4PD4D

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
248
structure length
248
Chain Sequence
b'MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 62
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4pd4D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4pd4D02
2N3YA 3CXHD 3BCCD 3VRDA 4GYDA 2L91A 2C1DB 1C52A 2YQBA 2JTIB 4AAMA 4J20A 2N3BA 2GIWA 1L0ND 3L4MA 3SXTA 1KV9A 1GQ1A 1GDVA 1C2RA 1IZL0 3A9FA 1F1FA 2KS1A 3PLNA 1ZZHA 1K3HA 2D0SA 2XTSB 2KNCB 1NTKD 2OZ1B 1HRCA 1IQCA 1HCMA 4YE1A 4A7PA 1EB7A 1CRGA 1L9JC 2ZZS1 1E29A 1HZVA 2I8FA 2K9JB 1M60A 351CA 1CSXA 1PP9D 4WQ9A 1HJ3A 2ORLA 2VHDA 3DR0A 3DP5A 3NWVA 3RN1A 1C6OA 3L74D 1OAEA 5KLIB 2PACA 2B10B 1J3SA 1C2NA 1NIRA 1YFCA 1KIBA 1CRIA 1A8CA 155CA 3PRJA 1CXAA 3H1JD 1NMIA 1CSUA 5IY51 1A56A 4N0KA 4AX3A 1BCCD 1CTZA 2BH4X 3CP5A 1HJ4A 2O3JA 2BLFB 1AKKA 4WQDA 2CXBA 3OA8A 1CHHA 2GC4D 4GEDB 2B0ZB 2DVHA 3SLEA 1DW0A 1YIQA 1P84D 4FA9A 4EIDA 2ZOOA 1CRJA 1CORA 2BPBB 2GB8B 1H9YA 1CRCA 4WQ8A 3PXWA 1KB9D 1QL4A 4O1WA 1RZ6A 4L1QA 2N18B 1FJ0A 4WQ7A 5DJQB 1I6DA 4WQCA 3OCDA 1KX7A 3O5CA 1H9XA 2Q3EA 3ZBMA 1DT1A 1U74B 1NTZD 4FA5A 3VYMA 5B66V 5CIEB 4DY9A 2QJPB 5KKZB 1LC1A 1H31B 1IRWA 1RAPA 2ZBOA 1F1CA 4AALA 1ZRTD 1DW1A 2N9JA 1RAQA 2LITA 1RZ5A 1NNOA 2ZONG 1H33B 1C6RA 5KAFV 3ZOWA 1LC2A 1HH7A 1I8OA 3WUIA 1N9CA 3L72D 2QJYB 1LMSA 1YICA 3CWBD 3RMZA 1YTCA 5E79V 1QKSA 2CE0A 4LJIA 2JQRA 3GW6A 4FAVA 1CIEA 5H2FV 3KZIV 3JBTB 3O0RC 3SVWA 1GU2A 3L75D 1EZVD 1AOFA 3WFDC 2IBZD 1NU1D 2Y0DA 1DIIC 3WU2V 1LFMA 1H32B 2C1DA 1HZUA 3ZIYA 4EDFA 1S5LV 4PJ0V 1DVHA 1CCHA 4RSZA 3X39A 2BCNB 1M6ZA 1I5TA 2B11B 3NBSA 4IL6V 2CA4B 3TF5A 4RJTA 4NFGB 1IRVA 1I6EA 2PCBB 1SQBD 2N18C 1H1OA 2C1VA 4Q5PA 2YIUB 4FB1A 4JCGA 1R0QA 4L3HA 3TYIA 4FANA 451CA 4UB6V 1ETPA 1FI9A 5KAIV 3H1ID 2OZ1A 4H0KA 4XXLA 1QL3A 2AIUA 5CYTR 3MK7B 1W5CT 2C2CA 4O1QA 2V07A 1CYCA 1VYDA 1CRHA 2FRCA 1MG2D 1JDLA 2HV4A 5CIDB 3WFEC 4QAOA 2QG4A 1WEJF 4FA4A 4WQAA 1YEBA 4PWAA 1CHIA 1DVVA 1C6SA 1HJ5A 3PHLA 1GJQA 1YEAA 2AI5A 1CIGA 1QN2A 3NBTA 1S6VB 3ZOOA 1M70A 5C0ZA 3HQ7A 1SQVD 3M97X 1N15A 4XYDB 3VNWA 3PXTA 4AAOA 1W2LA 2LIRA 3HQ6A 4UB8V 1OCDA 1MZ4A 2QJKB 3ZOYA 1L9BC 3ZCFA 2AXTV 1CXCA 3PH2B 1L0LD 2MTAC 3H1HD 1NTMD 4V2KA 2DGEA 4K3IA 4FA1A 1FCDC 1E8EA 1I54A 3VMAA 4Y5RA 3L4OA 1K3GA 2FYUD 4PD4D 2D0WA 5CIGB 5GTIV 2JWAA 1BL9A 3ZOXA 4MU8A 2C8SA 4D6TD 1SQQD 1E2RA 4H0JA 3ORVA 1QYZA 3TGUD 1CCRA 2Y0EA 1U75B 1IO3A 5CICB 1I55A 3SJLA 1CO6A 1A2SA 1COTA 1FI7A 3CYTI 3HQ8A 3MK7C 2BGVX 5TJHA 4WQEA 1CIFA 3O20A 1BGYD 3PXSA 3O1YA 2Y0CA 1YCCA 2EXVA 3L73D 3TDKA 1CHJA 1FOCA 3CX5W 1H31A 1SQXD 1YNRA 1FHBA 1KYOD 3GG2A 1CC5A 1HROA 5DFSA 1BE3D 3H1LD 1WVEC 2CE1A 1B7VA 1H33A 3OA8B 1CYJA 5DJQC 5C9MA 3CXHW 2N9YB 3PTZA 4L3GA 1NMLA 5GTHV 5CIHB 1CRYA 1KX2A 2C9XB 4AANA 4EIEA 1CSVA 1AYGA 1DW2A 1FI3A 2ZXYA 3L70D 3SWSA 1N50A 3KHUA 5CIFB 5TISV 1CNOA 5CIBB 3WFBC 1H32A 1N90A 1GKSA 2C1UA 5B5EV 1CTJA 2N9IA 2B4ZA 3OCDB 2YK3A 3A0HV 1CEDA 2RN0A 2MHMA 4P4QB 3C2CA 1C75A 2FWLA 4EIFA 1SQPD 1KYOW 3FWLA 3HQ9A 4U3FD 3RLMA 2YCCA 3WFCC 3CU4A 2CA3B 1GIWA 3H1KD 3DMIA 3L71D 3WC8A 2V08A 1KB0A 4EICA 5DF5A 5AURA 3RN0A 5EXQA 1PPJD 2FYNB 2PCCB 4KMGA 1LS9A 1AOQA 5B6QA 3CX5D 5KLVD 1DW3A 4WQBA 1CYIA 4PW9B 1CSWA 2BCCD 1CTYA 2A06D 2RMZA 1C7MA 1DIQC 2L4DA 1I8PA 2BH5X 2GC7D 1MG3D 3ITKA 2B12B 3A0BV 1CIHA
chains in the Genus database with same CATH superfamily
2N3YA 4TT3H 3GF3A 4GYDA 1FDOA 3IAOA 2WVRA 1JTHB 2FXPA 1BGYG 1CI6A 3JC22 4L74A 3HD7A 2JTIB 1K04A 2BEQD 1EDLA 2YKQA 1N73B 3TSIA 2OYIB 3A0BE 1L0ND 1L0LK 2FYZA 1NTMK 3HE4A 1JMBA 3H1LG 1FZAA 2P10A 1SQBE 3L36A 1GDVA 3G71P 3KDPB 2G8YA 1H89A 1C2RA 1HBWA 4IFDK 3Q1MA 2KS1A 1Y9BA 3RGUA 1ZZHA 2WPSA 1AFOA 2WSFJ 3H1IE 5APTA 3NXSA 2P58A 1IFPA 1QVFO 1SQQK 1HCMA 4A7PA 1CRGA 1IFIA 3AE8C 1FDMA 1KB9H 2E5TA 3VP9A 3VYIA 2KIKA 1VQ5P 1CSXA 2IX7C 3CCVP 3RK3C 3DR0A 3P8CD 1C6OA 4B86A 1OAEA 4IL6X 1CRIA 155CA 1YJWP 2KK7A 1LGHB 2KSEA 1NMIA 3LW5H 4GODA 5CCHA 4DCKA 3M0DC 3CL3D 2HPCB 5CJ4A 2O01J 4HB1A 1IO4A 4GEDB 4PD4E 3RL0D 2YMYA 2DVHA 3WUTA 3V2QA 5KAIE 5EFWB 4FA9A 1FZFA 2KZJA 3L73J 1MFTA 3RBXA 5CJ0A 1H9YA 1G1IA 3A3YB 4WY4B 1HWTC 1KB9D 1A02F 2OGUA 4O1WA 2N18B 5DJQB 4OGQC 5AVSB 3V4WA 3U1AA 1L4AC 2QM7A 3CCJP 1J1DC 2WSCH 3V2RA 1JM0A 3M91A 3M0AA 4YTPC 1YITP 1EZVE 3VYMA 3USSA 4GOEA 1URQD 3G4SP 1OW8A 1U7MA 2QEXP 1RAPA 1GL2B 1F1CA 2J5UA 3H25A 1BE3E 5AW2B 2Y9ZA 2N9JA 5KLIC 1M1KQ 3B5NC 2FXOA 3WUIA 1BSNA 1LTBC 4NPEA 1LMSA 1YICA 3CWBD 4GKGA 2CE0A 1KILB 2JQRA 4JBZA 3GW6A 1FJPA 1CIEA 5H2FV 3L75D 1OW7A 5KAFE 3P32A 3BASA 3WFDC 1NU1D 4W80A 2W90A 3F5HA 1DIIC 1SQBG 3CC2P 1DD3A 5E79E 4PJ0V 2K9YA 2FY8A 2KOGA 3X39A 3H1JG 1I5TA 2B11B 4IL6V 2CA4B 2QM8A 3H1IG 3BRVB 1IJDB 2NPSB 4ZNCA 3GF7A 4K35A 1KB9I 1FOSE 2PCBB 2WITA 3WU2E 4U3FE 1H1OA 4FB1A 4JCGA 2AEJA 1K8AQ 4FANA 1ETPA 3HTKB 5KAIV 2OZ1A 3LW5J 3HUSA 1JY3O 2ZXEB 2W83C 3VP8A 1JDLA 2HV4A 1J2JB 4QAOA 2I1JA 1FU1A 5K5GB 4L76A 2JJLA 2K9JA 2Y9YA 1KFMA 1CIGA 3NBTA 4ZKPA 1SQBK 3N7NA 1M70A 1NTKJ 3KXDA 3HQ7A 3BVHA 1N15A 1SFCD 3VNWA 1W2LA 1NU1J 3ZCFA 3M9BA 3NMDA 1L0NE 1USDA 2WSCJ 3H1HD 5APQA 1PGOA 3OAKA 3CC7P 4K3IA 3A0BH 1JB0J 2OYHB 1I54A 3VMAA 1QVGO 2D0WA 1SVFA 2JWAA 2AXTE 2B87B 1LWUA 3L74J 4MU8A 2IZ1A 5AVRB 2C8SA 2E75C 1JO5A 2N1TA 4HH2A 1E2RA 3MUDC 3H32B 3TGUD 4C46A 1EZVG 2ZYAA 3I56P 2XNDH 2W6JH 2O01N 3OJAB 1NH4A 2H7HA 1RF1B 3CYTI 3HQ8A 5CMZA 1OVUA 3O6QB 