4PD4D

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
248
structure length
248
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 62
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4pd4D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4pd4D02
2C8SA 4O1WA 1DVVA 1CRIA 2BH4X 2AI5A 3ZIYA 2QJYB 1OAEA 1FI3A 1SQBD 3VRDA 3HQ8A 2EXVA 5B5EV 1NTMD 1GQ1A 2ZONG 3ZOWA 3HQ6A 4H0KA 1R0QA 1CXCA 2C2CA 1PP9D 1IQCA 5CIFB 1L0LD 3OCDA 3L4MA 1NNOA 4H0JA 1HJ4A 1OCDA 5CIBB 2D0SA 2ZXYA 1N15A 4A7PA 2GIWA 4Q5PA 1HH7A 1C2NA 1DVHA 3SLEA 1SQQD 1CHJA 3RN1A 1KX7A 1CIEA 1H33B 2B0ZB 3BCCD 2B12B 1CSXA 1DW0A 3CWBD 3VNWA 1MZ4A 1QKSA 1NTKD 2B10B 1DW3A 1H32A 1KB0A 2C1VA 2QJKB 1H32B 5C9MA 1WEJF 1RZ5A 2K9JB 1YEAA 2N18C 3SJLA 3CU4A 1NTZD 2FRCA 3ZOXA 1I54A 2CA4B 3A0HV 1I6EA 2L91A 5CYTR 1IRWA 1LC2A 3OCDB 2PACA 5CIHB 2I8FA 2Y0CA 2ZZS1 2LIRA 2JQRA 1A56A 4FANA 3GW6A 1DW1A 3CXHW 5KLVD 4EIDA 2LITA 4PJ0V 1NU1D 2ORLA 1C6OA 2B4ZA 5KLIB 1FCDC 4DY9A 3PTZA 1MG2D 1DIIC 5AURA 1LC1A 2PCBB 2XTSB 2D0WA 2C9XB 3TF5A 4J20A 4YE1A 1HRCA 3DMIA 2AIUA 2BGVX 1YFCA 3CYTI 1K3GA 1C6RA 3ZOYA 2BCNB 3DP5A 4WQ9A 3M97X 2MTAC 4P4QB 3NWVA 1M60A 2BCCD 5DJQB 3PLNA 3RN0A 4D6TD 4LJIA 3FWLA 1CEDA 1SQVD 1BGYD 3CX5W 3C2CA 1WVEC 2YCCA 4WQCA 4FA4A 1HROA 1AOQA 1I5TA 2Y0DA 2OZ1A 4PWAA 4AAOA 4N0KA 2CE0A 1CIGA 1DW2A 3ORVA 5EXQA 1U75B 1AYGA 2GB8B 1E8EA 1GIWA 1SQXD 1H9XA 1C7MA 5CIGB 1BE3D 1CRJA 1H31A 1F1FA 1W5CT 1N50A 1GU2A 2O3JA 5TISV 3WU2V 1K3HA 3A0BV 1YEBA 4FA5A 2N9YB 5B66V 1RAQA 3PHLA 1FJ0A 1FHBA 5DJQC 3KHUA 2MHMA 3CXHD 1I8PA 1M70A 4AAMA 2JWAA 3H1LD 2BPBB 1M6ZA 3L75D 3VMAA 1CNOA 2BLFB 2A06D 3OA8B 2C1DB 1LMSA 3NBTA 3SVWA 1CIFA 1J3SA 1N9CA 1CYJA 1CHIA 3KZIV 1YCCA 1CRGA 3O0RC 3L71D 1DT1A 1C2RA 4FA9A 2N18B 4EICA 3L74D 4UB6V 3RMZA 2DGEA 4WQDA 1FOCA 5E79V 1IZL0 3MK7C 3H1JD 1DIQC 2N9JA 2PCCB 2YIUB 2YQBA 1SQPD 4RSZA 4L1QA 1KYOW 4Y5RA 1CCHA 1AOFA 1HJ3A 1CIHA 3PXTA 4MU8A 1S6VB 3O20A 1GKSA 3WFDC 3VYMA 1JDLA 1NMIA 2N3YA 5CIEB 2RN0A 2GC4D 1I55A 2RMZA 2YK3A 4AALA 1E29A 155CA 2N9IA 2AXTV 2Y0EA 1PPJD 2V07A 1A2SA 4EDFA 3WC8A 1H9YA 3ZOOA 1YNRA 3O1YA 3TGUD 1KIBA 1LFMA 5GTHV 4K3IA 1KYOD 5H2FV 1N90A 4XXLA 4L3HA 3MK7B 1CC5A 3ITKA 2FYNB 1GJQA 3CP5A 1HJ5A 2FYUD 1YICA 4PW9B 1EZVD 1VYDA 4FA1A 1CTZA 3GG2A 4L3GA 4NFGB 4WQ7A 4AANA 4KMGA 4PD4D 1I8OA 2Q3EA 3WFCC 1QYZA 3ZCFA 5CICB 1YTCA 1CSUA 5DF5A 1P84D 3PH2B 3PRJA 3SXTA 1B7VA 1CYIA 3X39A 5KAFV 1H1OA 1COTA 2B11B 3WUIA 1CHHA 1IO3A 3O5CA 1S5LV 2CXBA 2GC7D 3TYIA 2KS1A 1C6SA 1CORA 3TDKA 2ZBOA 3L70D 2C1UA 1EB7A 2CA3B 1E2RA 3PXSA 5KKZB 2KNCB 2N3BA 1L9JC 1I6DA 1MG3D 1BCCD 5B6QA 1C52A 4WQEA 1CSVA 2BH5X 5GTIV 3PXWA 4XYDB 1CSWA 1FI9A 3WFBC 1C75A 2C1DA 3HQ9A 1ZRTD 1F1CA 451CA 4GYDA 1NMLA 4UB8V 4IL6V 5TJHA 4FB1A 1GDVA 3NBSA 1U74B 2HV4A 1FI7A 1ETPA 2V08A 3SWSA 1CRHA 1CXAA 4O1QA 4V2KA 3HQ7A 1HZVA 3H1KD 4QAOA 3OA8A 1HZUA 5DFSA 3L73D 1QL4A 2QJPB 3CX5D 4JCGA 3DR0A 2FWLA 1BL9A 1HCMA 2DVHA 1H31B 1CRYA 4RJTA 4WQAA 4WQBA 1KB9D 1QN2A 3WFEC 1H33A 1L0ND 1CYCA 2JTIB 351CA 4FAVA 1CTYA 2L4DA 1AKKA 4EIEA 3H1ID 1QL3A 1CO6A 2CE1A 1RZ6A 5KAIV 1CTJA 1CRCA 2ZOOA 1RAPA 3L72D 4EIFA 1LS9A 3H1HD 1IRVA 2QG4A 1A8CA 5C0ZA 1ZZHA 1NIRA 5CIDB 3ZBMA 1CCRA 4AX3A 2OZ1B 4WQ8A 3JBTB 5IY51 1W2LA 4GEDB 1L9BC 3A9FA 4U3FD 3RLMA 2IBZD 1KX2A 1YIQA 3L4OA 2VHDA 1KV9A
chains in the Genus database with same CATH superfamily
1E79H 2WPSA 4HH2A 2QJYC 2QVAA 4O1WA 1N7SA 2WPQA 2AI5A 5AW1B 4W7YA 4DOJA 1OAEA 3SWFA 1FI3A 3AEBC 2HODB 1S5LX 2OYIA 3KZIE 3P7KA 1W5CE 4H0LC 2GUVA 4XA4A 1NKNA 1S9KD 3L74G 3B5NB 1EZVG 2C2CA 1N7SD 3Q5PA 5CIFB 3RGUA 2FYUG 5C39A 2K1AA 1LTJA 4NPEA 2D0SA 1YI2P 2ZXYA 1FU1A 4A7PA 4Q5PA 1C2NA 1JTHA 1WMKA 3SLEA 3L75G 1YJ9P 1U57A 1CIEA 1ZRTE 3M9QA 3NFQA 1EZVE 1CSXA 3FX0A 1H8AA 1NTKD 1DW3A 3AE6C 1H32A 2A45G 2C9NY 2H88C 2K9JB 4IFMA 2N18C 5APYA 3SJLA 2LKMA 2E5TA 3BCCE 1YBKA 1VL2A 2D2CC 2WSCJ 1M7LA 1IZNB 4L75A 2AXTE 5CIHB 2BCCJ 2W6BA 1HBWA 3CXHH 2JQRA 1DD4A 3GW6A 4N6JA 1L0NG 3L70E 1J2JB 3F5HA 2N1TC 1FDMA 1PGPA 1LTTC 4PV1D 1FCDC 4DY9A 3CWBJ 1OXZA 1MG2D 1SQBE 3H1HG 1CW5A 1DIIC 1P84I 3CL3D 3L73G 2BCCG 2A06G 3A0BE 4ZKUA 3AE4C 5CCHA 2D0WA 2C9XB 1FJKA 2FYUE 5KJ7C 2BGVX 3I5CA 5APXA 2HLOA 1L0NE 3CYTI 2QJPC 2HYNA 4U3FE 2LXCB 4PJ0E 2MTAC 3NWVA 3WU2H 3Q5RA 4L74A 4D6TD 2D2CB 3AEDC 1CEDA 1SQVD 3CX5W 4WY4A 1S5LH 2YCCA 4ASVA 2IYPA 3KDPB 1G2CB 4MN4C 3IF4A 3TGUE 4N78E 1NU1E 1U75B 1KB9H 3K5BA 3EFGA 4JYBA 1H9XA 5CBNA 1JY2P 5CIGB 1L0LK 1FBMA 1PFIA 1F1FA 1W5CT 1GU2A 3P8CD 4H13C 1GL2B 2R44A 3WU2V 3V2NA 1GL2A 2Q6QA 1YEBA 3KYQA 1Q90D 1FJ0A 1FHBA 1S5LE 1H0TB 1I8PA 1SQPJ 5AVZB 3RL0g 3H1LD 3I56P 4OGQC 2A06D 1VQ4P 3FGAD 2M3BA 3KZIH 2HODA 1CHIA 2J5UA 1NO4A 1PGJA 1KILC 5APVA 1RF1C 3A0HH 3CCQP 1DT1A 1FDIA 2N18B 3L74D 5KLIC 1OX3A 3H6PA 4UB6E 3RMZA 4WQDA 1FOCA 1Q81Q 2E76B 1H0TA 1W2EA 2FFDB 1N86A 1BCCE 5H2FH 2YIUB 1HGZA 3SFDC 2W90A 5CCGA 4KHXA 3AEAC 4RO0A 5KLVJ 2B88A 1HJ3A 1RHZB 1CIHA 3PXTA 4MU8A 1SQPG 1S6VB 3A0HE 4R4MA 2N3YA 4ASWA 4TLFA 2RN0A 3NMDA 4U7JA 3CCVP 2YK3A 1N8RQ 1D7MA 2AXTV 2E76D 1ZR4A 4OVNF 3AEGC 3T97B 3Q2YA 1YNRA 2E75B 3G71P 1SQQG 3WUTA 2FYNC 4YXWH 4WY4B 1KQFB 2IFMA 5H2FV 3CP5A 3CC4P 2HPCA 3L37A 2OGUA 2OQQA 2FKWB 1EZVD 1LTJC 1KYOE 4WQ7A 1L4AC 3LW5H 3HUSA 1P84E 4KMGA 1NTKJ 2OTKE 1I8OA 2Q3EA 1LTJB 3H1IJ 1JNMA 1AQTA 5GTIE 3O6QA 5GTHE 1MFTA 1HWTC 1CSUA 1VQ6P 4RKUJ 3L74J 1P84D 5B5EE 1M8OB 2M3EA 