1BGYD

Cytochrome bc1 complex from bovine
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 58
structure length 241
sequence length 241
chains with identical sequence P
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1bgyD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1bgyD01
2L4DA 3H1KD 1I6DA 3HQ7A 3ZBMA 1EZVD 1SQBD 3RMZA 2OZ1A 1I8OA 1CRIA 4PJ0V 2BCCD 1I54A 3RLMA 1H31B 3SWSA 3M97X 1MG2D 1SQVD 1CSWA 1CIFA 2FYNB 5TJHA 1S6VB 2LIRA 4FA4A 2KS1A 4PWAA 3MK7B 2EXVA 2MHMA 4QAOA 1R0QA 1BGYD 1H1OA 3PRJA 3MK7C 5CIGB 3ZIYA 4H0KA 3PLNA 5CIDB 5H2FV 1COTA 5CICB 5DF5A 2MTAC 4NFGB 3TF5A 1LFMA 1FI3A 2N9IA 2PCBB 3O20A 2B11B 2C9XB 2BPBB 1QL4A 1NTKD 1QN2A 1H9XA 2Y0DA 2C1UA 3CYTI 2CE0A 4Y5RA 4FA9A 4U3FD 2CXBA 1YNRA 2ZZS1 1CC5A 5KKZB 2FRCA 4XXLA 1YCCA 3OA8A 1CYJA 5B6QA 3PTZA 1RAPA 5TISV 1LS9A 3VNWA 3PXSA 1JDLA 1HJ3A 1H33A 1H31A 1CCHA 1CSVA 4PW9B 3ZOYA 4XYDB 1M60A 1CSXA 1N9CA 2C1DB 2B0ZB 1YTCA 4AAOA 1HH7A 2AIUA 4O1WA 3SJLA 3ITKA 2BH5X 1DW2A 3WFDC 1CHJA 1GU2A 1GQ1A 1KX2A 3DMIA 3HQ6A 351CA 1CIEA 2YQBA 1DVHA 1W5CT 1RZ5A 2C1VA 3CP5A 1HRCA 1PP9D 3L4OA 4FB1A 1I55A 3L75D 4EICA 1VYDA 3CU4A 5CIBB 1IQCA 1P84D 4K3IA 5KLVD 4YE1A 3ZOWA 1CCRA 5C0ZA 2C2CA 1YFCA 2K9JB 5CIEB 4L3GA 5GTIV 3H1LD 2D0WA 1N15A 4L3HA 1NU1D 1J3SA 2CA4B 1H9YA 3VRDA 2PACA 1E29A 2QJPB 3ORVA 1CYCA 2Y0EA 4FA1A 3SXTA 1QKSA 2JTIB 3CXHD 2N9JA 2QJYB 3JBTB 2C8SA 3H1JD 3HQ9A 4WQ8A 4FA5A 2BLFB 1BL9A 1CSUA 2QG4A 4A7PA 1IRWA 3SLEA 3GW6A 1H32A 1NTZD 1A56A 1I6EA 1YICA 1AOFA 4JCGA 1CXCA 5C9MA 3CX5W 4AALA 3KHUA 1C6SA 4D6TD 2DGEA 1CRYA 1C2NA 3WFEC 1NNOA 1N90A 1CTJA 1KYOW 1ZZHA 2YK3A 3WFBC 1DW1A 2N18B 1C75A 1CYIA 5KAIV 2N3YA 2N18C 1A2SA 5E79V 1AKKA 2AXTV 2YCCA 1L0LD 1W2LA 3FWLA 4EIDA 5KAFV 1FI7A 1KB9D 4WQBA 4UB8V 3L70D 1CRGA 1M6ZA 1IZL0 2CA3B 3WC8A 1LC2A 3PXWA 5IY51 3TDKA 1CHHA 3SVWA 2GC4D 1CIHA 3X39A 3PH2B 1LMSA 5AURA 1DIIC 1CRCA 1HZUA 2B10B 155CA 2RN0A 1C2RA 4LJIA 4RSZA 2BCNB 1L0ND 5DJQB 2DVHA 1ZRTD 5DJQC 4MU8A 1E2RA 4KMGA 