2ZYD A;  2MHM A;  1LT9 B;  4ASW A;  1L4A B;  1VQ5 P;  1GD2 E;  3WUT A;  2PCC B;  3HD7 B;  4KT0 J;  2HG5 D;  2P1J A;  3NFQ A;  1H32 A;  1B7V A;  4JYB A;  1GIW A;  2N9I A;  1IFJ A;  1KFN A;  2WSE J;  1ZP0 C;  1RH5 B;  3RBX A;  1ZLL A;  2GB8 B;  1CHJ A;  3TYY A;  3L75 G;  2ZT9 D;  3SWS A;  4JYC A;  3IR9 A;  1X9V A;  2CA4 B;  2M5A B;  3TYI A;  1C75 A;  1RE3 C;  3H1I G;  2V07 A;  3E1I A;  2R5D A;  5GTI E;  1QGK B;  3WFD C;  2RMZ A;  1DVH A;  2CXB A;  1NTZ K;  3PP5 A;  2BCC E;  1KC8 Q;  1NTM D;  3ZDM A;  1A8C A;  3E1R A;  1W5C T;  5DJQ B;  2ZVN B;  5L8R J;  3L70 G;  2YMK A;  1GDV A;  4U3F D;  2XKM A;  4IFF A;  2V08 A;  2DVH A;  3L72 E;  1RF0 A;  3A0B V;  1VQ8 P;  4KMG A;  3AEC C;  4H0J A;  1NTK G;  1KOR A;  4NPF X;  3WFE C;  3TK1 A;  2XU6 A;  3AE9 C;  4FA5 A;  4M3L A;  3WU2 E;  3RN1 A;  1IK7 A;  1S5L H;  2OZ1 B;  2R3C A;  3MP7 B;  1L0N D;  1A02 J;  1MKM A;  4Q5P A;  3BCC E;  1SS1 A;  1RZ6 A;  3ZOY A;  3MHV A;  1I55 A;  3RL0 D;  1HVV A;  3L4F A;  1Y9B A;  3H1J G;  5DJU B;  4C46 A;  1JY2 O;  5KAF H;  1L4A C;  3Q1M A;  3B8E B;  1NTM J;  3FXD A;  1BE3 E;  2OQQ A;  2E76 D;  3HD7 C;  1EC5 A;  2IZ0 A;  1YQ4 C;  1NKN A;  3HE4 B;  4H0L D;  1PP9 E;  1SQV J;  3H1K J;  1YEB A;  4PD4 E;  3TGU D;  1F1F A;  4U3F J;  4B86 A;  1LJ2 A;  2J59 M;  1HCM A;  1GTW A;  1GU2 A;  2P58 A;  3O20 A;  2HFE D;  1W5C E;  4R4M A;  4WVZ A;  1FOS F;  4Y28 J;  1JTH B;  3E7K A;  1IFM A;  2B87 A;  3AE2 C;  1L0N J;  3AE8 C;  2FWL A;  4HJG H;  1HTL C;  1EB7 A;  2Z5I A;  3KHU A;  1PGP A;  3M97 X;  4O1W A;  3V2R A;  2IFM A;  2P10 A;  5AVY B;  5CYT R;  2FYU K;  2JO1 A;  3L36 A;  3H1L E;  3O6Q A;  2NRG A;  3L73 E;  1BL9 A;  1KIL E;  2B87 B;  5KLV K;  5AVT B;  4AYC A;  5DJQ C;  2IFN A;  4IL6 H;  2W6A A;  1HWT C;  2O01 J;  1BCC E;  1J1D B;  3SSU A;  2LXC B;  5CIC B;  3OW2 O;  1AKK A;  3L71 G;  5CBO A;  1BDC A;  1QKS A;  1FS0 E;  2XNX A;  1KQG B;  1QVF O;  1GL2 A;  2WSC H;  1EXJ A;  3V5B A;  3CMA P;  3HUS A;  1USE A;  4H44 D;  1LTB C;  3WUV A;  2GUV A;  1NO4 A;  1S3J A;  5TJH A;  1VQ7 P;  3CI9 A;  4KHX A;  1VQL P;  1RF0 C;  4EIF A;  2A06 E;  3AE4 C;  3RMZ A;  2Y0E A;  1OFC X;  2N9B A;  4LLH A;  1NWQ A;  1AFO A;  1YI2 P;  2ZFC A;  3S4R A;  3ZOO A;  3NXS A;  1LTA C;  1E29 A;  2XV5 