3CMEP 2M0BA 3R2PA 1MZ9A 1H1OA 2B11B 3WUIA 1NVOA 1IO3A 1S9KE 1BCCJ 3O5CA 1GL2C 2WSSH 2OYHC 2CXBA 1WRGA 4OH8B 3NXSA 1GDTA 2ZBOA 1VQNP 1SVFA 3C9IA 3MP7B 4WQEA 1FZCB 1EDKA 1LT1A 3WMM0 1BCCG 4XYDB 1ZW0A 1FI9A 2A45I 3VP9A 4UB8E 1JMMA 4I2LC 5AVVB 1F1CA 4IL6V 2H43A 5TJHA 1L4AA 1VF5C 1GDVA 1U74B 1AA0A 1FI7A 1ETPA 1EXIA 4KJMA 1NTZE 3B4SA 1HZVA 2KIKA 5CJ0A 3GHGC 1AVOA 2OYIC 1NHLA 3LIEA 1L0LJ 1QL4A 2W27A 2FWLA 1BL9A 2Q9IA 2DVHA 1IFIA 4GKGA 1JMBA 1LWUC 4WQBA 3Q3DA 1A02J 2LR2A 1H88A 3WFEC 5AVWB 1H33A 3KXDA 3SWYA 351CA 1JM0A 4RESB 1FZCC 2H8PD 5APSA 3H1ID 1VQ8P 1YQ3C 1CO6A 5KAIV 5CMZA 3TNUA 2ZOOA 1PGQA 4WY4D 1LS9A 3G9RA 3H1HD 1IRVA 1LNQA 3RL0D 5C0ZA 1ZZHA 2QM7A 1ZOYC 3H1LE 2A45H 1ZLLA 3ZBMA 5CCHD 4AX3A 1BE3E 5IY51 1AQ5A 4D6TJ 3A9FA 2XNXA 3WUVA 2ZT9D 3L4OA 1HJBA 1JUNA 5AW5B 2FXOA 1MV8A 2ZYDA 4JBZA 2BH4X 3ZIYA 2WT7B 2WSFJ 3JC22 2JO1A 3VRDA 1RF0C 3HQ8A 1KZUB 3U59A 1U7JA 1ZN5A 4OWFA 2ZONG 3ZOWA 1PP9D 3S4RA 1L0LD 1NNOA 4EOTA 1OCDA 1SQBG 3TNUB 3BCCJ 3B5NC 1N15A 1OW7A 3HE4B 1DVHA 3L4FA 1GTWA 1S4XA 4PJ0H 2B0ZB 3VMXA 2B12B 1DEEG 1IO4A 1SQXK 2H7HA 1MFZA 4IL6X 2ZYGA 1KB0A 2QJKB 2FYUK 1WEJF 3CX5H 2KSEA 3M06A 2PFXA 3L70J 3USSA 1QGKB 2HR3A 1NTZD 2FRCA 3ZOXA 1JOCA 5AW8B 4GIFA 1YHQP 2CA4B 3A0HV 1X79B 3W68A 2R5DA 2QSIA 1EQ7A 2L91A 1LTAC 2KK7A 2ZZS1 2WWWA 2LIRA 3FXDA 1A56A 1RF0A 1Z56A 1OFCX 2IZ1A 2LITA 4PJ0V 3V6IA 2ORLA 2B4ZA 3AE2C 5KLIB 3PTZA 1FS0E 2D2CD 3AE7C 2I1JA 1KN7A 3HE5A 5BU8B 3RK2B 3RK3C 4YE1A 1HRCA 1KQGB 1IK7A 1VPCA 2BCNB 3HD7A 2PRRA 2KZIA 2N9BA 1N73B 2KOGA 2IZ0A 4WQ9A 1G1JA 1PP9E 3H1JJ 1U7MA 5CHXA 4ZNCA 3PLNA 2GUSA 3RN0A 1IFJA 2AXCA 1M1JC 3GF3A 3CLQA 1BGYD 1M1JA 1QL1A 5CCGC 2E75C 1Q7YQ 3HD7C 3RK2D 1HROA 1CSBA 1VQLP 1RQUA 1I5TA 2ZYAA 4PWAA 2ZVOB 2FBWC 2J58A 3ORVA 5EXQA 5AVUB 1S3JA 1EXJA 1NJIQ 2OTLP 3M0DC 3S9OA 1GIWA 5H2FE 1SQXD 2ZXXA 2Y9ZA 1OW8A 4H0LD 1BE3D 1CRJA 4QMAA 1N50A 2WSEJ 2O3JA 2W8ZA 1YJNP 2IFNA 1J1DB 3QH9A 3EQ2A 4JQ0D 1FOSF 5B66V 2JEEA 3PHLA 3KHUA 2MHMA 1BSNA 3CCUP 3CXHD 2YMYA 3CCMP 5B5EH 1EDJA 1GW4A 3MTUE 3KQGA 4JF7A 2L5GB 2KLUA 1NU1K 1FE6A 3IFMA 3NBTA 1CYJA 3KZIV 1YCCA 3O0RC 4OGQB 3L71D 2E43A 1S72P 3C8VA 3MGNA 2DGEA 1GZLA 1K05A 1NAFA 3AE9C 1FC2C 3MK7C 3H1JD 1ZXGA 1NGMB 1KTMA 4PV1B 1HVVA 2YQBA 3CX5E 1NTMK 1AOFA 4EIJA 1KQLA 3O20A 1GKSA 2YIUC 4OGQD 3HE5B 1ZV8A 3VYMA 3AE1C 1K73Q 2YXRB 4U3FG 4AALA 1WT6A 1JY2O 4DCKA 1A2SA 3HD7D 3RK2C 3WC8A 3RK3E 1Y9BA 3F89A 2ITAA 1RE4A 1H9YA 3ZOOA 1ZR2A 1JEKA 1KIBA 3B8EB 3MUDA 3EWKA 5KJ7A 1ZP0C 2FYZA 1KYOD 1N90A 2OARA 3M0AA 1L4AB 3MK7B 1LTBC 3D0WA 4L73A 4N78D 2FYNB 1GJQA 1OWAA 3H1LG 3L71J 3LW5J 2Q3IA 2Z4EA 2IYOA 5AW9B 3HD7B 3HE4A 4AANA 2KI7B 1LP1A 1CI6B 3H1KJ 2B89A 2P7JA 1T2KC 2P10A 1MKMA 1QYZA 3ZCFA 5CICB 2R3SA 4NPFX 4C46A 1Q82Q 3SXTA 1CYIA 5KAFV 1JY3P 3U1AA 2P67A 1CHHA 1FZCA 2M8RA 1HUCA 3CPWO 3H1JE 2QA4P 1C6SA 2V7QH 3AECC 2KNCB 1OW6A 1MG3D 1BCCD 1C52A 2P58A 1CSVA 1XTCC 5GTIV 1KILA 2DW3A 1RF1A 1NKZB 3L72G 3WFBC 3Q1MA 1R8EA 2HPCB 451CA 4GYDA 3AEEC 3G4SP 3TK1A 1J1DC 4WBAA 3SWSA 3VTPC 1CXAA 3H1KD 4QAOA 1YTZT 3OA8A 3M9BA 3L73D 2KYVA 4JCGA 1XTGB 1HCMA 3GF7A 1H31B 2JWDA 3CI9A 3N7NA 4WQAA 1T3UA 2I1KA 1YIJP 2JTIB 1SQQJ 4FAVA 1PPJE 1AKKA 1L0LE 4EIEA 2BEQD 2E75D 1KB9I 1DX7A 5CCGD 2P1JA 4K3AA 1RAPA 1BDDA 1A8CA 3IR9A 3CCEP 1LTGC 4BRYB 1YITP 5CIDB 1VQMP 5KAFH 1JB0J 3HTKA 4AUWA 3HUSC 3SSUA 5KLVE 2WSFH 2ZXEB 4WQ8A 1IJDB 3E1RA 4C7NB 4GDOA 2WPRA 2IBZD 1ZMEC 5CCHC 3PJSK 4KT0J 1NTZG 2XV5A 5E79E 4GODA 4U3FJ 1DVVA 1CRIA 3MZWB 3E1IA 2QJYB 3P8MC 1BSHA 4AYCA 2YXQB 2EXVA 1K8AQ 2HG5D 2MJZA 3H1HE 1NTMD 1R0QA 1R5SA 3L73J 3OCDA 5KJ7D 2J59M 4H0JA 1LTIC 1HJ4A 4IFFA 2YKOA 1QL2A 3L71E 2B87B 1IC2A 3MD0A 4LC1A 4GT1A 1HH7A 1SQQE 2N1TB 4I7ZC 3TGUG 1USDA 4EYYQ 1SQQD 2FFDC 1CHJA 1KX7A 1SS1A 1H33B 1QEXA 3BCCD 1QVFO 2NPSC 2QE7H 4CPGA 3CWBD 1IFPA 3VNWA 3JSVC 1MZ4A 1QKSA 2B10B 1SP4A 3TGUJ 2C1VA 5C9MA 1X22A 1YEAA 1JY3N 2C0WA 2K3RA 5BVZA 3BRVB 4JPZB 2BCCE 5CYTR 1KB9E 1LC2A 3OCDB 2PACA 2I8FA 4FANA 1GK6A 1DW1A 3CXHW 5KLVD 3PP5A 4WWIA 1PZQA 1SQXJ 1C6OA 1QX8A 5DJUB 3GLMA 3RL0B 3V4WA 1DH3A 5AURA 2FYUJ 3O8ZA 3AE8C 5AW4B 1Q86Q 2XTSB 1BGYE 3H1IG 3TF5A 1VQ9P 1M90Q 4EI2A 1N7SC 5TISH 2ZT9B 3HUSB 1C6RA 2C0XA 5CBOA 1VDFA 2FFDA 1EDLA 1KYOI 2YMKA 1RY3A 4P4QB 1OVVA 2BCCD 5DJQB 3JCUH 3M9HA 3H32A 4Y28J 3M91A 2FXMA 3A0BH 4LJIA 3L73E 4LGDE 1NYHA 4H0LB 3H1KE 1IFNA 5APTA 1SQVK 4WQCA 5K5GB 4PD4I 3D71A 1NOHA 2E74B 1AVYA 1JO5A 2Y0DA 1LGHB 2YO3A 2BASA 3IN6A 4ZMDA 2PP6A 5BU5A 2CE0A 4AQRD 1CIGA 1LWUA 4DZOA 3D6YA 2QIWA 1AYGA 2Z5HA 4JYCA 2GB8B 4HKZH 1TU3F 2KZJA 1SQVG 1H31A 2NPSD 2I8DA 3BASA 5AVQB 5GTHH 1K3HA 1AV1A 1OMIA 1S2EA 1G1IA 3A0BV 2N9YB 1FZEA 3C1LA 1N7LA 4AAMA 5EFWB 1LWUB 1Y47A 2A06E 2KB7P 2WSEH 1M6ZA 3L75D 2RKLA 1HTLC 3OA8B 4W80A 4IFDK 1LMSA 2M5AB 1CIFA 1J3SA 3AEFC 2V4HA 1C2RA 1K9MQ 2AXTH 3GMAA 4EICA 2KNCA 3CMAP 1X9VA 5E79H 2IBZE 5AVSB 1RE4C 1VQ7P 1IZL0 1DIQC 2WMMA 2N9JA 3V2RA 2QM8A 3GHGA 2PCCB 2K88A 4RSZA 4IOIH 4L1QA 3AE5C 1KYOW 1USEA 1CCHA 4O9BA 5AVRB 5KAFE 1NAYA 2GA1A 3WFDC 1L4AD 1JDLA 1NTKG 5CIEB 3H1JG 2GC4D 2IBZG 2RMZA 155CA 2N9IA 1LP1B 1PPJD 1SQVE 3H1HJ 1AFOA 1JY2N 3L71G 5B66H 3O1YA 1KFMA 2GM4A 3M0DA 3TGUD 2G8YA 3V2PA 4PD4E 4GOFA 2YKQA 5GTHV 1VQKP 1HJ0A 4HJGH 1L0NK 3CWBE 1CC5A 1HJ5A 2FYUD 2QEXP 1YICA 4PW9B 1CZQA 1NH4A 4I7ZB 1CTZA 1BE3J 1A02F 4NFGB 1NTMG 3VP8A 4NPDA 1GU4A 2KLVA 2WQYC 3RBXA 2JDIH 2YNYA 1HH0A 2XU6A 