4PD4D

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
248
structure length
248
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 62
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4pd4D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 4pd4D02
4FA4A 3TF5A 3NBTA 4J20A 2GC7D 4JCGA 1H33B 5CIBB 1KIBA 4GYDA 4EICA 1CCHA 4AX3A 1IQCA 1CRIA 3WFEC 3A0HV 3OA8B 3ZOOA 3PXSA 1RAQA 4EIDA 1AKKA 1SQQD 2BPBB 2C1DA 1L9JC 1DT1A 4WQ9A 2ZOOA 1IRWA 4DY9A 2KS1A 2LIRA 2BGVX 1LS9A 1LC1A 1I6EA 1BCCD 3ZOYA 1IO3A 2C2CA 2QJKB 1LMSA 1CIHA 1HZVA 2N9JA 4Y5RA 1C7MA 4WQBA 5DFSA 3KHUA 1E29A 1A56A 1HROA 4XXLA 1C2NA 1CTYA 4P4QB 1HJ3A 2BH4X 1KYOD 2N3YA 4RJTA 1U74B 2HV4A 1GQ1A 2ORLA 3PTZA 4UB6V 1CYJA 3A9FA 1YNRA 2FWLA 5H2FV 1HRCA 2XTSB 2B0ZB 3RMZA 1KB9D 4PWAA 3BCCD 2VHDA 4NFGB 5CYTR 1RAPA 4PD4D 1QN2A 1N50A 1F1CA 2I8FA 1PPJD 1ZRTD 1CTJA 3L72D 1WEJF 3ZIYA 3CX5W 5CIEB 2N9YB 2O3JA 4N0KA 1CYIA 4KMGA 3L70D 3ZOXA 2PACA 3VYMA 3SWSA 4FA1A 2JQRA 3GG2A 2C1VA 2Q3EA 2N3BA 3VNWA 5KAFV 4AANA 4FANA 1EZVD 1RZ6A 1C2RA 1BGYD 2YQBA 1H32A 5C9MA 2N9IA 1C75A 1WVEC 1DVVA 4AALA 3TGUD 1I8OA 1CSUA 5IY51 4FA9A 1YFCA 4EIFA 2YCCA 1GJQA 3M97X 3O0RC 1CIGA 2PCCB 1CRCA 2QJYB 2CA4B 3WU2V 2YIUB 1HCMA 3CU4A 2CXBA 2OZ1A 2C1DB 2D0SA 2CE0A 1CSWA 4WQDA 3GW6A 3L71D 3NBSA 3DR0A 3ZBMA 4WQ8A 3PLNA 1SQXD 4A7PA 1EB7A 1M60A 4QAOA 2AI5A 4WQEA 3ITKA 3C2CA 1J3SA 1L9BC 1N90A 4WQCA 3HQ7A 3DMIA 1SQPD 5GTIV 2Y0CA 3O20A 3HQ6A 3RN0A 2IBZD 3ZCFA 2A06D 451CA 1CRJA 5TISV 5B6QA 1SQBD 155CA 1AOQA 2PCBB 3L4OA 3VRDA 2JWAA 3PXTA 4FA5A 3ORVA 2K9JB 1C6OA 1COTA 1FCDC 351CA 2FYNB 3CYTI 2L4DA 4U3FD 1W5CT 2FYUD 1CXAA 2CE1A 1I55A 1C52A 3VMAA 3WUIA 4H0JA 1CORA 1NU1D 1MG3D 2GB8B 1LFMA 2B12B 3PRJA 1YCCA 1YICA 1RZ5A 2GC4D 3PH2B 1B7VA 4UB8V 2Y0EA 3SLEA 5KAIV 1F1FA 1H1OA 3O1YA 2ZZS1 1QKSA 2RMZA 1NTKD 1ZZHA 2AXTV 1SQVD 4AAMA 1H32B 1CYCA 1H9XA 1H31A 1LC2A 3OCDA 4D6TD 4O1WA 3KZIV 3CXHW 2JTIB 4PJ0V 1I54A 2B10B 5KLVD 3CX5D 1PP9D 1QL3A 3NWVA 3H1KD 5CIFB 1FI9A 3H1HD 1NMIA 1L0LD 1CNOA 1R0QA 1KV9A 1MZ4A 3WC8A 3FWLA 4WQAA 1I5TA 2OZ1B 1S6VB 2DGEA 1E2RA 4O1QA 3TDKA 1M70A 1AOFA 3PHLA 4XYDB 1KX7A 4L3HA 2CA3B 1GIWA 1NTZD 1CHJA 3L4MA 3TYIA 1DW3A 2LITA 2C9XB 1E8EA 2N18C 3RLMA 1MG2D 5AURA 1CTZA 1GDVA 3X39A 1HJ4A 4V2KA 3H1JD 1VYDA 3WFDC 2ZBOA 1IZL0 3L75D 4GEDB 1P84D 3H1LD 1NMLA 5DJQC 4K3IA 1DW2A 1S5LV 1HH7A 4L1QA 3L74D 1H9YA 5B5EV 4LJIA 1CHHA 2QG4A 1YEAA 3MK7C 2EXVA 1HJ5A 4MU8A 2KNCB 1CSXA 3RN1A 5B66V 1HZUA 2C1UA 2YK3A 3DP5A 5C0ZA 1NIRA 1FI3A 1A2SA 1L0ND 1DIQC 2N18B 2AIUA 1N15A 3O5CA 5KLIB 1NNOA 1CRHA 2C8SA 4FAVA 1ETPA 1YTCA 2Y0DA 2V07A 5TJHA 1C6RA 1H33A 1YIQA 1CXCA 1H31B 4L3GA 3HQ9A 5KKZB 4FB1A 1CRGA 5CICB 3OCDB 1K3GA 1FHBA 1JDLA 3OA8A 3HQ8A 3WFBC 1BE3D 1I8PA 1AYGA 2MHMA 2V08A 1CC5A 2MTAC 2BCCD 1KYOW 5DJQB 1CSVA 4YE1A 2L91A 4EDFA 3CP5A 2RN0A 1QL4A 1FOCA 1KB0A 1CO6A 3MK7B 4Q5PA 3SVWA 1M6ZA 1DW0A 2BH5X 4AAOA 3A0BV 1U75B 2QJPB 1DW1A 3ZOWA 1IRVA 5GTHV 1OCDA 1QYZA 5DF5A 3PXWA 2FRCA 1GU2A 3CXHD 2D0WA 3SJLA 1CCRA 1KX2A 4H0KA 1K3HA 1DVHA 1CEDA 1OAEA 2ZONG 2B11B 3WFCC 1BL9A 1FI7A 1CHIA 3SXTA 1NTMD 1CIFA 4IL6V 2B4ZA 1YEBA 2BCNB 1A8CA 2DVHA 1C6SA 1W2LA 3JBTB 4RSZA 1I6DA 3CWBD 2GIWA 2ZXYA 4EIEA 5CIHB 1CRYA 5CIGB 1FJ0A 1N9CA 3H1ID 1CIEA 4PW9B 2BLFB 4WQ7A 1GKSA 5CIDB 1DIIC 5EXQA 5E79V 3L73D
chains in the Genus database with same CATH superfamily
3CD6P 1KYOH 4LLHA 3TF5A 3CCQP 1G2CA 4HKZH 1BCCG 5CIBB 1KQFB 1CCHA 4H0LC 4AX3A 5AVTB 4ZMDA 4WB4A 4AUWA 1IQCA 1SQQK 4WY4D 1U57A 2C0XA 1ZOYC 2H43A 2E42A 3EFFK 2O01H 1AKKA 3LW5J 1G1JA 1BSNA 2FKWB 1L9JC 1IO4A 1ZN5A 3FXEA 4DY9A 3MIWA 4UB6E 1A02J 4H13C 1L2PA 1LJ2A 4L75A 5H2FE 3T97B 2B9BA 1FZCA 4Y5RA 4KT0J 1JB0J 2A45H 1S5LH 4LGDE 3KHUA 3HE4A 2QA4P 1HJ3A 2BH4X 1KYOD 3OW2O 4I7ZC 1T6AA 2XU6A 2HV4A 2ORLA 2R5BA 3PTZA 4CPGA 1CYJA 1RE4C 1Q82Q 1NTMJ 2XV5A 1HRCA 1USDA 1KB9D 3BCCD 4NFGB 5CYTR 3L36A 1N50A 3VP9A 2I8FA 1PPJD 1ZRTD 2P2UA 1EDKA 1NOHA 3CX5W 1KILD 2D2CB 3TGUJ 1Y47A 2OYIC 1VL2A 5AW2B 5AVUB 3L70D 4N3YB 1KB9E 2JWDA 2PACA 3V2RA 2P58A 1PPJE 3KXDA 1JMMA 2N3BA 3L70E 5APVA 1EZVD 1RZ6A 2E75B 4YXDC 1C75A 1HTLC 2QEXP 1I8OA 3V4QA 1OZHA 3M0DC 1YI2P 1EZVE 1AA0A 1GJQA 1DEEG 1CIGA 2FFDB 5AW0B 3MP7B 2YIUB 1HCMA 2C1DB 3AE1C 5CCHA 3GW6A 5AVZB 1GL2B 1FDOA 2PFXA 4ZNCA 1SFCB 1PIXA 1RQVA 1T3JA 1VQ6P 5TISE 4A7PA 1M60A 2I1KA 1FZBA 4HJGH 1J1DB 1QGKB 2Q1KA 2KLUA 3A2AA 3HQ7A 5CBNA 1MFZA 3RK3D 2A06D 1CRJA 1SQBD 3P7KA 1AOQA 3BCCJ 3SWYA 2N1TA 2JWAA 1NTKJ 5CHXA 2KUBA 4H44B 1WMKA 3CXHH 1BSHA 3OA7A 1M90Q 3B5NB 1SQBE 1DD4A 3L70J 1W5CT 4GOFA 1CXAA 1S4XA 1I55A 4MN4C 3WUIA 2P67A 2G8YA 4WY4B 5C39A 5KLVG 3F5HA 3D6YA 3M9QA 1L0LG 1LP1B 1B7VA 4UB8V 1YBKA 5BU8B 2Y0EA 3A0HH 3EQ2A 2ZZS1 1M1KQ 2KOGA 3S9OA 1ZZHA 2AXTV 5KLVK 1EXJA 1H32B 1HUCA 4C7NA 1H9XA 5GTIH 1L0LK 3KZIV 3VP8A 4R4LA 1N2DC 2ZAEB 1QL3A 3NWVA 1JCCA 2WMMA 1NMIA 1CNOA 3WC8A 1LTTC 2K3RA 3FWLA 2PGDA 1I5TA 2OZ1B 1GW4A 3M06A 1A02F 1S6VB 1DIPA 1BDDA 2DGEA 4Y99B 3PHLA 4XYDB 1SQXG 4L3HA 2ZFCA 2ZXXA 1KQGB 1LT9A 1N8RQ 1S72P 3L4MA 1DW3A 3C8VA 2C9XB 1BGYE 1E8EA 3RLMA 3PH0A 1H88A 1MZ9A 3AEBC 5AURA 1CTZA 1GDVA 1SQXK 5B5EE 4V2KA 2IBZG 2ZT9B 2H89C 1VQLP 2N9BA 1RF1A 2NPSA 1IZL0 3L75D 1URQA 3H1LD 1OW7A 2WTYA 3U1AA 1NMLA 1Q86Q 1S5LV 1W5CE 1H0TB 1LTIC 3AE5C 3L74D 1M7LA 5L8RJ 1H9YA 3L75E 2QG4A 3H1LE 3MK7C 2L5GB 2EXVA 3CPWO 1HJ5A 1EQ7A 3NXSA 4GOEA 1BE3J 4PD4I 3RN1A 