4PD4D

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
248
structure length
248
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
total genus 62
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4pd4D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4pd4D02
4JCGA 5CICB 3WFEC 1NU1D 1H9YA 3RMZA 1KYOW 3O0RC 2OZ1A 1C6SA 1CORA 1DVVA 5B66V 1QL3A 3ZIYA 2BGVX 1YICA 3TYIA 2D0WA 4FB1A 4N0KA 1IRVA 3FWLA 1CTZA 1DT1A 3PLNA 1E8EA 4L3HA 4L3GA 1IO3A 1QL4A 2DGEA 4WQDA 4U3FD 1L9BC 2B11B 3OCDB 1CYIA 2LIRA 2Q3EA 1SQPD 2C1DB 1FOCA 1YFCA 1KYOD 2N3BA 1SQVD 4EIDA 155CA 1HZUA 4EIFA 1C6RA 1CSVA 2XTSB 1LC2A 1FCDC 1H32A 1H31B 1S6VB 4AX3A 2C8SA 1MG3D 1A2SA 1FHBA 1FJ0A 4H0KA 3VMAA 4YE1A 4FA1A 2L4DA 2QJPB 1N90A 1KB0A 3A9FA 2N18B 1HH7A 3VNWA 3L74D 1AKKA 3PXSA 1GDVA 5KKZB 3L4OA 2EXVA 1LMSA 1CYCA 3SJLA 3RN1A 3OA8B 3PTZA 1PP9D 351CA 3SWSA 3ZCFA 1C2NA 4WQ9A 1I8PA 3DMIA 1CCRA 3CP5A 4Y5RA 4J20A 4K3IA 2KNCB 1YIQA 1K3HA 1NNOA 3WFDC 2N9IA 1C6OA 1C52A 1S5LV 2BCNB 3H1JD 3TF5A 3HQ6A 1M6ZA 1CRGA 1NTMD 2ZXYA 4XXLA 3OCDA 1P84D 3O20A 1ETPA 1NTKD 4IL6V 2CA3B 1M60A 1GJQA 1NTZD 4PW9B 3A0BV 3WU2V 1B7VA 3PH2B 3L72D 1I5TA 1CSWA 3A0HV 4MU8A 3VYMA 1COTA 1LC1A 1C7MA 1H1OA 2BCCD 1EZVD 5CIBB 3VRDA 2VHDA 2N9YB 3PRJA 1SQXD 3RN0A 1L9JC 2B10B 1L0ND 1CTJA 1CHIA 1QKSA 1ZZHA 3BCCD 4RJTA 2QJYB 2YQBA 1IRWA 1CCHA 4EIEA 5H2FV 1I54A 4GEDB 3CU4A 2V08A 2KS1A 2GIWA 1CO6A 2FRCA 2MTAC 1AYGA 2MHMA 3L71D 451CA 1J3SA 2ORLA 2BLFB 3H1KD 3WUIA 2ZBOA 2GC4D 2RN0A 2BH5X 4FANA 1MG2D 2CE0A 5IY51 1GU2A 5DJQB 1N9CA 1AOQA 5DFSA 5KAIV 2V07A 1DW2A 1N15A 3ZOYA 2CA4B 5CIFB 1PPJD 1CSUA 2AIUA 3M97X 4D6TD 4QAOA 5EXQA 2PCBB 4WQ7A 2RMZA 3KHUA 2YCCA 5GTIV 1KB9D 3MK7B 4H0JA 1WEJF 1MZ4A 3L70D 1H33A 1C2RA 3CWBD 2ZONG 1CEDA 2K9JB 2Y0EA 1CRJA 1YCCA 3ITKA 2C9XB 3O1YA 3WFBC 2BPBB 2Y0DA 5AURA 1GIWA 2JQRA 1YTCA 1I6EA 3SXTA 5DJQC 4L1QA 1OCDA 2A06D 4UB8V 4P4QB 2B12B 1FI9A 5CYTR 3HQ7A 1RAQA 4WQAA 5CIDB 1N50A 1SQQD 2YK3A 2ZZS1 2JWAA 3MK7C 5CIGB 5KAFV 1BCCD 2LITA 2N3YA 1CHHA 3GW6A 1DW0A 4AAOA 5DF5A 3C2CA 1KV9A 3O5CA 1EB7A 1BL9A 2FYUD 1CYJA 2FYNB 1E2RA 2OZ1B 1RZ6A 3L75D 3ZOXA 1SQBD 2C1DA 3CYTI 1A56A 1CIEA 1LFMA 4AALA 1U75B 1IQCA 4WQ8A 1CSXA 1H31A 4LJIA 1W5CT 1CRHA 3TGUD 3X39A 3H1HD 3NBTA 2D0SA 1YEBA 3GG2A 1U74B 1CIGA 4WQEA 1NIRA 1DVHA 5TJHA 3KZIV 2FWLA 1HJ4A 1CRCA 1CIFA 4NFGB 5KLIB 3OA8A 3SLEA 2C2CA 2O3JA 1H32B 1HZVA 1HRCA 3HQ9A 3WC8A 5GTHV 1CNOA 3NBSA 2AI5A 3L73D 1VYDA 1DIIC 3PXWA 4Q5PA 1CIHA 2I8FA 1HJ5A 1HJ3A 3DP5A 5CIHB 2PACA 4XYDB 2PCCB 1YNRA 1QN2A 3PHLA 1ZRTD 2HV4A 1M70A 2N9JA 3ZOOA 2BH4X 3TDKA 4WQCA 3H1ID 4A7PA 3CX5W 1CXCA 3ORVA 1HCMA 1CXAA 4UB6V 1KX2A 4FA9A 1F1CA 3RLMA 4V2KA 1I8OA 1AOFA 1GQ1A 1CTYA 1K3GA 2GC7D 5B6QA 4DY9A 4FAVA 2QJKB 1BGYD 1HROA 3PXTA 1RZ5A 1CRYA 1W2LA 1C75A 1LS9A 3CX5D 4KMGA 1QYZA 1R0QA 1DW1A 2IBZD 2AXTV 2B4ZA 1H9XA 2CE1A 3ZBMA 4WQBA 2C1UA 3CXHW 1KX7A 2L91A 4FA4A 4O1WA 2CXBA 5C9MA 1I55A 3DR0A 2C1VA 1DW3A 5C0ZA 1YEAA 4PD4D 3ZOWA 4FA5A 4EDFA 2GB8B 3L4MA 3WFCC 3H1LD 1BE3D 2ZOOA 1CHJA 1I6DA 2DVHA 1E29A 2N18C 3CXHD 1CC5A 1NMLA 1KIBA 2YIUB 1F1FA 1NMIA 2B0ZB 1FI7A 4AAMA 2QG4A 3SVWA 3HQ8A 1CRIA 1WVEC 5CIEB 1L0LD 4PWAA 5B5EV 1JDLA 1OAEA 5E79V 1GKSA 2JTIB 5TISV 4PJ0V 1RAPA 4RSZA 1A8CA 1FI3A 1H33B 3NWVA 4EICA 3JBTB 4O1QA 2Y0CA 4GYDA 1DIQC 1IZL0 4AANA 5KLVD
chains in the Genus database with same CATH superfamily
3NTNA 2HODA 2O01J 1CORA 1DVVA 3ZIYA 3M91A 1N7LA 1YICA 5KLVJ 4IFMA 4FB1A 4N0KA 1USEA 3FGAD 3LW5H 3PLNA 3B5NC 2O1JA 1VQ9P 3AE9C 4L3HA 2Q3IA 2B9BA 3L74E 2HLOA 2BCCG 2E76B 4GDOA 5KJ7C 3HD7C 2QJYC 2LIRA 3CPWO 2B89A 2WWWA 1FOCA 4U3FJ 4PD4E 3BCCG 4ZNCA 1KFMA 1JMMA 1EC5A 4EIDA 4EIFA 4KT0J 2XU6A 1VDFA 1H31B 4H0LD 2H43A 3ZDMA 3GHGB 1HUCA 1FJ0A 2WSSH 2AXTE 2AEJA 4FA1A 3E1RA 2L4DA 1S3JA 1JTHB 2E76C 2N18B 1HH7A 1X8YA 1AKKA 2E5TA 3L4OA 2EXVA 3H1KG 4IFDK 3SJLA 2WSCJ 1NTZE 3PTZA 1UIIA 3SWSA 1QEXA 1M1JB 2OYIA 1M90Q 3IFMA 3DMIA 1CCRA 1LTTC 2OYOA 4J20A 4K3IA 3BRVB 3CXHH 1NTMK 3WUTA 4K3AA 1PP9J 1LTSC 1WT6A 1NJIQ 3SWFA 4D6TG 1C52A 2P58A 1S5LV 1VQ5P 1M6ZA 1USDA 3O20A 1NTZK 1W2EA 4Z1MH 1NU1E 3MUDA 1GK6A 3PJSK 2CA3B 3AECC 1OX3A 2NRGA 3WU2V 1LT9B 3L72D 2FKWB 3VYMA 1H88A 1LC1A 1OW6A 1C7MA 2XZRA 2BCCD 1Y9BA 2VHDA 2B87A 3G71P 3K5BA 2W6BA 2B10B 1CHIA 3BCCD 1CW5A 3OAKA 1CSBA 1KYOE 1IRWA 1CCHA 3IF4A 1SQVE 2A45I 3L75G 1SQXJ 4GEDB 4RESB 1L4AD 3CU4A 2P67A 2GIWA 2LXCB 5E79H 5B66E 1BE3G 1SVFA 2MHMA 1VF5D 1J3SA 2ORLA 1QLED 3H1KD 2QM7A 2GC4D 2PAJA 4WBAA 5DJQB 4ASWA 5DFSA 1N15A 3FWNA 2AIUA 4D6TD 1BCCE 1RF1B 2WSCH 2RMZA 3KHUA 2YCCA 3KYQA 4UB6H 1VQOP 2WSFH 3RGUA 3HE4A 2WMMA 2Y0EA 2E5YA 1CRJA 2C9XB 1BSNA 4KHXA 5AW5B 3O1YA 1FAVA 1AVOA 2IPPA 3CXHI 1OZHA 1KILE 2KOGA 1DH3A 4I2LC 1I6EA 1RH5B 5DJQC 4L1QA 1URQB 4P4QB 1SQQK 2B12B 1FI9A 2AEFA 1NH4A 3HQ7A 1PIXA 5CMZA 5AW0B 2WPRA 1Y47A 3A7OA 2ZFCA 1QL1A 2YK3A 4JYCA 1KILC 1J1DC 2LITA 2N3YA 1IJDB 3TNUA 4XA4A 1EZVE 4AAOA 3JCUH 1K9MQ 1P84H 1EDIA 3CCEP 2KB7P 1TU3F 1H0TA 1YJ9P 1LTBC 1SQBK 1L0NE 2ZYGA 4JBZA 2HODB 1URQC 1CYJA 4ZKPA 4EYYQ 1SQPG 3L75D 4TT3H 3ZOXA 2C1DA 2M5AA 4H44C 1ZMEC 4BRYA 1DIPA 5APYA 2CPBA 1NO4A 1BDDA 1CRHA 1GL2D 1ZR2A 3X39A 4BWNA 5TISE 3GG2A 4PJ0E 5KTBA 5AVRB 4AANA 1NIRA 5TJHA 1LP1A 2Q7CA 1ZW0A 1XTGB 1Q90D 3P32A 3H1HJ 3SLEA 2O3JA 5AVVB 1HRCA 4ZKUA 2K3RA 2W90A 1SFCD 1YITP 2KLUA 2KNCA 1DIIC 4Q5PA 2LKMA 3L70E 3H1LG 3KDPB 3MHVA 1JY3P 1D7MA 