A;  2M3B A;  4UB8 H;  1OWA A;  3ZOX A;  1C2N A;  1T6A A;  1P84 E;  5APS A;  1U57 A;  3DP5 A;  2BEQ D;  1A56 A;  4W7Z A;  1MG2 D;  2BCC G;  2B10 B;  4PJ0 H;  2QEX P;  3A9F A;  2VRS A;  4WQ8 A;  3O0R C;  3A0H H;  3HD7 D;  2OTK E;  1CRY A;  2IYO A;  3WMM 0;  1C52 A;  1M1J A;  1DW0 A;  1T8Z A;  4GDO A;  3WUI A;  1IK9 A;  3PRJ A;  3GF7 A;  3L72 G;  3CCL P;  4EIJ A;  1RAP A;  3G3Z A;  1LTJ B;  1HJ4 A;  1NU1 D;  1ZRT E;  2H88 C;  1EDL A;  1CXA A;  3CX5 H;  1JEK A;  1CSB A;  3I5C A;  1M1J B;  451C A;  3BCC G;  4PW9 B;  1S5L E;  1YIC A;  4DZO A;  1CRG A;  2H8P D;  1J1D C;  1ZW0 A;  3LID A;  3WFB C;  5GTH E;  3P7K A;  2BLF B;  1IZL 0;  2WQY C;  2YMY A;  3P32 A;  5TIS H;  1L0L E;  5DF5 A;  1T2K C;  3FX0 A;  2Y0D A;  1SQP K;  1NNO A;  1I8P A;  1SQX E;  1PP9 G;  1JMB A;  3KZI H;  2C8S A;  2V4H A;  1C2R A;  3M0D A;  1H89 A;  2YNY A;  3EFG A;  3LW5 H;  4I2L C;  1C6R A;  2BH4 X;  2B0Z B;  1N7S B;  2FBW C;  2IBZ I;  1GL2 C;  1LTS C;  3S1K A;  4LJI A;  5APY A;  3CWB D;  2FYN B;  2R44 A;  2RH0 A;  5E79 E;  3HUS C;  1HGZ A;  2R5B A;  2I1J A;  1NTZ D;  5B5E H;  1AQ5 A;  4OVN F;  4U7J A;  1HH0 A;  3AE1 C;  1R8E A;  2KIK A;  1H33 B;  4EIE A;  1KIB A;  3L4M A;  2IDB A;  3PXW A;  5AW4 B;  3W68 A;  2QE7 H;  2AIU A;  2M8R A;  3H1L G;  5APV A;  4RSZ A;  1SQB J;  2Y9Z A;  2XTS B;  1FJK A;  3AE7 C;  5AW7 B;  4GKG A;  1L9B C;  2PFX A;  2AXT V;  1PZQ A;  1FJ0 A;  3VNW A;  2JP3 A;  3VMY A;  1H1O A;  2FXM A;  4BRY A;  1FZB A;  1I5T A;  2K9J A;  1FOC A;  1BCC G;  5GTI V;  3ZIY A;  4IL6 E;  4GIF A;  3L74 J;  5DFS A;  4H13 B;  3I56 P;  3B4S A;  4ZKP A;  351C A;  1COT A;  2W6J H;  3CWB J;  2R3S A;  2L4D A;  3C9I A;  1NTZ J;  1M1J C;  2XZR A;  2B4Z A;  4XE5 B;  1QYZ A;  4BRY B;  1KTM A;  1CHI A;  2GC7 D;  1SQQ E;  1ZXG A;  1ZR4 A;  3C8V A;  1IFI A;  4O9B A;  1KD1 Q;  2KXP B;  4O1Q A;  5CCG C;  3IN6 A;  2B88 A;  2JR8 A;  1HBW A;  3D71 A;  3Q5S A;  3NBS A;  3X39 A;  2QA4 P;  1ETP A;  4AUW A;  3W67 A;  4UB8 E;  2M0B A;  3N4X A;  2ZXE B;  1EXI A;  2A45 I;  3KPE A;  3QWO C;  1DW1 A;  2FRC A;  2NZ2 A;  2GM4 A;  4PJ0 E;  2OYI A;  3H1I J;  1M70 A;  2H43 A;  1YNR A;  3A0H E;  3TF5 A;  4EIC A;  3M0D C;  1GJQ A;  2ZT9 C;  1NTK E;  4XYD B;  3WU2 H;  2K3R A;  1PPJ D;  3L70 J;  