1EXIA 5AW6B 3L74E 4LC1A 5CCGD 1L0ND 1JNMA 2N18B 1N15A 3O5CA 4EIJA 1CRHA 2C8SA 1ETPA 3WU2H 2YXRB 2E74D 3WUUA 1YIQA 1L0NE 1LWUA 3HQ9A 5KKZB 5CICB 3OCDB 3CMEP 2XZRA 4AQRD 3MUDA 3A0BE 1AYGA 2MHMA 5GTHE 2BCCD 1KYOW 2HYNA 1RF0A 2G3AA 1YITP 1YQ4C 1KB0A 3A3YB 2WPRA 4Q5PA 5APXA 1DW0A 1FBMA 2W90A 2BH5X 2PAJA 3HE5B 1KN7A 1OCDA 5KTBA 2OTJP 3PXWA 4HH2A 4IL6E 3AEAC 1RH5B 2ZXEB 3RL0D 4NPFX 3H1JG 2B87B 3L75J 4H0KA 1K3HA 1Q7YQ 1E5WA 2WSEH 3H1LJ 1OAEA 2LXBA 3H1KE 1IFIA 2NRGA 3MHVA 3WFCC 1FI7A 1GU4A 1VF5B 4L73A 2Q6QA 2N1TD 2B4ZA 1YEBA 3A5TA 1N7SD 2I1JA 2WSCH 2DVHA 1IC2A 2JP3A 1LNQA 2M3BA 1R8EA 5CIHB 5CIGB 1JTHB 1FJ0A 1AFOA 2YMYA 3H1ID 1CIEA 1QVFO 4PJ0H 1USEA 2OYHB 3C9IA 1GKSA 1AJYA 1NWQA 1GU5A 3HD7D 1P84E 1HJ0A 2W6JH 2IYOA 4JCGA 1KORA 1M57D 2R44A 3WFEC 1DEBA 1RE4A 2BCCJ 1OVVA 4EOTA 2WWWA 3A0HV 2QJPC 2HODA 3BVHA 1LT9C 2QSIA 4EIDA 4JYBA 2P10A 4PD4H 1Z56A 2ZYAA 1M8OB 1LTBC 2JR8A 2D2CC 4PV1D 4WQ9A 2KS1A 2OYIA 2LIRA 5APQA 1LS9A 1CW5A 3ZOYA 1IO3A 2QJKB 4Z1MH 2E76B 1CIHA 2CPBA 1PGPA 1MUUA 3L72J 1HZVA 5AVVB 1PPJG 1RHZB 2QE7H 1VQ7P 2E75C 1E29A 1HROA 4P4QB 3GMAA 2HFED 3CCVP 1U74B 2M3EA 2NPSD 3IFMA 2LKMA 2FWLA 1URQD 3M0DA 1WRGA 1M1JA 2XTSB 5B66H 2FFDC 5BU5A 4DCKA 4IFDK 1RAPA 2YIUC 4PD4D 1EZVG 4IFFA 4DZOA 2DW3A 1S9KD 4OGQD 3R4YA 1CTJA 1GL2C 1QEXA 4N0KA 1S9KE 3H1IJ 3S1KA 4FA1A 2JQRA 3GG2A 2AEFA 3VNWA 3AEEC 2B89A 4U7JA 2M5AA 2WSEJ 2N9IA 1DVVA 2QRXA 2ZYGA 3TGUD 1NTME 5IY51 4EIFA 2YCCA 1FJPA 3G6EP 1JM0A 4H44C 2KIKA 4GIFA 2QJYB 3WU2V 3RL0B 3B5NC 3TGUE 2W6AA 2WSCJ 2FBWC 2D0SA 3HUSB 2RKLA 3PP5A 5AVRB 2WPVB 3NBSA 4WY4C 1SQBG 2UWJE 3JCUE 2JKVA 2Q5UA 3ITKA 3VMXA 3P8CD 5AW5B 1TU3F 1J2JB 2FYUJ 1L9BC 1SQBK 1N7SB 4WQCA 3DMIA 1SQPD 5CMZA 3RN0A 3HTKA 1NU1J 1MKMA 3P8CE 4O9BA 1NJIQ 451CA 2W6BA 4XA4A 3CXHI 1SQPE 3L4OA 3KPEA 3PXTA 4UB8E 3ORVA 2K9JB 4EI2A 4DJGA 1YIJP 4W80A 2AXTE 3CYTI 2L4DA 3HD7B 3LIDA 2KNCA 2CE1A 3C1LA 1GD2E 1QX8A 3VMAA 3KZIE 4H0JA 2CPSA 3AE3C 2GB8B 3PRJA 1JOCA 3B4SA 4H13D 3V6IA 2Q9IA 1U7JA 2GC4D 3PH2B 1KYOE 3I55P 1BGYG 2GA1A 4PV1B 1NTKD 2ZT9C 3WUVA 1FU1A 1SQVD 4AAMA 2YXQB 4D6TD 3GHGB 2P1JA 1MFTA 3BCCE 4PJ0V 2FYZA 2B10B 1NTKE 1ZRTE 1PP9D 1X8YA 1KILE 5CIFB 1FI9A 3H1HD 4RO0A 1KV9A 2M8RA 1BDCA 4XFJA 2OYOA 3L71G 2ITAA 4M3LA 1GK6A 1E2RA 4O1QA 2QVAA 1PP9E 3TDKA 4BXLA 1M70A 4I6MC 2HPCA 3PJSK 3NMDA 1NTZD 3TNUB 1JO5A 1FDIA 1M1JC 3G71P 1OW8A 3TYIA 2FXPA 1S5LE 2N18C 3L74G 1MG2D 5AVYB 1SQPJ 1R5LA 4OGQB 1HGVA 3X39A 3QH9A 4BRYA 1CSBA 1VYDA 5KKZC 2IZ0A 3WFDC 2ZBOA 2FXMA 1LTJB 3H32A 1L0NG 4GDOA 5CBOA 1HH7A 5AVSB 3JSVC 4KHXA 5AW1B 1KTMA 1GMJA 1YEAA 1LTSC 5KAFH 1L0NK 1CSXA 1FAVA 2W27A 2XNXA 3V2PA 5B66V 4N6JA 1HZUA 1QL2A 2WT7A 1N86A 1NIRA 3TSIA 1A2SA 3A7OA 2O01J 1YHQP 5EFWB 2BASA 3E1IA 3RK3E 1L4AB 1SQVJ 2A06E 1OMIA 4FAVA 2Y0DA 2V07A 4D6TJ 1DD3A 5TJHA 2JJLA 3FX0A 2AEMA 1H31B 3OAKA 4FB1A 1N73B 2H8PD 1FHBA 1PP9J 4NPEA 4RKUJ 1BE3D 1Q2NA 3H1HJ 1VF5C 3VN0A 3MZWB 2MTAC 3H1KG 4C46A 2H88C 4EDFA 3M9HA 3CP5A 1OVUA 4WWIA 1KFNA 5DJTB 1FOSE 3AE7C 1BE3E 2IDBA 3SVWA 1M6ZA 1NTZJ 1SLQA 3SFDC 2K37A 2V4HA 3CMAP 3IN6A 2Q7CA 3CL3D 1DW1A 3T97A 1IRVA 4ZKPA 1QYZA 2FRCA 4TT3H 1FZFA 1KZUB 3TYYA 3CXHD 1PGQA 3SJLA 1KX2A 1SP4A 1CEDA 1VQ9P 2PP6A 4I2LC 3CXHE 2IBZI 4K3AA 1CHIA 4W7ZA 4NPDA 1IFMA 1XTGB 3L73J 1CI6B 2YKQA 3O6QB 3RBXA 5KLIC 2KXPB 2BCNB 1X0TA 1KILB 4W7YA 1GW3A 5KAIH 3KYQA 1W2LA 3AEDC 1NGMB 4C7RA 3CWBD 3CCRP 2E76C 3A0HE 2ZXYA 4XE5B 2POHA 3CLQA 3W68A 1N9CA 2E5YA 4PW9B 1U7MA 3RBZA 5GTIE 4B86A 3CWBE 1BCCJ 1H33B 1OX3A 1OW6A 1MV8A 4GYDA 4L74A 5CCGC 1CRIA 1SS1A 1YJWP 3OA8B 1NH4A 2FFDA 3AEGC 1HGZA 1OXZA 4IL6X 3O8ZA 3GF7A 1IFDA 2M0BA 2C1DA 2XNDH 1R5SA 2OQQA 1GL2A 2IFMA 1SFCA 2BGVX 2HLOA 4IOIH 3V4WA 5KJ7C 1LC1A 2JEEA 2BEQD 2QIWA 3CX5H 1KV4A 1LMSA 2IFNA 1GZLA 2N9JA 3GF3A 3MD0A 1IZNB 5DFSA 2LR2A 4XXLA 2SPZA 4RJTA 2P7JA 4OVNF 3RK3B 2BCCE 5CCHD 3A9FA 1ZR2A 1NTMG 2B0ZB 3RL0C 1VDFA 2B88A 1VQ8P 1QN2A 1F1CA 3B5NA 1K05A 5APYA 5AW8B 1KC8Q 2OTLP 1LGHB 3L72D 1WEJF 3HUSC 3ZIYA 3E1RA 1S3JA 3TGUG 1CZQA 2IX7C 3CWBJ 4WY4A 1NTMK 1EC5A 1ZP0C 1NKZB 3VYMA 2Z4EA 3L72E 3SWSA 1LP1A 2C1VA 4BWNA 3V2NA 1JUNA 2R32A 3GLMA 2Q3EA 3WU2E 5KAFV 4JQ0D 4AANA 2HG5D 4FANA 5APWA 1H32A 2JO1A 1G2CB 2V7QH 3D70A 4AALA 5CJ4A 3Q1MA 1CSUA 4FA9A 1YFCA 1PGOA 1KQSO 2QM7A 2PCCB 5AW4B 1CRCA 3D71A 1N7LA 4GT1A 2CA4B 1SQPG 3I5CA 3HD7C 3CU4A 1OIPA 2OZ1A 2CE0A 1CSWA 1VQKP 1ZLLA 3DR0A 2WSFH 5DJUB 3H1IE 3PLNA 1SQXD 4KJMA 1SQPK 1EB7A 4QAOA 2AI5A 5AW9B 1CI6A 3R2PA 3C2CA 2MJZA 5AVWB 4EYYQ 2YKOA 1FZCB 1QLED 3WMM0 1N90A 3QWOC 5GTIV 2Y0CA 3O20A 3AE4C 3HQ6A 1K8AQ 1OFCX 2IBZD 3HE4B 3S4RA 3GHGC 3VOPA 1NHLA 3RGUA 1YQ3C 1S1CX 2K1AA 1OVRA 1FE6A 2PCBB 3BCCG 2R3CA 3VRDA 1H0TA 4FA5A 2ZYDA 3L4FA 4YTPC 3IAOA 1NTKG 1FS0E 1FCDC 351CA 2FYNB 1IFNA 3F89A 4U3FD 2FYUD 2D2CD 3L70G 5E79H 3AEFC 3VMYA 1CORA 1NU1D 4RESB 1PP9G 1NTKK 4PJ0E 1YCCA 4K35A 1L0LJ 4OH8B 1SQVK 4U3FE 2FYUE 4DOJA 1RZ5A 4ASVA 4OGQC 1EDIA 3SLEA 5KAIV 1F1FA 1H1OA 3O1YA 1FOSF 1NU1E 2A45G 2J58A 1KD1Q 2E74B 1CYCA 1LTJC 1SFCC 3OCDA 1EDJA 4O1WA 3KQGA 4PD4E 3CXHW 1VQNP 1JEKA 1PGJA 4L76A 1J1DC 1HBWA 3BATA 3RK2D 2Y9YA 1MZ4A 3LIEA 1LTGC 2YO2A 1NTZK 1ZW0A 5AVXB 1SQXJ 1AOFA 5AW3B 1KX7A 3HE5A 2VRSA 4I1LA 2CA3B 1GIWA 3L35A 1AVYA 1RY3A 1CHJA 2W8ZA 4UB6H 1L4AC 5H2FH 3VYIA 1ZMEC 5M1BA 3D0WA 2B87A 1HJ4A 2O1JA 3H1JD 2V7QJ 2A06G 1N73C 4HYTB 3RL0g 5B66E 1T2KD 2YNYA 4WBAA 1NVOA 3B71A 4K3IA 