2RH0A 5AW2B 4HYTB 3ZDMA 1YTCA 3H1KG 5DF5A 1SQXG 2O01H 4N3YB 3X39A 3HRNA 1S5LV 2GC7D 2NZ2A 3CC7P 1KYOH 1SLQA 1CORA 1KILD 3II6A 3B5ND 3L70D 5L8RJ 1EB7A 2CA3B 1LT9A 3L72E 1HGVA 2WSCH 1M1KQ 1PIXA 1BGYG 2BH5X 4C7RA 1SQXE 1IFMA 1BDCA 1CSWA 1EDIA 1E5WA 2R32A 1C75A 2ZAEB 2O1KA 2C1DA 4C7NA 1ZRTD 3OJAB 1SFCA 1UIXA 3NBSA 3MHVA 3A5TA 2V08A 3VMZA 1CRHA 3Q5SA 4V2KA 2M5AA 3EFFK 3HQ7A 5M1BA 2WPVB 1HZUA 5DFSA 2QRXA 4D6TG 4YTPC 1JTHB 1EC5A 1CRYA 4RJTA 1IFDA 1SFCD 1KB9D 1NU1G 3VN0A 2IX7C 2L4DA 1KORA 3B5NA 1DD3A 3MUDC 1T3JA 4WY4C 4K35A 2P2UA 3BVHA 3G6EP 4H44D 4DJGA 3L72D 4EIFA 3W67A 3A3YB 1VQOP 1KILE 1R5LA 1N2DC 1YQ4C 2IBZI 3VYIA 2R3CA 2B9BA 5APWA 1SFCB 1CCRA 3FXEA 5GTIH 5AW6B 1W2LA 3CXHI 4GEDB 3V5BA 1L9BC 5APQA 1N73A 4U3FD 1BGYJ 4I6MC 3D70A 1KV9A 4L76A 2MKVA 3D6ZA 3TSIA 2C9LY 2C8SA 4H44B 1LT9B 2ZFCA 3CX5I 4PV1C 2N1TD 1SQBD 2LXBA 2V7QJ 3CWBG 1FJPA 5B5EV 3V2QA 1PP9G 1GQ1A 3HQ6A 4H0KA 3BRTB 3L36A 1T2KD 1CXCA 4YXDC 1NTME 1IQCA 3L4MA 5CJ4A 3VOPA 2E74C 3OAKA 1PGOA 5CIBB 2K37A 1UIIA 1H89A 1QVGO 2GIWA 4B86A 5DJTB 2NRGA 1FZBA 1GL2D 3RN1A 1G2CA 5AVXB 2Q5UA 1DW0A 1M1JB 4H13B 1QLED 2ZVNB 2AEMA 2UWJE 4XFJA 2ZJSE 3SWKA 1H32B 1BE3G 1RZ5A 3CU4A 1LTSC 1URQB 1P84H 3G3ZA 4BWNA 2E42A 4DT0A 1I54A 1I6EA 5AVTB 1IRWA 2Y0CA 4EIDA 4IL6H 1NU1D 1FZAA 2B87A 2W6JH 1T6AA 3QWOC 2E76C 1J1EC 3KPEA 1LC1A 2OYHA 3B71A 4GOEA 2PCBB 5AW0B 2KS1B 4J20A 1JCCA 2E74D 3DMIA 2VRSA 1NTZJ 2AIUA 1YFCA 1K3GA 3ZOYA 3WUUA 2XZRA 3H1IE 4IL6E 2O01J 3DP5A 3M97X 1M60A 2WT7A 3CCRP 1YTZI 2WTYA 2SPZA 1FAVA 3FWLA 4BRYA 3C2CA 1WVEC 1PL5A 3OA7A 4XE5B 3VMYA 3H25A 4FA4A 2E5YA 1SQBK 1AOQA 3R4YA 5AVYB 2OZ1A 4AAOA 3UIAA 1OVRA 4Y99C 4N0KA 4M3LA 1DW2A 2XKMA 2W83C 3CCLP 1MUUA 2H89C 5KAIE 2KSJA 1JY3O 4Y99B 1E8EA 2KP8A 3N4XA 1C7MA 4HB1A 2Q7CA 1GU5A 5TISV 4R4LA 4UB6H 1NWQA 1GW3A 1T8ZA 4H44C 4FA5A 1HF9A 1SQVJ 1OVUA 1GD2E 1RAQA 2WZ7A 1LJ2A 5DJQC 4H13D 2QJKC 1M70A 2XDJA 1IK9A 1RE3A 2JWAA 2BPBB 4W7ZA 1L2PA 1URQC 3H32B 3RBZA 3VMAA 1CNOA 2BLFB 2YO2A 5KLVK 1SFCC 2C1DB 4WB4A 3TYYA 1NTKK 3SVWA 1YYCA 1URQD 1KQSO 3RK3D 1N9CA 4BXLA 3MIWA 2WVRA 1AJYA 1CRGA 1FZGA 4WVZA 4FA9A 3L35A 2YKPA 4UB6V 3IAOA 1PPJG 2Y9YA 3HTKB 1S1CX 5E79V 2FXPA 1GK4A 2CPBA 3CCSP 1KMIZ 1SQPD 3H1LJ 2ZT9C 4Y5RA 1DIPA 3O6QB 3LIDA 4D6TE 1NMIA 5TISE 1I55A 3P32A 1RE3C 1E29A 2Y0EA 1VQPP 2V07A 4EDFA 3AE3C 3L75J 3WU2E 1GMJA 2NPSA 3JCUE 2K9YA 2JKVA 2CK3H 1NU1J 1LFMA 4Z1MH 4K3IA 2POHA 1VF5B 2OYOA 4XXLA 4L3HA 3BATA 3ITKA 3S1KA 1L0LG 1VYDA 4FA1A 2KXPB 3L74E 3GG2A 1X0TA 4L3GA 2JP3A 1KILB 1RF1B 2CPSA 4I1LA 2KUBA 4PD4D 1M56D 1OZHA 1RH5B 2AEFA 1EZVI 3WFCC 5KTBA 4LLHA 2XNDH 2NPSB 1NTMJ 2OYHB 1PP9J 3OW2O 1VF5D 3SFEC 3PRJA 3PH2B 1X8YA 1B7VA 1YJWP 1SQPE 1L0NJ 1COTA 1LT9C 1NTZK 1NTKE 2HFED 2R5BA 5KAIH 1SQQK 5AW3B 3TYIA 2KS1A 4ZKPA 3TDKA 2C1UA 3PH0A 2G3AA 1E2RA 3PXSA 5KKZB 2O01N 1N7SB 2N3BA 1FDOA 1L9JC 1I6DA 5B6QA 3U1CA 3FWNA 2Q1KA 1CI6A 3RK3B 2Z5IA 3PXWA 1URQA 5KKZC 1DEBA 1Y8AA 2O1JA 3ABVC 2K9JA 3P8CE 3HQ9A 1SQBJ 2IDBA 1KC8Q 1NMLA 4UB8V 1N73C 3RL0C 1RQVA 4FB1A 2AEJA 2HV4A 1KFNA 2WITA 2IPPA 4TT3H 4O1QA 2BEZF 3E7KA 2PAJA 2PGDA 4YPCA 3A2AA 2QJPB 3CX5D 3T97A 3DR0A 2FY8A 2JR8A 1K04A 3CD6P 1OIPA 3A7OA 1QN2A 3NTNA 1KD1Q 3I55P 1L0ND 1CYCA 5KLVG 1VQ5P 1KV4A 1CTYA 3L75E 3L72J 5B66E 2N1TA 4UB8H 1M57D 1QL3A 2CE1A 1RZ6A 1CTJA 1CRCA 1Q2NA 2OTJP 5APUA 3V4QA 1FOSE 2QG4A 3CC2P 1NIRA 2JJLA 1JCDA 4PD4H 1W2BO 3CXHE 2OZ1B 2W6AA 3JBTB 3L70G 5AW7B 1PV3A 1FZFA 3GHGB 3RLMA 1KX2A 1YIQA 2OYIB 1J1EB 2VHDA 3BCCG 1SQPK 3CCJP
chains in the Genus database with same CATH topology
2C8SA 4O1WA 1DVVA 1CRIA 2BH4X 2AI5A 3ZIYA 2QJYB 1OAEA 1FI3A 1SQBD 3VRDA 3HQ8A 2EXVA 5B5EV 1NTMD 1GQ1A 2ZONG 3ZOWA 3HQ6A 4H0KA 1R0QA 1CXCA 2C2CA 1PP9D 1IQCA 5CIFB 1L0LD 3OCDA 3L4MA 1NNOA 4H0JA 1HJ4A 1OCDA 5CIBB 2D0SA 2ZXYA 1N15A 4A7PA 2GIWA 4Q5PA 1HH7A 1C2NA 1DVHA 3SLEA 1SQQD 1CHJA 3RN1A 1KX7A 1CIEA 1H33B 2B0ZB 3BCCD 2B12B 1CSXA 1DW0A 3CWBD 3VNWA 1MZ4A 1QKSA 1NTKD 2B10B 1DW3A 1H32A 1KB0A 2C1VA 2QJKB 1H32B 5C9MA 1WEJF 1RZ5A 2K9JB 1YEAA 2N18C 3SJLA 3CU4A 1NTZD 2FRCA 3ZOXA 1I54A 2CA4B 3A0HV 1I6EA 2L91A 5CYTR 1IRWA 1LC2A 3OCDB 2PACA 5CIHB 2I8FA 2Y0CA 2ZZS1 2LIRA 2JQRA 1A56A 4FANA 3GW6A 1DW1A 3CXHW 5KLVD 4EIDA 2LITA 4PJ0V 1NU1D 2ORLA 1C6OA 2B4ZA 5KLIB 1FCDC 4DY9A 3PTZA 1MG2D 1DIIC 5AURA 1LC1A 2PCBB 2XTSB 2D0WA 2C9XB 3TF5A 4J20A 4YE1A 1HRCA 3DMIA 2AIUA 2BGVX 1YFCA 3CYTI 1K3GA 1C6RA 3ZOYA 2BCNB 3DP5A 4WQ9A 3M97X 2MTAC 4P4QB 3NWVA 1M60A 2BCCD 5DJQB 3PLNA 3RN0A 4D6TD 4LJIA 3FWLA 1CEDA 1SQVD 1BGYD 3CX5W 3C2CA 1WVEC 2YCCA 4WQCA 4FA4A 1HROA 1AOQA 1I5TA 2Y0DA 2OZ1A 4PWAA 4AAOA 4N0KA 2CE0A 1CIGA 1DW2A 3ORVA 5EXQA 1U75B 1AYGA 2GB8B 1E8EA 1GIWA 1SQXD 1H9XA 1C7MA 5CIGB 1BE3D 1CRJA 1H31A 1F1FA 1W5CT 1N50A 1GU2A 2O3JA 5TISV 3WU2V 1K3HA 3A0BV 1YEBA 4FA5A 2N9YB 5B66V 1RAQA 3PHLA 1FJ0A 1FHBA 5DJQC 3KHUA 2MHMA 3CXHD 1I8PA 1M70A 4AAMA 2JWAA 3H1LD 2BPBB 1M6ZA 3L75D 3VMAA 1CNOA 2BLFB 2A06D 3OA8B 2C1DB 1LMSA 3NBTA 3SVWA 1CIFA 1J3SA 1N9CA 1CYJA 1CHIA 3KZIV 1YCCA 1CRGA 3O0RC 3L71D 1DT1A 1C2RA 4FA9A 2N18B 4EICA 3L74D 4UB6V 3RMZA 2DGEA 4WQDA 1FOCA 5E79V 1IZL0 3MK7C 3H1JD 1DIQC 2N9JA 2PCCB 2YIUB 2YQBA 1SQPD 4RSZA 4L1QA 1KYOW 4Y5RA 1CCHA 1AOFA 1HJ3A 1CIHA 3PXTA 4MU8A 1S6VB 3O20A 1GKSA 3WFDC 3VYMA 1JDLA 1NMIA 2N3YA 5CIEB 2RN0A 2GC4D 1I55A 2RMZA 2YK3A 4AALA 1E29A 155CA 2N9IA 2AXTV 2Y0EA 1PPJD 2V07A 1A2SA 4EDFA 