1G2C B;  2KK7 A;  3R4Y A;  1C7M A;  4ZNC A;  3WUU A;  5H2F H;  3Q3D A;  2N18 B;  1OX3 A;  1X0T A;  3ITK A;  1AOQ A;  1HJ5 A;  2VHD A;  1L0L G;  1SVF A;  2B9B A;  2HOD A;  5KAI H;  3HTK A;  5TIS E;  1R5S A;  3H1H J;  1KYO D;  3CCJ P;  4YE1 A;  2CPB A;  2ZOO A;  1J2J B;  1GZL A;  2A45 H;  4RKU J;  2FYU J;  3K5B A;  2Q3E A;  3T97 A;  3KZI E;  3U1C A;  4XXL A;  2RN0 A;  3I55 P;  5KLV J;  2D2C B;  1CSU A;  3H32 A;  2YO3 A;  2C9L Y;  3HTK B;  3MK7 B;  4IFM A;  1IJD B;  4H44 B;  3RK3 E;  1PGO A;  1FHB A;  4RO0 A;  1I6E A;  3DMI A;  3G9R A;  1KB9 I;  4YXW H;  2JTI B;  2K37 A;  3T97 B;  2P2U A;  1LT9 A;  1M7L A;  1OW6 A;  2KYV A;  1XTC C;  2E76 C;  1FDO A;  1BGY E;  2M3E A;  3H32 B;  5APW A;  4N0K A;  2EXV A;  2KLU A;  1CRJ A;  1E2R A;  3MZW B;  1DD4 A;  4MU8 A;  2KS1 B;  4JPZ B;  3IFM A;  5CCG D;  5DJT B;  1CSX A;  1SQX K;  4L3H A;  1QL2 A;  1S2E A;  1VQM P;  2Z5H A;  1M60 A;  3O5C A;  3PTZ A;  3L71 E;  3V4Q A;  1HJ3 A;  4FA9 A;  3VYI A;  3N7N A;  3VMA A;  1S4X A;  3B5N D;  2JWA A;  2M5A A;  4OWF A;  4OH8 B;  1CTJ A;  2OYI C;  2Q6Q A;  1N7S D;  3M9B A;  5AW6 B;  1EZV D;  5APU A;  1MZ4 A;  1OZH A;  1S72 P;  2ZYG A;  5AW0 B;  1SQB K;  2E75 B;  2OTL P;  5KJ7 D;  3MTU E;  3WFC C;  1SQP D;  1SQQ G;  2IBZ E;  2N18 C;  1IFN A;  1NOH A;  3VTP C;  2KP8 A;  1VQO P;  1GK4 A;  1P84 H;  2E5Y A;  5APT A;  1S5L V;  3SJL A;  1JY3 P;  1JY3 N;  2C1D A;  1FZG A;  1YIQ A;  5KAF V;  2YIU B;  4H13 D;  1AJY A;  3MK7 C;  2W6B A;  4I7Z B;  2OZ1 A;  4H44 C;  1SQV D;  3H1K D;  1DEE G;  5APQ A;  4V2K A;  2XDJ A;  3VP9 A;  1R5L A;  1SFC B;  3II6 A;  1SQP J;  2IX7 C;  3AED C;  3RL0 g;  2C1D B;  3EWK A;  1PFI A;  2Q3I A;  1JY2 P;  1N15 A;  1JY2 N;  1FZE A;  3NMD A;  1COR A;  4JBZ A;  2N3Y A;  3HE4 A;  2W83 C;  4QMA A;  155C A;  1VQ6 P;  1LMS A;  1Y47 A;  2QG4 A;  5GTH H;  1OW7 A;  2WMM A;  5KLI B;  1QEX A;  1LT9 C;  3CCQ P;  2C2C A;  5H2F E;  2KUB A;  1NTM E;  3CCS P;  3SWK A;  1JTH A;  2POH A;  2CE0 A;  5KAI E;  2AEF A;  4RJT A;  2D0S A;  2QRX A;  4U3F E;  2E75 C;  2P7J A;  1K73 Q;  2G3A A;  1IFP A;  4IL6 V;  1BE3 J;  2HR3 A;  3PJS K;  3V2P A;  2I8D A;  1NTK K;  1HRO A;  3L35 A;  1U75 B;  5E79 H;  3MD0 A;  1CXC A;  3EQ2 A;  1CCH A;  2L5G B;  3GMA A;  1NVO A;  1AYG A;  