1DW2A 1VQOP 2N1TB 4U3FJ 4L1QA 3V2QA 3B5ND 1CHHA 1IK7A 2OTKE 2WSFJ 2KB7P 2Y9ZA 2YK3A 1BE3G 3DP5A 4H0LD 1KB9H 1JTHA 3G4SP 2WVRA 1DX7A 1PV3A 2OYHA 1D7MA 1DIQC 3I56P 1NNOA 1Q90D 3CI9A 1YTCA 1ZR4A 4Y99C 4C7NB 1JY2P 1CXCA 5AVQB 1CRGA 1K3GA 2WITA 4R4MA 3CC2P 3IR9A 3FWNA 3HQ8A 3WFBC 4JF7A 1I8PA 2V08A 3G9RA 1CC5A 1S5LX 5DJQB 2NZ2A 2BEZF 1YTZI 3P8MC 1PFIA 1KILC 1RQUA 3L37A 1WT6A 1QL1A 5APUA 2E5TA 4AAOA 1VQMP 3K5BA 2QJPB 3ZOWA 3Q2YA 1LT9B 1GTWA 3EWKA 5TISH 3SFEC 1SQVE 4ASWA 1X79B 3H1JJ 4D6TE 1FZGA 1GU2A 2ZVNB 1CCRA 2ZT9D 3L75G 1JY3N 2KZJA 3CWBG 1RF1B 2YMKA 3P32A 2K9YA 2NPSB 3H1HE 4HB1A 5CCGA 3H1LG 2B11B 1URQB 1NAFA 2R5DA 4DT0A 5APTA 3SXTA 1CIFA 1DH3A 3CCLP 2KI7B 2C0WA 1KFMA 1NTZE 3Q5RA 1Q81Q 1HWTC 1OWAA 5KJ7A 1IFPA 4RSZA 2GIWA 4EIEA 1ZXGA 3Q3DA 1JY2O 2O1KA 1J1EB 3RK2B 3ABVC 2BLFB 2Q3IA 5CIDB 5EXQA 5E79V 3L73D 3JC22 4FA4A 3CCMP 3RK3C 3NBTA 4J20A 2WQYC 2GC7D 2KLVA 1KIBA 1T8ZA 1LWUB 4EICA 3CCSP 3M9BA 3D6ZA 3H6PA 2BCCG 3L73E 3ZOOA 3PXSA 1RAQA 2XKMA 2MKVA 1SQQD 1XTCC 2BPBB 2J59M 2R3SA 3HUSA 1DT1A 3CX5I 1X9VA 2ZOOA 1IRWA 1YTZT 1I6EA 1BCCD 1IK9A 3SWFA 4GKGA 2C2CA 1SQQE 4JBZA 2KP8A 1AV1A 2YKPA 3L72G 1RE3C 1N7SA 1C7MA 4WQBA 1BCCE 3VTPC 1A56A 1C2NA 1CTYA 2KK7A 2N3YA 5B5EH 3CCUP 1GQ1A 4UB6V 1YNRA 1LT1A 4H0LB 1H89A 5H2FV 2Z5HA 2C9LY 3NFQA 3RMZA 4PWAA 1VF5D 2K9JA 1VQPP 2OYHC 2VHDA 4TLFA 5KAFE 2I8DA 1P84I 1YJ9P 3HD7A 5CIEB 2N9YB 2O3JA 3N7NA 1CYIA 4KMGA 1JCDA 3ZOXA 2QM8A 2C9NY 1NKNA 3UIAA 4H13B 3H1IG 1K9MQ 1VQ5P 1KQLA 3KDPB 3TK1A 2KYVA 1FZCC 4YXWH 1C2RA 1BGYD 2YQBA 5C9MA 3CC7P 2AEJA 1YYCA 3GHGA 3U59A 1WVEC 2YO3A 4I7ZB 2QJKC 4IFMA 2HODB 3M97X 3O0RC 1PL5A 1SQQJ 3A0BH 2FYNC 5GTHH 1FJKA 2CXBA 4WQDA 3E7KA 3L71D 1SQBJ 3BRVB 2KS1B 2OYIB 3HRNA 3ZBMA 4WQ8A 1S2EA 2AXCA 3TNUA 2PRRA 3WUTA 4WQEA 3V5BA 1KMIZ 2E76D 2W83C 2OARA 3L71E 1NYHA 1W2EA 3SWKA 1J3SA 3MGNA 4U3FG 4ZKUA 2FYUG 5K5GB 2E74C 1FC2C 1FDMA 2LXCB 4IL6H 1NU1G 1LTJA 3AECC 3ZCFA 1JY2N 3EFGA 5TISV 5B6QA 155CA 3USSA 2JDIH 3CCEP 1AVOA 2FYUK 3FXDA 1M1JB 2OGUA 2WSSH 5KAIE 3MTUE 1C6OA 1NU1K 1COTA 3B8EB 5CCHC 2GUVA 1FZEA 1IFJA 1C52A 5APSA 1MG3D 5KJ7D 1LFMA 1E79H 1VQ4P 2B12B 1EDLA 3G3ZA 1YICA 4JPZB 3M0AA 1LTAC 2QJYC 2WPSA 1BGYJ 1ZV8A 1L4AA 2K88A 1QKSA 2RMZA 1AQTA 1H31A 1LC2A 2M5AB 1N73A 1HH0A 1P84H 1K04A 2ZJSE 2JTIB 5BVZA 1I54A 5KLVD 3CX5D 2N1TC 2WZ7A 3H1KD 2KZIA 1L0LD 1R0QA 1N7SC 2KSJA 3L71J 1Y9BA 4WQAA 3ZDMA 4YPCA 5KLVE 3CX5E 2ZVOB 2XDJA 2KSEA 1AQ5A 1JY3P 3FGAD 2E43A 1L0LE 2LITA 3L74J 2H7HA 1W2BO 1JMBA 3HTKB 2O01N 4GEDB 1L0NJ 1K73Q 1H8AA 1P84D 3AE6C 5DJQC 4QMAA 1KYOI 3O6QA 3LW5H 4PV1C 1KILA 5B5EV 4LJIA 1SQXE 2IPPA 1KB9I 3Q5SA 4MU8A 2KNCB 1UIXA 3CCJP 3U1CA 2C1UA 5C0ZA 1HJBA 1FI3A 1YJNP 4JYCA 1PZQA 2IBZE 2AIUA 4N78D 2IYPA 5KLIB 1HVVA 2FXOA 2Z5IA 1SQVG 4WVZA 3SSUA 1C6RA 1H33A 4D6TG 1RF1C 1GK4A 2NPSC 4L3GA 1URQC 5KLVJ 1JDLA 1QVGO 4N78E 1EZVI 2A45I 3II6A 2CK3H 3H1KJ 3OA8A 2GM4A 2HR3A 3H1HG 1CSVA 2FY8A 1JY3O 4YE1A 2L91A 2RN0A 1M56D 2RH0A 3AE9C 1QL4A 2GUSA 1FOCA 1CO6A 3W67A 3H25A 2E75D 1IJDB 3MK7B 1FZAA 1NTZG 2HPCB 3A0BV 1U75B 1UIIA 1J1EC 3JCUH 5GTHV 3RK2C 5DF5A 4Y28J 1T3UA 3N4XA 3Q5PA 2J5UA 1SVFA 3AE8C 2D0WA 3BRTB 4BRYB 1LWUC 3AE2C 1DVHA 1GL2D 4AYCA 1SFCD 3IF4A 2ZONG 3MUDC 3NTNA 3H32B 3BASA 1X22A 4GODA 1BL9A 1NAYA 1RF0C 1NTMD 3L73G 2IZ1A 4IL6V 4OWFA 5E79E 4UB8H 1A8CA 3M91A 1HF9A 1G1IA 1C6SA 1T2KC 1NO4A 1VPCA 2AXTH 3JBTB 1Y8AA 3CC4P 3OJAB 5CJ0A 5AW7B 1I6DA 2WT7B 1GDTA 3VMZA 1CRYA 3KZIH 3H1JE 1SQQG 4WQ7A 2WPQA 1RE3A 1DIIC 4H44D 1L4AD
chains in the Genus database with same CATH topology
4FA4A 3TF5A 3NBTA 4J20A 2GC7D 4JCGA 1H33B 5CIBB 1KIBA 4GYDA 4EICA 1CCHA 4AX3A 1IQCA 1CRIA 3WFEC 3A0HV 3OA8B 3ZOOA 3PXSA 1RAQA 4EIDA 1AKKA 1SQQD 2BPBB 2C1DA 1L9JC 1DT1A 4WQ9A 2ZOOA 1IRWA 4DY9A 2KS1A 2LIRA 2BGVX 1LS9A 1LC1A 1I6EA 1BCCD 3ZOYA 1IO3A 2C2CA 2QJKB 1LMSA 1CIHA 1HZVA 2N9JA 4Y5RA 1C7MA 4WQBA 5DFSA 3KHUA 1E29A 1A56A 1HROA 4XXLA 1C2NA 1CTYA 4P4QB 1HJ3A 2BH4X 1KYOD 2N3YA 4RJTA 1U74B 2HV4A 1GQ1A 2ORLA 3PTZA 4UB6V 1CYJA 3A9FA 1YNRA 2FWLA 5H2FV 1HRCA 2XTSB 2B0ZB 3RMZA 1KB9D 4PWAA 3BCCD 2VHDA 4NFGB 5CYTR 1RAPA 4PD4D 1QN2A 1N50A 1F1CA 2I8FA 1PPJD 1ZRTD 1CTJA 3L72D 1WEJF 3ZIYA 3CX5W 5CIEB 2N9YB 2O3JA 4N0KA 1CYIA 4KMGA 3L70D 3ZOXA 2PACA 3VYMA 3SWSA 4FA1A 2JQRA 3GG2A 2C1VA 2Q3EA 2N3BA 3VNWA 5KAFV 4AANA 4FANA 1EZVD 1RZ6A 1C2RA 1BGYD 2YQBA 1H32A 5C9MA 2N9IA 1C75A 1WVEC 1DVVA 4AALA 3TGUD 1I8OA 1CSUA 5IY51 4FA9A 1YFCA 4EIFA 2YCCA 1GJQA 3M97X 3O0RC 1CIGA 2PCCB 1CRCA 2QJYB 2CA4B 3WU2V 2YIUB 1HCMA 3CU4A 2CXBA 2OZ1A 2C1DB 2D0SA 2CE0A 1CSWA 4WQDA 3GW6A 3L71D 3NBSA 3DR0A 3ZBMA 4WQ8A 3PLNA 1SQXD 4A7PA 1EB7A 1M60A 4QAOA 2AI5A 4WQEA 3ITKA 3C2CA 1J3SA 1L9BC 1N90A 4WQCA 3HQ7A 3DMIA 1SQPD 5GTIV 2Y0CA 3O20A 3HQ6A 3RN0A 2IBZD 3ZCFA 2A06D 451CA 1CRJA 5TISV 5B6QA 1SQBD 155CA 1AOQA 2PCBB 3L4OA 3VRDA 2JWAA 3PXTA 4FA5A 3ORVA 2K9JB 1C6OA 1COTA 1FCDC 351CA 2FYNB 3CYTI 2L4DA 4U3FD 1W5CT 2FYUD 1CXAA 2CE1A 1I55A 1C52A 3VMAA 3WUIA 4H0JA 1CORA 1NU1D 1MG3D 2GB8B 1LFMA 2B12B 3PRJA 1YCCA 1YICA 1RZ5A 2GC4D 3PH2B 1B7VA 4UB8V 2Y0EA 3SLEA 5KAIV 1F1FA 1H1OA 3O1YA 2ZZS1 1QKSA 2RMZA 1NTKD 1ZZHA 2AXTV 1SQVD 4AAMA 1H32B 1CYCA 1H9XA 1H31A 1LC2A 3OCDA 4D6TD 4O1WA 3KZIV 3CXHW 2JTIB 4PJ0V 1I54A 2B10B 5KLVD 3CX5D 1PP9D 1QL3A 3NWVA 3H1KD 5CIFB 1FI9A 3H1HD 1NMIA 1L0LD 1CNOA 1R0QA 1KV9A 1MZ4A 3WC8A 3FWLA 4WQAA 1I5TA 2OZ1B 1S6VB 