1J1EB 4RKUJ 5AW4B 2G8YA 5CIHB 4GIFA 4XYDB 1JY3O 1FZEA 1QN2A 1ZRTD 1M70A 3ZOOA 1L4AA 1GK4A 3RK2B 2Y9ZA 2IBZE 2OYIB 3CX5W 1AJYA 3H1KJ 1DX7A 4UB6V 1YTZT 1KB9H 1NVOA 5KAIE 4OGQB 1T6AA 2QE7H 4GT1A 1AOFA 1BDCA 3FX0A 4OVNF 2O01N 4IOIH 3Q2YA 1S9KD 5B6QA 4DOJA 4FAVA 5GTIE 1BSHA 2QJKB 2YO3A 1CZQA 4D6TJ 1HWTC 1RZ5A 2FYUE 5L8RJ 1FBMA 1W2LA 3Q5SA 5K5GB 1C75A 5KLVG 2K1AA 2OYIC 1P84I 2H88C 4KMGA 1R0QA 1DW1A 2M3BA 4PV1B 3ZBMA 2SPZA 4WQBA 1YTZI 1YQ4C 1KX7A 2B87B 2L91A 4O1WA 4XFJA 2Q5UA 1LTJA 4U3FG 3MUDC 5C0ZA 1YEAA 4EIJA 3ZOWA 3SWKA 3WMM0 1PGJA 2GB8B 3CCQP 3L4MA 2YXQB 2OTLP 3H1LD 4I1LA 2BASA 5APXA 1I6DA 3L73E 3BVHA 3CXHD 1LNQA 2J5UA 1OVRA 1BE3J 1R5SA 3MGNA 3H1IE 1SP4A 3M0AA 1GL2A 4PWAA 3HUSB 1S72P 3I56P 1K04A 3P7KA 1A8CA 1SQXK 3IN6A 3NWVA 3HE4B 3A0HH 4OWFA 4O1QA 1RF0C 2Y0CA 4GYDA 2ZT9B 3BATA 3H1JG 1IZL0 1KB9I 2ZXXA 1NAYA 5KLVD 4JCGA 4HYTB 5CICB 3WFEC 2FYUG 1SFCA 4H13D 1KYOW 3KZIH 1C6SA 1NTKG 2P10A 3CC4P 2XDJA 3FWLA 1IRVA 1DT1A 1NU1J 1OXZA 5H2FH 2QVAA 5GTHH 3TNUB 4L3GA 2OQQA 1H89A 1IO3A 1QL4A 3M9QA 4U3FD 1L9BC 1T2KD 3H32A 4WY4D 3OCDB 1YYCA 2WPQA 4H0LC 4YPCA 3NMDA 1VQNP 3CX5H 1VQ8P 3D0WA 2M5AB 2C1DB 1KQSO 1IFJA 2N3BA 3L36A 4BRYB 155CA 3E1IA 4O9BA 1S1CX 1PGPA 4Y99C 1FCDC 1H32A 4AX3A 1AVYA 1SQPJ 4K35A 1FZFA 1MG3D 1A2SA 1FHBA 1MV8A 1JY3N 1KQGB 1SQVJ 1KB0A 1KN7A 3VNWA 2IDBA 2YKOA 3PXSA 1LP1B 2NPSD 5KAFE 4PD4H 3CC7P 1CYCA 3PH0A 1JCDA 1MFTA 1PP9D 3L72E 2M3EA 1VL2A 4HH2A 5BVZA 3RL0D 3D70A 2E75D 2WPVB 2KNCB 1YIQA 1K3HA 1PPJG 4AUWA 2PP6A 2BCNB 3H1JD 3M0DC 3SFEC 3TF5A 3AE3C 4LLHA 1CRGA 4KJMA 1P84D 1N7SD 1BGYG 3O6QB 3H1LJ 2R3SA 1NTKD 4PW9B 2A06G 1B7VA 3PH2B 5CCHD 3A3YB 3UIAA 3A0HV 3S1KA 2JR8A 3MP7B 1KTMA 2KUBA 5AVQB 2ZAEB 2JO1A 3KQGA 3VP8A 1L4AC 3OJAB 2C0WA 3PRJA 1SQXD 1HJ0A 1CTJA 2QJYB 2E74D 1VF5C 5H2FV 3VMZA 2K88A 1I54A 1IFMA 3CX5I 1QL2A 3H25A 3BRTB 5APQA 2GA1A 3A5TA 1N86A 2ZXEB 3WUIA 3H1HG 4L73A 3P8CD 1KYOH 3D6YA 1E5WA 1N9CA 1LTAC 1YI2P 1OW8A 1K73Q 1L0LG 3ZOYA 1GD2E 1PPJD 5B66H 1CSUA 3B71A 4QAOA 4DJGA 2PCBB 4WQ7A 1KMIZ 2W6AA 1KB9D 3MK7B 1LTJC 1H33A 2ZVNB 2POHA 1C2RA 2K9JB 2I1JA 1NTME 3ITKA 1JY2O 2Y0DA 5AURA 1W2BO 1YTCA 3SXTA 3L70J 5AVZB 1OCDA 2A06D 1G1IA 2V7QJ 1T3JA 4UB8V 1Q82Q 3CCVP 2C9NY 1Q86Q 5CYTR 1WRGA 4WQAA 2WSFJ 1QX8A 2M0BA 1Q2NA 3C1LA 3T97A 2KSEA 5CCGD 5AW6B 2JWAA 3W68A 3MK7C 2NPSA 3VN0A 2IZ0A 1KV9A 3HRNA 3N4XA 1S5LE 2KIKA 1BL9A 1GL2C 1EDLA 1S2EA 2GUSA 1MFZA 1RE3A 3H1JJ 3CYTI 1LFMA 1CIEA 5DJTB 1VQ6P 3Q5RA 2YNYA 5AW8B 2FYUJ 3JC22 2FYZA 1IQCA 5AVUB 1RQUA 2WTYA 3E7KA 3CCUP 1NTKJ 5B5EE 3L71E 1CI6A 3H32B 1JNMA 3H1HD 3NBTA 1OVVA 3L74G 1CIGA 4WQEA 1SFCC 5CCHA 3VTPC 3LIDA 1HJ4A 1CRCA 4AQRD 3TK1A 2C2CA 1YBKA 1H32B 1U7JA 3HQ9A 1KYOI 2IYPA 2OGUA 2JKVA 5CBOA 3QH9A 3WUVA 5TISH 1CIHA 4PJ0H 3CWBE 1HJ3A 4GKGA 4C7NA 2PGDA 2N1TD 4I7ZC 3B4SA 1DEBA 1K05A 1RF0A 3HE5A 4BXLA 2BH4X 4WQCA 2WITA 1OIPA 1CXCA 4NPFX 1E79H 1NTZG 4ZMDA 3V2RA 1HCMA 1X0TA 4N78D 2AEMA 1SQQE 1XTCC 3RLMA 1IZNB 2V7QH 3H1IJ 3D6ZA 2H7HA 1CTYA 1IFIA 5AW2B 3MIWA 2G3AA 2YMYA 4WB4A 1PFIA 1HH0A 1KILB 1J1DB 2KLVA 1PGQA 4R4LA 3B5ND 1HROA 1EXJA 1SQBE 3CX5D 1NU1G 5KJ7D 3HD7D 1BGYJ 3CL3D 3WUUA 4H44B 3P8MC 3CXHE 3RK3B 1JO5A 1VPCA 3R4YA 2C1UA 3TGUE 3II6A 5GTIH 1L2PA 1JOCA 3RK3E 2KK7A 1EZVI 2LXBA 4QMAA 1RE4A 4PD4D 2E76D 4FA5A 1PGOA 4HJGH 4EDFA 1ZP0C 1SQVG 3RK3C 1BE3D 2ZOOA 1JY2N 1N73A 3RBZA 5AW7B 2WZ7A 3A0BE 2DW3A 1SLQA 2LR2A 2FFDC 2K9YA 4AAMA 2YMKA 2QG4A 3M0DA 1RQVA 3SVWA 3CCLP 5CIEB 4IL6X 2BEQD 5E79V 2I1KA 2JTIB 4IL6H 5TISV 4PJ0V 2WQYC 1PV3A 1H33B 1L0LJ 1BCCG 5KLVK 2Z5HA 3MTUE 3M9BA 1FC2C 3G9RA 2KYVA 1NWQA 1NU1D 1H9YA 1GU4A 3RMZA 2OZ1A 1ZLLA 1T2KC 1X22A 3T97B 2BGVX 3TYIA 2D0WA 1CTZA 3SSUA 2IYOA 3KPEA 1IC2A 4UB6E 2DGEA 2MKVA 2B11B 1EZVG 1CYIA 2D2CB 1SQPD 1PP9E 1L0NG 2WVRA 3VOPA 3U1AA 1KYOD 1J2JB 4JPZB 1SQVD 1KORA 1C6RA 1CSVA 2XTSB 2KSJA 2GUVA 2NPSC 4AYCA 4L75A 4W7ZA 2WT7A 3VMAA 1FJPA 2QJPB 4DCKA 1N90A 3A9FA 3JCUE 4LGDE 2OTJP 2D2CC 2W83C 1GDVA 5KKZB 2FXPA 3RL0C 2ZYDA 1LMSA 1RE3C 3RN1A 1EDKA 1GW4A 3L74J 3ZCFA 1C2NA 1N7SC 3S4RA 1KD1Q 1JCCA 2N9IA 1U7MA 2JP3A 2QJPC 1EDJA 1LTIC 3O8ZA 1SQXE 3HQ6A 1S4XA 3L70G 2ZXYA 1HGZA 5CCHC 1NTKK 5KAFH 5KKZC 4XXLA 1ETPA 3HE5B 4IL6V 2W6JH 1OWAA 1GJQA 1GU5A 4W80A 2IBZG 1I5TA 1CSWA 1URQD 3AE5C 3GHGA 2CK3H 1NTZJ 2E74C 1Q81Q 1EZVD 5CIBB 1JTHA 3JSVC 3CMAP 5CHXA 3I5CA 3CI9A 1MZ9A 1L0ND 1QKSA 3V6IA 4H0LB 1FS0E 2YQBA 4YXDC 4JQ0D 1KQLA 1IFNA 3AE4C 2KS1A 1W5CE 2MTAC 3Q5PA 4Y99B 4RO0A 1YQ3C 2BLFB 2HYNA 1H0TB 2R5DA 2RN0A 2BH5X 4FANA 5APUA 5IY51 5KLIC 3L71J 4EI2A 2O1KA 4GOEA 1DD4A 3M97X 1N73B 5M1BA 4H0JA 3L70D 1EQ7A 3F5HA 1AA0A 1R8EA 2HFED 3AEFC 3L73G 1YCCA 3WFBC 1RE4C 1GIWA 2J59M 3CWBJ 3EQ2A 3Q1MA 1M8OB 2JEEA 1KFNA 4LC1A 2UWJE 2ITAA 3H1IG 5BU5A 1GW3A 1N73C 4XE5B 1N50A 3RK2D 2AXTH 5CIGB 5KAFV 1ZOYC 2BCCE 1VQLP 1NYHA 4OGQD 3FXDA 3O5CA 1BCCJ 3BCCE 2FYUD 1L4AB 1VQMP 2FYNB 1E2RA 2OZ1B 1RZ6A 1NHLA 3QWOC 4AALA 1VF5B 4WQ8A 3AE2C 1RF1A 2KXPB 2L5GB 3VYIA 2PFXA 3GMAA 1N8RQ 1S5LX 3A0HE 3L35A 4PV1D 2D0SA 1YEBA 3H1KE 1S5LH 3IAOA 1U74B 1DVHA 2FFDA 2FYNC 3TGUJ 3KZIV 5CBNA 3OA8A 5AVXB 3WC8A 5GTHV 4D6TE 1L0NJ 1LTGC 2WT7B 5H2FE 5B5EH 3NBSA 2RH0A 2AI5A 3L73D 4NPEA 1WMKA 3GLMA 2YIUC 3CCMP 1M1KQ 2I8FA 1KZUB 5APSA 3EFGA 4ASVA 3DP5A 1FZCC 5AVWB 1LTJB 2PACA 2IX7C 2KZIA 4B86A 2PCCB 2HPCA 2HV4A 2N9JA 1MKMA 3VP9A 1A02F 3CX5E 3H1ID 3L72G 1KX2A 2YKPA 4PD4I 1I8OA 