3WC8A 1H9YA 3ZOOA 1YNRA 3O1YA 3TGUD 1KIBA 1LFMA 5GTHV 4K3IA 1KYOD 5H2FV 1N90A 4XXLA 4L3HA 3MK7B 1CC5A 3ITKA 2FYNB 1GJQA 3CP5A 1HJ5A 2FYUD 1YICA 4PW9B 1EZVD 1VYDA 4FA1A 1CTZA 3GG2A 4L3GA 4NFGB 4WQ7A 4AANA 4KMGA 4PD4D 1I8OA 2Q3EA 3WFCC 1QYZA 3ZCFA 5CICB 1YTCA 1CSUA 5DF5A 1P84D 3PH2B 3PRJA 3SXTA 1B7VA 1CYIA 3X39A 5KAFV 1H1OA 1COTA 2B11B 3WUIA 1CHHA 1IO3A 3O5CA 1S5LV 2CXBA 2GC7D 3TYIA 2KS1A 1C6SA 1CORA 3TDKA 2ZBOA 3L70D 2C1UA 1EB7A 2CA3B 1E2RA 3PXSA 5KKZB 2KNCB 2N3BA 1L9JC 1I6DA 1MG3D 1BCCD 5B6QA 1C52A 4WQEA 1CSVA 2BH5X 5GTIV 3PXWA 4XYDB 1CSWA 1FI9A 3WFBC 1C75A 2C1DA 3HQ9A 1ZRTD 1F1CA 451CA 4GYDA 1NMLA 4UB8V 4IL6V 5TJHA 4FB1A 1GDVA 3NBSA 1U74B 2HV4A 1FI7A 1ETPA 2V08A 3SWSA 1CRHA 1CXAA 4O1QA 4V2KA 3HQ7A 1HZVA 3H1KD 4QAOA 3OA8A 1HZUA 5DFSA 3L73D 1QL4A 2QJPB 3CX5D 4JCGA 3DR0A 2FWLA 1BL9A 1HCMA 2DVHA 1H31B 1CRYA 4RJTA 4WQAA 4WQBA 1KB9D 1QN2A 3WFEC 1H33A 1L0ND 1CYCA 2JTIB 351CA 4FAVA 1CTYA 2L4DA 1AKKA 4EIEA 3H1ID 1QL3A 1CO6A 2CE1A 1RZ6A 5KAIV 1CTJA 1CRCA 2ZOOA 1RAPA 3L72D 4EIFA 1LS9A 3H1HD 1IRVA 2QG4A 1A8CA 5C0ZA 1ZZHA 1NIRA 5CIDB 3ZBMA 1CCRA 4AX3A 2OZ1B 4WQ8A 3JBTB 5IY51 1W2LA 4GEDB 1L9BC 3A9FA 4U3FD 3RLMA 2IBZD 1KX2A 1YIQA 3L4OA 2VHDA 1KV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8S A;  4O1W A;  1DVV A;  1CRI A;  2BH4 X;  2AI5 A;  3ZIY A;  2QJY B;  1OAE A;  1FI3 A;  1SQB D;  3VRD A;  3HQ8 A;  2EXV A;  5B5E V;  1NTM D;  1GQ1 A;  2ZON G;  3ZOW A;  3HQ6 A;  4H0K A;  1R0Q A;  1CXC A;  2C2C A;  1PP9 D;  1IQC A;  5CIF B;  1L0L D;  3OCD A;  3L4M A;  1NNO A;  4H0J A;  1HJ4 A;  1OCD A;  5CIB B;  2D0S A;  2ZXY A;  1N15 A;  4A7P A;  2GIW A;  4Q5P A;  1HH7 A;  1C2N A;  1DVH A;  3SLE A;  1SQQ D;  1CHJ A;  3RN1 A;  1KX7 A;  1CIE A;  1H33 B;  2B0Z B;  3BCC D;  2B12 B;  1CSX A;  1DW0 A;  3CWB D;  3VNW A;  1MZ4 A;  1QKS A;  1NTK D;  2B10 B;  1DW3 A;  1H32 A;  1KB0 A;  2C1V A;  2QJK B;  1H32 B;  5C9M A;  1WEJ F;  1RZ5 A;  2K9J B;  1YEA A;  2N18 C;  3SJL A;  3CU4 A;  1NTZ D;  2FRC A;  3ZOX A;  1I54 A;  2CA4 B;  3A0H V;  1I6E A;  2L91 A;  5CYT R;  1IRW A;  1LC2 A;  3OCD B;  2PAC A;  5CIH B;  2I8F A;  2Y0C A;  2ZZS 1;  2LIR A;  2JQR A;  1A56 A;  4FAN A;  3GW6 A;  1DW1 A;  3CXH W;  5KLV D;  4EID A;  2LIT A;  4PJ0 V;  1NU1 D;  2ORL A;  1C6O A;  2B4Z A;  5KLI B;  1FCD C;  4DY9 A;  3PTZ A;  1MG2 D;  1DII C;  5AUR A;  1LC1 A;  2PCB B;  2XTS B;  2D0W A;  2C9X B;  3TF5 A;  4J20 A;  4YE1 A;  1HRC A;  3DMI A;  2AIU A;  2BGV X;  1YFC A;  3CYT I;  1K3G A;  1C6R A;  3ZOY A;  2BCN B;  3DP5 A;  4WQ9 A;  3M97 X;  2MTA C;  4P4Q B;  3NWV A;  1M60 A;  2BCC D;  5DJQ B;  3PLN A;  3RN0 A;  4D6T D;  4LJI A;  3FWL A;  1CED A;  1SQV D;  1BGY D;  3CX5 W;  3C2C A;  1WVE C;  2YCC A;  4WQC A;  4FA4 A;  1HRO A;  1AOQ A;  1I5T A;  2Y0D A;  2OZ1 A;  4PWA A;  4AAO A;  4N0K A;  2CE0 A;  1CIG A;  1DW2 A;  3ORV A;  5EXQ A;  1U75 B;  1AYG A;  2GB8 B;  1E8E A;  1GIW A;  1SQX D;  1H9X A;  1C7M A;  5CIG B;  1BE3 D;  1CRJ A;  1H31 A;  1F1F A;  1W5C T;  1N50 A;  1GU2 A;  2O3J A;  5TIS V;  3WU2 V;  1K3H A;  3A0B V;  1YEB A;  4FA5 A;  2N9Y B;  5B66 V;  1RAQ A;  3PHL A;  1FJ0 A;  1FHB A;  5DJQ C;  3KHU A;  2MHM A;  3CXH D;  1I8P A;  1M70 A;  4AAM A;  2JWA A;  3H1L D;  2BPB B;  1M6Z A;  3L75 D;  3VMA A;  1CNO A;  2BLF B;  2A06 D;  3OA8 B;  2C1D B;  1LMS A;  3NBT A;  3SVW A;  1CIF A;  1J3S A;  1N9C A;  1CYJ A;  1CHI A;  3KZI V;  1YCC A;  1CRG A;  3O0R C;  3L71 D;  1DT1 A;  1C2R A;  4FA9 A;  2N18 B;  4EIC A;  3L74 D;  4UB6 V;  3RMZ A;  2DGE A;  4WQD A;  1FOC A;  5E79 V;  1IZL 0;  3MK7 C;  3H1J D;  1DIQ C;  2N9J A;  2PCC B;  2YIU B;  2YQB A;  1SQP D;  4RSZ A;  4L1Q A;  1KYO W;  4Y5R A;  1CCH A;  1AOF A;  1HJ3 A;  1CIH A;  3PXT A;  4MU8 A;  1S6V B;  3O20 A;  1GKS A;  3WFD C;  3VYM A;  1JDL A;  1NMI A;  2N3Y A;  5CIE B;  2RN0 A;  2GC4 D;  1I55 A;  2RMZ A;  2YK3 A;  4AAL A;  1E29 A;  155C A;  2N9I A;  2AXT V;  2Y0E A;  1PPJ D;  2V07 A;  1A2S A;  4EDF A;  3WC8 A;  1H9Y A;  3ZOO A;  1YNR A;  3O1Y A;  3TGU D;  1KIB A;  1LFM A;  5GTH V;  4K3I A;  1KYO D;  5H2F V;  1N90 A;  4XXL A;  4L3H A;  3MK7 B;  1CC5 A;  3ITK A;  2FYN B;  1GJQ A;  3CP5 A;  1HJ5 A;  2FYU D;  1YIC A;  4PW9 B;  1EZV D;  1VYD A;  4FA1 A;  1CTZ A;  3GG2 A;  4L3G A;  4NFG B;  4WQ7 A;  4AAN A;  4KMG A;  4PD4 D;  1I8O A;  2Q3E A;  3WFC C;  1QYZ A;  3ZCF A;  5CIC B;  1YTC A;  1CSU A;  5DF5 A;  1P84 D;  3PH2 B;  3PRJ A;  3SXT A;  1B7V A;  1CYI A;  3X39 A;  5KAF V;  1H1O A;  1COT A;  2B11 B;  3WUI A;  1CHH A;  1IO3 A;  3O5C A;  1S5L V;  2CXB A;  2GC7 D;  3TYI A;  2KS1 A;  1C6S A;  1COR A;  3TDK A;  2ZBO A;  3L70 D;  2C1U A;  1EB7 A;  2CA3 B;  1E2R A;  3PXS A;  5KKZ B;  2KNC B;  2N3B A;  1L9J C;  1I6D A;  1MG3 D;  1BCC D;  5B6Q A;  1C52 A;  4WQE A;  1CSV A;  2BH5 X;  5GTI V;  3PXW A;  4XYD B;  1CSW A;  1FI9 A;  3WFB C;  1C75 A;  2C1D A;  3HQ9 A;  1ZRT D;  1F1C A;  451C A;  4GYD A;  1NML A;  4UB8 V;  4IL6 V;  5TJH A;  4FB1 A;  1GDV A;  3NBS A;  1U74 B;  2HV4 A;  1FI7 A;  1ETP A;  2V08 A;  3SWS A;  1CRH A;  1CXA A;  4O1Q A;  4V2K A;  3HQ7 A;  1HZV A;  3H1K D;  4QAO A;  3OA8 A;  1HZU A;  5DFS A;  3L73 D;  1QL4 A;  2QJP B;  3CX5 D;  4JCG A;  3DR0 A;  2FWL A;  1BL9 A;  1HCM A;  2DVH A;  1H31 B;  1CRY A;  4RJT A;  4WQA A;  4WQB A;  1KB9 D;  1QN2 A;  3WFE C;  1H33 A;  1L0N D;  1CYC A;  2JTI B;  351C A;  4FAV A;  1CTY A;  2L4D A;  1AKK A;  4EIE A;  3H1I D;  1QL3 A;  1CO6 A;  2CE1 A;  1RZ6 A;  5KAI V;  1CTJ A;  1CRC A;  2ZOO A;  1RAP A;  3L72 D;  4EIF A;  1LS9 A;  3H1H D;  1IRV A;  2QG4 A;  1A8C A;  5C0Z A;  1ZZH A;  1NIR A;  5CID B;  3ZBM A;  1CCR A;  4AX3 A;  2OZ1 B;  4WQ8 A;  3JBT B;  5IY5 1;  1W2L A;  4GED B;  1L9B C;  3A9F A;  4U3F D;  3RLM A;  2IBZ D;  1KX2 A;  1YIQ A;  3L4O A;  2VHD A;  1KV9 A; 