2DGEA 1E2RA 4O1QA 3TDKA 1M70A 1AOFA 3PHLA 4XYDB 1KX7A 4L3HA 2CA3B 1GIWA 1NTZD 1CHJA 3L4MA 3TYIA 1DW3A 2LITA 2C9XB 1E8EA 2N18C 3RLMA 1MG2D 5AURA 1CTZA 1GDVA 3X39A 1HJ4A 4V2KA 3H1JD 1VYDA 3WFDC 2ZBOA 1IZL0 3L75D 4GEDB 1P84D 3H1LD 1NMLA 5DJQC 4K3IA 1DW2A 1S5LV 1HH7A 4L1QA 3L74D 1H9YA 5B5EV 4LJIA 1CHHA 2QG4A 1YEAA 3MK7C 2EXVA 1HJ5A 4MU8A 2KNCB 1CSXA 3RN1A 5B66V 1HZUA 2C1UA 2YK3A 3DP5A 5C0ZA 1NIRA 1FI3A 1A2SA 1L0ND 1DIQC 2N18B 2AIUA 1N15A 3O5CA 5KLIB 1NNOA 1CRHA 2C8SA 4FAVA 1ETPA 1YTCA 2Y0DA 2V07A 5TJHA 1C6RA 1H33A 1YIQA 1CXCA 1H31B 4L3GA 3HQ9A 5KKZB 4FB1A 1CRGA 5CICB 3OCDB 1K3GA 1FHBA 1JDLA 3OA8A 3HQ8A 3WFBC 1BE3D 1I8PA 1AYGA 2MHMA 2V08A 1CC5A 2MTAC 2BCCD 1KYOW 5DJQB 1CSVA 4YE1A 2L91A 4EDFA 3CP5A 2RN0A 1QL4A 1FOCA 1KB0A 1CO6A 3MK7B 4Q5PA 3SVWA 1M6ZA 1DW0A 2BH5X 4AAOA 3A0BV 1U75B 2QJPB 1DW1A 3ZOWA 1IRVA 5GTHV 1OCDA 1QYZA 5DF5A 3PXWA 2FRCA 1GU2A 3CXHD 2D0WA 3SJLA 1CCRA 1KX2A 4H0KA 1K3HA 1DVHA 1CEDA 1OAEA 2ZONG 2B11B 3WFCC 1BL9A 1FI7A 1CHIA 3SXTA 1NTMD 1CIFA 4IL6V 2B4ZA 1YEBA 2BCNB 1A8CA 2DVHA 1C6SA 1W2LA 3JBTB 4RSZA 1I6DA 3CWBD 2GIWA 2ZXYA 4EIEA 5CIHB 1CRYA 5CIGB 1FJ0A 1N9CA 3H1ID 1CIEA 4PW9B 2BLFB 4WQ7A 1GKSA 5CIDB 1DIIC 5EXQA 5E79V 3L73D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 A;  3TF5 A;  3NBT A;  4J20 A;  2GC7 D;  4JCG A;  1H33 B;  5CIB B;  1KIB A;  4GYD A;  4EIC A;  1CCH A;  4AX3 A;  1IQC A;  1CRI A;  3WFE C;  3A0H V;  3OA8 B;  3ZOO A;  3PXS A;  1RAQ A;  4EID A;  1AKK A;  1SQQ D;  2BPB B;  2C1D A;  1L9J C;  1DT1 A;  4WQ9 A;  2ZOO A;  1IRW A;  4DY9 A;  2KS1 A;  2LIR A;  2BGV X;  1LS9 A;  1LC1 A;  1I6E A;  1BCC D;  3ZOY A;  1IO3 A;  2C2C A;  2QJK B;  1LMS A;  1CIH A;  1HZV A;  2N9J A;  4Y5R A;  1C7M A;  4WQB A;  5DFS A;  3KHU A;  1E29 A;  1A56 A;  1HRO A;  4XXL A;  1C2N A;  1CTY A;  4P4Q B;  1HJ3 A;  2BH4 X;  1KYO D;  2N3Y A;  4RJT A;  1U74 B;  2HV4 A;  1GQ1 A;  2ORL A;  3PTZ A;  4UB6 V;  1CYJ A;  3A9F A;  1YNR A;  2FWL A;  5H2F V;  1HRC A;  2XTS B;  2B0Z B;  3RMZ A;  1KB9 D;  4PWA A;  3BCC D;  2VHD A;  4NFG B;  5CYT R;  1RAP A;  4PD4 D;  1QN2 A;  1N50 A;  1F1C A;  2I8F A;  1PPJ D;  1ZRT D;  1CTJ A;  3L72 D;  1WEJ F;  3ZIY A;  3CX5 W;  5CIE B;  2N9Y B;  2O3J A;  4N0K A;  1CYI A;  4KMG A;  3L70 D;  3ZOX A;  2PAC A;  3VYM A;  3SWS A;  4FA1 A;  2JQR A;  3GG2 A;  2C1V A;  2Q3E A;  2N3B A;  3VNW A;  5KAF V;  4AAN A;  4FAN A;  1EZV D;  1RZ6 A;  1C2R A;  1BGY D;  2YQB A;  1H32 A;  5C9M A;  2N9I A;  1C75 A;  1WVE C;  1DVV A;  4AAL A;  3TGU D;  1I8O A;  1CSU A;  5IY5 1;  4FA9 A;  1YFC A;  4EIF A;  2YCC A;  1GJQ A;  3M97 X;  3O0R C;  1CIG A;  2PCC B;  1CRC A;  2QJY B;  2CA4 B;  3WU2 V;  2YIU B;  1HCM A;  3CU4 A;  2CXB A;  2OZ1 A;  2C1D B;  2D0S A;  2CE0 A;  1CSW A;  4WQD A;  3GW6 A;  3L71 D;  3NBS A;  3DR0 A;  3ZBM A;  4WQ8 A;  3PLN A;  1SQX D;  4A7P A;  1EB7 A;  1M60 A;  4QAO A;  2AI5 A;  4WQE A;  3ITK A;  3C2C A;  1J3S A;  1L9B C;  1N90 A;  4WQC A;  3HQ7 A;  3DMI A;  1SQP D;  5GTI V;  2Y0C A;  3O20 A;  3HQ6 A;  3RN0 A;  2IBZ D;  3ZCF A;  2A06 D;  451C A;  1CRJ A;  5TIS V;  5B6Q A;  1SQB D;  155C A;  1AOQ A;  2PCB B;  3L4O A;  3VRD A;  2JWA A;  3PXT A;  4FA5 A;  3ORV A;  2K9J B;  1C6O A;  1COT A;  1FCD C;  351C A;  2FYN B;  3CYT I;  2L4D A;  4U3F D;  1W5C T;  2FYU D;  1CXA A;  2CE1 A;  1I55 A;  1C52 A;  3VMA A;  3WUI A;  4H0J A;  1COR A;  1NU1 D;  1MG3 D;  2GB8 B;  1LFM A;  2B12 B;  3PRJ A;  1YCC A;  1YIC A;  1RZ5 A;  2GC4 D;  3PH2 B;  1B7V A;  4UB8 V;  2Y0E A;  3SLE A;  5KAI V;  1F1F A;  1H1O A;  3O1Y A;  2ZZS 1;  1QKS A;  2RMZ A;  1NTK D;  1ZZH A;  2AXT V;  1SQV D;  4AAM A;  1H32 B;  1CYC A;  1H9X A;  1H31 A;  1LC2 A;  3OCD A;  4D6T D;  4O1W A;  3KZI V;  3CXH W;  2JTI B;  4PJ0 V;  1I54 A;  2B10 B;  5KLV D;  3CX5 D;  1PP9 D;  1QL3 A;  3NWV A;  3H1K D;  5CIF B;  1FI9 A;  3H1H D;  1NMI A;  1L0L D;  1CNO A;  1R0Q A;  1KV9 A;  1MZ4 A;  3WC8 A;  3FWL A;  4WQA A;  1I5T A;  2OZ1 B;  1S6V B;  2DGE A;  1E2R A;  4O1Q A;  3TDK A;  1M70 A;  1AOF A;  3PHL A;  4XYD B;  1KX7 A;  4L3H A;  2CA3 B;  1GIW A;  1NTZ D;  1CHJ A;  3L4M A;  3TYI A;  1DW3 A;  2LIT A;  2C9X B;  1E8E A;  2N18 C;  3RLM A;  1MG2 D;  5AUR A;  1CTZ A;  1GDV A;  3X39 A;  1HJ4 A;  4V2K A;  3H1J D;  1VYD A;  3WFD C;  2ZBO A;  1IZL 0;  3L75 D;  4GED B;  1P84 D;  3H1L D;  1NML A;  5DJQ C;  4K3I A;  1DW2 A;  1S5L V;  1HH7 A;  4L1Q A;  3L74 D;  1H9Y A;  5B5E V;  4LJI A;  1CHH A;  2QG4 A;  1YEA A;  3MK7 C;  2EXV A;  1HJ5 A;  4MU8 A;  2KNC B;  1CSX A;  3RN1 A;  5B66 V;  1HZU A;  2C1U A;  2YK3 A;  3DP5 A;  5C0Z A;  1NIR A;  1FI3 A;  1A2S A;  1L0N D;  1DIQ C;  2N18 B;  2AIU A;  1N15 A;  3O5C A;  5KLI B;  1NNO A;  1CRH A;  2C8S A;  4FAV A;  1ETP A;  1YTC A;  2Y0D A;  2V07 A;  5TJH A;  1C6R A;  1H33 A;  1YIQ A;  1CXC A;  1H31 B;  4L3G A;  3HQ9 A;  5KKZ B;  4FB1 A;  1CRG A;  5CIC B;  3OCD B;  1K3G A;  1FHB A;  1JDL A;  3OA8 A;  3HQ8 A;  3WFB C;  1BE3 D;  1I8P A;  1AYG A;  2MHM A;  2V08 A;  1CC5 A;  2MTA C;  2BCC D;  1KYO W;  5DJQ B;  1CSV A;  4YE1 A;  2L91 A;  4EDF A;  3CP5 A;  2RN0 A;  1QL4 A;  1FOC A;  1KB0 A;  1CO6 A;  3MK7 B;  4Q5P A;  3SVW A;  1M6Z A;  1DW0 A;  2BH5 X;  4AAO A;  3A0B V;  1U75 B;  2QJP B;  1DW1 A;  3ZOW A;  1IRV A;  5GTH V;  1OCD A;  1QYZ A;  5DF5 A;  3PXW A;  2FRC A;  1GU2 A;  3CXH D;  2D0W A;  3SJL A;  1CCR A;  1KX2 A;  4H0K A;  1K3H A;  1DVH A;  1CED A;  1OAE A;  2ZON G;  2B11 B;  3WFC C;  1BL9 A;  1FI7 A;  1CHI A;  3SXT A;  1NTM D;  1CIF A;  4IL6 V;  2B4Z A;  1YEB A;  2BCN B;  1A8C A;  2DVH A;  1C6S A;  1W2L A;  3JBT B;  4RSZ A;  1I6D A;  3CWB D;  2GIW A;  2ZXY A;  4EIE A;  5CIH B;  1CRY A;  5CIG B;  1FJ0 A;  1N9C A;  3H1I D;  1CIE A;  4PW9 B;  2BLF B;  4WQ7 A;  1GKS A;  5CID B;  1DII C;  5EXQ A;  5E79 V;  3L73 D; 