1GQ1A 4WY4A 4YTPC 2A45H 1JY2P 3V2NA 1G2CA 1BGYD 3PXTA 1ZV8A 2AXCA 1JUNA 3GF3A 3L75E 2ZT9D 3L37A 3SWYA 1LS9A 1GL2B 1FDMA 1FJKA 1FOSE 2AXTV 5AVSB 2B4ZA 1BE3E 4JYBA 4UB8E 1NAFA 2H8PD 2Q9IA 2C9LY 1Q7YQ 4FA4A 3AEGC 3SFDC 1YJNP 2CXBA 4M3LA 2JDIH 4IFFA 1I55A 1DW3A 1NKZB 1SFCB 1KC8Q 2KS1B 3GHGC 2H89C 1NGMB 3F89A 2P7JA 1AFOA 2DVHA 3AEDC 1E29A 1N2DC 2OTKE 2N18C 3WU2E 1N7SA 1CC5A 3G6EP 1NMLA 1KIBA 1F1FA 1ZRTE 2ZVOB 4I6MC 4C46A 1M1JC 4I7ZB 1CRIA 1WVEC 1L0LD 5B5EV 1JDLA 2R44A 1GKSA 5APWA 5AW1B 2FXOA 1U57A 2O01H 1FU1A 3A0BH 2W27A 1FI3A 1LWUA 3CCJP 2E43A 1FDIA 1S9KE 1NU1K 1DIQC 1SQPE 1NTMG 3USSA 2NZ2A 3L73J 1AV1A 4Y28J 1LT9C 3C8VA 1IK7A 3O0RC 5B66V 2MJZA 1QL3A 1AQTA 2IZ1A 3VMYA 4C7RA 2XKMA 2K37A 1GZLA 3KXDA 1E8EA 4WQDA 3NFQA 1SQPK 3V5BA 4GOFA 3HTKA 3C9IA 2YO2A 1SQVK 2Q3EA 1M57D 1T8ZA 4JF7A 1M7LA 1RY3A 1YFCA 1GMJA 3V2QA 2P1JA 2R32A 1HZUA 3CMEP 3HUSA 3TYYA 1LC2A 1S6VB 3BASA 4DT0A 2C8SA 4OH8B 3H1LE 4WVZA 5KAIH 5APTA 4H0KA 4YE1A 1GTWA 1FE6A 2XNDH 1VQKP 1PZQA 3L71G 3L74D 2FFDB 1KV4A 3V4WA 3OA8B 2Z5IA 351CA 2WPSA 5CJ4A 5CCGA 1GDTA 4WQ9A 1I8PA 1RF1C 3CC2P 4N3YB 3CP5A 4Y5RA 3D71A 1NNOA 3WFDC 2CPSA 3G4SP 1NOHA 1M56D 1C6OA 4NPDA 4H13B 3TSIA 2HPCB 1NTMD 3OCDA 3CWBG 3LIEA 5KLVE 4YXWH 2KZJA 2A45G 3MZWB 3OA7A 2HG5D 1M60A 1MUUA 3ABVC 3GF7A 2OYHA 1NTZD 2N9BA 3A0BV 3CCSP 3AEBC 1OFCX 1KQFB 4MU8A 1QVFO 4TLFA 4WY4B 1COTA 1OMIA 1SQQG 5E79E 1YJWP 1H1OA 1L0NK 1G2CB 3G3ZA 1T3UA 3VRDA 3L72J 4H13C 4U3FE 2N9YB 2QA4P 4EOTA 3RN0A 1L9JC 3AE1C 1ZZHA 4RJTA 2BCCJ 1HTLC 2RKLA 4EIEA 2R3CA 4WWIA 3AEEC 1SQBG 1NKNA 2V08A 1HJBA 3BCCJ 2Y9YA 4R4MA 4WY4C 1CO6A 2FRCA 3M9HA 1QGKB 2IBZI 1AYGA 2NPSB 1R5LA 3L71D 2N1TA 451CA 4W7YA 3R2PA 4HKZH 1X9VA 3TGUG 1HGVA 2ZBOA 2WSEJ 3O6QA 1MG2D 2CE0A 2IFMA 1GU2A 1FZCA 3AEAC 3AE7C 3RL0B 2FY8A 2E75B 5DJUB 2QSIA 1EXIA 1AOQA 5KAIV 2V07A 1DW2A 2CA4B 5CIFB 1YIJP 2BEZF 2P2UA 5EXQA 1J1EC 1N7SB 5GTIV 3RBXA 1WEJF 1MZ4A 3B5NA 3H1JE 1CI6B 3CWBD 5AW9B 2ZONG 1CEDA 2XNXA 2QRXA 1P84E 2ZJSE 2BPBB 2W8ZA 3RK2C 3U1CA 2JQRA 5KJ7A 3HD7A 2E75C 1H8AA 1LGHB 1NTKE 1OVUA 1JEKA 1IFPA 2C0XA 1RAQA 2E42A 1FDOA 1ZR4A 4OGQC 5CIDB 1IO4A 1SQQD 1LWUB 2ZZS1 1HVVA 1BCCD 4DZOA 1CHHA 2M8RA 3GW6A 1DW0A 2QJKC 2FYUK 5DF5A 2E74B 3C2CA 4C7NB 1VQ7P 1OW7A 3V2PA 1EB7A 1Z56A 1KILD 2B88A 3NXSA 1SQBD 4PV1C 1A56A 1U75B 4L74A 1NTMJ 2YXRB 2YKQA 4IL6E 1LWUC 1CSXA 3L75J 1H31A 4LJIA 1W5CT 2KP8A 3TGUD 2Q1KA 3RL0g 3HTKB 2K9JA 2XV5A 2FBWC 3S9OA 4H44D 3VMXA 3AE8C 5BU8B 1X79B 3RK3D 3P8CE 5AW3B 2FWLA 1CIFA 4NFGB 5KLIB 1PP9G 1ZXGA 1HZVA 2WSEH 1PPJE 2Q6QA 1M1JA 1RHZB 3N7NA 1YHQP 1CNOA 2GM4A 1VYDA 1KB9E 3PXWA 1HJ5A 5CJ0A 1A02J 1BGYE 1PL5A 2OARA 3U59A 2VRSA 1YNRA 3PHLA 2A06E 5AVTB 3TDKA 3B8EB 3HUSC 4A7PA 1IFDA 1JM0A 4N6JA 3ORVA 5C39A 1IK9A 4MN4C 1FZBA 1CXAA 1DEEG 1LT9A 2V4HA 4FA9A 1F1CA 4V2KA 4U7JA 1K3GA 2ZT9C 2GC7D 3I55P 1JMBA 3AE6C 4DY9A 3A2AA 3L4FA 1SQXG 2FXMA 3Q3DA 3LW5J 1CRYA 5CCGC 2OYHB 2JWDA 5APVA 3PP5A 1QYZA 1QVGO 2IBZD 1VQ4P 3H6PA 1H9XA 2ZYAA 4CPGA 2CE1A 3CD6P 1HBWA 3CXHW 1FZAA 2J58A 3OW2O 4HB1A 3H1HE 3CCRP 1G1JA 1SS1A 3V4QA 3EFFK 5AVYB 4L76A 5C9MA 1LJ2A 3DR0A 1SQQJ 2C1VA 2OYHC 1L0LE 4GODA 2D2CD 3W67A 4UB8H 3FXEA 2QIWA 3WFCC 1K8AQ 1CHJA 1LT1A 1VQPP 2N1TB 1FZGA 1DD3A 1SQBJ 1ZN5A 3M06A 1KILA 2YIUB 1NMIA 2B0ZB 1FI7A 1L0LK 1FZCB 1JB0J 2I8DA 1FOSF 3HQ8A 3MD0A 1URQA 2HR3A 2PRRA 2KI7B 3KZIE 1OAEA 2JJLA 4N78E 1UIXA 1AQ5A 3IR9A 1RAPA 4RSZA 3WU2H 2N1TC 2IFNA 3B5NB 1Y8AA 1HF9A 2R5BA 4EICA 5GTHE 3JBTB 2Z4EA 5EFWB 3CLQA 2QEXP 2QM8A 3HD7B 3EWKA
chains in the Genus database with same CATH topology
4JCGA 5CICB 3WFEC 1NU1D 1H9YA 3RMZA 1KYOW 3O0RC 2OZ1A 1C6SA 1CORA 1DVVA 5B66V 1QL3A 3ZIYA 2BGVX 1YICA 3TYIA 2D0WA 4FB1A 4N0KA 1IRVA 3FWLA 1CTZA 1DT1A 3PLNA 1E8EA 4L3HA 4L3GA 1IO3A 1QL4A 2DGEA 4WQDA 4U3FD 1L9BC 2B11B 3OCDB 1CYIA 2LIRA 2Q3EA 1SQPD 2C1DB 1FOCA 1YFCA 1KYOD 2N3BA 1SQVD 4EIDA 155CA 1HZUA 4EIFA 1C6RA 1CSVA 2XTSB 1LC2A 1FCDC 1H32A 1H31B 1S6VB 4AX3A 2C8SA 1MG3D 1A2SA 1FHBA 1FJ0A 4H0KA 3VMAA 4YE1A 4FA1A 2L4DA 2QJPB 1N90A 1KB0A 3A9FA 2N18B 1HH7A 3VNWA 3L74D 1AKKA 3PXSA 1GDVA 5KKZB 3L4OA 2EXVA 1LMSA 1CYCA 3SJLA 3RN1A 3OA8B 3PTZA 1PP9D 351CA 3SWSA 3ZCFA 1C2NA 4WQ9A 1I8PA 3DMIA 1CCRA 3CP5A 4Y5RA 4J20A 4K3IA 2KNCB 1YIQA 1K3HA 1NNOA 3WFDC 2N9IA 1C6OA 1C52A 1S5LV 2BCNB 3H1JD 3TF5A 3HQ6A 1M6ZA 1CRGA 1NTMD 2ZXYA 4XXLA 3OCDA 1P84D 3O20A 1ETPA 1NTKD 4IL6V 2CA3B 1M60A 1GJQA 1NTZD 4PW9B 3A0BV 3WU2V 1B7VA 3PH2B 3L72D 1I5TA 1CSWA 3A0HV 4MU8A 3VYMA 1COTA 1LC1A 1C7MA 1H1OA 2BCCD 1EZVD 5CIBB 3VRDA 2VHDA 2N9YB 3PRJA 1SQXD 3RN0A 1L9JC 2B10B 1L0ND 1CTJA 1CHIA 1QKSA 1ZZHA 3BCCD 4RJTA 2QJYB 2YQBA 1IRWA 1CCHA 4EIEA 5H2FV 1I54A 4GEDB 3CU4A 2V08A 2KS1A 2GIWA 1CO6A 2FRCA 2MTAC 1AYGA 2MHMA 3L71D 451CA 1J3SA 2ORLA 2BLFB 3H1KD 3WUIA 2ZBOA 2GC4D 2RN0A 2BH5X 4FANA 1MG2D 2CE0A 5IY51 1GU2A 5DJQB 1N9CA 1AOQA 5DFSA 5KAIV 2V07A 1DW2A 1N15A 3ZOYA 2CA4B 5CIFB 1PPJD 1CSUA 2AIUA 3M97X 4D6TD 4QAOA 5EXQA 2PCBB 4WQ7A 2RMZA 3KHUA 2YCCA 5GTIV 1KB9D 3MK7B 4H0JA 1WEJF 1MZ4A 3L70D 1H33A 1C2RA 3CWBD 2ZONG 1CEDA 2K9JB 2Y0EA 1CRJA 1YCCA 3ITKA 2C9XB 3O1YA 3WFBC 2BPBB 2Y0DA 5AURA 1GIWA 2JQRA 1YTCA 1I6EA 3SXTA 5DJQC 4L1QA 1OCDA 2A06D 4UB8V 4P4QB 2B12B 1FI9A 5CYTR 3HQ7A 1RAQA 4WQAA 5CIDB 1N50A 1SQQD 2YK3A 2ZZS1 2JWAA 3MK7C 5CIGB 5KAFV 1BCCD 2LITA 2N3YA 1CHHA 3GW6A 1DW0A 4AAOA 5DF5A 3C2CA 1KV9A 3O5CA 1EB7A 1BL9A 2FYUD 