#chains in the Genus database with same CATH topology
 1E79 H;  2WPS A;  4HH2 A;  2QJY C;  2QVA A;  4O1W A;  1N7S A;  2WPQ A;  2AI5 A;  5AW1 B;  4W7Y A;  4DOJ A;  1OAE A;  3SWF A;  1FI3 A;  3AEB C;  2HOD B;  1S5L X;  2OYI A;  3KZI E;  3P7K A;  1W5C E;  4H0L C;  2GUV A;  4XA4 A;  1NKN A;  1S9K D;  3L74 G;  3B5N B;  1EZV G;  2C2C A;  1N7S D;  3Q5P A;  5CIF B;  3RGU A;  2FYU G;  5C39 A;  2K1A A;  1LTJ A;  4NPE A;  2D0S A;  1YI2 P;  2ZXY A;  1FU1 A;  4A7P A;  4Q5P A;  1C2N A;  1JTH A;  1WMK A;  3SLE A;  3L75 G;  1YJ9 P;  1U57 A;  1CIE A;  1ZRT E;  3M9Q A;  3NFQ A;  1EZV E;  1CSX A;  3FX0 A;  1H8A A;  1NTK D;  1DW3 A;  3AE6 C;  1H32 A;  2A45 G;  2C9N Y;  2H88 C;  2K9J B;  4IFM A;  2N18 C;  5APY A;  3SJL A;  2LKM A;  2E5T A;  3BCC E;  1YBK A;  1VL2 A;  2D2C C;  2WSC J;  1M7L A;  1IZN B;  4L75 A;  2AXT E;  5CIH B;  2BCC J;  2W6B A;  1HBW A;  3CXH H;  2JQR A;  1DD4 A;  3GW6 A;  4N6J A;  1L0N G;  3L70 E;  1J2J B;  3F5H A;  2N1T C;  1FDM A;  1PGP A;  1LTT C;  4PV1 D;  1FCD C;  4DY9 A;  3CWB J;  1OXZ A;  1MG2 D;  1SQB E;  3H1H G;  1CW5 A;  1DII C;  1P84 I;  3CL3 D;  3L73 G;  2BCC G;  2A06 G;  3A0B E;  4ZKU A;  3AE4 C;  5CCH A;  2D0W A;  2C9X B;  1FJK A;  2FYU E;  5KJ7 C;  2BGV X;  3I5C A;  5APX A;  2HLO A;  1L0N E;  3CYT I;  2QJP C;  2HYN A;  4U3F E;  2LXC B;  4PJ0 E;  2MTA C;  3NWV A;  3WU2 H;  3Q5R A;  4L74 A;  4D6T D;  2D2C B;  3AED C;  1CED A;  1SQV D;  3CX5 W;  4WY4 A;  1S5L H;  2YCC A;  4ASV A;  2IYP A;  3KDP B;  1G2C B;  4MN4 C;  3IF4 A;  3TGU E;  4N78 E;  1NU1 E;  1U75 B;  1KB9 H;  3K5B A;  3EFG A;  4JYB A;  1H9X A;  5CBN A;  1JY2 P;  5CIG B;  1L0L K;  1FBM A;  1PFI A;  1F1F A;  1W5C T;  1GU2 A;  3P8C D;  4H13 C;  1GL2 B;  2R44 A;  3WU2 V;  3V2N A;  1GL2 A;  2Q6Q A;  1YEB A;  3KYQ A;  1Q90 D;  1FJ0 A;  1FHB A;  1S5L E;  1H0T B;  1I8P A;  1SQP J;  5AVZ B;  3RL0 g;  3H1L D;  3I56 P;  4OGQ C;  2A06 D;  1VQ4 P;  3FGA D;  2M3B A;  3KZI H;  2HOD A;  1CHI A;  2J5U A;  1NO4 A;  1PGJ A;  1KIL C;  5APV A;  1RF1 C;  3A0H H;  3CCQ P;  1DT1 A;  1FDI A;  2N18 B;  3L74 D;  5KLI C;  1OX3 A;  3H6P A;  4UB6 E;  3RMZ A;  4WQD A;  1FOC A;  1Q81 Q;  2E76 B;  1H0T A;  1W2E A;  2FFD B;  1N86 A;  1BCC E;  5H2F H;  2YIU B;  1HGZ A;  3SFD C;  2W90 A;  5CCG A;  4KHX A;  3AEA C;  4RO0 A;  5KLV J;  2B88 A;  1HJ3 A;  1RHZ B;  1CIH A;  3PXT A;  4MU8 A;  1SQP G;  1S6V B;  3A0H E;  4R4M A;  2N3Y A;  4ASW A;  4TLF A;  2RN0 A;  3NMD A;  4U7J A;  3CCV P;  2YK3 A;  1N8R Q;  1D7M A;  2AXT V;  2E76 D;  1ZR4 A;  4OVN F;  3AEG C;  3T97 B;  3Q2Y A;  1YNR A;  2E75 B;  3G71 P;  1SQQ G;  3WUT A;  2FYN C;  4YXW H;  4WY4 B;  1KQF B;  2IFM A;  5H2F V;  3CP5 A;  3CC4 P;  2HPC A;  3L37 A;  2OGU A;  2OQQ A;  2FKW B;  1EZV D;  1LTJ C;  1KYO E;  4WQ7 A;  1L4A C;  3LW5 H;  3HUS A;  1P84 E;  4KMG A;  1NTK J;  2OTK E;  1I8O A;  2Q3E A;  1LTJ B;  3H1I J;  1JNM A;  1AQT A;  5GTI E;  3O6Q A;  5GTH E;  1MFT A;  1HWT C;  1CSU A;  1VQ6 P;  4RKU J;  3L74 J;  1P84 D;  5B5E E;  1M8O B;  2M3E A;  3CME P;  2M0B A;  3R2P A;  1MZ9 A;  1H1O A;  2B11 B;  3WUI A;  1NVO A;  1IO3 A;  1S9K E;  1BCC J;  3O5C A;  1GL2 C;  2WSS H;  2OYH C;  2CXB A;  1WRG A;  4OH8 B;  3NXS A;  1GDT A;  2ZBO A;  1VQN P;  1SVF A;  3C9I A;  3MP7 B;  4WQE A;  1FZC B;  1EDK A;  1LT1 A;  3WMM 0;  1BCC G;  4XYD B;  1ZW0 A;  1FI9 A;  2A45 I;  3VP9 A;  4UB8 E;  1JMM A;  4I2L C;  5AVV B;  1F1C A;  4IL6 V;  2H43 A;  5TJH A;  1L4A A;  1VF5 C;  1GDV A;  1U74 B;  1AA0 A;  1FI7 A;  1ETP A;  1EXI A;  4KJM A;  1NTZ E;  3B4S A;  1HZV A;  2KIK A;  5CJ0 A;  3GHG C;  1AVO A;  2OYI C;  1NHL A;  3LIE A;  1L0L J;  1QL4 A;  2W27 A;  2FWL A;  1BL9 A;  2Q9I A;  2DVH A;  1IFI A;  4GKG A;  1JMB A;  1LWU C;  4WQB A;  3Q3D A;  1A02 J;  2LR2 A;  1H88 A;  3WFE C;  5AVW B;  1H33 A;  3KXD A;  3SWY A;  351C A;  1JM0 A;  4RES B;  1FZC C;  2H8P D;  5APS A;  3H1I D;  1VQ8 P;  1YQ3 C;  1CO6 A;  5KAI V;  5CMZ A;  3TNU A;  2ZOO A;  1PGQ A;  4WY4 D;  1LS9 A;  3G9R A;  3H1H D;  1IRV A;  1LNQ A;  3RL0 D;  5C0Z A;  1ZZH A;  2QM7 A;  1ZOY C;  3H1L E;  2A45 H;  1ZLL A;  3ZBM A;  5CCH D;  4AX3 A;  1BE3 E;  5IY5 1;  1AQ5 A;  4D6T J;  3A9F A;  2XNX A;  3WUV A;  2ZT9 D;  3L4O A;  1HJB A;  1JUN A;  5AW5 B;  2FXO A;  1MV8 A;  2ZYD A;  4JBZ A;  2BH4 X;  3ZIY A;  2WT7 B;  2WSF J;  3JC2 2;  2JO1 A;  3VRD A;  1RF0 C;  3HQ8 A;  1KZU B;  3U59 A;  1U7J A;  1ZN5 A;  4OWF A;  2ZON G;  3ZOW A;  1PP9 D;  3S4R A;  1L0L D;  1NNO A;  4EOT A;  1OCD A;  1SQB G;  3TNU B;  3BCC J;  3B5N C;  1N15 A;  1OW7 A;  3HE4 B;  1DVH A;  3L4F A;  1GTW A;  1S4X A;  4PJ0 H;  2B0Z B;  3VMX A;  2B12 B;  1DEE G;  1IO4 A;  1SQX K;  2H7H A;  1MFZ A;  4IL6 X;  2ZYG A;  1KB0 A;  2QJK B;  2FYU K;  1WEJ F;  3CX5 H;  2KSE A;  3M06 A;  2PFX A;  3L70 J;  3USS A;  1QGK B;  2HR3 A;  1NTZ D;  2FRC A;  3ZOX A;  1JOC A;  5AW8 B;  4GIF A;  1YHQ P;  