#chains in the Genus database with same CATH topology
 3CD6 P;  1KYO H;  4LLH A;  3TF5 A;  3CCQ P;  1G2C A;  4HKZ H;  1BCC G;  5CIB B;  1KQF B;  1CCH A;  4H0L C;  4AX3 A;  5AVT B;  4ZMD A;  4WB4 A;  4AUW A;  1IQC A;  1SQQ K;  4WY4 D;  1U57 A;  2C0X A;  1ZOY C;  2H43 A;  2E42 A;  3EFF K;  2O01 H;  1AKK A;  3LW5 J;  1G1J A;  1BSN A;  2FKW B;  1L9J C;  1IO4 A;  1ZN5 A;  3FXE A;  4DY9 A;  3MIW A;  4UB6 E;  1A02 J;  4H13 C;  1L2P A;  1LJ2 A;  4L75 A;  5H2F E;  3T97 B;  2B9B A;  1FZC A;  4Y5R A;  4KT0 J;  1JB0 J;  2A45 H;  1S5L H;  4LGD E;  3KHU A;  3HE4 A;  2QA4 P;  1HJ3 A;  2BH4 X;  1KYO D;  3OW2 O;  4I7Z C;  1T6A A;  2XU6 A;  2HV4 A;  2ORL A;  2R5B A;  3PTZ A;  4CPG A;  1CYJ A;  1RE4 C;  1Q82 Q;  1NTM J;  2XV5 A;  1HRC A;  1USD A;  1KB9 D;  3BCC D;  4NFG B;  5CYT R;  3L36 A;  1N50 A;  3VP9 A;  2I8F A;  1PPJ D;  1ZRT D;  2P2U A;  1EDK A;  1NOH A;  3CX5 W;  1KIL D;  2D2C B;  3TGU J;  1Y47 A;  2OYI C;  1VL2 A;  5AW2 B;  5AVU B;  3L70 D;  4N3Y B;  1KB9 E;  2JWD A;  2PAC A;  3V2R A;  2P58 A;  1PPJ E;  3KXD A;  1JMM A;  2N3B A;  3L70 E;  5APV A;  1EZV D;  1RZ6 A;  2E75 B;  4YXD C;  1C75 A;  1HTL C;  2QEX P;  1I8O A;  3V4Q A;  1OZH A;  3M0D C;  1YI2 P;  1EZV E;  1AA0 A;  1GJQ A;  1DEE G;  1CIG A;  2FFD B;  5AW0 B;  3MP7 B;  2YIU B;  1HCM A;  2C1D B;  3AE1 C;  5CCH A;  3GW6 A;  5AVZ B;  1GL2 B;  1FDO A;  2PFX A;  4ZNC A;  1SFC B;  1PIX A;  1RQV A;  1T3J A;  1VQ6 P;  5TIS E;  4A7P A;  1M60 A;  2I1K A;  1FZB A;  4HJG H;  1J1D B;  1QGK B;  2Q1K A;  2KLU A;  3A2A A;  3HQ7 A;  5CBN A;  1MFZ A;  3RK3 D;  2A06 D;  1CRJ A;  1SQB D;  3P7K A;  1AOQ A;  3BCC J;  3SWY A;  2N1T A;  2JWA A;  1NTK J;  5CHX A;  2KUB A;  4H44 B;  1WMK A;  3CXH H;  1BSH A;  3OA7 A;  1M90 Q;  3B5N B;  1SQB E;  1DD4 A;  3L70 J;  1W5C T;  4GOF A;  1CXA A;  1S4X A;  1I55 A;  4MN4 C;  3WUI A;  2P67 A;  2G8Y A;  4WY4 B;  5C39 A;  5KLV G;  3F5H A;  3D6Y A;  3M9Q A;  1L0L G;  1LP1 B;  1B7V A;  4UB8 V;  1YBK A;  5BU8 B;  2Y0E A;  3A0H H;  3EQ2 A;  2ZZS 1;  1M1K Q;  2KOG A;  3S9O A;  1ZZH A;  2AXT V;  5KLV K;  1EXJ A;  1H32 B;  1HUC A;  4C7N A;  1H9X A;  5GTI H;  1L0L K;  3KZI V;  3VP8 A;  4R4L A;  1N2D C;  2ZAE B;  1QL3 A;  3NWV A;  1JCC A;  2WMM A;  1NMI A;  1CNO A;  3WC8 A;  1LTT C;  2K3R A;  3FWL A;  2PGD A;  1I5T A;  2OZ1 B;  1GW4 A;  3M06 A;  1A02 F;  1S6V B;  1DIP A;  1BDD A;  2DGE A;  4Y99 B;  3PHL A;  4XYD B;  1SQX G;  4L3H A;  2ZFC A;  2ZXX A;  1KQG B;  1LT9 A;  1N8R Q;  1S72 P;  3L4M A;  1DW3 A;  3C8V A;  2C9X B;  1BGY E;  1E8E A;  3RLM A;  3PH0 A;  1H88 A;  1MZ9 A;  3AEB C;  5AUR A;  1CTZ A;  1GDV A;  1SQX K;  5B5E E;  4V2K A;  2IBZ G;  2ZT9 B;  2H89 C;  1VQL P;  2N9B A;  1RF1 A;  2NPS A;  1IZL 0;  3L75 D;  1URQ A;  3H1L D;  1OW7 A;  2WTY A;  3U1A A;  1NML A;  1Q86 Q;  1S5L V;  1W5C E;  1H0T B;  1LTI C;  3AE5 C;  3L74 D;  1M7L A;  5L8R J;  1H9Y A;  3L75 E;  2QG4 A;  3H1L E;  3MK7 C;  2L5G B;  2EXV A;  3CPW O;  1HJ5 A;  1EQ7 A;  3NXS A;  4GOE A;  1BE3 J;  4PD4 I;  3RN1 A;  1EXI A;  5AW6 B;  3L74 E;  4LC1 A;  5CCG D;  1L0N D;  1JNM A;  2N18 B;  1N15 A;  3O5C A;  4EIJ A;  1CRH A;  2C8S A;  1ETP A;  3WU2 H;  2YXR B;  2E74 D;  3WUU A;  1YIQ A;  1L0N E;  1LWU A;  3HQ9 A;  5KKZ B;  5CIC B;  3OCD B;  3CME P;  2XZR A;  4AQR D;  3MUD A;  3A0B E;  1AYG A;  2MHM A;  5GTH E;  2BCC D;  1KYO W;  2HYN A;  1RF0 A;  2G3A A;  1YIT P;  1YQ4 C;  1KB0 A;  3A3Y B;  2WPR A;  4Q5P A;  5APX A;  1DW0 A;  1FBM A;  2W90 A;  2BH5 X;  2PAJ A;  3HE5 B;  1KN7 A;  1OCD A;  5KTB A;  2OTJ P;  3PXW A;  4HH2 A;  4IL6 E;  3AEA C;  1RH5 B;  2ZXE B;  3RL0 D;  4NPF X;  3H1J G;  2B87 B;  3L75 J;  4H0K A;  1K3H A;  1Q7Y Q;  1E5W A;  2WSE H;  3H1L J;  1OAE A;  2LXB A;  3H1K E;  1IFI A;  2NRG A;  3MHV A;  3WFC C;  1FI7 A;  1GU4 A;  1VF5 B;  4L73 A;  2Q6Q A;  2N1T D;  2B4Z A;  1YEB A;  3A5T A;  1N7S D;  2I1J A;  2WSC H;  2DVH A;  1IC2 A;  2JP3 A;  1LNQ A;  2M3B A;  1R8E A;  5CIH B;  5CIG B;  1JTH B;  1FJ0 A;  1AFO A;  2YMY A;  3H1I D;  1CIE A;  1QVF O;  4PJ0 H;  1USE A;  2OYH B;  3C9I A;  1GKS A;  1AJY A;  1NWQ A;  1GU5 A;  3HD7 D;  1P84 E;  1HJ0 A;  2W6J H;  2IYO A;  4JCG A;  1KOR A;  1M57 D;  2R44 A;  3WFE C;  1DEB A;  1RE4 A;  2BCC J;  1OVV A;  4EOT A;  2WWW A;  3A0H V;  2QJP C;  2HOD A;  3BVH A;  1LT9 C;  2QSI A;  4EID A;  4JYB A;  2P10 A;  4PD4 H;  1Z56 A;  2ZYA A;  1M8O B;  1LTB C;  2JR8 A;  2D2C C;  4PV1 D;  4WQ9 A;  2KS1 A;  2OYI A;  2LIR A;  5APQ A;  1LS9 A;  1CW5 A;  3ZOY A;  1IO3 A;  2QJK B;  4Z1M H;  2E76 B;  1CIH A;  2CPB A;  1PGP A;  1MUU A;  3L72 J;  1HZV A;  5AVV B;  1PPJ G;  1RHZ B;  2QE7 H;  1VQ7 P;  2E75 C;  1E29 A;  1HRO A;  4P4Q B;  3GMA A;  2HFE D;  3CCV P;  1U74 B;  2M3E A;  2NPS D;  3IFM A;  2LKM A;  2FWL A;  1URQ D;  3M0D A;  1WRG A;  1M1J A;  2XTS B;  5B66 H;  2FFD C;  5BU5 A;  4DCK A;  4IFD K;  1RAP A;  2YIU C;  