1CYJA 2FYNB 1E2RA 2OZ1B 1RZ6A 3L75D 3ZOXA 1SQBD 2C1DA 3CYTI 1A56A 1CIEA 1LFMA 4AALA 1U75B 1IQCA 4WQ8A 1CSXA 1H31A 4LJIA 1W5CT 1CRHA 3TGUD 3X39A 3H1HD 3NBTA 2D0SA 1YEBA 3GG2A 1U74B 1CIGA 4WQEA 1NIRA 1DVHA 5TJHA 3KZIV 2FWLA 1HJ4A 1CRCA 1CIFA 4NFGB 5KLIB 3OA8A 3SLEA 2C2CA 2O3JA 1H32B 1HZVA 1HRCA 3HQ9A 3WC8A 5GTHV 1CNOA 3NBSA 2AI5A 3L73D 1VYDA 1DIIC 3PXWA 4Q5PA 1CIHA 2I8FA 1HJ5A 1HJ3A 3DP5A 5CIHB 2PACA 4XYDB 2PCCB 1YNRA 1QN2A 3PHLA 1ZRTD 2HV4A 1M70A 2N9JA 3ZOOA 2BH4X 3TDKA 4WQCA 3H1ID 4A7PA 3CX5W 1CXCA 3ORVA 1HCMA 1CXAA 4UB6V 1KX2A 4FA9A 1F1CA 3RLMA 4V2KA 1I8OA 1AOFA 1GQ1A 1CTYA 1K3GA 2GC7D 5B6QA 4DY9A 4FAVA 2QJKB 1BGYD 1HROA 3PXTA 1RZ5A 1CRYA 1W2LA 1C75A 1LS9A 3CX5D 4KMGA 1QYZA 1R0QA 1DW1A 2IBZD 2AXTV 2B4ZA 1H9XA 2CE1A 3ZBMA 4WQBA 2C1UA 3CXHW 1KX7A 2L91A 4FA4A 4O1WA 2CXBA 5C9MA 1I55A 3DR0A 2C1VA 1DW3A 5C0ZA 1YEAA 4PD4D 3ZOWA 4FA5A 4EDFA 2GB8B 3L4MA 3WFCC 3H1LD 1BE3D 2ZOOA 1CHJA 1I6DA 2DVHA 1E29A 2N18C 3CXHD 1CC5A 1NMLA 1KIBA 2YIUB 1F1FA 1NMIA 2B0ZB 1FI7A 4AAMA 2QG4A 3SVWA 3HQ8A 1CRIA 1WVEC 5CIEB 1L0LD 4PWAA 5B5EV 1JDLA 1OAEA 5E79V 1GKSA 2JTIB 5TISV 4PJ0V 1RAPA 4RSZA 1A8CA 1FI3A 1H33B 3NWVA 4EICA 3JBTB 4O1QA 2Y0CA 4GYDA 1DIQC 1IZL0 4AANA 5KLVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCG A;  5CIC B;  3WFE C;  1NU1 D;  1H9Y A;  3RMZ A;  1KYO W;  3O0R C;  2OZ1 A;  1C6S A;  1COR A;  1DVV A;  5B66 V;  1QL3 A;  3ZIY A;  2BGV X;  1YIC A;  3TYI A;  2D0W A;  4FB1 A;  4N0K A;  1IRV A;  3FWL A;  1CTZ A;  1DT1 A;  3PLN A;  1E8E A;  4L3H A;  4L3G A;  1IO3 A;  1QL4 A;  2DGE A;  4WQD A;  4U3F D;  1L9B C;  2B11 B;  3OCD B;  1CYI A;  2LIR A;  2Q3E A;  1SQP D;  2C1D B;  1FOC A;  1YFC A;  1KYO D;  2N3B A;  1SQV D;  4EID A;  155C A;  1HZU A;  4EIF A;  1C6R A;  1CSV A;  2XTS B;  1LC2 A;  1FCD C;  1H32 A;  1H31 B;  1S6V B;  4AX3 A;  2C8S A;  1MG3 D;  1A2S A;  1FHB A;  1FJ0 A;  4H0K A;  3VMA A;  4YE1 A;  4FA1 A;  2L4D A;  2QJP B;  1N90 A;  1KB0 A;  3A9F A;  2N18 B;  1HH7 A;  3VNW A;  3L74 D;  1AKK A;  3PXS A;  1GDV A;  5KKZ B;  3L4O A;  2EXV A;  1LMS A;  1CYC A;  3SJL A;  3RN1 A;  3OA8 B;  3PTZ A;  1PP9 D;  351C A;  3SWS A;  3ZCF A;  1C2N A;  4WQ9 A;  1I8P A;  3DMI A;  1CCR A;  3CP5 A;  4Y5R A;  4J20 A;  4K3I A;  2KNC B;  1YIQ A;  1K3H A;  1NNO A;  3WFD C;  2N9I A;  1C6O A;  1C52 A;  1S5L V;  2BCN B;  3H1J D;  3TF5 A;  3HQ6 A;  1M6Z A;  1CRG A;  1NTM D;  2ZXY A;  4XXL A;  3OCD A;  1P84 D;  3O20 A;  1ETP A;  1NTK D;  4IL6 V;  2CA3 B;  1M60 A;  1GJQ A;  1NTZ D;  4PW9 B;  3A0B V;  3WU2 V;  1B7V A;  3PH2 B;  3L72 D;  1I5T A;  1CSW A;  3A0H V;  4MU8 A;  3VYM A;  1COT A;  1LC1 A;  1C7M A;  1H1O A;  2BCC D;  1EZV D;  5CIB B;  3VRD A;  2VHD A;  2N9Y B;  3PRJ A;  1SQX D;  3RN0 A;  1L9J C;  2B10 B;  1L0N D;  1CTJ A;  1CHI A;  1QKS A;  1ZZH A;  3BCC D;  4RJT A;  2QJY B;  2YQB A;  1IRW A;  1CCH A;  4EIE A;  5H2F V;  1I54 A;  4GED B;  3CU4 A;  2V08 A;  2KS1 A;  2GIW A;  1CO6 A;  2FRC A;  2MTA C;  1AYG A;  2MHM A;  3L71 D;  451C A;  1J3S A;  2ORL A;  2BLF B;  3H1K D;  3WUI A;  2ZBO A;  2GC4 D;  2RN0 A;  2BH5 X;  4FAN A;  1MG2 D;  2CE0 A;  5IY5 1;  1GU2 A;  5DJQ B;  1N9C A;  1AOQ A;  5DFS A;  5KAI V;  2V07 A;  1DW2 A;  1N15 A;  3ZOY A;  2CA4 B;  5CIF B;  1PPJ D;  1CSU A;  2AIU A;  3M97 X;  4D6T D;  4QAO A;  5EXQ A;  2PCB B;  4WQ7 A;  2RMZ A;  3KHU A;  2YCC A;  5GTI V;  1KB9 D;  3MK7 B;  4H0J A;  1WEJ F;  1MZ4 A;  3L70 D;  1H33 A;  1C2R A;  3CWB D;  2ZON G;  1CED A;  2K9J B;  2Y0E A;  1CRJ A;  1YCC A;  3ITK A;  2C9X B;  3O1Y A;  3WFB C;  2BPB B;  2Y0D A;  5AUR A;  1GIW A;  2JQR A;  1YTC A;  1I6E A;  3SXT A;  5DJQ C;  4L1Q A;  1OCD A;  2A06 D;  4UB8 V;  4P4Q B;  2B12 B;  1FI9 A;  5CYT R;  3HQ7 A;  1RAQ A;  4WQA A;  5CID B;  1N50 A;  1SQQ D;  2YK3 A;  2ZZS 1;  2JWA A;  3MK7 C;  5CIG B;  5KAF V;  1BCC D;  2LIT A;  2N3Y A;  1CHH A;  3GW6 A;  1DW0 A;  4AAO A;  5DF5 A;  3C2C A;  1KV9 A;  3O5C A;  1EB7 A;  1BL9 A;  2FYU D;  1CYJ A;  2FYN B;  1E2R A;  2OZ1 B;  1RZ6 A;  3L75 D;  3ZOX A;  1SQB D;  2C1D A;  3CYT I;  1A56 A;  1CIE A;  1LFM A;  4AAL A;  1U75 B;  1IQC A;  4WQ8 A;  1CSX A;  1H31 A;  4LJI A;  1W5C T;  1CRH A;  3TGU D;  3X39 A;  3H1H D;  3NBT A;  2D0S A;  1YEB A;  3GG2 A;  1U74 B;  1CIG A;  4WQE A;  1NIR A;  1DVH A;  5TJH A;  3KZI V;  2FWL A;  1HJ4 A;  1CRC A;  1CIF A;  4NFG B;  5KLI B;  3OA8 A;  3SLE A;  2C2C A;  2O3J A;  1H32 B;  1HZV A;  1HRC A;  3HQ9 A;  3WC8 A;  5GTH V;  1CNO A;  3NBS A;  2AI5 A;  3L73 D;  1VYD A;  1DII C;  3PXW A;  4Q5P A;  1CIH A;  2I8F A;  1HJ5 A;  1HJ3 A;  3DP5 A;  5CIH B;  2PAC A;  4XYD B;  2PCC B;  1YNR A;  1QN2 A;  3PHL A;  1ZRT D;  2HV4 A;  1M70 A;  2N9J A;  3ZOO A;  2BH4 X;  3TDK A;  4WQC A;  3H1I D;  4A7P A;  3CX5 W;  1CXC A;  3ORV A;  1HCM A;  1CXA A;  4UB6 V;  1KX2 A;  4FA9 A;  1F1C A;  3RLM A;  4V2K A;  1I8O A;  1AOF A;  1GQ1 A;  1CTY A;  1K3G A;  2GC7 D;  5B6Q A;  4DY9 A;  4FAV A;  2QJK B;  1BGY D;  1HRO A;  3PXT A;  1RZ5 A;  1CRY A;  1W2L A;  1C75 A;  1LS9 A;  3CX5 D;  4KMG A;  1QYZ A;  1R0Q A;  1DW1 A;  2IBZ D;  2AXT V;  2B4Z A;  1H9X A;  2CE1 A;  3ZBM A;  4WQB A;  2C1U A;  3CXH W;  1KX7 A;  2L91 A;  4FA4 A;  4O1W A;  2CXB A;  5C9M A;  1I55 A;  3DR0 A;  2C1V A;  1DW3 A;  5C0Z A;  1YEA A;  4PD4 D;  3ZOW A;  4FA5 A;  4EDF A;  2GB8 B;  3L4M A;  3WFC C;  3H1L D;  1BE3 D;  2ZOO A;  1CHJ A;  1I6D A;  2DVH A;  1E29 A;  2N18 C;  3CXH D;  1CC5 A;  1NML A;  1KIB A;  2YIU B;  1F1F A;  1NMI A;  2B0Z B;  1FI7 A;  4AAM A;  2QG4 A;  3SVW A;  3HQ8 A;  1CRI A;  1WVE C;  5CIE B;  1L0L D;  4PWA A;  5B5E V;  1JDL A;  1OAE A;  5E79 V;  1GKS A;  2JTI B;  5TIS V;  4PJ0 V;  1RAP A;  4RSZ A;  1A8C A;  1FI3 A;  1H33 B;  3NWV A;  4EIC A;  3JBT B;  4O1Q A;  2Y0C A;  4GYD A;  1DIQ C;  1IZL 0;  4AAN A;  5KLV D; 