5TJHA 2IZ0A 1BE3G 1NTZK 2D2CD 1X8YA 5H2FH 3VMXA 1OZHA 3MD0A 3P8CE 1OMIA 2Y0CA 3MTUE 2M5AB 2RH0A 1LTJA 1LJ2A 4Y99B 3Q5SA 3EQ2A 1H31A 3R4YA 2GUSA 1FHBA 2YMKA 1GD2E 1KYOD 4WY4C 5DFSA 1N2DC 1IFMA 4IL6H 4H13D 5AVXB 1ZXGA 2AXCA 1B7VA 3II6A 1H33A 3L37A 4OWFA 4ASWA 2QSIA 5CCGC 5DJQC 5C9MA 2YNYA 3PJSK 4JPZB 3PTZA 4PD4H 3KPEA 1AA0A 5KAIH 2C9LY 2W6BA 1RQUA 1T3JA 1KB9E 1N50A 2E74B 3WFBC 1GL2C 3TGUJ 2Q3IA 2N9IA 2YK3A 1M1JA 3L72J 1H0TA 3FXEA 1SQPD 1SP4A 3M9HA 1HF9A 4WVZA 3VMZA 1YJNP 3CU4A 2CA3B 3DMIA 4EICA 5EXQA 1ZV8A 1HH0A 3RK3B 1PL5A 4D6TG 5B6QA 5KLVD 3ZDMA 4WQBA 4C7NA 2PP6A 3CWBE 1LTGC 3CI9A 2A06D 1X22A 1URQA 2LR2A 3SWKA 1DIQC 1I8PA 2R3SA 2NPSC 2BH5X 1NHLA 3L75E 1FZCA 3BCCD 5AW5B 4KT0J 1NU1E 1LT9A 4KJMA 1S1CX 4PV1D 1IC2A 3L73G 4AAMA 1AQ5A 3D71A 2KLVA 4DJGA 4IFMA 3A2AA 5E79H 2GIWA 2QVAA 3L4MA 2QIWA 2H43A 2W8ZA 1AQTA 2E76D 2ZXXA 3RK2D 5B66E 4CPGA 4W7ZA 1F1FA 2OYOA 3VMYA 3E1RA 3WU2H 3PLNA 1SQPJ 1QX8A 3L35A 1QL1A 3B8EB 1J1DB 1Q81Q 2I1KA 1HRCA 3LIDA 1IQCA 1P84H 1ZW0A 3MHVA 3G9RA 1L9JC 2ZZS1 5KLVJ 2I8FA 5AVUB 1WRGA 1M60A 4ASVA 4WQ9A 1HJ3A 2VHDA 4K3AA 3NWVA 1VQKP 1BSHA 2KLUA 2OQQA 5KLIB 4PD4I 3TK1A 2YO3A 1MKMA 1PGQA 1GMJA 1NIRA 1YFCA 1KIBA 1JY2P 3AE3C 3PRJA 1NGMB 1G2CA 1EXJA 1CSUA 5IY51 2PAJA 3H1HE 4N0KA 2IFNA 2M3EA 1PPJG 4WQDA 3OA8A 1CHHA 1VL2A 3SLEA 4U7JA 1DW0A 2IFMA 5AW1B 2IYOA 1P84D 1YHQP 3S4RA 2ZOOA 2AXTH 2BPBB 1S4XA 1AJYA 1H8AA 1SS1A 1KQSO 3TGUE 1QL4A 4Y99C 3R2PA 3VN0A 1FJ0A 4H0LC 4QMAA 1RHZB 2WMMA 1I6DA 1HJ0A 1KX7A 3K5BA 3O5CA 1R5LA 2ZT9C 1CSBA 1RE3A 3T97B 4AUWA 4FA5A 2O1KA 3KQGA 5B66V 4L75A 5KKZB 3B71A 3G3ZA 1ZN5A 2N1TD 4AALA 1KYOE 1KTMA 1Y8AA 1DW1A 1NTKG 2ZYDA 1RAQA 1T2KD 1RZ5A 2JR8A 2ZONG 2JDIH 2E74C 1LC2A 1NU1G 1I8OA 1RF0A 1OIPA 3AECC 2QJYB 2VRSA 5CHXA 1QKSA 4U3FJ 3Q2YA 2WT7B 4FAVA 2B88A 1DX7A 3O0RC 1GU2A 3N4XA 2Q9IA 1N7SB 3L74G 1GU5A 1W2EA 4XFJA 2WQYC 2C1DA 1P84I 3CLQA 3NTNA 2BCNB 3AE6C 5H2FE 3GHGB 1FS0E 2K1AA 1LP1A 4RJTA 1OXZA 1IRVA 1RQVA 4DT0A 1SQPE 2E75B 1L2PA 3SFDC 2YIUB 4PJ0E 5AW0B 4UB6V 1SFCB 4IL6E 1NTKK 2KNCA 3KYQA 4XXLA 1QL3A 1W2BO 5CYTR 2C2CA 1X79B 1CYCA 5KLVE 2XZRA 1LTJC 2AEMA 3HRNA 1L0NJ 3WUUA 4OGQD 1FZGA 1L4AD 5CIDB 2A06E 2QG4A 4FA4A 3V2PA 4WQAA 1YEBA 1U7JA 4PWAA 1CHIA 1C6SA 2HYNA 1HJ5A 3BCCE 1QN2A 3CCEP 1VQ7P 1S6VB 3ZOOA 5C0ZA 1CI6B 3IFMA 4AAOA 3PXTA 3HD7B 2LIRA 1E79H 1MZ4A 3PP5A 4C7RA 1GK4A 3PH2B 1L0LD 2MTAC 3HE4B 1NTMD 3V5BA 4V2KA 3B5ND 1FCDC 2HODA 3TGUG 1E8EA 2KS1B 3L72G 3V2NA 3RL0C 5B66H 4N78D 1BL9A 5AW6B 1KZUB 1PFIA 1W5CE 4HYTB 1SQQD 4H0JA 2QE7H 1QYZA 3ABVC 1CCRA 2Y0EA 1U75B 1I55A 1A2SA 3EWKA 4IFFA 4N3YB 1COTA 1FI7A 4I7ZC 3CMEP 4OVNF 1IFNA 1CW5A 3CPWO 3CD6P 4AQRD 4WQEA 2NZ2A 2KSJA 4BRYA 1YI2P 3D70A 1BGYD 3PXSA 3C1LA 3SFEC 2EXVA 3TDKA 1CHJA 1VPCA 1URQC 3AEAC 1SQXD 1CC5A 1HROA 1FZCC 1KQLA 3H1LD 1M56D 1LT9C 2YKPA 2KXPB 1NTMJ 1CYJA 2CK3H 2QJKC 2FFDA 3NFQA 5AW9B 4DOJA 5GTHV 1P84E 1R8EA 5CIHB 4TLFA 4UB6H 4AANA 1CSVA 1AYGA 1DW2A 1EC5A 1FI3A 1M57D 1KFNA 3SWSA 1PGJA 3KHUA 5CIFB 3CXHH 2J59M 1H32A 1N90A 1GKSA 3RL0g 4XA4A 5KKZC 1SQQJ 2V4HA 1EXIA 4R4MA 5DJTB 5B5EV 1CTJA 1E5WA 3A0HV 1CEDA 2RN0A 3O8ZA 3CWBJ 3IR9A 3FX0A 4EIFA 2C0XA 3FWLA 2P2UA 5KLVG 2QJYC 1VQMP 3TNUA 3L75J 1DEEG 2PFXA 1VF5D 1KB0A 2ZVNB 4YXDC 5DF5A 3AE7C 2FYNB 3Q5RA 1KYOH 1N7SC 1SQXJ 3CX5D 1VQOP 1CYIA 5KTBA 4AYCA 2BCCD 1CTYA 3W67A 1FBMA 2R5BA 1C7MA 3GHGC 2GC7D 5L8RJ 1YTZT 2GA1A 3CXHD 2L91A 1ZMEC 2YIUC 1AVYA 1C52A 5AW7B 2YQBA 3M06A 1SFCC 4J20A 2N3BA 2R44A 1Q86Q 1SLQA 1Q82Q 4WY4D 3VTPC 2P7JA 1DIPA 3SXTA 1KV9A 1HGZA 1GQ1A 1JEKA 5AVZB 5CCGD 1IZL0 3A9FA 4H44B 1ZP0C 4YPCA 4H0LB 4PJ0H 2OZ1B 3A7OA 3HUSB 1IFDA 5AVQB 3SWYA 2L5GB 2ZT9B 4YE1A 4OH8B 1EB7A 3JCUH 2B89A 4EOTA 3H1HJ 3HD7C 1N7LA 1GL2D 1E29A 2Q7CA 3FGAD 2K9JB 351CA 2BCCJ 4JYBA 5GTHH 2YXRB 1PP9D 3SWFA 1S5LX 4N6JA 1KD1Q 2PACA 2B10B 1C2NA 4U3FG 1KILD 1S5LE 1M7LA 1FOSF 1QEXA 4YXWH 3H1JD 4MN4C 1L4AA 3WUVA 1A56A 1L0LE 3CXHI 5B5EH 1NTME 4AX3A 1BCCD 2BH4X 3A0HH 2JP3A 1T8ZA 4H13C 4DZOA 2BLFB 3CCQP 2CXBA 3W68A 1Z56A 3HE5A 2B0ZB 4O9BA 2KZIA 3CCRP 4N78E 1EDIA 1LWUB 2FXMA 1YIQA 1M90Q 1CORA 2GB8B 4JF7A 5C39A 2M8RA 1CRCA 1SQQE 2N1TB 4WQ8A 3PXWA 3F89A 1JY3P 2B9BA 3B5NA 4WQ7A 3U1CA 1Y47A 1YIJP 1KYOI 5CCHC 4JYCA 3OCDA 1H9XA 2Q3EA 3ZBMA 1L0NG 1DT1A 2OTLP 1NTZD 1BGYE 2Z4EA 3EFFK 1HVVA 1LTJB 1MZ9A 1PP9J 2PGDA 4BXLA 1LC1A 1H31B 1IRWA 3AEFC 1SQXE 1NYHA 2ZFCA 3CCUP 1NJIQ 2LITA 1H33B 3ZOWA 2Z5IA 1HH7A 5AW8B 1N9CA 1BCCJ 5KJ7D 3D6ZA 2V7QH 4M3LA 1YTCA 2JO1A 2HFED 4LJIA 1IK7A 2WWWA 3KZIV 2MKVA 2WPQA 2N9BA 3JBTB 3SVWA 2RKLA 5CBNA 4LC1A 1EZVD 1AOFA 2IBZD 3S9OA 1JTHA 2Y0DA 1FZEA 1CZQA 1HZUA 4HJGH 1PGPA 4EDFA 1KN7A 1S5LV 1DVHA 1QGKB 1CCHA 1JY2N 4RSZA 1N73A 3RL0B 1M6ZA 1M1JB 1FAVA 2OYIA 1L0NK 2FYNC 4NFGB 1I6EA 1H0TB 1NO4A 2E76C 1JOCA 3AE2C 3RK2C 4Q5PA 1NTZJ 1RH5B 2KB7P 3BCCJ 3TYIA 1S72P 451CA 1FI9A 4I7ZB 2FKWB 3P8MC 2C0WA 1S9KD 4O1QA 3RBZA 2V07A 1T6AA 1G1JA 4WB4A 1VYDA 3CX5E 1CRHA 4C7NB 2BCCE 2QJPC 3MGNA 2FRCA 1MG2D 1YJ9P 4UB6E 1URQB 3UIAA 1WEJF 3TYYA 1BDDA 1GJQA 3A5TA 4IOIH 3CXHE 1FZCB 2AI5A 3Q5PA 3I55P 1LT9B 1FC2C 5TISE 1SQVD 2FFDC 4H44C 4XYDB 4UB8V 2QJKB 3ZOYA 3CC4P 1CXCA 1VQ4P 3HUSC 2IBZI 1LT1A 2E74D 2HPCA 1SQQG 1PV3A 3MZWB 3U59A 4Y5RA 2FYUD 2Q6QA 2GM4A 5GTIV 3CWBG 2H8PD 3ZOXA 1XTGB 2HLOA 2E43A 4D6TD 1NOHA 4WY4A 3IF4A 3L75G 3FXDA 1PZQA 4LLHA 1IO3A 1ZR4A 2WPRA 4ZKUA 2OARA 1QLED 1CO6A 