2CA4 B;  3A0H V;  1X79 B;  3W68 A;  2R5D A;  2QSI A;  1EQ7 A;  2L91 A;  1LTA C;  2KK7 A;  2ZZS 1;  2WWW A;  2LIR A;  3FXD A;  1A56 A;  1RF0 A;  1Z56 A;  1OFC X;  2IZ1 A;  2LIT A;  4PJ0 V;  3V6I A;  2ORL A;  2B4Z A;  3AE2 C;  5KLI B;  3PTZ A;  1FS0 E;  2D2C D;  3AE7 C;  2I1J A;  1KN7 A;  3HE5 A;  5BU8 B;  3RK2 B;  3RK3 C;  4YE1 A;  1HRC A;  1KQG B;  1IK7 A;  1VPC A;  2BCN B;  3HD7 A;  2PRR A;  2KZI A;  2N9B A;  1N73 B;  2KOG A;  2IZ0 A;  4WQ9 A;  1G1J A;  1PP9 E;  3H1J J;  1U7M A;  5CHX A;  4ZNC A;  3PLN A;  2GUS A;  3RN0 A;  1IFJ A;  2AXC A;  1M1J C;  3GF3 A;  3CLQ A;  1BGY D;  1M1J A;  1QL1 A;  5CCG C;  2E75 C;  1Q7Y Q;  3HD7 C;  3RK2 D;  1HRO A;  1CSB A;  1VQL P;  1RQU A;  1I5T A;  2ZYA A;  4PWA A;  2ZVO B;  2FBW C;  2J58 A;  3ORV A;  5EXQ A;  5AVU B;  1S3J A;  1EXJ A;  1NJI Q;  2OTL P;  3M0D C;  3S9O A;  1GIW A;  5H2F E;  1SQX D;  2ZXX A;  2Y9Z A;  1OW8 A;  4H0L D;  1BE3 D;  1CRJ A;  4QMA A;  1N50 A;  2WSE J;  2O3J A;  2W8Z A;  1YJN P;  2IFN A;  1J1D B;  3QH9 A;  3EQ2 A;  4JQ0 D;  1FOS F;  5B66 V;  2JEE A;  3PHL A;  3KHU A;  2MHM A;  1BSN A;  3CCU P;  3CXH D;  2YMY A;  3CCM P;  5B5E H;  1EDJ A;  1GW4 A;  3MTU E;  3KQG A;  4JF7 A;  2L5G B;  2KLU A;  1NU1 K;  1FE6 A;  3IFM A;  3NBT A;  1CYJ A;  3KZI V;  1YCC A;  3O0R C;  4OGQ B;  3L71 D;  2E43 A;  1S72 P;  3C8V A;  3MGN A;  2DGE A;  1GZL A;  1K05 A;  1NAF A;  3AE9 C;  1FC2 C;  3MK7 C;  3H1J D;  1ZXG A;  1NGM B;  1KTM A;  4PV1 B;  1HVV A;  2YQB A;  3CX5 E;  1NTM K;  1AOF A;  4EIJ A;  1KQL A;  3O20 A;  1GKS A;  2YIU C;  4OGQ D;  3HE5 B;  1ZV8 A;  3VYM A;  3AE1 C;  1K73 Q;  2YXR B;  4U3F G;  4AAL A;  1WT6 A;  1JY2 O;  4DCK A;  1A2S A;  3HD7 D;  3RK2 C;  3WC8 A;  3RK3 E;  1Y9B A;  3F89 A;  2ITA A;  1RE4 A;  1H9Y A;  3ZOO A;  1ZR2 A;  1JEK A;  1KIB A;  3B8E B;  3MUD A;  3EWK A;  5KJ7 A;  1ZP0 C;  2FYZ A;  1KYO D;  1N90 A;  2OAR A;  3M0A A;  1L4A B;  3MK7 B;  1LTB C;  3D0W A;  4L73 A;  4N78 D;  2FYN B;  1GJQ A;  1OWA A;  3H1L G;  3L71 J;  3LW5 J;  2Q3I A;  2Z4E A;  2IYO A;  5AW9 B;  3HD7 B;  3HE4 A;  4AAN A;  2KI7 B;  1LP1 A;  1CI6 B;  3H1K J;  2B89 A;  2P7J A;  1T2K C;  2P10 A;  1MKM A;  1QYZ A;  3ZCF A;  5CIC B;  2R3S A;  4NPF X;  4C46 A;  1Q82 Q;  3SXT A;  1CYI A;  5KAF V;  1JY3 P;  3U1A A;  2P67 A;  1CHH A;  1FZC A;  2M8R A;  1HUC A;  3CPW O;  3H1J E;  2QA4 P;  1C6S A;  2V7Q H;  3AEC C;  2KNC B;  1OW6 A;  1MG3 D;  1BCC D;  1C52 A;  2P58 A;  1CSV A;  1XTC C;  5GTI V;  1KIL A;  2DW3 A;  1RF1 A;  1NKZ B;  3L72 G;  3WFB C;  3Q1M A;  1R8E A;  2HPC B;  451C A;  4GYD A;  3AEE C;  3G4S P;  3TK1 A;  1J1D C;  4WBA A;  3SWS A;  3VTP C;  1CXA A;  3H1K D;  4QAO A;  1YTZ T;  3OA8 A;  3M9B A;  3L73 D;  2KYV A;  4JCG A;  1XTG B;  1HCM A;  3GF7 A;  1H31 B;  2JWD A;  3CI9 A;  3N7N A;  4WQA A;  1T3U A;  2I1K A;  1YIJ P;  2JTI B;  1SQQ J;  4FAV A;  1PPJ E;  1AKK A;  1L0L E;  4EIE A;  2BEQ D;  2E75 D;  1KB9 I;  1DX7 A;  5CCG D;  2P1J A;  4K3A A;  1RAP A;  1BDD A;  1A8C A;  3IR9 A;  3CCE P;  1LTG C;  4BRY B;  1YIT P;  5CID B;  1VQM P;  5KAF H;  1JB0 J;  3HTK A;  4AUW A;  3HUS C;  3SSU A;  5KLV E;  2WSF H;  2ZXE B;  4WQ8 A;  1IJD B;  3E1R A;  4C7N B;  4GDO A;  2WPR A;  2IBZ D;  1ZME C;  5CCH C;  3PJS K;  4KT0 J;  1NTZ G;  2XV5 A;  5E79 E;  4GOD A;  4U3F J;  1DVV A;  1CRI A;  3MZW B;  3E1I A;  2QJY B;  3P8M C;  1BSH A;  4AYC A;  2YXQ B;  2EXV A;  1K8A Q;  2HG5 D;  2MJZ A;  3H1H E;  1NTM D;  1R0Q A;  1R5S A;  3L73 J;  3OCD A;  5KJ7 D;  2J59 M;  4H0J A;  1LTI C;  1HJ4 A;  4IFF A;  2YKO A;  1QL2 A;  3L71 E;  2B87 B;  1IC2 A;  3MD0 A;  4LC1 A;  4GT1 A;  1HH7 A;  1SQQ E;  2N1T B;  4I7Z C;  3TGU G;  1USD A;  4EYY Q;  1SQQ D;  2FFD C;  1CHJ A;  1KX7 A;  1SS1 A;  1H33 B;  1QEX A;  3BCC D;  1QVF O;  2NPS C;  2QE7 H;  4CPG A;  3CWB D;  1IFP A;  3VNW A;  3JSV C;  1MZ4 A;  1QKS A;  2B10 B;  1SP4 A;  3TGU J;  2C1V A;  5C9M A;  1X22 A;  1YEA A;  1JY3 N;  2C0W A;  2K3R A;  5BVZ A;  3BRV B;  4JPZ B;  2BCC E;  5CYT R;  1KB9 E;  1LC2 A;  3OCD B;  2PAC A;  2I8F A;  4FAN A;  1GK6 A;  1DW1 A;  3CXH W;  5KLV D;  3PP5 A;  4WWI A;  1PZQ A;  1SQX J;  1C6O A;  1QX8 A;  5DJU B;  3GLM A;  3RL0 B;  3V4W A;  1DH3 A;  5AUR A;  2FYU J;  3O8Z A;  3AE8 C;  5AW4 B;  1Q86 Q;  2XTS B;  1BGY E;  3H1I G;  3TF5 A;  1VQ9 P;  1M90 Q;  4EI2 A;  1N7S C;  5TIS H;  2ZT9 B;  3HUS B;  1C6R A;  2C0X A;  5CBO A;  1VDF A;  2FFD A;  1EDL A;  1KYO I;  2YMK A;  1RY3 A;  4P4Q B;  1OVV A;  2BCC D;  5DJQ B;  3JCU H;  3M9H A;  3H32 A;  4Y28 J;  3M91 A;  2FXM A;  3A0B H;  4LJI A;  3L73 E;  4LGD E;  1NYH A;  4H0L B;  3H1K E;  1IFN A;  5APT A;  1SQV K;  4WQC A;  5K5G B;  4PD4 I;  3D71 A;  1NOH A;  2E74 B;  1AVY A;  1JO5 A;  2Y0D A;  1LGH B;  2YO3 A;  2BAS A;  3IN6 A;  4ZMD A;  2PP6 A;  5BU5 A;  2CE0 A;  4AQR D;  1CIG A;  1LWU A;  4DZO A;  3D6Y A;  2QIW A;  1AYG A;  2Z5H A;  4JYC A;  2GB8 B;  4HKZ H;  1TU3 F;  2KZJ A;  1SQV G;  1H31 A;  2NPS D;  2I8D A;  3BAS A;  5AVQ B;  5GTH H;  1K3H A;  1AV1 A;  1OMI A;  1S2E A;  1G1I A;  3A0B V;  2N9Y B;  1FZE A;  3C1L A;  1N7L A;  4AAM A;  5EFW B;  1LWU B;  1Y47 A;  2A06 E;  2KB7 P;  2WSE H;  1M6Z A;  3L75 D;  2RKL A;  1HTL C;  3OA8 B;  4W80 A;  4IFD K;  1LMS A;  2M5A B;  1CIF A;  1J3S A;  3AEF C;  2V4H A;  1C2R A;  1K9M Q;  2AXT H;  3GMA A;  4EIC A;  2KNC A;  