#chains in the Genus database with same CATH topology
 3NTN A;  2HOD A;  2O01 J;  1COR A;  1DVV A;  3ZIY A;  3M91 A;  1N7L A;  1YIC A;  5KLV J;  4IFM A;  4FB1 A;  4N0K A;  1USE A;  3FGA D;  3LW5 H;  3PLN A;  3B5N C;  2O1J A;  1VQ9 P;  3AE9 C;  4L3H A;  2Q3I A;  2B9B A;  3L74 E;  2HLO A;  2BCC G;  2E76 B;  4GDO A;  5KJ7 C;  3HD7 C;  2QJY C;  2LIR A;  3CPW O;  2B89 A;  2WWW A;  1FOC A;  4U3F J;  4PD4 E;  3BCC G;  4ZNC A;  1KFM A;  1JMM A;  1EC5 A;  4EID A;  4EIF A;  4KT0 J;  2XU6 A;  1VDF A;  1H31 B;  4H0L D;  2H43 A;  3ZDM A;  3GHG B;  1HUC A;  1FJ0 A;  2WSS H;  2AXT E;  2AEJ A;  4FA1 A;  3E1R A;  2L4D A;  1S3J A;  1JTH B;  2E76 C;  2N18 B;  1HH7 A;  1X8Y A;  1AKK A;  2E5T A;  3L4O A;  2EXV A;  3H1K G;  4IFD K;  3SJL A;  2WSC J;  1NTZ E;  3PTZ A;  1UII A;  3SWS A;  1QEX A;  1M1J B;  2OYI A;  1M90 Q;  3IFM A;  3DMI A;  1CCR A;  1LTT C;  2OYO A;  4J20 A;  4K3I A;  3BRV B;  3CXH H;  1NTM K;  3WUT A;  4K3A A;  1PP9 J;  1LTS C;  1WT6 A;  1NJI Q;  3SWF A;  4D6T G;  1C52 A;  2P58 A;  1S5L V;  1VQ5 P;  1M6Z A;  1USD A;  3O20 A;  1NTZ K;  1W2E A;  4Z1M H;  1NU1 E;  3MUD A;  1GK6 A;  3PJS K;  2CA3 B;  3AEC C;  1OX3 A;  2NRG A;  3WU2 V;  1LT9 B;  3L72 D;  2FKW B;  3VYM A;  1H88 A;  1LC1 A;  1OW6 A;  1C7M A;  2XZR A;  2BCC D;  1Y9B A;  2VHD A;  2B87 A;  3G71 P;  3K5B A;  2W6B A;  2B10 B;  1CHI A;  3BCC D;  1CW5 A;  3OAK A;  1CSB A;  1KYO E;  1IRW A;  1CCH A;  3IF4 A;  1SQV E;  2A45 I;  3L75 G;  1SQX J;  4GED B;  4RES B;  1L4A D;  3CU4 A;  2P67 A;  2GIW A;  2LXC B;  5E79 H;  5B66 E;  1BE3 G;  1SVF A;  2MHM A;  1VF5 D;  1J3S A;  2ORL A;  1QLE D;  3H1K D;  2QM7 A;  2GC4 D;  2PAJ A;  4WBA A;  5DJQ B;  4ASW A;  5DFS A;  1N15 A;  3FWN A;  2AIU A;  4D6T D;  1BCC E;  1RF1 B;  2WSC H;  2RMZ A;  3KHU A;  2YCC A;  3KYQ A;  4UB6 H;  1VQO P;  2WSF H;  3RGU A;  3HE4 A;  2WMM A;  2Y0E A;  2E5Y A;  1CRJ A;  2C9X B;  1BSN A;  4KHX A;  5AW5 B;  3O1Y A;  1FAV A;  1AVO A;  2IPP A;  3CXH I;  1OZH A;  1KIL E;  2KOG A;  1DH3 A;  4I2L C;  1I6E A;  1RH5 B;  5DJQ C;  4L1Q A;  1URQ B;  4P4Q B;  1SQQ K;  2B12 B;  1FI9 A;  2AEF A;  1NH4 A;  3HQ7 A;  1PIX A;  5CMZ A;  5AW0 B;  2WPR A;  1Y47 A;  3A7O A;  2ZFC A;  1QL1 A;  2YK3 A;  4JYC A;  1KIL C;  1J1D C;  2LIT A;  2N3Y A;  1IJD B;  3TNU A;  4XA4 A;  1EZV E;  4AAO A;  3JCU H;  1K9M Q;  1P84 H;  1EDI A;  3CCE P;  2KB7 P;  1TU3 F;  1H0T A;  1YJ9 P;  1LTB C;  1SQB K;  1L0N E;  2ZYG A;  4JBZ A;  2HOD B;  1URQ C;  1CYJ A;  4ZKP A;  4EYY Q;  1SQP G;  3L75 D;  4TT3 H;  3ZOX A;  2C1D A;  2M5A A;  4H44 C;  1ZME C;  4BRY A;  1DIP A;  5APY A;  2CPB A;  1NO4 A;  1BDD A;  1CRH A;  1GL2 D;  1ZR2 A;  3X39 A;  4BWN A;  5TIS E;  3GG2 A;  4PJ0 E;  5KTB A;  5AVR B;  4AAN A;  1NIR A;  5TJH A;  1LP1 A;  2Q7C A;  1ZW0 A;  1XTG B;  1Q90 D;  3P32 A;  3H1H J;  3SLE A;  2O3J A;  5AVV B;  1HRC A;  4ZKU A;  2K3R A;  2W90 A;  1SFC D;  1YIT P;  2KLU A;  2KNC A;  1DII C;  4Q5P A;  2LKM A;  3L70 E;  3H1L G;  3KDP B;  3MHV A;  1JY3 P;  1D7M A;  1J1E B;  4RKU J;  5AW4 B;  2G8Y A;  5CIH B;  4GIF A;  4XYD B;  1JY3 O;  1FZE A;  1QN2 A;  1ZRT D;  1M70 A;  3ZOO A;  1L4A A;  1GK4 A;  3RK2 B;  2Y9Z A;  2IBZ E;  2OYI B;  3CX5 W;  1AJY A;  3H1K J;  1DX7 A;  4UB6 V;  1YTZ T;  1KB9 H;  1NVO A;  5KAI E;  4OGQ B;  1T6A A;  2QE7 H;  4GT1 A;  1AOF A;  1BDC A;  3FX0 A;  4OVN F;  2O01 N;  4IOI H;  3Q2Y A;  1S9K D;  5B6Q A;  4DOJ A;  4FAV A;  5GTI E;  1BSH A;  2QJK B;  2YO3 A;  1CZQ A;  4D6T J;  1HWT C;  1RZ5 A;  2FYU E;  5L8R J;  1FBM A;  1W2L A;  3Q5S A;  5K5G B;  1C75 A;  5KLV G;  2K1A A;  2OYI C;  1P84 I;  2H88 C;  4KMG A;  1R0Q A;  1DW1 A;  2M3B A;  4PV1 B;  3ZBM A;  2SPZ A;  4WQB A;  1YTZ I;  1YQ4 C;  1KX7 A;  2B87 B;  2L91 A;  4O1W A;  4XFJ A;  2Q5U A;  1LTJ A;  4U3F G;  3MUD C;  5C0Z A;  1YEA A;  4EIJ A;  3ZOW A;  3SWK A;  3WMM 0;  1PGJ A;  2GB8 B;  3CCQ P;  3L4M A;  2YXQ B;  2OTL P;  3H1L D;  4I1L A;  2BAS A;  5APX A;  1I6D A;  3L73 E;  3BVH A;  3CXH D;  1LNQ A;  2J5U A;  1OVR A;  1BE3 J;  1R5S A;  3MGN A;  3H1I E;  1SP4 A;  3M0A A;  1GL2 A;  4PWA A;  3HUS B;  1S72 P;  3I56 P;  1K04 A;  3P7K A;  1A8C A;  1SQX K;  3IN6 A;  3NWV A;  3HE4 B;  3A0H H;  4OWF A;  4O1Q A;  1RF0 C;  2Y0C A;  4GYD A;  2ZT9 B;  3BAT A;  3H1J G;  1IZL 0;  1KB9 I;  2ZXX A;  1NAY A;  5KLV D;  4JCG A;  4HYT B;  5CIC B;  3WFE C;  2FYU G;  1SFC A;  4H13 D;  1KYO W;  3KZI H;  1C6S A;  1NTK G;  2P10 A;  3CC4 P;  2XDJ A;  3FWL A;  1IRV A;  1DT1 A;  1NU1 J;  1OXZ A;  5H2F H;  2QVA A;  5GTH H;  3TNU B;  4L3G A;  2OQQ A;  1H89 A;  1IO3 A;  1QL4 A;  3M9Q A;  4U3F D;  1L9B C;  1T2K D;  3H32 A;  4WY4 D;  3OCD B;  1YYC A;  2WPQ A;  4H0L C;  4YPC A;  3NMD A;  1VQN P;  3CX5 H;  1VQ8 P;  3D0W A;  2M5A B;  2C1D B;  1KQS O;  1IFJ A;  2N3B A;  3L36 A;  4BRY B;  155C A;  3E1I A;  4O9B A;  1S1C X;  1PGP A;  4Y99 C;  1FCD C;  1H32 