4PD4 D;  1EZV G;  4IFF A;  4DZO A;  2DW3 A;  1S9K D;  4OGQ D;  3R4Y A;  1CTJ A;  1GL2 C;  1QEX A;  4N0K A;  1S9K E;  3H1I J;  3S1K A;  4FA1 A;  2JQR A;  3GG2 A;  2AEF A;  3VNW A;  3AEE C;  2B89 A;  4U7J A;  2M5A A;  2WSE J;  2N9I A;  1DVV A;  2QRX A;  2ZYG A;  3TGU D;  1NTM E;  5IY5 1;  4EIF A;  2YCC A;  1FJP A;  3G6E P;  1JM0 A;  4H44 C;  2KIK A;  4GIF A;  2QJY B;  3WU2 V;  3RL0 B;  3B5N C;  3TGU E;  2W6A A;  2WSC J;  2FBW C;  2D0S A;  3HUS B;  2RKL A;  3PP5 A;  5AVR B;  2WPV B;  3NBS A;  4WY4 C;  1SQB G;  2UWJ E;  3JCU E;  2JKV A;  2Q5U A;  3ITK A;  3VMX A;  3P8C D;  5AW5 B;  1TU3 F;  1J2J B;  2FYU J;  1L9B C;  1SQB K;  1N7S B;  4WQC A;  3DMI A;  1SQP D;  5CMZ A;  3RN0 A;  3HTK A;  1NU1 J;  1MKM A;  3P8C E;  4O9B A;  1NJI Q;  451C A;  2W6B A;  4XA4 A;  3CXH I;  1SQP E;  3L4O A;  3KPE A;  3PXT A;  4UB8 E;  3ORV A;  2K9J B;  4EI2 A;  4DJG A;  1YIJ P;  4W80 A;  2AXT E;  3CYT I;  2L4D A;  3HD7 B;  3LID A;  2KNC A;  2CE1 A;  3C1L A;  1GD2 E;  1QX8 A;  3VMA A;  3KZI E;  4H0J A;  2CPS A;  3AE3 C;  2GB8 B;  3PRJ A;  1JOC A;  3B4S A;  4H13 D;  3V6I A;  2Q9I A;  1U7J A;  2GC4 D;  3PH2 B;  1KYO E;  3I55 P;  1BGY G;  2GA1 A;  4PV1 B;  1NTK D;  2ZT9 C;  3WUV A;  1FU1 A;  1SQV D;  4AAM A;  2YXQ B;  4D6T D;  3GHG B;  2P1J A;  1MFT A;  3BCC E;  4PJ0 V;  2FYZ A;  2B10 B;  1NTK E;  1ZRT E;  1PP9 D;  1X8Y A;  1KIL E;  5CIF B;  1FI9 A;  3H1H D;  4RO0 A;  1KV9 A;  2M8R A;  1BDC A;  4XFJ A;  2OYO A;  3L71 G;  2ITA A;  4M3L A;  1GK6 A;  1E2R A;  4O1Q A;  2QVA A;  1PP9 E;  3TDK A;  4BXL A;  1M70 A;  4I6M C;  2HPC A;  3PJS K;  3NMD A;  1NTZ D;  3TNU B;  1JO5 A;  1FDI A;  1M1J C;  3G71 P;  1OW8 A;  3TYI A;  2FXP A;  1S5L E;  2N18 C;  3L74 G;  1MG2 D;  5AVY B;  1SQP J;  1R5L A;  4OGQ B;  1HGV A;  3X39 A;  3QH9 A;  4BRY A;  1CSB A;  1VYD A;  5KKZ C;  2IZ0 A;  3WFD C;  2ZBO A;  2FXM A;  1LTJ B;  3H32 A;  1L0N G;  4GDO A;  5CBO A;  1HH7 A;  5AVS B;  3JSV C;  4KHX A;  5AW1 B;  1KTM A;  1GMJ A;  1YEA A;  1LTS C;  5KAF H;  1L0N K;  1CSX A;  1FAV A;  2W27 A;  2XNX A;  3V2P A;  5B66 V;  4N6J A;  1HZU A;  1QL2 A;  2WT7 A;  1N86 A;  1NIR A;  3TSI A;  1A2S A;  3A7O A;  2O01 J;  1YHQ P;  5EFW B;  2BAS A;  3E1I A;  3RK3 E;  1L4A B;  1SQV J;  2A06 E;  1OMI A;  4FAV A;  2Y0D A;  2V07 A;  4D6T J;  1DD3 A;  5TJH A;  2JJL A;  3FX0 A;  2AEM A;  1H31 B;  3OAK A;  4FB1 A;  1N73 B;  2H8P D;  1FHB A;  1PP9 J;  4NPE A;  4RKU J;  1BE3 D;  1Q2N A;  3H1H J;  1VF5 C;  3VN0 A;  3MZW B;  2MTA C;  3H1K G;  4C46 A;  2H88 C;  4EDF A;  3M9H A;  3CP5 A;  1OVU A;  4WWI A;  1KFN A;  5DJT B;  1FOS E;  3AE7 C;  1BE3 E;  2IDB A;  3SVW A;  1M6Z A;  1NTZ J;  1SLQ A;  3SFD C;  2K37 A;  2V4H A;  3CMA P;  3IN6 A;  2Q7C A;  3CL3 D;  1DW1 A;  3T97 A;  1IRV A;  4ZKP A;  1QYZ A;  2FRC A;  4TT3 H;  1FZF A;  1KZU B;  3TYY A;  3CXH D;  1PGQ A;  3SJL A;  1KX2 A;  1SP4 A;  1CED A;  1VQ9 P;  2PP6 A;  4I2L C;  3CXH E;  2IBZ I;  4K3A A;  1CHI A;  4W7Z A;  4NPD A;  1IFM A;  1XTG B;  3L73 J;  1CI6 B;  2YKQ A;  3O6Q B;  3RBX A;  5KLI C;  2KXP B;  2BCN B;  1X0T A;  1KIL B;  4W7Y A;  1GW3 A;  5KAI H;  3KYQ A;  1W2L A;  3AED C;  1NGM B;  4C7R A;  3CWB D;  3CCR P;  2E76 C;  3A0H E;  2ZXY A;  4XE5 B;  2POH A;  3CLQ A;  3W68 A;  1N9C A;  2E5Y A;  4PW9 B;  1U7M A;  3RBZ A;  5GTI E;  4B86 A;  3CWB E;  1BCC J;  1H33 B;  1OX3 A;  1OW6 A;  1MV8 A;  4GYD A;  4L74 A;  5CCG C;  1CRI A;  1SS1 A;  1YJW P;  3OA8 B;  1NH4 A;  2FFD A;  3AEG C;  1HGZ A;  1OXZ A;  4IL6 X;  3O8Z A;  3GF7 A;  1IFD A;  2M0B A;  2C1D A;  2XND H;  1R5S A;  2OQQ A;  1GL2 A;  2IFM A;  1SFC A;  2BGV X;  2HLO A;  4IOI H;  3V4W A;  5KJ7 C;  1LC1 A;  2JEE A;  2BEQ D;  2QIW A;  3CX5 H;  1KV4 A;  1LMS A;  2IFN A;  1GZL A;  2N9J A;  3GF3 A;  3MD0 A;  1IZN B;  5DFS A;  2LR2 A;  4XXL A;  2SPZ A;  4RJT A;  2P7J A;  4OVN F;  3RK3 B;  2BCC E;  5CCH D;  3A9F A;  1ZR2 A;  1NTM G;  2B0Z B;  3RL0 C;  1VDF A;  2B88 A;  1VQ8 P;  1QN2 A;  1F1C A;  3B5N A;  1K05 A;  5APY A;  5AW8 B;  1KC8 Q;  2OTL P;  1LGH B;  3L72 D;  1WEJ F;  3HUS C;  3ZIY A;  3E1R A;  1S3J A;  3TGU G;  1CZQ A;  2IX7 C;  3CWB J;  4WY4 A;  1NTM K;  1EC5 A;  1ZP0 C;  1NKZ B;  3VYM A;  2Z4E A;  3L72 E;  3SWS A;  1LP1 A;  2C1V A;  4BWN A;  3V2N A;  1JUN A;  2R32 A;  3GLM A;  2Q3E A;  3WU2 E;  5KAF V;  4JQ0 D;  4AAN A;  2HG5 D;  4FAN A;  5APW A;  1H32 A;  2JO1 A;  1G2C B;  2V7Q H;  3D70 A;  4AAL A;  5CJ4 A;  3Q1M A;  1CSU A;  4FA9 A;  1YFC A;  1PGO A;  1KQS O;  2QM7 A;  2PCC B;  5AW4 B;  1CRC A;  3D71 A;  1N7L A;  4GT1 A;  2CA4 B;  1SQP G;  3I5C A;  3HD7 C;  3CU4 A;  1OIP A;  2OZ1 A;  2CE0 A;  1CSW A;  1VQK P;  1ZLL A;  3DR0 A;  2WSF H;  5DJU B;  3H1I E;  3PLN A;  1SQX D;  4KJM A;  1SQP K;  1EB7 A;  4QAO A;  2AI5 A;  5AW9 B;  1CI6 A;  3R2P A;  3C2C A;  2MJZ A;  5AVW B;  4EYY Q;  2YKO A;  1FZC B;  1QLE D;  3WMM 0;  1N90 A;  3QWO C;  5GTI V;  2Y0C A;  3O20 A;  3AE4 C;  3HQ6 A;  1K8A Q;  1OFC X;  2IBZ D;  3HE4 B;  3S4R A;  3GHG C;  3VOP A;  1NHL A;  3RGU A;  1YQ3 C;  1S1C X;  2K1A A;  1OVR A;  1FE6 A;  2PCB B;  3BCC G;  2R3C A;  3VRD A;  1H0T A;  4FA5 A;  2ZYD A;  3L4F A;  4YTP C;  3IAO A;  1NTK G;  1FS0 E;  1FCD C;  351C A;  2FYN B;  1IFN A;  3F89 A;  4U3F D;  2FYU D;  2D2C D;  3L70 G;  5E79 H;  3AEF C;  3VMY A;  1COR A;  1NU1 D;  4RES B;  1PP9 G;  1NTK