3CMA P;  1X9V A;  5E79 H;  2IBZ E;  5AVS B;  1RE4 C;  1VQ7 P;  1IZL 0;  1DIQ C;  2WMM A;  2N9J A;  3V2R A;  2QM8 A;  3GHG A;  2PCC B;  2K88 A;  4RSZ A;  4IOI H;  4L1Q A;  3AE5 C;  1KYO W;  1USE A;  1CCH A;  4O9B A;  5AVR B;  5KAF E;  1NAY A;  2GA1 A;  3WFD C;  1L4A D;  1JDL A;  1NTK G;  5CIE B;  3H1J G;  2GC4 D;  2IBZ G;  2RMZ A;  155C A;  2N9I A;  1LP1 B;  1PPJ D;  1SQV E;  3H1H J;  1AFO A;  1JY2 N;  3L71 G;  5B66 H;  3O1Y A;  1KFM A;  2GM4 A;  3M0D A;  3TGU D;  2G8Y A;  3V2P A;  4PD4 E;  4GOF A;  2YKQ A;  5GTH V;  1VQK P;  1HJ0 A;  4HJG H;  1L0N K;  3CWB E;  1CC5 A;  1HJ5 A;  2FYU D;  2QEX P;  1YIC A;  4PW9 B;  1CZQ A;  1NH4 A;  4I7Z B;  1CTZ A;  1BE3 J;  1A02 F;  4NFG B;  1NTM G;  3VP8 A;  4NPD A;  1GU4 A;  2KLV A;  2WQY C;  3RBX A;  2JDI H;  2YNY A;  1HH0 A;  2XU6 A;  2RH0 A;  5AW2 B;  4HYT B;  3ZDM A;  1YTC A;  3H1K G;  5DF5 A;  1SQX G;  2O01 H;  4N3Y B;  3X39 A;  3HRN A;  1S5L V;  2GC7 D;  2NZ2 A;  3CC7 P;  1KYO H;  1SLQ A;  1COR A;  1KIL D;  3II6 A;  3B5N D;  3L70 D;  5L8R J;  1EB7 A;  2CA3 B;  1LT9 A;  3L72 E;  1HGV A;  2WSC H;  1M1K Q;  1PIX A;  1BGY G;  2BH5 X;  4C7R A;  1SQX E;  1IFM A;  1BDC A;  1CSW A;  1EDI A;  1E5W A;  2R32 A;  1C75 A;  2ZAE B;  2O1K A;  2C1D A;  4C7N A;  1ZRT D;  3OJA B;  1SFC A;  1UIX A;  3NBS A;  3MHV A;  3A5T A;  2V08 A;  3VMZ A;  1CRH A;  3Q5S A;  4V2K A;  2M5A A;  3EFF K;  3HQ7 A;  5M1B A;  2WPV B;  1HZU A;  5DFS A;  2QRX A;  4D6T G;  4YTP C;  1JTH B;  1EC5 A;  1CRY A;  4RJT A;  1IFD A;  1SFC D;  1KB9 D;  1NU1 G;  3VN0 A;  2IX7 C;  2L4D A;  1KOR A;  3B5N A;  1DD3 A;  3MUD C;  1T3J A;  4WY4 C;  4K35 A;  2P2U A;  3BVH A;  3G6E P;  4H44 D;  4DJG A;  3L72 D;  4EIF A;  3W67 A;  3A3Y B;  1VQO P;  1KIL E;  1R5L A;  1N2D C;  1YQ4 C;  2IBZ I;  3VYI A;  2R3C A;  2B9B A;  5APW A;  1SFC B;  1CCR A;  3FXE A;  5GTI H;  5AW6 B;  1W2L A;  3CXH I;  4GED B;  3V5B A;  1L9B C;  5APQ A;  1N73 A;  4U3F D;  1BGY J;  4I6M C;  3D70 A;  1KV9 A;  4L76 A;  2MKV A;  3D6Z A;  3TSI A;  2C9L Y;  2C8S A;  4H44 B;  1LT9 B;  2ZFC A;  3CX5 I;  4PV1 C;  2N1T D;  1SQB D;  2LXB A;  2V7Q J;  3CWB G;  1FJP A;  5B5E V;  3V2Q A;  1PP9 G;  1GQ1 A;  3HQ6 A;  4H0K A;  3BRT B;  3L36 A;  1T2K D;  1CXC A;  4YXD C;  1NTM E;  1IQC A;  3L4M A;  5CJ4 A;  3VOP A;  2E74 C;  3OAK A;  1PGO A;  5CIB B;  2K37 A;  1UII A;  1H89 A;  1QVG O;  2GIW A;  4B86 A;  5DJT B;  2NRG A;  1FZB A;  1GL2 D;  3RN1 A;  1G2C A;  5AVX B;  2Q5U A;  1DW0 A;  1M1J B;  4H13 B;  1QLE D;  2ZVN B;  2AEM A;  2UWJ E;  4XFJ A;  2ZJS E;  3SWK A;  1H32 B;  1BE3 G;  1RZ5 A;  3CU4 A;  1LTS C;  1URQ B;  1P84 H;  3G3Z A;  4BWN A;  2E42 A;  4DT0 A;  1I54 A;  1I6E A;  5AVT B;  1IRW A;  2Y0C A;  4EID A;  4IL6 H;  1NU1 D;  1FZA A;  2B87 A;  2W6J H;  1T6A A;  3QWO C;  2E76 C;  1J1E C;  3KPE A;  1LC1 A;  2OYH A;  3B71 A;  4GOE A;  2PCB B;  5AW0 B;  2KS1 B;  4J20 A;  1JCC A;  2E74 D;  3DMI A;  2VRS A;  1NTZ J;  2AIU A;  1YFC A;  1K3G A;  3ZOY A;  3WUU A;  2XZR A;  3H1I E;  4IL6 E;  2O01 J;  3DP5 A;  3M97 X;  1M60 A;  2WT7 A;  3CCR P;  1YTZ I;  2WTY A;  2SPZ A;  1FAV A;  3FWL A;  4BRY A;  3C2C A;  1WVE C;  1PL5 A;  3OA7 A;  4XE5 B;  3VMY A;  3H25 A;  4FA4 A;  2E5Y A;  1SQB K;  1AOQ A;  3R4Y A;  5AVY B;  2OZ1 A;  4AAO A;  3UIA A;  1OVR A;  4Y99 C;  4N0K A;  4M3L A;  1DW2 A;  2XKM A;  2W83 C;  3CCL P;  1MUU A;  2H89 C;  5KAI E;  2KSJ A;  1JY3 O;  4Y99 B;  1E8E A;  2KP8 A;  3N4X A;  1C7M A;  4HB1 A;  2Q7C A;  1GU5 A;  5TIS V;  4R4L A;  4UB6 H;  1NWQ A;  1GW3 A;  1T8Z A;  4H44 C;  4FA5 A;  1HF9 A;  1SQV J;  1OVU A;  1GD2 E;  1RAQ A;  2WZ7 A;  1LJ2 A;  5DJQ C;  4H13 D;  2QJK C;  1M70 A;  2XDJ A;  1IK9 A;  1RE3 A;  2JWA A;  2BPB B;  4W7Z A;  1L2P A;  1URQ C;  3H32 B;  3RBZ A;  3VMA A;  1CNO A;  2BLF B;  2YO2 A;  5KLV K;  1SFC C;  2C1D B;  4WB4 A;  3TYY A;  1NTK K;  3SVW A;  1YYC A;  1URQ D;  1KQS O;  3RK3 D;  1N9C A;  4BXL A;  3MIW A;  2WVR A;  1AJY A;  1CRG A;  1FZG A;  4WVZ A;  4FA9 A;  3L35 A;  2YKP A;  4UB6 V;  3IAO A;  1PPJ G;  2Y9Y A;  3HTK B;  1S1C X;  5E79 V;  2FXP A;  1GK4 A;  2CPB A;  3CCS P;  1KMI Z;  1SQP D;  3H1L J;  2ZT9 C;  4Y5R A;  1DIP A;  3O6Q B;  3LID A;  4D6T E;  1NMI A;  5TIS E;  1I55 A;  3P32 A;  1RE3 C;  1E29 A;  2Y0E A;  1VQP P;  2V07 A;  4EDF A;  3AE3 C;  3L75 J;  3WU2 E;  1GMJ A;  2NPS A;  3JCU E;  2K9Y A;  2JKV A;  2CK3 H;  1NU1 J;  1LFM A;  4Z1M H;  4K3I A;  2POH A;  1VF5 B;  2OYO A;  4XXL A;  4L3H A;  3BAT A;  3ITK A;  3S1K A;  1L0L G;  1VYD A;  4FA1 A;  2KXP B;  3L74 E;  3GG2 A;  1X0T A;  4L3G A;  2JP3 A;  1KIL B;  1RF1 B;  2CPS A;  4I1L A;  2KUB A;  4PD4 D;  1M56 D;  1OZH A;  1RH5 B;  2AEF A;  1EZV I;  3WFC C;  5KTB A;  4LLH A;  2XND H;  2NPS B;  1NTM J;  2OYH B;  1PP9 J;  3OW2 O;  1VF5 D;  3SFE C;  3PRJ A;  3PH2 B;  1X8Y A;  1B7V A;  1YJW P;  1SQP E;  1L0N J;  1COT A;  1LT9 C;  1NTZ K;  1NTK E;  2HFE D;  2R5B A;  5KAI H;  1SQQ K;  5AW3 B;  3TYI A;  2KS1 A;  4ZKP A;  3TDK A;  2C1U A;  3PH0 A;  2G3A A;  1E2R A;  3PXS A;  5KKZ B;  2O01 N;  1N7S B;  2N3B A;  1FDO A;  1L9J C;  1I6D A;  5B6Q A;  3U1C A;  3FWN A;  2Q1K A;  1CI6 A;  3RK3 B;  2Z5I A;  3PXW A;  1URQ A;  5KKZ C;  1DEB A;  1Y8A A;  2O1J A;  3ABV C;  2K9J A;  3P8C E;  3HQ9 A;  1SQB J;  2IDB A;  1KC8 Q;  1NML A;  4UB8 V;  1N73 C;  3RL0 C;  1RQV A;  4FB1 A;  2AEJ A;  2HV4 A;  1KFN A;  2WIT A;  2IPP A;  4TT3 H;  4O1Q A;  2BEZ F;  3E7K A;  2PAJ A;  2PGD A;  4YPC A;  3A2A A;  2QJP B;  3CX5 D;  3T97 A;  3DR0 A;  2FY8 A;  2JR8 A;  1K04 A;  3CD6 P;  1OIP A;  3A7O A;  1QN2 A;  3NTN A;  1KD1 Q;  3I55 P;  1L0N D;  1CYC A;  5KLV G;  1VQ5 P;  1KV4 A;  1CTY A;  3L75 E;  3L72 J;  5B66 E;  2N1T A;  4UB8 H;  1M57 D;  1QL3 A;  2CE1 A;  1RZ6 A;  1CTJ A;  1CRC A;  1Q2N A;  2OTJ P;  5APU A;  3V4Q A;  1FOS E;  2QG4 A;  3CC2 P;  1NIR A;  2JJL A;  1JCD A;  4PD4 H;  1W2B O;  3CXH E;  2OZ1 B;  2W6A A;  3JBT B;  3L70 G;  5AW7 B;  1PV3 A;  1FZF A;  3GHG B;  3RLM A;  1KX2 A;  1YIQ A;  2OYI B;  1J1E B;  2VHD A;  3BCC G;  1SQP K;  3CCJ P; 