A;  4AX3 A;  1AVY A;  1SQP J;  4K35 A;  1FZF A;  1MG3 D;  1A2S A;  1FHB A;  1MV8 A;  1JY3 N;  1KQG B;  1SQV J;  1KB0 A;  1KN7 A;  3VNW A;  2IDB A;  2YKO A;  3PXS A;  1LP1 B;  2NPS D;  5KAF E;  4PD4 H;  3CC7 P;  1CYC A;  3PH0 A;  1JCD A;  1MFT A;  1PP9 D;  3L72 E;  2M3E A;  1VL2 A;  4HH2 A;  5BVZ A;  3RL0 D;  3D70 A;  2E75 D;  2WPV B;  2KNC B;  1YIQ A;  1K3H A;  1PPJ G;  4AUW A;  2PP6 A;  2BCN B;  3H1J D;  3M0D C;  3SFE C;  3TF5 A;  3AE3 C;  4LLH A;  1CRG A;  4KJM A;  1P84 D;  1N7S D;  1BGY G;  3O6Q B;  3H1L J;  2R3S A;  1NTK D;  4PW9 B;  2A06 G;  1B7V A;  3PH2 B;  5CCH D;  3A3Y B;  3UIA A;  3A0H V;  3S1K A;  2JR8 A;  3MP7 B;  1KTM A;  2KUB A;  5AVQ B;  2ZAE B;  2JO1 A;  3KQG A;  3VP8 A;  1L4A C;  3OJA B;  2C0W A;  3PRJ A;  1SQX D;  1HJ0 A;  1CTJ A;  2QJY B;  2E74 D;  1VF5 C;  5H2F V;  3VMZ A;  2K88 A;  1I54 A;  1IFM A;  3CX5 I;  1QL2 A;  3H25 A;  3BRT B;  5APQ A;  2GA1 A;  3A5T A;  1N86 A;  2ZXE B;  3WUI A;  3H1H G;  4L73 A;  3P8C D;  1KYO H;  3D6Y A;  1E5W A;  1N9C A;  1LTA C;  1YI2 P;  1OW8 A;  1K73 Q;  1L0L G;  3ZOY A;  1GD2 E;  1PPJ D;  5B66 H;  1CSU A;  3B71 A;  4QAO A;  4DJG A;  2PCB B;  4WQ7 A;  1KMI Z;  2W6A A;  1KB9 D;  3MK7 B;  1LTJ C;  1H33 A;  2ZVN B;  2POH A;  1C2R A;  2K9J B;  2I1J A;  1NTM E;  3ITK A;  1JY2 O;  2Y0D A;  5AUR A;  1W2B O;  1YTC A;  3SXT A;  3L70 J;  5AVZ B;  1OCD A;  2A06 D;  1G1I A;  2V7Q J;  1T3J A;  4UB8 V;  1Q82 Q;  3CCV P;  2C9N Y;  1Q86 Q;  5CYT R;  1WRG A;  4WQA A;  2WSF J;  1QX8 A;  2M0B A;  1Q2N A;  3C1L A;  3T97 A;  2KSE A;  5CCG D;  5AW6 B;  2JWA A;  3W68 A;  3MK7 C;  2NPS A;  3VN0 A;  2IZ0 A;  1KV9 A;  3HRN A;  3N4X A;  1S5L E;  2KIK A;  1BL9 A;  1GL2 C;  1EDL A;  1S2E A;  2GUS A;  1MFZ A;  1RE3 A;  3H1J J;  3CYT I;  1LFM A;  1CIE A;  5DJT B;  1VQ6 P;  3Q5R A;  2YNY A;  5AW8 B;  2FYU J;  3JC2 2;  2FYZ A;  1IQC A;  5AVU B;  1RQU A;  2WTY A;  3E7K A;  3CCU P;  1NTK J;  5B5E E;  3L71 E;  1CI6 A;  3H32 B;  1JNM A;  3H1H D;  3NBT A;  1OVV A;  3L74 G;  1CIG A;  4WQE A;  1SFC C;  5CCH A;  3VTP C;  3LID A;  1HJ4 A;  1CRC A;  4AQR D;  3TK1 A;  2C2C A;  1YBK A;  1H32 B;  1U7J A;  3HQ9 A;  1KYO I;  2IYP A;  2OGU A;  2JKV A;  5CBO A;  3QH9 A;  3WUV A;  5TIS H;  1CIH A;  4PJ0 H;  3CWB E;  1HJ3 A;  4GKG A;  4C7N A;  2PGD A;  2N1T D;  4I7Z C;  3B4S A;  1DEB A;  1K05 A;  1RF0 A;  3HE5 A;  4BXL A;  2BH4 X;  4WQC A;  2WIT A;  1OIP A;  1CXC A;  4NPF X;  1E79 H;  1NTZ G;  4ZMD A;  3V2R A;  1HCM A;  1X0T A;  4N78 D;  2AEM A;  1SQQ E;  1XTC C;  3RLM A;  1IZN B;  2V7Q H;  3H1I J;  3D6Z A;  2H7H A;  1CTY A;  1IFI A;  5AW2 B;  3MIW A;  2G3A A;  2YMY A;  4WB4 A;  1PFI A;  1HH0 A;  1KIL B;  1J1D B;  2KLV A;  1PGQ A;  4R4L A;  3B5N D;  1HRO A;  1EXJ A;  1SQB E;  3CX5 D;  1NU1 G;  5KJ7 D;  3HD7 D;  1BGY J;  3CL3 D;  3WUU A;  4H44 B;  3P8M C;  3CXH E;  3RK3 B;  1JO5 A;  1VPC A;  3R4Y A;  2C1U A;  3TGU E;  3II6 A;  5GTI H;  1L2P A;  1JOC A;  3RK3 E;  2KK7 A;  1EZV I;  2LXB A;  4QMA A;  1RE4 A;  4PD4 D;  2E76 D;  4FA5 A;  1PGO A;  4HJG H;  4EDF A;  1ZP0 C;  1SQV G;  3RK3 C;  1BE3 D;  2ZOO A;  1JY2 N;  1N73 A;  3RBZ A;  5AW7 B;  2WZ7 A;  3A0B E;  2DW3 A;  1SLQ A;  2LR2 A;  2FFD C;  2K9Y A;  4AAM A;  2YMK A;  2QG4 A;  3M0D A;  1RQV A;  3SVW A;  3CCL P;  5CIE B;  4IL6 X;  2BEQ D;  5E79 V;  2I1K A;  2JTI B;  4IL6 H;  5TIS V;  4PJ0 V;  2WQY C;  1PV3 A;  1H33 B;  1L0L J;  1BCC G;  5KLV K;  2Z5H A;  3MTU E;  3M9B A;  1FC2 C;  3G9R A;  2KYV A;  1NWQ A;  1NU1 D;  1H9Y A;  1GU4 A;  3RMZ A;  2OZ1 A;  1ZLL A;  1T2K C;  1X22 A;  3T97 B;  2BGV X;  3TYI A;  2D0W A;  1CTZ A;  3SSU A;  2IYO A;  3KPE A;  1IC2 A;  4UB6 E;  2DGE A;  2MKV A;  2B11 B;  1EZV G;  1CYI A;  2D2C B;  1SQP D;  1PP9 E;  1L0N G;  2WVR A;  3VOP A;  3U1A A;  1KYO D;  1J2J B;  4JPZ B;  1SQV D;  1KOR A;  1C6R A;  1CSV A;  2XTS B;  2KSJ A;  2GUV A;  2NPS C;  4AYC A;  4L75 A;  4W7Z A;  2WT7 A;  3VMA A;  1FJP A;  2QJP B;  4DCK A;  1N90 A;  3A9F A;  3JCU E;  4LGD E;  2OTJ P;  2D2C C;  2W83 C;  1GDV A;  5KKZ B;  2FXP A;  3RL0 C;  2ZYD A;  1LMS A;  1RE3 C;  3RN1 A;  1EDK A;  1GW4 A;  3L74 J;  3ZCF A;  1C2N A;  1N7S C;  3S4R A;  1KD1 Q;  1JCC A;  2N9I A;  1U7M A;  2JP3 A;  2QJP C;  1EDJ A;  1LTI C;  3O8Z A;  1SQX E;  3HQ6 A;  1S4X A;  3L70 G;  2ZXY A;  1HGZ A;  5CCH C;  1NTK K;  5KAF H;  5KKZ C;  4XXL A;  1ETP A;  3HE5 B;  4IL6 V;  2W6J H;  1OWA A;  1GJQ A;  1GU5 A;  4W80 A;  2IBZ G;  1I5T A;  1CSW A;  1URQ D;  3AE5 C;  3GHG A;  2CK3 H;  1NTZ J;  2E74 C;  1Q81 Q;  1EZV D;  5CIB B;  1JTH A;  3JSV C;  3CMA P;  5CHX A;  3I5C A;  3CI9 A;  1MZ9 A;  1L0N D;  1QKS A;  3V6I A;  4H0L B;  1FS0 E;  2YQB A;  4YXD C;  4JQ0 D;  1KQL A;  1IFN A;  3AE4 C;  2KS1 A;  1W5C E;  2MTA C;  3Q5P A;  4Y99 B;  4RO0 A;  1YQ3 C;  2BLF B;  2HYN A;  1H0T B;  2R5D A;  2RN0 A;  2BH5 X;  4FAN A;  5APU A;  5IY5 1;  5KLI C;  3L71 J;  4EI2 A;  2O1K A;  4GOE A;  1DD4 A;  3M97 X;  1N73 B;  5M1B A;  4H0J A;  3L70 D;  1EQ7 A;  3F5H A;  1AA0 A;  1R8E A;  2HFE D;  3AEF C;  3L73 G;  1YCC A;  3WFB C;  1RE4 C;  1GIW A;  2J59 M;  3CWB J;  3EQ2 A;  3Q1M A;  1M8O B;  2JEE A;  1KFN A;  4LC1 A;  2UWJ E;  2ITA A;  3H1I G;  5BU5 A;  1GW3 A;  1N73 C;  4XE5 B;  1N50 A;  3RK2 D;  2AXT H;  5CIG B;  5KAF V;  1ZOY C;  2BCC E;  1VQL P;  1NYH A;  4OGQ D;  3FXD A;  3O5C A;  