1RF1 A;  2BH5 X;  1L0N E;  1BSH A;  2DGE A;  1WEJ F;  1ZZH A;  3BAT A;  1HH7 A;  4FAV A;  4A7P A;  4EOT A;  4L3G A;  3SLE A;  3G6E P;  1BGY G;  1C6O A;  3VMX A;  2C9N Y;  5B66 H;  2GC4 D;  5CCH D;  4EI2 A;  1N8R Q;  1KB9 D;  1VPC A;  1X79 B;  1RF1 B;  1VDF A;  2KZI A;  2YO2 A;  3TGU E;  1U7J A;  1YFC A;  1VQ9 P;  4UB8 V;  1QL3 A;  4AAM A;  4WQA A;  3L73 J;  1OAE A;  2WTY A;  1FZC B;  5CHX A;  2WSS H;  3AEE C;  2QVA A;  1LP1 B;  2Y0C A;  3OCD A;  1KZU B;  2D2C D;  3KQG A;  1GQ1 A;  1S1C X;  4PJ0 V;  2E43 A;  1BCC J;  2YCC A;  4C7N B;  1CIF A;  2ZVO B;  1HGV A;  3A0H V;  3VP8 A;  1K3H A;  2ZXX A;  1VQ4 P;  1YIJ P;  5KLI C;  2PP6 A;  2IBZ G;  2O1K A;  1VQK P;  4C7R A;  1HJB A;  3CC2 P;  3SXT A;  2LIT A;  2QJP B;  3OCD B;  4GOF A;  1CYI A;  5AVS B;  3CP5 A;  2PAC A;  2KNC B;  2K88 A;  1IO3 A;  2OYH A;  1N7L A;  3CXH D;  3HQ8 A;  4HYT B;  3OA7 A;  4OGQ D;  3CME P;  3D0W A;  3HE5 A;  1VF5 B;  2W90 A;  1U7M A;  3IF4 A;  1LTJ A;  5TIS V;  2B11 B;  3ORV A;  2NPS B;  1NHL A;  1SP4 A;  2OYH B;  2GUS A;  2WSF H;  4ZMD A;  3IAO A;  4K35 A;  2JJL A;  3KZI V;  2IPP A;  1ZME C;  4GOD A;  2E75 D;  1IO4 A;  3HE5 B;  4D6T D;  3PXT A;  3AE5 C;  1LS9 A;  1YEA A;  5CCG A;  1M1K Q;  1PGQ A;  3BVH A;  1RF1 C;  3BRV B;  5CMZ A;  1CYC A;  1CZQ A;  2C1U A;  2OYO A;  1FBM A;  1KYO I;  2C0W A;  1FDM A;  1CYJ A;  5B5E V;  3B5N A;  3CLQ A;  1NTM G;  1H0T A;  1N7S A;  5BVZ A;  1CIG A;  3CXH W;  1SQB D;  4PWA A;  3U1A A;  1N90 A;  1GU4 A;  5KJ7 A;  3P8C D;  1SQV G;  3H1K G;  5C0Z A;  2PGD A;  1WVE C;  4U3F G;  5C39 A;  2A45 G;  1H33 A;  3B5N B;  3L74 D;  4D6T J;  1LTG C;  2YQB A;  1SFC D;  2RKL A;  4LC1 A;  4ZKU A;  1H0T B;  1SQX J;  1CRH A;  1NU1 E;  1CW5 A;  1CIE A;  1N73 B;  2QJP C;  3OA8 B;  5C9M A;  1W2L A;  4GT1 A;  1CI6 A;  2LR2 A;  5EXQ A;  1L0N G;  4GOE A;  3RGU A;  2N9J A;  4DJG A;  4AAO A;  3A0B E;  1OXZ A;  3TNU B;  5B6Q A;  1JO5 A;  1KYO H;  3R2P A;  2CK3 H;  3RK2 B;  2DW3 A;  1J1E B;  3A3Y B;  3UIA A;  1PGJ A;  3CCE P;  5B66 E;  1CI6 B;  1S6V B;  1AV1 A;  3WC8 A;  1RAQ A;  5AUR A;  3TGU G;  1K8A Q;  2OYH C;  4N78 D;  4DT0 A;  1EZV I;  1CTZ A;  1EDI A;  4WQD A;  3L75 D;  1UIX A;  3L74 E; 
#chains in the Genus database with same CATH homology