1IK9A 5CCGA 4I1LA 3V6IA 2V7QJ 2XDJA 1SQXG 1H88A 3RK3D 3B4SA 4RKUJ 3MK7C 2R3CA 1PP9E 2BGVX 3GMAA 4GDOA 1MFZA 3KZIH 1CIFA 5APSA 3O20A 3PH0A 1GZLA 3O1YA 5BU8B 3L73D 1KILE 1FOCA 1LWUC 3CX5W 1G2CB 3H1JE 1GL2A 1SQVJ 1S5LH 3GG2A 2A45H 1VQ8P 3D0WA 1BCCE 2N1TC 2W27A 2O1JA 1GDTA 1EQ7A 4L73A 3V4QA 2Q5UA 1T2KC 3OA8B 3I5CA 3CXHW 2CPBA 2N9YB 1GW3A 1NMLA 1KILA 1CRYA 2FYUJ 3JCUE 1GU4A 2C9NY 1EDJA 2C9XB 1DD4A 4EIEA 1VF5B 3FWNA 1IFJA 1AVOA 1NU1K 3L70D 1VDFA 5TISV 1JMMA 2YO2A 4D6TJ 1K05A 1LTSC 5GTHE 1LTIC 1SQXK 2B4ZA 1VQPP 3BATA 5AVWB 2NPSA 4P4QB 3H1HG 1NTZE 2POHA 1KC8Q 1JNMA 1KYOW 1HUCA 3RLMA 2YCCA 2BCCG 2JKVA 1OVVA 5B5EE 4I2LC 3H1KD 3L71D 4UB8H 3A0HE 3HTKA 4I6MC 2V08A 1KV4A 1LTTC 5AURA 3RN0A 1PPJD 2BASA 5APXA 1LS9A 1AOQA 2D2CB 1CSWA 1X0TA 2RMZA 1M1JC 2WSSH 2LXCB 2L4DA 5GTIH 1UIXA 1NWQA 3ITKA 3A0BV 3VRDA 1ZR2A 2IBZE 4NPFX 1R5SA 4H13B 1YYCA 2AEFA 2C1DB 2ZYGA 2M0BA 3L70J 3D6YA 2MJZA 5KJ7A 4BWNA 2Z5HA 2E42A 1LP1B 2H88C 3GLMA 2OYHA 2OTJP 2IYPA 3C9IA 3QH9A 1K3HA 2B87A 2D0SA 2XTSB 1XTCC 2KNCB 1NTKD 1RE4A 1S9KE 1PP9G 3H1KJ 3L71J 3H32A 1OWAA 3C8VA 2QA4P 1L0LJ 2DW3A 2A45I 2I8DA 3CX5H 2P1JA 1NKNA 3LIEA 1HZVA 4WBAA 2ZAEB 1RF1A 5APVA 3O6QA 1BCCG 2ORLA 2OTKE 4ZMDA 2SPZA 3DP5A 2R5DA 2K3RA 3RN1A 3L74D 1SQPG 1SQVE 2M5AA 1TU3F 1J3SA 3M9QA 5BVZA 1A8CA 3CCMP 1CXAA 1FZBA 5TISH 1GTWA 1RY3A 5AW3B 1CTZA 1N7SD 1IZNB 3CP5A 2HR3A 1HJ4A 2BEZF 2O3JA 3Q3DA 1AKKA 3H6PA 2HODB 4Z1MH 2GC4D 1VQ9P 2FYUE 1K9MQ 1Q2NA 1JCCA 1N73C 1S2EA 4PV1B 1BGYJ 2A06G 2OYIC 3AE9C 3EFGA 2KUBA 1OFCX 4EIDA 4XE5B 2E75D 1CRJA 5AVTB 3S1KA 4D6TE 1QL2A 1NVOA 1NTZG 3BCCG 2G3AA 3CCLP 1WT6A 2E76B 1RZ6A 4GIFA 4L1QA 3H1LJ 3RK2B 4EI2A 1FDIA 1VQLP 1OX3A 4WQCA 3RK3E 3AEEC 1AV1A 5APUA 2IPPA 1U74B 4BRYB 1SQPK 3L73E 5CIEB 4DY9A 2QJPB 1OW6A 1N86A 3MP7B 2ZBOA 1ZRTD 1VF5C 3L4FA 2YXQB 2K88A 1NNOA 1C6RA 5KAFV 5KLVK 3HD7D 1KORA 2IBZG 2XU6A 3L72D 4HKZH 2FFDB 1N8RQ 1M8OB 3RMZA 1EDKA 5E79V 4NPDA 3AEGC 1JCDA 1RE3C 3AEBC 2NRGA 1J1EB 3G6EP 2KP8A 3L70E 3M0DA 1KMIZ 2K37A 1MV8A 3WU2V 1JY2O 1LFMA 1H32B 1OVRA 2H89C 3ZIYA 4GOFA 1VQNP 3NBSA 3KZIE 3TF5A 3P7KA 1S3JA 3CX5I 1GK6A 1A02J 1SQBD 1RF0C 2D2CC 1LTAC 2N18C 2C1VA 2P67A 1R0QA 4L3HA 3TNUB 3H1KE 3L71E 2GUVA 1HTLC 4RESB 1FE6A 3H1ID 2KYVA 4H0KA 2ZVOB 4KHXA 1PPJE 1UIIA 2AIUA 2WZ7A 3MK7B 1W5CT 3WMM0 1DEBA 1SQVG 1JY3N 3WFEC 5CCHD 2WPVB 3IN6A 2NPSD 3CCSP 3AEDC 1Q90D 2R32A 1DVVA 3PHLA 1YEAA 2QRXA 1NAYA 2XNXA 2YKOA 5APWA 5DJUB 3M97X 3HQ6A 1OCDA 2FYUG 1KILC 5AVVB 1L9BC 2AXTV 1YQ3C 3E7KA 1FJKA 3SSUA 2DGEA 4FA1A 2WSEH 4JQ0D 3L4OA 4UB8E 1K3GA 4PD4D 5CIGB 2IDBA 3AE5C 1SQBJ 1NTKE 3H1LE 1NKZB 1NAFA 3H1JJ 3ORVA 3H1IJ 1SQVK 1KQFB 1YBKA 5CICB 5KAFH 3SJLA 1LNQA 5GTIE 5AVYB 2CPSA 3OA7A 3JSVC 2LKMA 2HG5D 4GT1A 3T97A 2E5YA 3L74E 2KI7B 1U57A 4EYYQ 1YCCA 2FYUK 2ITAA 4PV1C 1ZLLA 2WSFH 2UWJE 2Q1KA 4OGQB 2WTYA 1L4AB 1YNRA 3OW2O 1YTZI 3VOPA 4Y28J 1BE3D 1WVEC 2CE1A 3MIWA 3BRTB 5BU5A 5AW4B 1X9VA 3L70G 1JUNA 3HE5B 5CBOA 5KJ7C 4L3GA 3E1IA 1Q7YQ 2FBWC 2WT7A 1KX2A 2OYHC 4W7YA 1DH3A 2M3BA 4R4LA 2ZXYA 4EIJA 1N7SA 4H44D 1PIXA 4LGDE 3B5NB 1CNOA 5CIBB 4H0LD 5M1BA 1USEA 3QWOC 2C1UA 1RE4C 2A45G 3H1KG 3OCDB 3L71G 1K73Q 3GHGA 2ZT9D 2PRRA 2MHMA 1WMKA 4RO0A 1L0LG 3C2CA 1NTMG 2O01H 1C75A 2FWLA 3HQ9A 3CMAP 3MUDA 1T3UA 4U3FD 1YQ4C 3WFCC 1HGVA 1RF1C 1GIWA 1HJBA 3AE1C 3WC8A 1SFCA 4WWIA 2XKMA 2J58A 1ZRTE 1EZVI 1J1EC 2JEEA 2PCCB 4KMGA 2LXBA 1ZOYC 1DW3A 2JWDA 2ZJSE 4PW9B 2WSEJ 1BE3J 3L72E 5APYA 1VQ6P 1GW4A 1BDCA 1D7MA 3AE4C 2XV5A 1MUUA 1MG3D 1KQGB 2B12B 2W6AA 1CIHA
chains in the Genus database with same CATH topology
2N3YA 3CXHD 3BCCD 3VRDA 4GYDA 2L91A 2C1DB 1C52A 2YQBA 2JTIB 4AAMA 4J20A 2N3BA 2GIWA 1L0ND 3L4MA 3SXTA 1KV9A 1GQ1A 1GDVA 1C2RA 1IZL0 3A9FA 1F1FA 2KS1A 3PLNA 1ZZHA 1K3HA 2D0SA 2XTSB 2KNCB 1NTKD 2OZ1B 1HRCA 1IQCA 1HCMA 4YE1A 4A7PA 1EB7A 1CRGA 1L9JC 2ZZS1 1E29A 1HZVA 2I8FA 2K9JB 1M60A 351CA 1CSXA 1PP9D 4WQ9A 1HJ3A 2ORLA 2VHDA 3DR0A 3DP5A 3NWVA 3RN1A 1C6OA 3L74D 1OAEA 5KLIB 2PACA 2B10B 1J3SA 1C2NA 1NIRA 1YFCA 1KIBA 1CRIA 1A8CA 155CA 3PRJA 1CXAA 3H1JD 1NMIA 1CSUA 5IY51 1A56A 4N0KA 4AX3A 1BCCD 1CTZA 2BH4X 3CP5A 1HJ4A 2O3JA 2BLFB 1AKKA 4WQDA 2CXBA 3OA8A 1CHHA 2GC4D 4GEDB 2B0ZB 2DVHA 3SLEA 1DW0A 1YIQA 1P84D 4FA9A 4EIDA 2ZOOA 1CRJA 1CORA 2BPBB 2GB8B 1H9YA 1CRCA 4WQ8A 3PXWA 1KB9D 1QL4A 4O1WA 1RZ6A 4L1QA 2N18B 1FJ0A 4WQ7A 5DJQB 1I6DA 4WQCA 3OCDA 1KX7A 3O5CA 1H9XA 2Q3EA 3ZBMA 1DT1A 1U74B 1NTZD 4FA5A 3VYMA 5B66V 5CIEB 4DY9A 2QJPB 5KKZB 1LC1A 1H31B 1IRWA 1RAPA 2ZBOA 1F1CA 4AALA 1ZRTD 1DW1A 2N9JA 1RAQA 2LITA 1RZ5A 1NNOA 2ZONG 1H33B 1C6RA 5KAFV 3ZOWA 1LC2A 1HH7A 1I8OA 3WUIA 1N9CA 3L72D 2QJYB 1LMSA 1YICA 3CWBD 3RMZA 1YTCA 5E79V 1QKSA 2CE0A 4LJIA 2JQRA 3GW6A 4FAVA 1CIEA 5H2FV 3KZIV 3JBTB 3O0RC 3SVWA 1GU2A 3L75D 1EZVD 1AOFA 3WFDC 2IBZD 1NU1D 2Y0DA 1DIIC 3WU2V 1LFMA 1H32B 2C1DA 1HZUA 3ZIYA 4EDFA 1S5LV 4PJ0V 1DVHA 1CCHA 4RSZA 3X39A 2BCNB 1M6ZA 1I5TA 2B11B 3NBSA 4IL6V 2CA4B 3TF5A 4RJTA 4NFGB 1IRVA 1I6EA 2PCBB 1SQBD 2N18C 1H1OA 2C1VA 4Q5PA 2YIUB 4FB1A 4JCGA 1R0QA 4L3HA 3TYIA 4FANA 451CA 4UB6V 1ETPA 1FI9A 5KAIV 3H1ID 2OZ1A 4H0KA 4XXLA 1QL3A 2AIUA 5CYTR 3MK7B 1W5CT 2C2CA 4O1QA 2V07A 1CYCA 1VYDA 1CRHA 2FRCA 1MG2D 1JDLA 2HV4A 5CIDB 3WFEC 4QAOA 2QG4A 1WEJF 4FA4A 4WQAA 1YEBA 4PWAA 1CHIA 1DVVA 1C6SA 1HJ5A 3PHLA 1GJQA 1YEAA 2AI5A 1CIGA 1QN2A 3NBTA 1S6VB 3ZOOA 1M70A 5C0ZA 3HQ7A 1SQVD 3M97X 1N15A 