K;  4PJ0 E;  1YCC A;  4K35 A;  1L0L J;  4OH8 B;  1SQV K;  4U3F E;  2FYU E;  4DOJ A;  1RZ5 A;  4ASV A;  4OGQ C;  1EDI A;  3SLE A;  5KAI V;  1F1F A;  1H1O A;  3O1Y A;  1FOS F;  1NU1 E;  2A45 G;  2J58 A;  1KD1 Q;  2E74 B;  1CYC A;  1LTJ C;  1SFC C;  3OCD A;  1EDJ A;  4O1W A;  3KQG A;  4PD4 E;  3CXH W;  1VQN P;  1JEK A;  1PGJ A;  4L76 A;  1J1D C;  1HBW A;  3BAT A;  3RK2 D;  2Y9Y A;  1MZ4 A;  3LIE A;  1LTG C;  2YO2 A;  1NTZ K;  1ZW0 A;  5AVX B;  1SQX J;  1AOF A;  5AW3 B;  1KX7 A;  3HE5 A;  2VRS A;  4I1L A;  2CA3 B;  1GIW A;  3L35 A;  1AVY A;  1RY3 A;  1CHJ A;  2W8Z A;  4UB6 H;  1L4A C;  5H2F H;  3VYI A;  1ZME C;  5M1B A;  3D0W A;  2B87 A;  1HJ4 A;  2O1J A;  3H1J D;  2V7Q J;  2A06 G;  1N73 C;  4HYT B;  3RL0 g;  5B66 E;  1T2K D;  2YNY A;  4WBA A;  1NVO A;  3B71 A;  4K3I A;  1DW2 A;  1VQO P;  2N1T B;  4U3F J;  4L1Q A;  3V2Q A;  3B5N D;  1CHH A;  1IK7 A;  2OTK E;  2WSF J;  2KB7 P;  2Y9Z A;  2YK3 A;  1BE3 G;  3DP5 A;  4H0L D;  1KB9 H;  1JTH A;  3G4S P;  2WVR A;  1DX7 A;  1PV3 A;  2OYH A;  1D7M A;  1DIQ C;  3I56 P;  1NNO A;  1Q90 D;  3CI9 A;  1YTC A;  1ZR4 A;  4Y99 C;  4C7N B;  1JY2 P;  1CXC A;  5AVQ B;  1CRG A;  1K3G A;  2WIT A;  4R4M A;  3CC2 P;  3IR9 A;  3FWN A;  3HQ8 A;  3WFB C;  4JF7 A;  1I8P A;  2V08 A;  3G9R A;  1CC5 A;  1S5L X;  5DJQ B;  2NZ2 A;  2BEZ F;  1YTZ I;  3P8M C;  1PFI A;  1KIL C;  1RQU A;  3L37 A;  1WT6 A;  1QL1 A;  5APU A;  2E5T A;  4AAO A;  1VQM P;  3K5B A;  2QJP B;  3ZOW A;  3Q2Y A;  1LT9 B;  1GTW A;  3EWK A;  5TIS H;  3SFE C;  1SQV E;  4ASW A;  1X79 B;  3H1J J;  4D6T E;  1FZG A;  1GU2 A;  2ZVN B;  1CCR A;  2ZT9 D;  3L75 G;  1JY3 N;  2KZJ A;  3CWB G;  1RF1 B;  2YMK A;  3P32 A;  2K9Y A;  2NPS B;  3H1H E;  4HB1 A;  5CCG A;  3H1L G;  2B11 B;  1URQ B;  1NAF A;  2R5D A;  4DT0 A;  5APT A;  3SXT A;  1CIF A;  1DH3 A;  3CCL P;  2KI7 B;  2C0W A;  1KFM A;  1NTZ E;  3Q5R A;  1Q81 Q;  1HWT C;  1OWA A;  5KJ7 A;  1IFP A;  4RSZ A;  2GIW A;  4EIE A;  1ZXG A;  3Q3D A;  1JY2 O;  2O1K A;  1J1E B;  3RK2 B;  3ABV C;  2BLF B;  2Q3I A;  5CID B;  5EXQ A;  5E79 V;  3L73 D;  3JC2 2;  4FA4 A;  3CCM P;  3RK3 C;  3NBT A;  4J20 A;  2WQY C;  2GC7 D;  2KLV A;  1KIB A;  1T8Z A;  1LWU B;  4EIC A;  3CCS P;  3M9B A;  3D6Z A;  3H6P A;  2BCC G;  3L73 E;  3ZOO A;  3PXS A;  1RAQ A;  2XKM A;  2MKV A;  1SQQ D;  1XTC C;  2BPB B;  2J59 M;  2R3S A;  3HUS A;  1DT1 A;  3CX5 I;  1X9V A;  2ZOO A;  1IRW A;  1YTZ T;  1I6E A;  1BCC D;  1IK9 A;  3SWF A;  4GKG A;  2C2C A;  1SQQ E;  4JBZ A;  2KP8 A;  1AV1 A;  2YKP A;  3L72 G;  1RE3 C;  1N7S A;  1C7M A;  4WQB A;  1BCC E;  3VTP C;  1A56 A;  1C2N A;  1CTY A;  2KK7 A;  2N3Y A;  5B5E H;  3CCU P;  1GQ1 A;  4UB6 V;  1YNR A;  1LT1 A;  4H0L B;  1H89 A;  5H2F V;  2Z5H A;  2C9L Y;  3NFQ A;  3RMZ A;  4PWA A;  1VF5 D;  2K9J A;  1VQP P;  2OYH C;  2VHD A;  4TLF A;  5KAF E;  2I8D A;  1P84 I;  1YJ9 P;  3HD7 A;  5CIE B;  2N9Y B;  2O3J A;  3N7N A;  1CYI A;  4KMG A;  1JCD A;  3ZOX A;  2QM8 A;  2C9N Y;  1NKN A;  3UIA A;  4H13 B;  3H1I G;  1K9M Q;  1VQ5 P;  1KQL A;  3KDP B;  3TK1 A;  2KYV A;  1FZC C;  4YXW H;  1C2R A;  1BGY D;  2YQB A;  5C9M A;  3CC7 P;  2AEJ A;  1YYC A;  3GHG A;  3U59 A;  1WVE C;  2YO3 A;  4I7Z B;  2QJK C;  4IFM A;  2HOD B;  3M97 X;  3O0R C;  1PL5 A;  1SQQ J;  3A0B H;  2FYN C;  5GTH H;  1FJK A;  2CXB A;  4WQD A;  3E7K A;  3L71 D;  1SQB J;  3BRV B;  2KS1 B;  2OYI B;  3HRN A;  3ZBM A;  4WQ8 A;  1S2E A;  2AXC A;  3TNU A;  2PRR A;  3WUT A;  4WQE A;  3V5B A;  1KMI Z;  2E76 D;  2W83 C;  2OAR A;  3L71 E;  1NYH A;  1W2E A;  3SWK A;  1J3S A;  3MGN A;  4U3F G;  4ZKU A;  2FYU G;  5K5G B;  2E74 C;  1FC2 C;  1FDM A;  2LXC B;  4IL6 H;  1NU1 G;  1LTJ A;  3AEC C;  3ZCF A;  1JY2 N;  3EFG A;  5TIS V;  5B6Q A;  155C A;  3USS A;  2JDI H;  3CCE P;  1AVO A;  2FYU K;  3FXD A;  1M1J B;  2OGU A;  2WSS H;  5KAI E;  3MTU E;  1C6O A;  1NU1 K;  1COT A;  3B8E B;  5CCH C;  2GUV A;  1FZE A;  1IFJ A;  1C52 A;  5APS A;  1MG3 D;  5KJ7 D;  1LFM A;  1E79 H;  1VQ4 P;  2B12 B;  1EDL A;  3G3Z A;  1YIC A;  4JPZ B;  3M0A A;  1LTA C;  2QJY C;  2WPS A;  1BGY J;  1ZV8 A;  1L4A A;  2K88 A;  1QKS A;  2RMZ A;  1AQT A;  1H31 A;  1LC2 A;  2M5A B;  1N73 A;  1HH0 A;  1P84 H;  1K04 A;  2ZJS E;  2JTI B;  5BVZ A;  1I54 A;  5KLV D;  3CX5 D;  2N1T C;  2WZ7 A;  3H1K D;  2KZI A;  1L0L D;  1R0Q A;  1N7S C;  2KSJ A;  3L71 J;  1Y9B A;  4WQA A;  3ZDM A;  4YPC A;  5KLV E;  3CX5 E;  2ZVO B;  2XDJ A;  2KSE A;  1AQ5 A;  1JY3 P;  3FGA D;  2E43 A;  1L0L E;  2LIT A;  3L74 J;  2H7H A;  1W2B O;  1JMB A;  3HTK B;  2O01 N;  4GED B;  1L0N J;  1K73 Q;  1H8A A;  1P84 D;  3AE6 C;  5DJQ C;  4QMA A;  1KYO I;  3O6Q A;  3LW5 H;  4PV1 C;  1KIL A;  5B5E V;  4LJI A;  1SQX E;  2IPP A;  1KB9 I;  3Q5S A;  4MU8 A;  2KNC B;  1UIX A;  3CCJ P;  3U1C A;  2C1U A;  5C0Z A;  1HJB A;  1FI3 A;  1YJN P;  4JYC A;  1PZQ A;  2IBZ E;  2AIU A;  4N78 D;  2IYP A;  5KLI B;  1HVV A;  2FXO A;  2Z5I A;  1SQV G;  4WVZ A;  3SSU A;  1C6R A;  1H33 A;  4D6T G;  1RF1 C;  1GK4 A;  2NPS C;  4L3G A;  1URQ C;  5KLV J;  1JDL A;  1QVG O;  4N78 E;  1EZV I;  2A45 I;  3II6 A;  2CK3 H;  3H1K J;  3OA8 A;  2GM4 A;  2HR3 A;  3H1H G;  1CSV A;  2FY8 A;  1JY3 O;  4YE1 A;  2L91 A;  2RN0 A;  1M56 D;  2RH0 A;  3AE9 C;  1QL4 A;  2GUS A;  1FOC A;  1CO6 A;  3W67 A;  3H25 A;  2E75 D;  1IJD B;  3MK7 B;  1FZA A;  1NTZ G;  2HPC B;  3A0B V;  1U75 B;  1UII A;  1J1E C;  3JCU H;  5GTH V;  3RK2 C;  5DF5 A;  4Y28 J;  1T3U A;  3N4X A;  3Q5P A;  2J5U A;  1SVF A;  3AE8 C;  2D0W A;  3BRT B;  4BRY B;  1LWU C;  3AE2 C;  1DVH A;  1GL2 D;  4AYC A;  1SFC D;  3IF4 A;  2ZON G;  3MUD C;  3NTN A;  3H32 B;  3BAS A;  1X22 A;  4GOD A;  1BL9 A;  1NAY A;  1RF0 C;  1NTM D;  3L73 G;  2IZ1 A;  4IL6 V;  4OWF A;  5E79 E;  4UB8 H;  1A8C A;  3M91 A;  1HF9 A;  1G1I A;  1C6S A;  1T2K C;  1NO4 A;  1VPC A;  2AXT H;  3JBT B;  1Y8A A;  3CC4 P;  3OJA B;  5CJ0 A;  5AW7 B;  1I6D A;  2WT7 B;  1GDT A;  3VMZ A;  1CRY A;  3KZI H;  3H1J E;  1SQQ G;  4WQ7 A;  2WPQ A;  1RE3 A;  1DII C;  4H44 D;  1L4A D; 