 1CSU A;  1GKS A;  1NIR A;  3WFE C;  1ZRT D;  5CIF B;  3MK7 B;  4FA5 A;  1A2S A;  3RN1 A;  1KV9 A;  2OZ1 B;  4WQC A;  2LIR A;  4H0K A;  4K3I A;  1L0N D;  4Q5P A;  1FHB A;  3H1I D;  1I6E A;  3DMI A;  1RZ6 A;  3ZOY A;  1I55 A;  2JTI B;  1QL4 A;  2CE1 A;  1K3G A;  1RZ5 A;  1L0L D;  1DW2 A;  3CU4 A;  4JCG A;  5CIG B;  4N0K A;  3RN0 A;  4WQ9 A;  2EXV A;  1LC2 A;  1VYD A;  1CRJ A;  1E2R A;  1SQX D;  4MU8 A;  1LC1 A;  3L70 D;  3TDK A;  1YEB A;  3WU2 V;  5CID B;  3TGU D;  1CSX A;  1CCR A;  1F1F A;  4L3H A;  3L4O A;  1HCM A;  1M60 A;  3O5C A;  3PTZ A;  1DIQ C;  1GU2 A;  4GED B;  3O20 A;  1HJ3 A;  4FA9 A;  3VMA A;  5H2F V;  1N50 A;  2C1V A;  2JWA A;  3SVW A;  1CTJ A;  3H1H D;  2FWL A;  3CX5 D;  3NWV A;  1EZV D;  3OA8 A;  5KAI V;  1MZ4 A;  1CED A;  1EB7 A;  3KHU A;  3M97 X;  4O1W A;  5KKZ B;  3H1J D;  2FYU D;  3WFC C;  1E8E A;  1SQP D;  2N18 C;  1KX2 A;  5CYT R;  5KLV D;  1OCD A;  1BL9 A;  2ZXY A;  5DJQ C;  3ZOW A;  4UB6 V;  4AAN A;  1S5L V;  1CRI A;  3SJL A;  3HQ7 A;  5CIC B;  1QN2 A;  1AKK A;  1L9J C;  1QKS A;  2C1D A;  4EDF A;  1R0Q A;  1IRV A;  2BGV X;  1YIQ A;  4NFG B;  1IQC A;  5KAF V;  2YIU B;  2ZZS 1;  3MK7 C;  1HZV A;  2OZ1 A;  1SQV D;  3H1K D;  4V2K A;  5TJH A;  1SQQ D;  2AI5 A;  4EIF A;  2C1D B;  3HQ6 A;  4J20 A;  2CA3 B;  3RMZ A;  2Y0E A;  1N15 A;  4FA1 A;  3ZOO A;  1E29 A;  1COR A;  1MG3 D;  2N3Y A;  2KS1 A;  1CNO A;  155C A;  1DVV A;  1IRW A;  1LMS A;  1AOF A;  3ZOX A;  2QG4 A;  1C2N A;  4WQ7 A;  5KLI B;  3DP5 A;  1A56 A;  3PH2 B;  1MG2 D;  2O3J A;  2C2C A;  2B10 B;  1JDL A;  3A9F A;  4WQ8 A;  3O0R C;  2CE0 A;  1CRY A;  1C52 A;  1CIH A;  1DW0 A;  3DR0 A;  2K9J B;  4RJT A;  2D0S A;  4DY9 A;  3FWL A;  3WUI A;  3PRJ A;  4IL6 V;  1NTK D;  1I54 A;  1KYO W;  4FA4 A;  1RAP A;  2ORL A;  3ZBM A;  1HJ4 A;  1HRO A;  1NU1 D;  1CSV A;  1U75 B;  3VYM A;  1CXA A;  1CXC A;  1I8O A;  1CCH A;  1AYG A;  2BH5 X;  1CC5 A;  451C A;  2DGE A;  4PW9 B;  1WEJ F;  4Y5R A;  1YIC A;  4AX3 A;  1ZZH A;  1CRG A;  3WFB C;  2BCN B;  1HH7 A;  4FAV A;  4A7P A;  4L3G A;  2BCC D;  1IZL 0;  2BLF B;  3SLE A;  5IY5 1;  1HRC A;  1KB0 A;  5DF5 A;  1C6O A;  1FI3 A;  2Y0D A;  4P4Q B;  3O1Y A;  1NNO A;  2GC4 D;  1KB9 D;  3NBT A;  5CIB B;  1I8P A;  1KX7 A;  2C8S A;  3JBT B;  