4XYDB 3VNWA 3PXTA 4AAOA 1W2LA 2LIRA 3HQ6A 4UB8V 1OCDA 1MZ4A 2QJKB 3ZOYA 1L9BC 3ZCFA 2AXTV 1CXCA 3PH2B 1L0LD 2MTAC 3H1HD 1NTMD 4V2KA 2DGEA 4K3IA 4FA1A 1FCDC 1E8EA 1I54A 3VMAA 4Y5RA 3L4OA 1K3GA 2FYUD 4PD4D 2D0WA 5CIGB 5GTIV 2JWAA 1BL9A 3ZOXA 4MU8A 2C8SA 4D6TD 1SQQD 1E2RA 4H0JA 3ORVA 1QYZA 3TGUD 1CCRA 2Y0EA 1U75B 1IO3A 5CICB 1I55A 3SJLA 1CO6A 1A2SA 1COTA 1FI7A 3CYTI 3HQ8A 3MK7C 2BGVX 5TJHA 4WQEA 1CIFA 3O20A 1BGYD 3PXSA 3O1YA 2Y0CA 1YCCA 2EXVA 3L73D 3TDKA 1CHJA 1FOCA 3CX5W 1H31A 1SQXD 1YNRA 1FHBA 1KYOD 3GG2A 1CC5A 1HROA 5DFSA 1BE3D 3H1LD 1WVEC 2CE1A 1B7VA 1H33A 3OA8B 1CYJA 5DJQC 5C9MA 3CXHW 2N9YB 3PTZA 4L3GA 1NMLA 5GTHV 5CIHB 1CRYA 1KX2A 2C9XB 4AANA 4EIEA 1CSVA 1AYGA 1DW2A 1FI3A 2ZXYA 3L70D 3SWSA 1N50A 3KHUA 5CIFB 5TISV 1CNOA 5CIBB 3WFBC 1H32A 1N90A 1GKSA 2C1UA 5B5EV 1CTJA 2N9IA 2B4ZA 3OCDB 2YK3A 3A0HV 1CEDA 2RN0A 2MHMA 4P4QB 3C2CA 1C75A 2FWLA 4EIFA 1SQPD 1KYOW 3FWLA 3HQ9A 4U3FD 3RLMA 2YCCA 3WFCC 3CU4A 2CA3B 1GIWA 3H1KD 3DMIA 3L71D 3WC8A 2V08A 1KB0A 4EICA 5DF5A 5AURA 3RN0A 5EXQA 1PPJD 2FYNB 2PCCB 4KMGA 1LS9A 1AOQA 5B6QA 3CX5D 5KLVD 1DW3A 4WQBA 1CYIA 4PW9B 1CSWA 2BCCD 1CTYA 2A06D 2RMZA 1C7MA 1DIQC 2L4DA 1I8PA 2BH5X 2GC7D 1MG3D 3ITKA 2B12B 3A0BV 1CIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3Y A;  3CXH D;  3BCC D;  3VRD A;  4GYD A;  2L91 A;  2C1D B;  1C52 A;  2YQB A;  2JTI B;  4AAM A;  4J20 A;  2N3B A;  2GIW A;  1L0N D;  3L4M A;  3SXT A;  1KV9 A;  1GQ1 A;  1GDV A;  1C2R A;  1IZL 0;  3A9F A;  1F1F A;  2KS1 A;  3PLN A;  1ZZH A;  1K3H A;  2D0S A;  2XTS B;  2KNC B;  1NTK D;  2OZ1 B;  1HRC A;  1IQC A;  1HCM A;  4YE1 A;  4A7P A;  1EB7 A;  1CRG A;  1L9J C;  2ZZS 1;  1E29 A;  1HZV A;  2I8F A;  2K9J B;  1M60 A;  351C A;  1CSX A;  1PP9 D;  4WQ9 A;  1HJ3 A;  2ORL A;  2VHD A;  3DR0 A;  3DP5 A;  3NWV A;  3RN1 A;  1C6O A;  3L74 D;  1OAE A;  5KLI B;  2PAC A;  2B10 B;  1J3S A;  1C2N A;  1NIR A;  1YFC A;  1KIB A;  1CRI A;  1A8C A;  155C A;  3PRJ A;  1CXA A;  3H1J D;  1NMI A;  1CSU A;  5IY5 1;  1A56 A;  4N0K A;  4AX3 A;  1BCC D;  1CTZ A;  2BH4 X;  3CP5 A;  1HJ4 A;  2O3J A;  2BLF B;  1AKK A;  4WQD A;  2CXB A;  3OA8 A;  1CHH A;  2GC4 D;  4GED B;  2B0Z B;  2DVH A;  3SLE A;  1DW0 A;  1YIQ A;  1P84 D;  4FA9 A;  4EID A;  2ZOO A;  1CRJ A;  1COR A;  2BPB B;  2GB8 B;  1H9Y A;  1CRC A;  4WQ8 A;  3PXW A;  1KB9 D;  1QL4 A;  4O1W A;  1RZ6 A;  4L1Q A;  2N18 B;  1FJ0 A;  4WQ7 A;  5DJQ B;  1I6D A;  4WQC A;  3OCD A;  1KX7 A;  3O5C A;  1H9X A;  2Q3E A;  3ZBM A;  1DT1 A;  1U74 B;  1NTZ D;  4FA5 A;  3VYM A;  5B66 V;  5CIE B;  4DY9 A;  2QJP B;  5KKZ B;  1LC1 A;  1H31 B;  1IRW A;  1RAP A;  2ZBO A;  1F1C A;  4AAL A;  1ZRT D;  1DW1 A;  2N9J A;  1RAQ A;  2LIT A;  1RZ5 A;  1NNO A;  2ZON G;  1H33 B;  1C6R A;  5KAF V;  3ZOW A;  1LC2 A;  1HH7 A;  1I8O A;  3WUI A;  1N9C A;  3L72 D;  2QJY B;  1LMS A;  1YIC A;  3CWB D;  3RMZ A;  1YTC A;  5E79 V;  1QKS A;  2CE0 A;  4LJI A;  2JQR A;  3GW6 A;  4FAV A;  1CIE A;  5H2F V;  3KZI V;  3JBT B;  3O0R C;  3SVW A;  1GU2 A;  3L75 D;  1EZV D;  1AOF A;  3WFD C;  2IBZ D;  1NU1 D;  2Y0D A;  1DII C;  3WU2 V;  1LFM A;  1H32 B;  2C1D A;  1HZU A;  3ZIY A;  4EDF A;  1S5L V;  4PJ0 V;  1DVH A;  1CCH A;  4RSZ A;  3X39 A;  2BCN B;  1M6Z A;  1I5T A;  2B11 B;  3NBS A;  4IL6 V;  2CA4 B;  3TF5 A;  4RJT A;  4NFG B;  1IRV A;  1I6E A;  2PCB B;  1SQB D;  2N18 C;  1H1O A;  2C1V A;  4Q5P A;  2YIU B;  4FB1 A;  4JCG A;  1R0Q A;  4L3H A;  3TYI A;  4FAN A;  451C A;  4UB6 V;  1ETP A;  1FI9 A;  5KAI V;  3H1I D;  2OZ1 A;  4H0K A;  4XXL A;  1QL3 A;  2AIU A;  5CYT R;  3MK7 B;  1W5C T;  2C2C A;  4O1Q A;  2V07 A;  1CYC A;  1VYD A;  1CRH A;  2FRC A;  1MG2 D;  1JDL A;  2HV4 A;  5CID B;  3WFE C;  4QAO A;  2QG4 A;  1WEJ F;  4FA4 A;  4WQA A;  1YEB A;  4PWA A;  1CHI A;  1DVV A;  1C6S A;  1HJ5 A;  3PHL A;  1GJQ A;  1YEA A;  2AI5 A;  1CIG A;  1QN2 A;  3NBT A;  1S6V B;  3ZOO A;  1M70 A;  5C0Z A;  3HQ7 A;  1SQV D;  3M97 X;  1N15 A;  4XYD B;  3VNW A;  3PXT A;  4AAO A;  1W2L A;  2LIR A;  3HQ6 A;  4UB8 V;  1OCD A;  1MZ4 A;  2QJK B;  3ZOY A;  1L9B C;  3ZCF A;  2AXT V;  1CXC A;  3PH2 B;  1L0L D;  2MTA C;  3H1H D;  1NTM D;  4V2K A;  2DGE A;  4K3I A;  4FA1 A;  1FCD C;  1E8E A;  1I54 A;  3VMA A;  4Y5R A;  3L4O A;  1K3G A;  2FYU D;  4PD4 D;  2D0W A;  5CIG B;  5GTI V;  2JWA A;  1BL9 A;  3ZOX A;  4MU8 A;  2C8S A;  4D6T D;  1SQQ D;  1E2R A;  4H0J A;  3ORV A;  1QYZ A;  3TGU D;  1CCR A;  2Y0E A;  1U75 B;  1IO3 A;  5CIC B;  1I55 A;  3SJL A;  1CO6 A;  1A2S A;  1COT A;  1FI7 A;  3CYT I;  3HQ8 A;  3MK7 C;  2BGV X;  5TJH A;  4WQE A;  1CIF A;  3O20 A;  1BGY D;  3PXS A;  3O1Y A;  2Y0C A;  1YCC A;  2EXV A;  3L73 D;  3TDK A;  1CHJ A;  1FOC A;  3CX5 W;  1H31 A;  1SQX D;  1YNR A;  1FHB A;  1KYO D;  3GG2 A;  1CC5 A;  1HRO A;  5DFS A;  1BE3 D;  3H1L D;  1WVE C;  2CE1 A;  1B7V A;  1H33 A;  3OA8 B;  1CYJ A;  5DJQ C;  5C9M A;  3CXH W;  2N9Y B;  3PTZ A;  4L3G A;  1NML A;  5GTH V;  5CIH B;  1CRY A;  1KX2 A;  2C9X B;  4AAN A;  4EIE A;  1CSV A;  1AYG A;  1DW2 A;  1FI3 A;  2ZXY A;  3L70 D;  3SWS A;  1N50 A;  3KHU A;  5CIF B;  5TIS V;  1CNO A;  5CIB B;  3WFB C;  1H32 A;  1N90 A;  1GKS A;  2C1U A;  5B5E V;  1CTJ A;  2N9I A;  2B4Z A;  3OCD B;  2YK3 A;  3A0H V;  1CED A;  2RN0 A;  2MHM A;  4P4Q B;  3C2C A;  1C75 A;  2FWL A;  4EIF A;  1SQP D;  1KYO W;  3FWL A;  3HQ9 A;  4U3F D;  3RLM A;  2YCC A;  3WFC C;  3CU4 A;  2CA3 B;  1GIW A;  3H1K D;  3DMI A;  3L71 D;  3WC8 A;  2V08 A;  1KB0 A;  4EIC A;  5DF5 A;  5AUR A;  3RN0 A;  5EXQ A;  1PPJ D;  2FYN B;  2PCC B;  4KMG A;  1LS9 A;  1AOQ A;  5B6Q A;  3CX5 D;  5KLV D;  1DW3 A;  4WQB A;  1CYI A;  4PW9 B;  1CSW A;  2BCC D;  1CTY A;  2A06 D;  2RMZ A;  1C7M A;  1DIQ C;  2L4D A;  1I8P A;  2BH5 X;  2GC7 D;  1MG3 D;  3ITK A;  2B12 B;  3A0B V;  1CIH A; 