#chains in the Genus database with same CATH homology
 4FA4 A;  3TF5 A;  3NBT A;  4J20 A;  2GC7 D;  4JCG A;  1H33 B;  5CIB B;  1KIB A;  4GYD A;  4EIC A;  1CCH A;  4AX3 A;  1IQC A;  1CRI A;  3WFE C;  3A0H V;  3OA8 B;  3ZOO A;  3PXS A;  1RAQ A;  4EID A;  1AKK A;  1SQQ D;  2BPB B;  2C1D A;  1L9J C;  1DT1 A;  4WQ9 A;  2ZOO A;  1IRW A;  4DY9 A;  2KS1 A;  2LIR A;  2BGV X;  1LS9 A;  1LC1 A;  1I6E A;  1BCC D;  3ZOY A;  1IO3 A;  2C2C A;  2QJK B;  1LMS A;  1CIH A;  1HZV A;  2N9J A;  4Y5R A;  1C7M A;  4WQB A;  5DFS A;  3KHU A;  1E29 A;  1A56 A;  1HRO A;  4XXL A;  1C2N A;  1CTY A;  4P4Q B;  1HJ3 A;  2BH4 X;  1KYO D;  2N3Y A;  4RJT A;  1U74 B;  2HV4 A;  1GQ1 A;  2ORL A;  3PTZ A;  4UB6 V;  1CYJ A;  3A9F A;  1YNR A;  2FWL A;  5H2F V;  1HRC A;  2XTS B;  2B0Z B;  3RMZ A;  1KB9 D;  4PWA A;  3BCC D;  2VHD A;  4NFG B;  5CYT R;  1RAP A;  4PD4 D;  1QN2 A;  1N50 A;  1F1C A;  2I8F A;  1PPJ D;  1ZRT D;  1CTJ A;  3L72 D;  1WEJ F;  3ZIY A;  3CX5 W;  5CIE B;  2N9Y B;  2O3J A;  4N0K A;  1CYI A;  4KMG A;  3L70 D;  3ZOX A;  2PAC A;  3VYM A;  3SWS A;  4FA1 A;  2JQR A;  3GG2 A;  2C1V A;  2Q3E A;  2N3B A;  3VNW A;  5KAF V;  4AAN A;  4FAN A;  1EZV D;  1RZ6 A;  1C2R A;  1BGY D;  2YQB A;  1H32 A;  5C9M A;  2N9I A;  1C75 A;  1WVE C;  1DVV A;  4AAL A;  3TGU D;  1I8O A;  1CSU A;  5IY5 1;  4FA9 A;  1YFC A;  4EIF A;  2YCC A;  1GJQ A;  3M97 X;  3O0R C;  1CIG A;  2PCC B;  1CRC A;  2QJY B;  2CA4 B;  3WU2 V;  2YIU B;  1HCM A;  3CU4 A;  2CXB A;  2OZ1 A;  2C1D B;  2D0S A;  2CE0 A;  1CSW A;  4WQD A;  3GW6 A;  3L71 D;  3NBS A;  3DR0 A;  3ZBM A;  4WQ8 A;  3PLN A;  1SQX D;  4A7P A;  1EB7 A;  1M60 A;  4QAO A;  2AI5 A;  4WQE A;  3ITK A;  3C2C A;  1J3S A;  1L9B C;  1N90 A;  4WQC A;  3HQ7 A;  3DMI A;  1SQP D;  5GTI V;  2Y0C A;  3O20 A;  3HQ6 A;  3RN0 A;  2IBZ D;  3ZCF A;  2A06 D;  451C A;  1CRJ A;  5TIS V;  5B6Q A;  1SQB D;  155C A;  1AOQ A;  2PCB B;  3L4O A;  3VRD A;  2JWA A;  3PXT A;  4FA5 A;  3ORV A;  2K9J B;  1C6O A;  1COT A;  1FCD C;  351C A;  2FYN B;  3CYT I;  2L4D A;  4U3F D;  1W5C T;  2FYU D;  1CXA A;  2CE1 A;  1I55 A;  1C52 A;  3VMA A;  3WUI A;  4H0J A;  1COR A;  1NU1 D;  1MG3 D;  2GB8 B;  1LFM A;  2B12 B;  3PRJ A;  1YCC A;  1YIC A;  1RZ5 A;  2GC4 D;  3PH2 B;  1B7V A;  4UB8 V;  2Y0E A;  3SLE A;  5KAI V;  1F1F A;  1H1O A;  3O1Y A;  2ZZS 1;  1QKS A;  2RMZ A;  1NTK D;  1ZZH A;  2AXT V;  1SQV D;  4AAM A;  1H32 B;  1CYC A;  1H9X A;  1H31 A;  1LC2 A;  3OCD A;  4D6T D;  4O1W A;  3KZI V;  3CXH W;  2JTI B;  4PJ0 V;  1I54 A;  2B10 B;  5KLV D;  3CX5 D;  1PP9 D;  1QL3 A;  3NWV A;  3H1K D;  5CIF B;  1FI9 A;  3H1H D;  1NMI A;  1L0L D;  1CNO A;  1R0Q A;  1KV9 A;  1MZ4 A;  3WC8 A;  3FWL A;  4WQA A;  1I5T A;  2OZ1 B;  1S6V B;  2DGE A;  1E2R A;  4O1Q A;  3TDK A;  1M70 A;  1AOF A;  3PHL A;  4XYD B;  1KX7 A;  4L3H A;  2CA3 B;  1GIW A;  1NTZ D;  1CHJ A;  3L4M A;  3TYI A;  1DW3 A;  2LIT A;  2C9X B;  1E8E A;  2N18 C;  3RLM A;  1MG2 D;  5AUR A;  1CTZ A;  1GDV A;  3X39 A;  1HJ4 A;  4V2K A;  3H1J D;  1VYD A;  3WFD C;  2ZBO A;  1IZL 0;  3L75 D;  4GED B;  1P84 D;  3H1L D;  1NML A;  5DJQ C;  4K3I A;  1DW2 A;  1S5L V;  1HH7 A;  4L1Q A;  3L74 D;  1H9Y A;  5B5E V;  4LJI A;  1CHH A;  2QG4 A;  1YEA A;  3MK7 C;  2EXV A;  1HJ5 A;  4MU8 A;  2KNC B;  1CSX A;  3RN1 A;  5B66 V;  1HZU A;  2C1U A;  2YK3 A;  3DP5 A;  5C0Z A;  1NIR A;  1FI3 A;  1A2S A;  1L0N D;  1DIQ C;  2N18 B;  2AIU A;  1N15 A;  3O5C A;  5KLI B;  1NNO A;  1CRH A;  2C8S A;  4FAV A;  1ETP A;  1YTC A;  2Y0D A;  2V07 A;  5TJH A;  1C6R A;  1H33 A;  1YIQ A;  1CXC A;  1H31 B;  4L3G A;  3HQ9 A;  5KKZ B;  4FB1 A;  1CRG A;  5CIC B;  3OCD B;  1K3G A;  1FHB A;  1JDL A;  3OA8 A;  3HQ8 A;  3WFB C;  1BE3 D;  1I8P A;  1AYG A;  2MHM A;  2V08 A;  1CC5 A;  2MTA C;  2BCC D;  1KYO W;  5DJQ B;  1CSV A;  4YE1 A;  2L91 A;  4EDF A;  3CP5 A;  2RN0 A;  1QL4 A;  1FOC A;  1KB0 A;  1CO6 A;  3MK7 B;  4Q5P A;  3SVW A;  1M6Z A;  1DW0 A;  2BH5 X;  4AAO A;  3A0B V;  1U75 B;  2QJP B;  1DW1 A;  3ZOW A;  1IRV A;  5GTH V;  1OCD A;  1QYZ A;  5DF5 A;  3PXW A;  2FRC A;  1GU2 A;  3CXH D;  2D0W A;  3SJL A;  1CCR A;  1KX2 A;  4H0K A;  1K3H A;  1DVH A;  1CED A;  1OAE A;  2ZON G;  2B11 B;  3WFC C;  1BL9 A;  1FI7 A;  1CHI A;  3SXT A;  1NTM D;  1CIF A;  4IL6 V;  2B4Z A;  1YEB A;  2BCN B;  1A8C A;  2DVH A;  1C6S A;  1W2L A;  3JBT B;  4RSZ A;  1I6D A;  3CWB D;  2GIW A;  2ZXY A;  4EIE A;  5CIH B;  1CRY A;  5CIG B;  1FJ0 A;  1N9C A;  3H1I D;  1CIE A;  4PW9 B;  2BLF B;  4WQ7 A;  1GKS A;  5CID B;  1DII C;  5EXQ A;  5E79 V;  3L73 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...