#chains in the Genus database with same CATH homology
 2C8S A;  4O1W A;  1DVV A;  1CRI A;  2BH4 X;  2AI5 A;  3ZIY A;  2QJY B;  1OAE A;  1FI3 A;  1SQB D;  3VRD A;  3HQ8 A;  2EXV A;  5B5E V;  1NTM D;  1GQ1 A;  2ZON G;  3ZOW A;  3HQ6 A;  4H0K A;  1R0Q A;  1CXC A;  2C2C A;  1PP9 D;  1IQC A;  5CIF B;  1L0L D;  3OCD A;  3L4M A;  1NNO A;  4H0J A;  1HJ4 A;  1OCD A;  5CIB B;  2D0S A;  2ZXY A;  1N15 A;  4A7P A;  2GIW A;  4Q5P A;  1HH7 A;  1C2N A;  1DVH A;  3SLE A;  1SQQ D;  1CHJ A;  3RN1 A;  1KX7 A;  1CIE A;  1H33 B;  2B0Z B;  3BCC D;  2B12 B;  1CSX A;  1DW0 A;  3CWB D;  3VNW A;  1MZ4 A;  1QKS A;  1NTK D;  2B10 B;  1DW3 A;  1H32 A;  1KB0 A;  2C1V A;  2QJK B;  1H32 B;  5C9M A;  1WEJ F;  1RZ5 A;  2K9J B;  1YEA A;  2N18 C;  3SJL A;  3CU4 A;  1NTZ D;  2FRC A;  3ZOX A;  1I54 A;  2CA4 B;  3A0H V;  1I6E A;  2L91 A;  5CYT R;  1IRW A;  1LC2 A;  3OCD B;  2PAC A;  5CIH B;  2I8F A;  2Y0C A;  2ZZS 1;  2LIR A;  2JQR A;  1A56 A;  4FAN A;  3GW6 A;  1DW1 A;  3CXH W;  5KLV D;  4EID A;  2LIT A;  4PJ0 V;  1NU1 D;  2ORL A;  1C6O A;  2B4Z A;  5KLI B;  1FCD C;  4DY9 A;  3PTZ A;  1MG2 D;  1DII C;  5AUR A;  1LC1 A;  2PCB B;  2XTS B;  2D0W A;  2C9X B;  3TF5 A;  4J20 A;  4YE1 A;  1HRC A;  3DMI A;  2AIU A;  2BGV X;  1YFC A;  3CYT I;  1K3G A;  1C6R A;  3ZOY A;  2BCN B;  3DP5 A;  4WQ9 A;  3M97 X;  2MTA C;  4P4Q B;  3NWV A;  1M60 A;  2BCC D;  5DJQ B;  3PLN A;  3RN0 A;  4D6T D;  4LJI A;  3FWL A;  1CED A;  1SQV D;  1BGY D;  3CX5 W;  3C2C A;  1WVE C;  2YCC A;  4WQC A;  4FA4 A;  1HRO A;  1AOQ A;  1I5T A;  2Y0D A;  2OZ1 A;  4PWA A;  4AAO A;  4N0K A;  2CE0 A;  1CIG A;  1DW2 A;  3ORV A;  5EXQ A;  1U75 B;  1AYG A;  2GB8 B;  1E8E A;  1GIW A;  1SQX D;  1H9X A;  1C7M A;  5CIG B;  1BE3 D;  1CRJ A;  1H31 A;  1F1F A;  1W5C T;  1N50 A;  1GU2 A;  2O3J A;  5TIS V;  3WU2 V;  1K3H A;  3A0B V;  1YEB A;  4FA5 A;  2N9Y B;  5B66 V;  1RAQ A;  3PHL A;  1FJ0 A;  1FHB A;  5DJQ C;  3KHU A;  2MHM A;  3CXH D;  1I8P A;  1M70 A;  4AAM A;  2JWA A;  3H1L D;  2BPB B;  1M6Z A;  3L75 D;  3VMA A;  1CNO A;  2BLF B;  2A06 D;  3OA8 B;  2C1D B;  1LMS A;  3NBT A;  3SVW A;  1CIF A;  1J3S A;  1N9C A;  1CYJ A;  1CHI A;  3KZI V;  1YCC A;  1CRG A;  3O0R C;  3L71 D;  1DT1 A;  1C2R A;  4FA9 A;  2N18 B;  4EIC A;  3L74 D;  4UB6 V;  3RMZ A;  2DGE A;  4WQD A;  1FOC A;  5E79 V;  1IZL 0;  3MK7 C;  3H1J D;  1DIQ C;  2N9J A;  2PCC B;  2YIU B;  2YQB A;  1SQP D;  4RSZ A;  4L1Q A;  1KYO W;  4Y5R A;  1CCH A;  1AOF A;  1HJ3 A;  1CIH A;  3PXT A;  4MU8 A;  1S6V B;  3O20 A;  1GKS A;  3WFD C;  3VYM A;  1JDL A;  1NMI A;  2N3Y A;  5CIE B;  2RN0 A;  2GC4 D;  1I55 A;  2RMZ A;  2YK3 A;  4AAL A;  1E29 A;  155C A;  2N9I A;  2AXT V;  2Y0E A;  1PPJ D;  2V07 A;  1A2S A;  4EDF A;  3WC8 A;  1H9Y A;  3ZOO A;  1YNR A;  3O1Y A;  3TGU D;  1KIB A;  1LFM A;  5GTH V;  4K3I A;  1KYO D;  5H2F V;  1N90 A;  4XXL A;  4L3H A;  3MK7 B;  1CC5 A;  3ITK A;  2FYN B;  1GJQ A;  3CP5 A;  1HJ5 A;  2FYU D;  1YIC A;  4PW9 B;  1EZV D;  1VYD A;  4FA1 A;  1CTZ A;  3GG2 A;  4L3G A;  4NFG B;  4WQ7 A;  4AAN A;  4KMG A;  4PD4 D;  1I8O A;  2Q3E A;  3WFC C;  1QYZ A;  3ZCF A;  5CIC B;  1YTC A;  1CSU A;  5DF5 A;  1P84 D;  3PH2 B;  3PRJ A;  3SXT A;  1B7V A;  1CYI A;  3X39 A;  5KAF V;  1H1O A;  1COT A;  2B11 B;  3WUI A;  1CHH A;  1IO3 A;  3O5C A;  1S5L V;  2CXB A;  2GC7 D;  3TYI A;  2KS1 A;  1C6S A;  1COR A;  3TDK A;  2ZBO A;  3L70 D;  2C1U A;  1EB7 A;  2CA3 B;  1E2R A;  3PXS A;  5KKZ B;  2KNC B;  2N3B A;  1L9J C;  1I6D A;  1MG3 D;  1BCC D;  5B6Q A;  1C52 A;  4WQE A;  1CSV A;  2BH5 X;  5GTI V;  3PXW A;  4XYD B;  1CSW A;  1FI9 A;  3WFB C;  1C75 A;  2C1D A;  3HQ9 A;  1ZRT D;  1F1C A;  451C A;  4GYD A;  1NML A;  4UB8 V;  4IL6 V;  5TJH A;  4FB1 A;  1GDV A;  3NBS A;  1U74 B;  2HV4 A;  1FI7 A;  1ETP A;  2V08 A;  3SWS A;  1CRH A;  1CXA A;  4O1Q A;  4V2K A;  3HQ7 A;  1HZV A;  3H1K D;  4QAO A;  3OA8 A;  1HZU A;  5DFS A;  3L73 D;  1QL4 A;  2QJP B;  3CX5 D;  4JCG A;  3DR0 A;  2FWL A;  1BL9 A;  1HCM A;  2DVH A;  1H31 B;  1CRY A;  4RJT A;  4WQA A;  4WQB A;  1KB9 D;  1QN2 A;  3WFE C;  1H33 A;  1L0N D;  1CYC A;  2JTI B;  351C A;  4FAV A;  1CTY A;  2L4D A;  1AKK A;  4EIE A;  3H1I D;  1QL3 A;  1CO6 A;  2CE1 A;  1RZ6 A;  5KAI V;  1CTJ A;  1CRC A;  2ZOO A;  1RAP A;  3L72 D;  4EIF A;  1LS9 A;  3H1H D;  1IRV A;  2QG4 A;  1A8C A;  5C0Z A;  1ZZH A;  1NIR A;  5CID B;  3ZBM A;  1CCR A;  4AX3 A;  2OZ1 B;  4WQ8 A;  3JBT B;  5IY5 1;  1W2L A;  4GED B;  1L9B C;  3A9F A;  4U3F D;  3RLM A;  2IBZ D;  1KX2 A;  1YIQ A;  3L4O A;  2VHD A;  1KV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...