#chains in the Genus database with same CATH topology
 2N3Y A;  4TT3 H;  3GF3 A;  4GYD A;  1FDO A;  3IAO A;  2WVR A;  1JTH B;  2FXP A;  1BGY G;  1CI6 A;  3JC2 2;  4L74 A;  3HD7 A;  2JTI B;  1K04 A;  2BEQ D;  1EDL A;  2YKQ A;  1N73 B;  3TSI A;  2OYI B;  3A0B E;  1L0N D;  1L0L K;  2FYZ A;  1NTM K;  3HE4 A;  1JMB A;  3H1L G;  1FZA A;  2P10 A;  1SQB E;  3L36 A;  1GDV A;  3G71 P;  3KDP B;  2G8Y A;  1H89 A;  1C2R A;  1HBW A;  4IFD K;  3Q1M A;  2KS1 A;  1Y9B A;  3RGU A;  1ZZH A;  2WPS A;  1AFO A;  2WSF J;  3H1I E;  5APT A;  3NXS A;  2P58 A;  1IFP A;  1QVF O;  1SQQ K;  1HCM A;  4A7P A;  1CRG A;  1IFI A;  3AE8 C;  1FDM A;  1KB9 H;  2E5T A;  3VP9 A;  3VYI A;  2KIK A;  1VQ5 P;  1CSX A;  2IX7 C;  3CCV P;  3RK3 C;  3DR0 A;  3P8C D;  1C6O A;  4B86 A;  1OAE A;  4IL6 X;  1CRI A;  155C A;  1YJW P;  2KK7 A;  1LGH B;  2KSE A;  1NMI A;  3LW5 H;  4GOD A;  5CCH A;  4DCK A;  3M0D C;  3CL3 D;  2HPC B;  5CJ4 A;  2O01 J;  4HB1 A;  1IO4 A;  4GED B;  4PD4 E;  3RL0 D;  2YMY A;  2DVH A;  3WUT A;  3V2Q A;  5KAI E;  5EFW B;  4FA9 A;  1FZF A;  2KZJ A;  3L73 J;  1MFT A;  3RBX A;  5CJ0 A;  1H9Y A;  1G1I A;  3A3Y B;  4WY4 B;  1HWT C;  1KB9 D;  1A02 F;  2OGU A;  4O1W A;  2N18 B;  5DJQ B;  4OGQ C;  5AVS B;  3V4W A;  3U1A A;  1L4A C;  2QM7 A;  3CCJ P;  1J1D C;  2WSC H;  3V2R A;  1JM0 A;  3M91 A;  3M0A A;  4YTP C;  1YIT P;  1EZV E;  3VYM A;  3USS A;  4GOE A;  1URQ D;  3G4S P;  1OW8 A;  1U7M A;  2QEX P;  1RAP A;  1GL2 B;  1F1C A;  2J5U A;  3H25 A;  1BE3 E;  5AW2 B;  2Y9Z A;  2N9J A;  5KLI C;  1M1K Q;  3B5N C;  2FXO A;  3WUI A;  1BSN A;  1LTB C;  4NPE A;  1LMS A;  1YIC A;  3CWB D;  4GKG A;  2CE0 A;  1KIL B;  2JQR A;  4JBZ A;  3GW6 A;  1FJP A;  1CIE A;  5H2F V;  3L75 D;  1OW7 A;  5KAF E;  3P32 A;  3BAS A;  3WFD C;  1NU1 D;  4W80 A;  2W90 A;  3F5H A;  1DII C;  1SQB G;  3CC2 P;  1DD3 A;  5E79 E;  4PJ0 V;  2K9Y A;  2FY8 A;  2KOG A;  3X39 A;  3H1J G;  1I5T A;  2B11 B;  4IL6 V;  2CA4 B;  2QM8 A;  3H1I G;  3BRV B;  1IJD B;  2NPS B;  4ZNC A;  3GF7 A;  4K35 A;  1KB9 I;  1FOS E;  2PCB B;  2WIT A;  3WU2 E;  4U3F E;  1H1O A;  4FB1 A;  4JCG A;  2AEJ A;  1K8A Q;  4FAN A;  1ETP A;  3HTK B;  5KAI V;  2OZ1 A;  3LW5 J;  3HUS A;  1JY3 O;  2ZXE B;  2W83 C;  3VP8 A;  1JDL A;  2HV4 A;  1J2J B;  4QAO A;  2I1J A;  1FU1 A;  5K5G B;  4L76 A;  2JJL A;  2K9J A;  2Y9Y A;  1KFM A;  1CIG A;  3NBT A;  4ZKP A;  1SQB K;  3N7N A;  1M70 A;  1NTK J;  3KXD A;  3HQ7 A;  3BVH A;  1N15 A;  1SFC D;  3VNW A;  1W2L A;  1NU1 J;  3ZCF A;  3M9B A;  3NMD A;  1L0N E;  1USD A;  2WSC J;  3H1H D;  5APQ A;  1PGO A;  3OAK A;  3CC7 P;  4K3I A;  3A0B H;  1JB0 J;  2OYH B;  1I54 A;  3VMA A;  1QVG O;  2D0W A;  1SVF A;  2JWA A;  2AXT E;  2B87 B;  1LWU A;  3L74 J;  4MU8 A;  2IZ1 A;  5AVR B;  2C8S A;  2E75 C;  1JO5 A;  2N1T A;  4HH2 A;  1E2R A;  3MUD C;  3H32 B;  3TGU D;  4C46 A;  1EZV G;  2ZYA A;  3I56 P;  2XND H;  2W6J H;  2O01 N;  3OJA B;  1NH4 A;  2H7H A;  1RF1 B;  3CYT I;  3HQ8 A;  5CMZ A;  1OVU A;  3O6Q B;  5TJH A;  2IZ0 A;  1BE3 G;  1NTZ K;  2D2C D;  1X8Y A;  5H2F H;  3VMX A;  1OZH A;  3MD0 A;  3P8C E;  1OMI A;  2Y0C A;  3MTU E;  2M5A B;  2RH0 A;  1LTJ A;  1LJ2 A;  4Y99 B;  3Q5S A;  3EQ2 A;  1H31 A;  3R4Y A;  2GUS A;  1FHB A;  2YMK A;  1GD2 E;  1KYO D;  4WY4 C;  5DFS A;  1N2D C;  1IFM A;  4IL6 H;  4H13 D;  5AVX B;  1ZXG A;  2AXC A;  1B7V A;  3II6 A;  1H33 A;  3L37 A;  4OWF A;  4ASW A;  2QSI A;  5CCG C;  5DJQ C;  5C9M A;  2YNY A;  3PJS K;  4JPZ B;  3PTZ A;  4PD4 H;  3KPE A;  1AA0 A;  5KAI H;  2C9L Y;  2W6B A;  1RQU A;  1T3J A;  1KB9 E;  1N50 A;  2E74 B;  3WFB C;  1GL2 C;  3TGU J;  2Q3I A;  2N9I A;  2YK3 A;  1M1J A;  3L72 J;  1H0T A;  3FXE A;  1SQP D;  1SP4 A;  3M9H A;  1HF9 A;  4WVZ A;  3VMZ A;  1YJN P;  3CU4 A;  2CA3 B;  3DMI A;  4EIC A;  5EXQ A;  1ZV8 A;  1HH0 A;  3RK3 B;  1PL5 A;  4D6T G;  5B6Q A;  5KLV D;  3ZDM A;  4WQB A;  4C7N A;  2PP6 A;  3CWB E;  1LTG C;  3CI9 A;  2A06 D;  1X22 A;  1URQ A;  2LR2 A;  3SWK A;  1DIQ C;  1I8P A;  2R3S A;  2NPS C;  2BH5 X;  1NHL A;  3L75 E;  1FZC A;  3BCC D;  5AW5 B;  4KT0 J;  1NU1 E;  1LT9 A;  4KJM A;  1S1C X;  4PV1 D;  1IC2 A;  3L73 G;  4AAM A;  1AQ5 A;  3D71 A;  2KLV A;  4DJG A;  4IFM A;  3A2A A;  5E79 H;  2GIW A;  2QVA A;  3L4M A;  2QIW A;  2H43 A;  2W8Z A;  1AQT A;  2E76 D;  2ZXX A;  3RK2 D;  5B66 E;  4CPG A;  4W7Z A;  1F1F A;  2OYO A;  3VMY A;  3E1R A;  3WU2 H;  3PLN A;  1SQP J;  1QX8 A;  3L35 A;  1QL1 A;  3B8E B;  1J1D B;  1Q81 Q;  2I1K A;  1HRC A;  3LID A;  1IQC A;  1P84 H;  1ZW0 A;  3MHV A;  3G9R A;  1L9J C;  2ZZS 1;  5KLV J;  2I8F A;  5AVU B;  1WRG A;  1M60 A;  4ASV A;  4WQ9 A;  1HJ3 A;  2VHD A;  4K3A A;  3NWV A;  1VQK P;  1BSH A;  2KLU A;  2OQQ A;  5KLI B;  4PD4 I;  3TK1 A;  2YO3 A;  1MKM A;  1PGQ A;  1GMJ A;  1NIR A;  1YFC A;  1KIB A;  1JY2 P;  3AE3 C;  3PRJ A;  1NGM B;  1G2C A;  1EXJ A;  1CSU