1C2R A;  1YCC A;  2C9X B;  1YFC A;  4WQB A;  2QJK B;  3L72 D;  4UB8 V;  1C6R A;  1QL3 A;  4AAM A;  5GTH V;  1H31 A;  4WQA A;  2BH4 X;  2B0Z B;  1OAE A;  1H32 B;  1NMI A;  2Y0C A;  3OCD A;  1H9X A;  4LJI A;  1GQ1 A;  4L1Q A;  1DW3 A;  3CWB D;  4PJ0 V;  2FYN B;  2GIW A;  1LFM A;  3BCC D;  2YCC A;  3GG2 A;  1CHH A;  1CIF A;  2D0W A;  1NTZ D;  3A0H V;  4EID A;  1K3H A;  1C6S A;  4GYD A;  4QAO A;  3CYT I;  1H9Y A;  1H33 B;  4EIE A;  1KIB A;  1HZU A;  1BE3 D;  3L4M A;  1H31 B;  1BGY D;  3PXW A;  1YTC A;  1CTY A;  2AIU A;  3CX5 W;  3SXT A;  2LIT A;  1FI9 A;  4RSZ A;  2BPB B;  1CRC A;  2QJP B;  2XTS B;  3OCD B;  1CO6 A;  1CYI A;  1L9B C;  2AXT V;  1DT1 A;  4AAL A;  1PP9 D;  4PD4 D;  3CP5 A;  1FJ0 A;  3VNW A;  2PAC A;  2KNC B;  3PLN A;  1CSW A;  1H1O A;  5E79 V;  1IO3 A;  1I5T A;  1FOC A;  3CXH D;  3HQ8 A;  3ZIY A;  5GTI V;  2I8F A;  4WQE A;  3L71 D;  3ZCF A;  5DFS A;  1NML A;  351C A;  1COT A;  3RLM A;  1M6Z A;  1DII C;  5TIS V;  2B11 B;  3HQ9 A;  3ORV A;  2L4D A;  2MTA C;  2B12 B;  5B66 V;  2B4Z A;  1QYZ A;  2JQR A;  3GW6 A;  1J3S A;  1U74 B;  1CHI A;  2GC7 D;  3KZI V;  2IBZ D;  5CIH B;  3H1L D;  4D6T D;  3PXT A;  1LS9 A;  3L73 D;  4FAN A;  1YEA A;  4O1Q A;  2ZBO A;  3NBS A;  5CIE B;  2QJY B;  2N3B A;  3X39 A;  1BCC D;  1CYC A;  1ETP A;  2C1U A;  2MHM A;  1F1C A;  1I6D A;  2L91 A;  1CYJ A;  5B5E V;  2PCC B;  3PXS A;  1H32 A;  1DW1 A;  1CIG A;  2FRC A;  3CXH W;  1B7V A;  1SQB D;  4PWA A;  1M70 A;  2N9Y B;  1N90 A;  1GIW A;  2N9I A;  1YNR A;  3TF5 A;  5C0Z A;  4EIC A;  1WVE C;  1GJQ A;  1CHJ A;  2GB8 B;  1H33 A;  2A06 D;  3C2C A;  3L74 D;  2YQB A;  4XYD B;  3SWS A;  1PPJ D;  1CRH A;  3VRD A;  2CA4 B;  1CIE A;  3TYI A;  1C75 A;  2HV4 A;  3OA8 B;  5C9M A;  1W2L A;  1C7M A;  5EXQ A;  1FCD C;  2YK3 A;  2V07 A;  2N9J A;  3WFD C;  1P84 D;  4AAO A;  2ZON G;  2RMZ A;  1DVH A;  2CXB A;  2N18 B;  3ITK A;  1AOQ A;  1HJ5 A;  2VHD A;  5B6Q A;  1NTM D;  3PHL A;  1A8C A;  1N9C A;  1W5C T;  1FI7 A;  1KYO D;  4YE1 A;  5DJQ B;  2PCB B;  2ZOO A;  1S6V B;  1GDV A;  3WC8 A;  1RAQ A;  5AUR A;  2Q3E A;  4U3F D;  2V08 A;  4XXL A;  2DVH A;  2RN0 A;  3A0B V;  1CTZ A;  4KMG A;  4H0J A;  4WQD A;  3L75 D;  4FB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...