1BCC J;  3BCC E;  2FYU D;  1L4A B;  1VQM P;  2FYN B;  1E2R A;  2OZ1 B;  1RZ6 A;  1NHL A;  3QWO C;  4AAL A;  1VF5 B;  4WQ8 A;  3AE2 C;  1RF1 A;  2KXP B;  2L5G B;  3VYI A;  2PFX A;  3GMA A;  1N8R Q;  1S5L X;  3A0H E;  3L35 A;  4PV1 D;  2D0S A;  1YEB A;  3H1K E;  1S5L H;  3IAO A;  1U74 B;  1DVH A;  2FFD A;  2FYN C;  3TGU J;  3KZI V;  5CBN A;  3OA8 A;  5AVX B;  3WC8 A;  5GTH V;  4D6T E;  1L0N J;  1LTG C;  2WT7 B;  5H2F E;  5B5E H;  3NBS A;  2RH0 A;  2AI5 A;  3L73 D;  4NPE A;  1WMK A;  3GLM A;  2YIU C;  3CCM P;  1M1K Q;  2I8F A;  1KZU B;  5APS A;  3EFG A;  4ASV A;  3DP5 A;  1FZC C;  5AVW B;  1LTJ B;  2PAC A;  2IX7 C;  2KZI A;  4B86 A;  2PCC B;  2HPC A;  2HV4 A;  2N9J A;  1MKM A;  3VP9 A;  1A02 F;  3CX5 E;  3H1I D;  3L72 G;  1KX2 A;  2YKP A;  4PD4 I;  1I8O A;  1GQ1 A;  4WY4 A;  4YTP C;  2A45 H;  1JY2 P;  3V2N A;  1G2C A;  1BGY D;  3PXT A;  1ZV8 A;  2AXC A;  1JUN A;  3GF3 A;  3L75 E;  2ZT9 D;  3L37 A;  3SWY A;  1LS9 A;  1GL2 B;  1FDM A;  1FJK A;  1FOS E;  2AXT V;  5AVS B;  2B4Z A;  1BE3 E;  4JYB A;  4UB8 E;  1NAF A;  2H8P D;  2Q9I A;  2C9L Y;  1Q7Y Q;  4FA4 A;  3AEG C;  3SFD C;  1YJN P;  2CXB A;  4M3L A;  2JDI H;  4IFF A;  1I55 A;  1DW3 A;  1NKZ B;  1SFC B;  1KC8 Q;  2KS1 B;  3GHG C;  2H89 C;  1NGM B;  3F89 A;  2P7J A;  1AFO A;  2DVH A;  3AED C;  1E29 A;  1N2D C;  2OTK E;  2N18 C;  3WU2 E;  1N7S A;  1CC5 A;  3G6E P;  1NML A;  1KIB A;  1F1F A;  1ZRT E;  2ZVO B;  4I6M C;  4C46 A;  1M1J C;  4I7Z B;  1CRI A;  1WVE C;  1L0L D;  5B5E V;  1JDL A;  2R44 A;  1GKS A;  5APW A;  5AW1 B;  2FXO A;  1U57 A;  2O01 H;  1FU1 A;  3A0B H;  2W27 A;  1FI3 A;  1LWU A;  3CCJ P;  2E43 A;  1FDI A;  1S9K E;  1NU1 K;  1DIQ C;  1SQP E;  1NTM G;  3USS A;  2NZ2 A;  3L73 J;  1AV1 A;  4Y28 J;  1LT9 C;  3C8V A;  1IK7 A;  3O0R C;  5B66 V;  2MJZ A;  1QL3 A;  1AQT A;  2IZ1 A;  3VMY A;  4C7R A;  2XKM A;  2K37 A;  1GZL A;  3KXD A;  1E8E A;  4WQD A;  3NFQ A;  1SQP K;  3V5B A;  4GOF A;  3HTK A;  3C9I A;  2YO2 A;  1SQV K;  2Q3E A;  1M57 D;  1T8Z A;  4JF7 A;  1M7L A;  1RY3 A;  1YFC A;  1GMJ A;  3V2Q A;  2P1J A;  2R32 A;  1HZU A;  3CME P;  3HUS A;  3TYY A;  1LC2 A;  1S6V B;  3BAS A;  4DT0 A;  2C8S A;  4OH8 B;  3H1L E;  4WVZ A;  5KAI H;  5APT A;  4H0K A;  4YE1 A;  1GTW A;  1FE6 A;  2XND H;  1VQK P;  1PZQ A;  3L71 G;  3L74 D;  2FFD B;  1KV4 A;  3V4W A;  3OA8 B;  2Z5I A;  351C A;  2WPS A;  5CJ4 A;  5CCG A;  1GDT A;  4WQ9 A;  1I8P A;  1RF1 C;  3CC2 P;  4N3Y B;  3CP5 A;  4Y5R A;  3D71 A;  1NNO A;  3WFD C;  2CPS A;  3G4S P;  1NOH A;  1M56 D;  1C6O A;  4NPD A;  4H13 B;  3TSI A;  2HPC B;  1NTM D;  3OCD A;  3CWB G;  3LIE A;  5KLV E;  4YXW H;  2KZJ A;  2A45 G;  3MZW B;  3OA7 A;  2HG5 D;  1M60 A;  1MUU A;  3ABV C;  3GF7 A;  2OYH A;  1NTZ D;  2N9B A;  3A0B V;  3CCS P;  3AEB C;  1OFC X;  1KQF B;  4MU8 A;  1QVF O;  4TLF A;  4WY4 B;  1COT A;  1OMI A;  1SQQ G;  5E79 E;  1YJW P;  1H1O A;  1L0N K;  1G2C B;  3G3Z A;  1T3U A;  3VRD A;  3L72 J;  4H13 C;  4U3F E;  2N9Y B;  2QA4 P;  4EOT A;  3RN0 A;  1L9J C;  3AE1 C;  1ZZH A;  4RJT A;  2BCC J;  1HTL C;  2RKL A;  4EIE A;  2R3C A;  4WWI A;  3AEE C;  1SQB G;  1NKN A;  2V08 A;  1HJB A;  3BCC J;  2Y9Y A;  4R4M A;  4WY4 C;  1CO6 A;  2FRC A;  3M9H A;  1QGK B;  2IBZ I;  1AYG A;  2NPS B;  1R5L A;  3L71 D;  2N1T A;  451C A;  4W7Y A;  3R2P A;  4HKZ H;  1X9V A;  3TGU G;  1HGV A;  2ZBO A;  2WSE J;  3O6Q A;  1MG2 D;  2CE0 A;  2IFM A;  1GU2 A;  1FZC A;  3AEA C;  3AE7 C;  3RL0 B;  2FY8 A;  2E75 B;  5DJU B;  2QSI A;  1EXI A;  1AOQ A;  5KAI V;  2V07 A;  1DW2 A;  2CA4 B;  5CIF B;  1YIJ P;  2BEZ F;  2P2U A;  5EXQ A;  1J1E C;  1N7S B;  5GTI V;  3RBX A;  1WEJ F;  1MZ4 A;  3B5N A;  3H1J E;  1CI6 B;  3CWB D;  5AW9 B;  2ZON G;  1CED A;  2XNX A;  2QRX A;  1P84 E;  2ZJS E;  2BPB B;  2W8Z A;  3RK2 C;  3U1C A;  2JQR A;  5KJ7 A;  3HD7 A;  2E75 C;  1H8A A;  1LGH B;  1NTK E;  1OVU A;  1JEK A;  1IFP A;  2C0X A;  1RAQ A;  2E42 A;  1FDO A;  1ZR4 A;  4OGQ C;  5CID B;  1IO4 A;  1SQQ D;  1LWU B;  2ZZS 1;  1HVV A;  1BCC D;  4DZO A;  1CHH A;  2M8R A;  3GW6 A;  1DW0 A;  2QJK C;  2FYU K;  5DF5 A;  2E74 B;  3C2C A;  4C7N B;  1VQ7 P;  1OW7 A;  3V2P A;  1EB7 A;  1Z56 A;  1KIL D;  2B88 A;  3NXS A;  1SQB D;  4PV1 C;  1A56 A;  1U75 B;  4L74 A;  1NTM J;  2YXR B;  2YKQ A;  4IL6 E;  1LWU C;  1CSX A;  3L75 J;  1H31 A;  4LJI A;  1W5C T;  2KP8 A;  3TGU D;  2Q1K A;  3RL0 g;  3HTK B;  2K9J A;  2XV5 A;  2FBW C;  3S9O A;  4H44 D;  3VMX A;  3AE8 C;  5BU8 B;  1X79 B;  3RK3 D;  3P8C E;  5AW3 B;  2FWL A;  1CIF A;  4NFG B;  5KLI B;  1PP9 G;  1ZXG A;  1HZV A;  2WSE H;  1PPJ E;  2Q6Q A;  1M1J A;  1RHZ B;  3N7N A;  1YHQ P;  1CNO A;  2GM4 A;  1VYD A;  1KB9 E;  3PXW A;  1HJ5 A;  5CJ0 A;  1A02 J;  1BGY E;  1PL5 A;  2OAR A;  3U59 A;  2VRS A;  1YNR A;  3PHL A;  2A06 E;  5AVT B;  3TDK A;  3B8E B;  3HUS C;  4A7P A;  1IFD A;  1JM0 A;  4N6J A;  3ORV A;  5C39 A;  1IK9 A;  4MN4 C;  1FZB A;  1CXA A;  1DEE G;  1LT9 A;  2V4H A;  4FA9 A;  1F1C A;  4V2K A;  4U7J A;  1K3G A;  2ZT9 C;  2GC7 D;  3I55 P;  1JMB A;  3AE6 C;  4DY9 A;  3A2A A;  3L4F A;  1SQX G;  2FXM A;  3Q3D A;  3LW5 J;  1CRY A;  5CCG C;  2OYH B;  2JWD A;  5APV A;  3PP5 A;  1QYZ A;  1QVG O;  2IBZ D;  1VQ4 P;  3H6P A;  1H9X A;  2ZYA A;  4CPG A;  2CE1 A;  3CD6 P;  1HBW A;  3CXH W;  1FZA A;  2J58 A;  3OW2 O;  4HB1 A;  3H1H E;  3CCR P;  1G1J A;  1SS1 A;  3V4Q A;  3EFF K;  5AVY B;  4L76 A;  5C9M A;  1LJ2 A;  3DR0 A;  1SQQ J;  2C1V A;  2OYH C;  1L0L E;  4GOD A;  2D2C D;  3W67 A;  4UB8 H;  3FXE A;  2QIW A;  3WFC C;  1K8A Q;  1CHJ A;  1LT1 A;  1VQP P;  2N1T B;  1FZG A;  1DD3 A;  1SQB J;  1ZN5 A;  3M06 A;  1KIL A;  2YIU B;  1NMI A;  2B0Z B;  1FI7 A;  1L0L K;  1FZC B;  1JB0 J;  2I8D A;  1FOS F;  3HQ8 A;  3MD0 A;  1URQ A;  2HR3 A;  2PRR A;  2KI7 B;  3KZI E;  1OAE A;  2JJL A;  4N78 E;  1UIX A;  1AQ5 A;  3IR9 A;  1RAP A;  4RSZ A;  3WU2 H;  2N1T C;  2IFN A;  3B5N B;  1Y8A A;  1HF9 A;  2R5B A;  4EIC A;  5GTH E;  3JBT B;  2Z4E A;  5EFW B;  3CLQ A;  2QEX P;  2QM8 A;  3HD7 B;  3EWK A; 