A;  5IY5 1;  2PAJ A;  3H1H E;  4N0K A;  2IFN A;  2M3E A;  1PPJ G;  4WQD A;  3OA8 A;  1CHH A;  1VL2 A;  3SLE A;  4U7J A;  1DW0 A;  2IFM A;  5AW1 B;  2IYO A;  1P84 D;  1YHQ P;  3S4R A;  2ZOO A;  2AXT H;  2BPB B;  1S4X A;  1AJY A;  1H8A A;  1SS1 A;  1KQS O;  3TGU E;  1QL4 A;  4Y99 C;  3R2P A;  3VN0 A;  1FJ0 A;  4H0L C;  4QMA A;  1RHZ B;  2WMM A;  1I6D A;  1HJ0 A;  1KX7 A;  3K5B A;  3O5C A;  1R5L A;  2ZT9 C;  1CSB A;  1RE3 A;  3T97 B;  4AUW A;  4FA5 A;  2O1K A;  3KQG A;  5B66 V;  4L75 A;  5KKZ B;  3B71 A;  3G3Z A;  1ZN5 A;  2N1T D;  4AAL A;  1KYO E;  1KTM A;  1Y8A A;  1DW1 A;  1NTK G;  2ZYD A;  1RAQ A;  1T2K D;  1RZ5 A;  2JR8 A;  2ZON G;  2JDI H;  2E74 C;  1LC2 A;  1NU1 G;  1I8O A;  1RF0 A;  1OIP A;  3AEC C;  2QJY B;  2VRS A;  5CHX A;  1QKS A;  4U3F J;  3Q2Y A;  2WT7 B;  4FAV A;  2B88 A;  1DX7 A;  3O0R C;  1GU2 A;  3N4X A;  2Q9I A;  1N7S B;  3L74 G;  1GU5 A;  1W2E A;  4XFJ A;  2WQY C;  2C1D A;  1P84 I;  3CLQ A;  3NTN A;  2BCN B;  3AE6 C;  5H2F E;  3GHG B;  1FS0 E;  2K1A A;  1LP1 A;  4RJT A;  1OXZ A;  1IRV A;  1RQV A;  4DT0 A;  1SQP E;  2E75 B;  1L2P A;  3SFD C;  2YIU B;  4PJ0 E;  5AW0 B;  4UB6 V;  1SFC B;  4IL6 E;  1NTK K;  2KNC A;  3KYQ A;  4XXL A;  1QL3 A;  1W2B O;  5CYT R;  2C2C A;  1X79 B;  1CYC A;  5KLV E;  2XZR A;  1LTJ C;  2AEM A;  3HRN A;  1L0N J;  3WUU A;  4OGQ D;  1FZG A;  1L4A D;  5CID B;  2A06 E;  2QG4 A;  4FA4 A;  3V2P A;  4WQA A;  1YEB A;  1U7J A;  4PWA A;  1CHI A;  1C6S A;  2HYN A;  1HJ5 A;  3BCC E;  1QN2 A;  3CCE P;  1VQ7 P;  1S6V B;  3ZOO A;  5C0Z A;  1CI6 B;  3IFM A;  4AAO A;  3PXT A;  3HD7 B;  2LIR A;  1E79 H;  1MZ4 A;  3PP5 A;  4C7R A;  1GK4 A;  3PH2 B;  1L0L D;  2MTA C;  3HE4 B;  1NTM D;  3V5B A;  4V2K A;  3B5N D;  1FCD C;  2HOD A;  3TGU G;  1E8E A;  2KS1 B;  3L72 G;  3V2N A;  3RL0 C;  5B66 H;  4N78 D;  1BL9 A;  5AW6 B;  1KZU B;  1PFI A;  1W5C E;  4HYT B;  1SQQ D;  4H0J A;  2QE7 H;  1QYZ A;  3ABV C;  1CCR A;  2Y0E A;  1U75 B;  1I55 A;  1A2S A;  3EWK A;  4IFF A;  4N3Y B;  1COT A;  1FI7 A;  4I7Z C;  3CME P;  4OVN F;  1IFN A;  1CW5 A;  3CPW O;  3CD6 P;  4AQR D;  4WQE A;  2NZ2 A;  2KSJ A;  4BRY A;  1YI2 P;  3D70 A;  1BGY D;  3PXS A;  3C1L A;  3SFE C;  2EXV A;  3TDK A;  1CHJ A;  1VPC A;  1URQ C;  3AEA C;  1SQX D;  1CC5 A;  1HRO A;  1FZC C;  1KQL A;  3H1L D;  1M56 D;  1LT9 C;  2YKP A;  2KXP B;  1NTM J;  1CYJ A;  2CK3 H;  2QJK C;  2FFD A;  3NFQ A;  5AW9 B;  4DOJ A;  5GTH V;  1P84 E;  1R8E A;  5CIH B;  4TLF A;  4UB6 H;  4AAN A;  1CSV A;  1AYG A;  1DW2 A;  1EC5 A;  1FI3 A;  1M57 D;  1KFN A;  3SWS A;  1PGJ A;  3KHU A;  5CIF B;  3CXH H;  2J59 M;  1H32 A;  1N90 A;  1GKS A;  3RL0 g;  4XA4 A;  5KKZ C;  1SQQ J;  2V4H A;  1EXI A;  4R4M A;  5DJT B;  5B5E V;  1CTJ A;  1E5W A;  3A0H V;  1CED A;  2RN0 A;  3O8Z A;  3CWB J;  3IR9 A;  3FX0 A;  4EIF A;  2C0X A;  3FWL A;  2P2U A;  5KLV G;  2QJY C;  1VQM P;  3TNU A;  3L75 J;  1DEE G;  2PFX A;  1VF5 D;  1KB0 A;  2ZVN B;  4YXD C;  5DF5 A;  3AE7 C;  2FYN B;  3Q5R A;  1KYO H;  1N7S C;  1SQX J;  3CX5 D;  1VQO P;  1CYI A;  5KTB A;  4AYC A;  2BCC D;  1CTY A;  3W67 A;  1FBM A;  2R5B A;  1C7M A;  3GHG C;  2GC7 D;  5L8R J;  1YTZ T;  2GA1 A;  3CXH D;  2L91 A;  1ZME C;  2YIU C;  1AVY A;  1C52 A;  5AW7 B;  2YQB A;  3M06 A;  1SFC C;  4J20 A;  2N3B A;  2R44 A;  1Q86 Q;  1SLQ A;  1Q82 Q;  4WY4 D;  3VTP C;  2P7J A;  1DIP A;  3SXT A;  1KV9 A;  1HGZ A;  1GQ1 A;  1JEK A;  5AVZ B;  5CCG D;  1IZL 0;  3A9F A;  4H44 B;  1ZP0 C;  4YPC A;  4H0L B;  4PJ0 H;  2OZ1 B;  3A7O A;  3HUS B;  1IFD A;  5AVQ B;  3SWY A;  2L5G B;  2ZT9 B;  4YE1 A;  4OH8 B;  1EB7 A;  3JCU H;  2B89 A;  4EOT A;  3H1H J;  3HD7 C;  1N7L A;  1GL2 D;  1E29 A;  2Q7C A;  3FGA D;  2K9J B;  351C A;  2BCC J;  4JYB A;  5GTH H;  2YXR B;  1PP9 D;  3SWF A;  1S5L X;  4N6J A;  1KD1 Q;  2PAC A;  2B10 B;  1C2N A;  4U3F G;  1KIL D;  1S5L E;  1M7L A;  1FOS F;  1QEX A;  4YXW H;  3H1J D;  4MN4 C;  1L4A A;  3WUV A;  1A56 A;  1L0L E;  3CXH I;  5B5E H;  1NTM E;  4AX3 A;  1BCC D;  2BH4 X;  3A0H H;  2JP3 A;  1T8Z A;  4H13 C;  4DZO A;  2BLF B;  3CCQ P;  2CXB A;  3W68 A;  1Z56 A;  3HE5 A;  2B0Z B;  4O9B A;  2KZI A;  3CCR P;  4N78 E;  1EDI A;  1LWU B;  2FXM A;  1YIQ A;  1M90 Q;  1COR A;  2GB8 B;  4JF7 A;  5C39 A;  2M8R A;  1CRC A;  1SQQ E;  2N1T B;  4WQ8 A;  3PXW A;  3F89 A;  1JY3 P;  2B9B A;  3B5N A;  4WQ7 A;  3U1C A;  1Y47 A;  1YIJ P;  1KYO I;  5CCH C;  4JYC A;  3OCD A;  1H9X A;  2Q3E A;  3ZBM A;  1L0N G;  1DT1 A;  2OTL P;  1NTZ D;  1BGY E;  2Z4E A;  3EFF K;  1HVV A;  1LTJ B;  1MZ9 A;  1PP9 J;  2PGD A;  4BXL A;  1LC1 A;  1H31 B;  1IRW A;  3AEF C;  1SQX E;  1NYH A;  2ZFC A;  3CCU P;  1NJI Q;  2LIT A;  1H33 B;  3ZOW A;  2Z5I A;  1HH7 A;  5AW8 B;  1N9C A;  1BCC J;  5KJ7 D;  3D6Z A;  2V7Q H;  4M3L A;  1YTC A;  2JO1 A;  2HFE D;  4LJI A;  1IK7 A;  2WWW A;  3KZI V;  2MKV A;  2WPQ A;  2N9B A;  3JBT B;  3SVW A;  2RKL A;  5CBN A;  4LC1 A;  1EZV D;  1AOF A;  2IBZ D;  3S9O A;  1JTH A;  2Y0D A;  1FZE A;  1CZQ A;  1HZU A;  4HJG H;  1PGP A;  4EDF A;  1KN7 A;  1S5L V;  1DVH A;  1QGK B;  1CCH A;  1JY2 N;  4RSZ A;  1N73 A;  3RL0 B;  1M6Z A;  1M1J B;  1FAV A;  2OYI A;  1L0N K;  2FYN C;  4NFG B;  1I6E A;  1H0T B;  1NO4 A;  2E76 C;  1JOC A;  3AE2 C;  3RK2 C;  4Q5P A;  1NTZ J;  1RH5 B;  2KB7 P;  3BCC J;  3TYI A;  1S72 P;  451C A;  1FI9 A;  4I7Z B;  2FKW B;  3P8M C;  2C0W A;  1S9K D;  4O1Q A;  3RBZ A;  2V07 A;  1T6A A;  1G1J A;  4WB4 A;  1VYD A;  3CX5 E;  1CRH A;  4C7N B;  2BCC E;  2QJP C;  3MGN A;  2FRC A;  1MG2 D;  1YJ9 P;  4UB6 E;  1URQ B;  3UIA A;  1WEJ F;  3TYY A;  1BDD A;  1GJQ A;  3A5T A;  4IOI H;  3CXH E;  1FZC B;  2AI5 A;  3Q5P A;  3I55 P;  1LT9 B;  1FC2 C;  5TIS E;  1SQV D;  2FFD C;  4H44 C;  4XYD B;  4UB8 V;  2QJK B;  3ZOY A;  3CC4 P;  1CXC A;  1VQ4 P;  3HUS C;  2IBZ I;  1LT1 A;  2E74 D;  2HPC A;  1SQQ G;  1PV3 A;  3MZW B;  3U59 A;  4Y5R A;  2FYU D;  2Q6Q A;  2GM4 A;  5GTI V;  3CWB G;  2H8P D;  3ZOX A;  1XTG B;  2HLO A;  2E43 A;  4D6T D;  1NOH A;  4WY4 A;  3IF4 A;  3L75 G;  3FXD A;  1PZQ A;  4LLH A;  1IO3 A;  1ZR4 A;  2WPR A;  4ZKU A;  2OAR A;  1QLE D;  1CO6 A;  1IK9 A;  5CCG A;  4I1L A;  3V6I A;  2V7Q J;  2XDJ A;  1SQX G;  1H88 A;  3RK3 D;  3B4S A;  4RKU J;  3MK7 C;  2R3C A;  1PP9 E;  2BGV X;  3GMA A;  4GDO A;  1MFZ A;  3KZI H;  1CIF A;  5APS A;  3O20 A;  3PH0 A;  1GZL A;  3O1Y A;  5BU8 B;  3L73 D;  1KIL E;  1FOC A;  1LWU C;  3CX5 W;  1G2C B;  3H1J E;  1GL2 A;  1SQV J;  1S5L H;  3GG2 A;  2A45 H;  1VQ8 P;  3D0W A;  1BCC E;  2N1T C;  2W27 A;  2O1J A;  1GDT A;  1EQ7 A;  4L73 A;  3V4Q A;  2Q5U A;  1T2K C;  3OA8 B;  3I5C A;  3CXH W;  2CPB A;  2N9Y B;  1GW3 A;  1NML A;  1KIL A;  1CRY A;  2FYU J;  3JCU E;  1GU4 A;  2C9N Y;  1EDJ A;  2C9X B;  1DD4 A;  4EIE A;  1VF5 B;  3FWN A;  1IFJ A;  1AVO A;  1NU1 K;  3L70 D;  1VDF A;  5TIS V;  1JMM A;  2YO2 A;  4D6T J;  1K05 A;  1LTS C;  5GTH E;  1LTI C;  1SQX K;  2B4Z A;  1VQP P;  3BAT A;  5AVW B;  2NPS A;  4P4Q B;  3H1H G;  1NTZ E;  2POH A;  1KC8 Q;  1JNM A;  1KYO W;  1HUC A;  3RLM A;  2YCC A;  2BCC G;  2JKV A;  1OVV A;  5B5E E;  4I2L C;  3H1K D;  3L71 D;  4UB8 H;  3A0H E;  3HTK A;  4I6M C;  2V08 A;  1KV4 A;  1LTT C;  5AUR A;  3RN0 A;  1PPJ D;  2BAS A;  5APX A;  1LS9 A;  1AOQ A;  2D2C B;  1CSW A;  1X0T A;  2RMZ A;  1M1J C;  2WSS H;  2LXC B;  2L4D A;  5GTI H;  1UIX A;  1NWQ A;  3ITK A;  3A0B V;  3VRD A;  1ZR2 A;  2IBZ E;  4NPF X;  1R5S A;  4H13 B;  1YYC A;  2AEF A;  2C1D B;  2ZYG A;  2M0B A;  3L70 J;  3D6Y A;  2MJZ A;  5KJ7 A;  4BWN A;  2Z5H A;  2E42 A;  1LP1 B;  2H88 C;  3GLM A;  2OYH A;  2OTJ P;  2IYP A;  3C9I A;  3QH9 A;  1K3H A;  2B87 A;  2D0S A;  2XTS B;  1XTC C;  2KNC B;  1NTK D;  1RE4 A;  1S9K E;  1PP9 G;  3H1K J;  3L71 J;  3H32 A;  1OWA A;  3C8V A;  2QA4 P;  1L0L J;  2DW3 A;  2A45 I;  2I8D A;  3CX5 H;  2P1J A;  1NKN A;  3LIE A;  1HZV A;  4WBA A;  2ZAE B;  1RF1 A;  5APV A;  3O6Q A;  1BCC G;  2ORL A;  2OTK E;  4ZMD A;  2SPZ A;  3DP5 A;  2R5D A;  2K3R A;  3RN1 A;  3L74 D;  1SQP G;  1SQV E;  2M5A A;  1TU3 F;  1J3S A;  3M9Q A;  5BVZ A;  1A8C A;  3CCM P;  1CXA A;  1FZB A;  5TIS H;  1GTW A;  1RY3 A;  5AW3 B;  1CTZ A;  1N7S D;  1IZN B;  3CP5 A;  2HR3 A;  1HJ4 A;  2BEZ F;  2O3J A;  3Q3D A;  1AKK A;  3H6P A;  2HOD B;  4Z1M H;  2GC4 D;  1VQ9 P;  2FYU E;  1K9M Q;  1Q2N A;  1JCC A;  1N73 C;  1S2E A;  4PV1 B;  1BGY J;  2A06 G;  2OYI C;  3AE9 C;  3EFG A;  2KUB A;  1OFC X;  4EID A;  4XE5 B;  2E75 D;  1CRJ A;  5AVT B;  3S1K A;  4D6T E;  1QL2 A;  1NVO A;  1NTZ G;  3BCC G;  2G3A A;  3CCL P;  1WT6 A;  2E76 B;  1RZ6 A;  4GIF A;  4L1Q A;  3H1L J;  3RK2 B;  4EI2 A;  1FDI A;  1VQL P;  1OX3 A;  4WQC A;  3RK3 E;  3AEE C;  1AV1 A;  5APU A;  2IPP A;  1U74 B;  4BRY B;  1SQP K;  3L73 E;  5CIE B;  4DY9 A;  2QJP B;  1OW6 A;  1N86 A;  3MP7 B;  2ZBO A;  1ZRT D;  1VF5 C;  3L4F A;  2YXQ B;  2K88 A;  1NNO A;  1C6R A;  5KAF V;  5KLV K;  3HD7 D;  1KOR A;  2IBZ G;  2XU6 A;  3L72 D;  4HKZ H;  2FFD B;  1N8R Q;  1M8O B;  3RMZ A;  1EDK A;  5E79 V;  4NPD A;  3AEG C;  1JCD A;  1RE3 C;  3AEB C;  2NRG A;  1J1E B;  3G6E P;  2KP8 A;  3L70 E;  3M0D A;  1KMI Z;  2K37 A;  1MV8 A;  3WU2 V;  1JY2 O;  1LFM A;  1H32 B;  1OVR A;  2H89 C;  3ZIY A;  4GOF A;  1VQN P;  3NBS A;  3KZI E;  3TF5 A;  3P7K A;  1S3J A;  3CX5 I;  1GK6 A;  1A02 J;  1SQB D;  1RF0 C;  2D2C C;  1LTA C;  2N18 C;  2C1V A;  2P67 A;  1R0Q A;  4L3H A;  3TNU B;  3H1K E;  3L71 E;  2GUV A;  1HTL C;  4RES B;  1FE6 A;  3H1I D;  2KYV A;  4H0K A;  2ZVO B;  4KHX A;  1PPJ E;  1UII A;  2AIU A;  2WZ7 A;  3MK7 B;  1W5C T;  3WMM 0;  1DEB A;  1SQV G;  1JY3 N;  3WFE C;  5CCH D;  2WPV B;  3IN6 A;  2NPS D;  3CCS P;  3AED C;  1Q90 D;  2R32 A;  1DVV A;  3PHL A;  1YEA A;  2QRX A;  1NAY A;  2XNX A;  2YKO A;  5APW A;  5DJU B;  3M97 X;  3HQ6 A;  1OCD A;  2FYU G;  1KIL C;  5AVV B;  1L9B C;  2AXT V;  1YQ3 C;  3E7K A;  1FJK A;  3SSU A;  2DGE A;  4FA1 A;  2WSE H;  4JQ0 D;  3L4O A;  4UB8 E;  1K3G A;  4PD4 D;  5CIG B;  2IDB A;  3AE5 C;  1SQB J;  1NTK E;  3H1L E;  1NKZ B;  1NAF A;  3H1J J;  3ORV A;  3H1I J;  1SQV K;  1KQF B;  1YBK A;  5CIC B;  5KAF H;  3SJL A;  1LNQ A;  5GTI E;  5AVY B;  2CPS A;  3OA7 A;  3JSV C;  2LKM A;  2HG5 D;  4GT1 A;  3T97 A;  2E5Y A;  3L74 E;  2KI7 B;  1U57 A;  4EYY Q;  1YCC A;  2FYU K;  2ITA A;  4PV1 C;  1ZLL A;  2WSF H;  2UWJ E;  2Q1K A;  4OGQ B;  2WTY A;  1L4A B;  1YNR A;  3OW2 O;  1YTZ I;  3VOP A;  4Y28 J;  1BE3 D;  1WVE C;  2CE1 A;  3MIW A;  3BRT B;  5BU5 A;  5AW4 B;  1X9V A;  3L70 G;  1JUN A;  3HE5 B;  5CBO A;  5KJ7 C;  4L3G A;  3E1I A;  1Q7Y Q;  2FBW C;  2WT7 A;  1KX2 A;  2OYH C;  4W7Y A;  1DH3 A;  2M3B A;  4R4L A;  2ZXY A;  4EIJ A;  1N7S A;  4H44 D;  1PIX A;  4LGD E;  3B5N B;  1CNO A;  5CIB B;  4H0L D;  5M1B A;  1USE A;  3QWO C;  2C1U A;  1RE4 C;  2A45 G;  3H1K G;  3OCD B;  3L71 G;  1K73 Q;  3GHG A;  2ZT9 D;  2PRR A;  2MHM A;  1WMK A;  4RO0 A;  1L0L G;  3C2C A;  1NTM G;  2O01 H;  1C75 A;  2FWL A;  3HQ9 A;  3CMA P;  3MUD A;  1T3U A;  4U3F D;  1YQ4 C;  3WFC C;  1HGV A;  1RF1 C;  1GIW A;  1HJB A;  3AE1 C;  3WC8 A;  1SFC A;  4WWI A;  2XKM A;  2J58 A;  1ZRT E;  1EZV I;  1J1E C;  2JEE A;  2PCC B;  4KMG A;  2LXB A;  1ZOY C;  1DW3 A;  2JWD A;  2ZJS E;  4PW9 B;  2WSE J;  1BE3 J;  3L72 E;  5APY A;  1VQ6 P;  1GW4 A;  1BDC A;  1D7M A;  3AE4 C;  2XV5 A;  1MUU A;  1MG3 D;  1KQG B;  2B12 B;  2W6A A;  1CIH A; 