#chains in the Genus database with same CATH homology
 4JCG A;  5CIC B;  3WFE C;  1NU1 D;  1H9Y A;  3RMZ A;  1KYO W;  3O0R C;  2OZ1 A;  1C6S A;  1COR A;  1DVV A;  5B66 V;  1QL3 A;  3ZIY A;  2BGV X;  1YIC A;  3TYI A;  2D0W A;  4FB1 A;  4N0K A;  1IRV A;  3FWL A;  1CTZ A;  1DT1 A;  3PLN A;  1E8E A;  4L3H A;  4L3G A;  1IO3 A;  1QL4 A;  2DGE A;  4WQD A;  4U3F D;  1L9B C;  2B11 B;  3OCD B;  1CYI A;  2LIR A;  2Q3E A;  1SQP D;  2C1D B;  1FOC A;  1YFC A;  1KYO D;  2N3B A;  1SQV D;  4EID A;  155C A;  1HZU A;  4EIF A;  1C6R A;  1CSV A;  2XTS B;  1LC2 A;  1FCD C;  1H32 A;  1H31 B;  1S6V B;  4AX3 A;  2C8S A;  1MG3 D;  1A2S A;  1FHB A;  1FJ0 A;  4H0K A;  3VMA A;  4YE1 A;  4FA1 A;  2L4D A;  2QJP B;  1N90 A;  1KB0 A;  3A9F A;  2N18 B;  1HH7 A;  3VNW A;  3L74 D;  1AKK A;  3PXS A;  1GDV A;  5KKZ B;  3L4O A;  2EXV A;  1LMS A;  1CYC A;  3SJL A;  3RN1 A;  3OA8 B;  3PTZ A;  1PP9 D;  351C A;  3SWS A;  3ZCF A;  1C2N A;  4WQ9 A;  1I8P A;  3DMI A;  1CCR A;  3CP5 A;  4Y5R A;  4J20 A;  4K3I A;  2KNC B;  1YIQ A;  1K3H A;  1NNO A;  3WFD C;  2N9I A;  1C6O A;  1C52 A;  1S5L V;  2BCN B;  3H1J D;  3TF5 A;  3HQ6 A;  1M6Z A;  1CRG A;  1NTM D;  2ZXY A;  4XXL A;  3OCD A;  1P84 D;  3O20 A;  1ETP A;  1NTK D;  4IL6 V;  2CA3 B;  1M60 A;  1GJQ A;  1NTZ D;  4PW9 B;  3A0B V;  3WU2 V;  1B7V A;  3PH2 B;  3L72 D;  1I5T A;  1CSW A;  3A0H V;  4MU8 A;  3VYM A;  1COT A;  1LC1 A;  1C7M A;  1H1O A;  2BCC D;  1EZV D;  5CIB B;  3VRD A;  2VHD A;  2N9Y B;  3PRJ A;  1SQX D;  3RN0 A;  1L9J C;  2B10 B;  1L0N D;  1CTJ A;  1CHI A;  1QKS A;  1ZZH A;  3BCC D;  4RJT A;  2QJY B;  2YQB A;  1IRW A;  1CCH A;  4EIE A;  5H2F V;  1I54 A;  4GED B;  3CU4 A;  2V08 A;  2KS1 A;  2GIW A;  1CO6 A;  2FRC A;  2MTA C;  1AYG A;  2MHM A;  3L71 D;  451C A;  1J3S A;  2ORL A;  2BLF B;  3H1K D;  3WUI A;  2ZBO A;  2GC4 D;  2RN0 A;  2BH5 X;  4FAN A;  1MG2 D;  2CE0 A;  5IY5 1;  1GU2 A;  5DJQ B;  1N9C A;  1AOQ A;  5DFS A;  5KAI V;  2V07 A;  1DW2 A;  1N15 A;  3ZOY A;  2CA4 B;  5CIF B;  1PPJ D;  1CSU A;  2AIU A;  3M97 X;  4D6T D;  4QAO A;  5EXQ A;  2PCB B;  4WQ7 A;  2RMZ A;  3KHU A;  2YCC A;  5GTI V;  1KB9 D;  3MK7 B;  4H0J A;  1WEJ F;  1MZ4 A;  3L70 D;  1H33 A;  1C2R A;  3CWB D;  2ZON G;  1CED A;  2K9J B;  2Y0E A;  1CRJ A;  1YCC A;  3ITK A;  2C9X B;  3O1Y A;  3WFB C;  2BPB B;  2Y0D A;  5AUR A;  1GIW A;  2JQR A;  1YTC A;  1I6E A;  3SXT A;  5DJQ C;  4L1Q A;  1OCD A;  2A06 D;  4UB8 V;  4P4Q B;  2B12 B;  1FI9 A;  5CYT R;  3HQ7 A;  1RAQ A;  4WQA A;  5CID B;  1N50 A;  1SQQ D;  2YK3 A;  2ZZS 1;  2JWA A;  3MK7 C;  5CIG B;  5KAF V;  1BCC D;  2LIT A;  2N3Y A;  1CHH A;  3GW6 A;  1DW0 A;  4AAO A;  5DF5 A;  3C2C A;  1KV9 A;  3O5C A;  1EB7 A;  1BL9 A;  2FYU D;  1CYJ A;  2FYN B;  1E2R A;  2OZ1 B;  1RZ6 A;  3L75 D;  3ZOX A;  1SQB D;  2C1D A;  3CYT I;  1A56 A;  1CIE A;  1LFM A;  4AAL A;  1U75 B;  1IQC A;  4WQ8 A;  1CSX A;  1H31 A;  4LJI A;  1W5C T;  1CRH A;  3TGU D;  3X39 A;  3H1H D;  3NBT A;  2D0S A;  1YEB A;  3GG2 A;  1U74 B;  1CIG A;  4WQE A;  1NIR A;  1DVH A;  5TJH A;  3KZI V;  2FWL A;  1HJ4 A;  1CRC A;  1CIF A;  4NFG B;  5KLI B;  3OA8 A;  3SLE A;  2C2C A;  2O3J A;  1H32 B;  1HZV A;  1HRC A;  3HQ9 A;  3WC8 A;  5GTH V;  1CNO A;  3NBS A;  2AI5 A;  3L73 D;  1VYD A;  1DII C;  3PXW A;  4Q5P A;  1CIH A;  2I8F A;  1HJ5 A;  1HJ3 A;  3DP5 A;  5CIH B;  2PAC A;  4XYD B;  2PCC B;  1YNR A;  1QN2 A;  3PHL A;  1ZRT D;  2HV4 A;  1M70 A;  2N9J A;  3ZOO A;  2BH4 X;  3TDK A;  4WQC A;  3H1I D;  4A7P A;  3CX5 W;  1CXC A;  3ORV A;  1HCM A;  1CXA A;  4UB6 V;  1KX2 A;  4FA9 A;  1F1C A;  3RLM A;  4V2K A;  1I8O A;  1AOF A;  1GQ1 A;  1CTY A;  1K3G A;  2GC7 D;  5B6Q A;  4DY9 A;  4FAV A;  2QJK B;  1BGY D;  1HRO A;  3PXT A;  1RZ5 A;  1CRY A;  1W2L A;  1C75 A;  1LS9 A;  3CX5 D;  4KMG A;  1QYZ A;  1R0Q A;  1DW1 A;  2IBZ D;  2AXT V;  2B4Z A;  1H9X A;  2CE1 A;  3ZBM A;  4WQB A;  2C1U A;  3CXH W;  1KX7 A;  2L91 A;  4FA4 A;  4O1W A;  2CXB A;  5C9M A;  1I55 A;  3DR0 A;  2C1V A;  1DW3 A;  5C0Z A;  1YEA A;  4PD4 D;  3ZOW A;  4FA5 A;  4EDF A;  2GB8 B;  3L4M A;  3WFC C;  3H1L D;  1BE3 D;  2ZOO A;  1CHJ A;  1I6D A;  2DVH A;  1E29 A;  2N18 C;  3CXH D;  1CC5 A;  1NML A;  1KIB A;  2YIU B;  1F1F A;  1NMI A;  2B0Z B;  1FI7 A;  4AAM A;  2QG4 A;  3SVW A;  3HQ8 A;  1CRI A;  1WVE C;  5CIE B;  1L0L D;  4PWA A;  5B5E V;  1JDL A;  1OAE A;  5E79 V;  1GKS A;  2JTI B;  5TIS V;  4PJ0 V;  1RAP A;  4RSZ A;  1A8C A;  1FI3 A;  1H33 B;  3NWV A;  4EIC A;  3JBT B;  4O1Q A;  2Y0C A;  4GYD A;  1DIQ C;  1IZL 0;  4AAN A;  5KLV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...