#chains in the Genus database with same CATH homology
 2N3Y A;  3CXH D;  3BCC D;  3VRD A;  4GYD A;  2L91 A;  2C1D B;  1C52 A;  2YQB A;  2JTI B;  4AAM A;  4J20 A;  2N3B A;  2GIW A;  1L0N D;  3L4M A;  3SXT A;  1KV9 A;  1GQ1 A;  1GDV A;  1C2R A;  1IZL 0;  3A9F A;  1F1F A;  2KS1 A;  3PLN A;  1ZZH A;  1K3H A;  2D0S A;  2XTS B;  2KNC B;  1NTK D;  2OZ1 B;  1HRC A;  1IQC A;  1HCM A;  4YE1 A;  4A7P A;  1EB7 A;  1CRG A;  1L9J C;  2ZZS 1;  1E29 A;  1HZV A;  2I8F A;  2K9J B;  1M60 A;  351C A;  1CSX A;  1PP9 D;  4WQ9 A;  1HJ3 A;  2ORL A;  2VHD A;  3DR0 A;  3DP5 A;  3NWV A;  3RN1 A;  1C6O A;  3L74 D;  1OAE A;  5KLI B;  2PAC A;  2B10 B;  1J3S A;  1C2N A;  1NIR A;  1YFC A;  1KIB A;  1CRI A;  1A8C A;  155C A;  3PRJ A;  1CXA A;  3H1J D;  1NMI A;  1CSU A;  5IY5 1;  1A56 A;  4N0K A;  4AX3 A;  1BCC D;  1CTZ A;  2BH4 X;  3CP5 A;  1HJ4 A;  2O3J A;  2BLF B;  1AKK A;  4WQD A;  2CXB A;  3OA8 A;  1CHH A;  2GC4 D;  4GED B;  2B0Z B;  2DVH A;  3SLE A;  1DW0 A;  1YIQ A;  1P84 D;  4FA9 A;  4EID A;  2ZOO A;  1CRJ A;  1COR A;  2BPB B;  2GB8 B;  1H9Y A;  1CRC A;  4WQ8 A;  3PXW A;  1KB9 D;  1QL4 A;  4O1W A;  1RZ6 A;  4L1Q A;  2N18 B;  1FJ0 A;  4WQ7 A;  5DJQ B;  1I6D A;  4WQC A;  3OCD A;  1KX7 A;  3O5C A;  1H9X A;  2Q3E A;  3ZBM A;  1DT1 A;  1U74 B;  1NTZ D;  4FA5 A;  3VYM A;  5B66 V;  5CIE B;  4DY9 A;  2QJP B;  5KKZ B;  1LC1 A;  1H31 B;  1IRW A;  1RAP A;  2ZBO A;  1F1C A;  4AAL A;  1ZRT D;  1DW1 A;  2N9J A;  1RAQ A;  2LIT A;  1RZ5 A;  1NNO A;  2ZON G;  1H33 B;  1C6R A;  5KAF V;  3ZOW A;  1LC2 A;  1HH7 A;  1I8O A;  3WUI A;  1N9C A;  3L72 D;  2QJY B;  1LMS A;  1YIC A;  3CWB D;  3RMZ A;  1YTC A;  5E79 V;  1QKS A;  2CE0 A;  4LJI A;  2JQR A;  3GW6 A;  4FAV A;  1CIE A;  5H2F V;  3KZI V;  3JBT B;  3O0R C;  3SVW A;  1GU2 A;  3L75 D;  1EZV D;  1AOF A;  3WFD C;  2IBZ D;  1NU1 D;  2Y0D A;  1DII C;  3WU2 V;  1LFM A;  1H32 B;  2C1D A;  1HZU A;  3ZIY A;  4EDF A;  1S5L V;  4PJ0 V;  1DVH A;  1CCH A;  4RSZ A;  3X39 A;  2BCN B;  1M6Z A;  1I5T A;  2B11 B;  3NBS A;  4IL6 V;  2CA4 B;  3TF5 A;  4RJT A;  4NFG B;  1IRV A;  1I6E A;  2PCB B;  1SQB D;  2N18 C;  1H1O A;  2C1V A;  4Q5P A;  2YIU B;  4FB1 A;  4JCG A;  1R0Q A;  4L3H A;  3TYI A;  4FAN A;  451C A;  4UB6 V;  1ETP A;  1FI9 A;  5KAI V;  3H1I D;  2OZ1 A;  4H0K A;  4XXL A;  1QL3 A;  2AIU A;  5CYT R;  3MK7 B;  1W5C T;  2C2C A;  4O1Q A;  2V07 A;  1CYC A;  1VYD A;  1CRH A;  2FRC A;  1MG2 D;  1JDL A;  2HV4 A;  5CID B;  3WFE C;  4QAO A;  2QG4 A;  1WEJ F;  4FA4 A;  4WQA A;  1YEB A;  4PWA A;  1CHI A;  1DVV A;  1C6S A;  1HJ5 A;  3PHL A;  1GJQ A;  1YEA A;  2AI5 A;  1CIG A;  1QN2 A;  3NBT A;  1S6V B;  3ZOO A;  1M70 A;  5C0Z A;  3HQ7 A;  1SQV D;  3M97 X;  1N15 A;  4XYD B;  3VNW A;  3PXT A;  4AAO A;  1W2L A;  2LIR A;  3HQ6 A;  4UB8 V;  1OCD A;  1MZ4 A;  2QJK B;  3ZOY A;  1L9B C;  3ZCF A;  2AXT V;  1CXC A;  3PH2 B;  1L0L D;  2MTA C;  3H1H D;  1NTM D;  4V2K A;  2DGE A;  4K3I A;  4FA1 A;  1FCD C;  1E8E A;  1I54 A;  3VMA A;  4Y5R A;  3L4O A;  1K3G A;  2FYU D;  4PD4 D;  2D0W A;  5CIG B;  5GTI V;  2JWA A;  1BL9 A;  3ZOX A;  4MU8 A;  2C8S A;  4D6T D;  1SQQ D;  1E2R A;  4H0J A;  3ORV A;  1QYZ A;  3TGU D;  1CCR A;  2Y0E A;  1U75 B;  1IO3 A;  5CIC B;  1I55 A;  3SJL A;  1CO6 A;  1A2S A;  1COT A;  1FI7 A;  3CYT I;  3HQ8 A;  3MK7 C;  2BGV X;  5TJH A;  4WQE A;  1CIF A;  3O20 A;  1BGY D;  3PXS A;  3O1Y A;  2Y0C A;  1YCC A;  2EXV A;  3L73 D;  3TDK A;  1CHJ A;  1FOC A;  3CX5 W;  1H31 A;  1SQX D;  1YNR A;  1FHB A;  1KYO D;  3GG2 A;  1CC5 A;  1HRO A;  5DFS A;  1BE3 D;  3H1L D;  1WVE C;  2CE1 A;  1B7V A;  1H33 A;  3OA8 B;  1CYJ A;  5DJQ C;  5C9M A;  3CXH W;  2N9Y B;  3PTZ A;  4L3G A;  1NML A;  5GTH V;  5CIH B;  1CRY A;  1KX2 A;  2C9X B;  4AAN A;  4EIE A;  1CSV A;  1AYG A;  1DW2 A;  1FI3 A;  2ZXY A;  3L70 D;  3SWS A;  1N50 A;  3KHU A;  5CIF B;  5TIS V;  1CNO A;  5CIB B;  3WFB C;  1H32 A;  1N90 A;  1GKS A;  2C1U A;  5B5E V;  1CTJ A;  2N9I A;  2B4Z A;  3OCD B;  2YK3 A;  3A0H V;  1CED A;  2RN0 A;  2MHM A;  4P4Q B;  3C2C A;  1C75 A;  2FWL A;  4EIF A;  1SQP D;  1KYO W;  3FWL A;  3HQ9 A;  4U3F D;  3RLM A;  2YCC A;  3WFC C;  3CU4 A;  2CA3 B;  1GIW A;  3H1K D;  3DMI A;  3L71 D;  3WC8 A;  2V08 A;  1KB0 A;  4EIC A;  5DF5 A;  5AUR A;  3RN0 A;  5EXQ A;  1PPJ D;  2FYN B;  2PCC B;  4KMG A;  1LS9 A;  1AOQ A;  5B6Q A;  3CX5 D;  5KLV D;  1DW3 A;  4WQB A;  1CYI A;  4PW9 B;  1CSW A;  2BCC D;  1CTY A;  2A06 D;  2RMZ A;  1C7M A;  1DIQ C;  2L4D A;  1I8P A;  2BH5 X;  2GC7 D;  1MG3 D;  3ITK A;  2B12 B;  3A0B V;  1CIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...