4AX3A 1N50A 1NMIA 3HQ8A 1C6OA 1CTYA 3ZOOA 2JQRA 3RN0A 1CXAA 1F1CA 3DP5A 1CRHA 1DIQC 1SQXD 3DR0A 1BE3D 2FYUD 1NMLA 1S5LV 3PXTA 451CA 3KZIV 1DW0A 1WVEC 1YEAA 2I8FA 1RAQA 1KX7A 3H1ID 4DY9A 3VMAA 1KIBA 2V08A 1NIRA 3RN1A 3PHLA 2HV4A 4FAVA 1L9BC 4WQDA 4WQAA 3A0HV 2Q3EA 1B7VA 4WQ9A 1HJ5A 1GDVA 2N9YB 2D0SA 1DW3A 3WFCC 2RMZA 5KLIB 3O0RC 2QJKB 4WQCA 3ZOXA 1OCDA 5GTHV 2C1DA 3OA8B 3OCDB 1FCDC 5CIFB 3NWVA 2A06D 1IRVA 3A9FA 2LITA 2B12B 1I8PA 2BGVX 1H33B 2GB8B 5DFSA 1C7MA 4H0JA 1SQQD 2JWAA 1CHIA 1FJ0A 1CRJA 2PCCB 1F1FA 2V07A 4J20A 4EIEA 1FI9A 4PD4D 1HJ4A 1C6RA 4RJTA 1HZVA 3NBTA 3L73D 2CE1A 1CEDA 3O5CA 3ZCFA 3L72D 4WQ7A 1A8CA 4WQEA 1CIGA 1CNOA 4P4QB 4FANA 2L91A 3GG2A 4EIFA 1QL3A 5EXQA 1CO6A 4AAMA 4GEDB 1OAEA 3WUIA 1FOCA 1FHBA 2O3JA 2VHDA 2ZBOA 2BH4X 3WU2V 4V2KA 4L1QA 1KB0A 3CXHW 3O1YA 3TGUD 5B5EV 1GIWA 1QYZA 3BCCD 2N3BA 1YEBA 2YIUB 3C2CA 2OZ1B 3OCDA 1CORA 1RZ6A 1SQPD 1YIQA 5CIHB 1IO3A 2ORLA 2AI5A 1GJQA 1DVVA 1C52A 3L71D 4EDFA 1HCMA 1K3GA 1I5TA 1AYGA 5B66V 2ZOOA 2B4ZA 1LC1A 1CTZA 1MZ4A 1NTMD 3CWBD 1E8EA 1U75B 1H32B 2GC7D 1DT1A 4AANA 1HROA 4Q5PA 1PPJD 4GYDA 4N0KA 1U74B 1BCCD 4IL6V 1MG3D 3TYIA 1AOQA 4O1QA 2FWLA 3CX5D 1M70A 1EB7A 1L9JC 3L4MA 1ETPA 5CYTR 3VYMA 2IBZD 3H1HD 2KNCB 2ZXYA 2ZONG 3A0BV 1GKSA 1KYOD 3NBSA 1WEJF 2GIWA 3L74D 1K3HA 2XTSB 2Y0CA 1KV9A 4UB6V
chains in the Genus database with same CATH superfamily
2L4DA 1KTMA 1Q86Q 3ZBMA 4I1LA 1RF1C 1EZVD 3AE9C 3BATA 2QSIA 3V5BA 3A0HE 3A3YB 3AE1C 1HBWA 3RLMA 5AVSB 3TYYA 1SQPK 1H31B 1YHQP 2XV5A 1CIFA 2G3AA 1KQSO 2LIRA 4FA4A 1NO4A 4JQ0D 5GTHE 1EZVG 1YJWP 4D6TJ 3PRJA 5CIGB 1LP1B 2WSEJ 1SFCD 1GU4A 1ZLLA 1NTMK 5CIDB 1LT9A 5CICB 2WMMA 2IFMA 3G6EP 3TF5A 1FI3A 1QEXA 2PCBB 3L72J 2IFNA 2AEJA 2K1AA 2XZRA 2BPBB 1N7SC 1NTKD 3TNUA 3B5NB 3PH0A 2FBWC 1ZMEC 2QA4P 3B5NC 3HE4A 2CXBA 1K05A 2WPQA 1HUCA 3TGUJ 3I56P 5C39A 3D0WA 4ZKUA 5KKZB 1U57A 1X9VA 2HG5D 3OA8A 5KKZC 5L8RJ 1KB9I 3WU2E 3N4XA 4XE5B 1HJ3A 1H33A 5B5EE 4PW9B 1NKZB 3ZOYA 4XYDB 2XKMA 1CSXA 1N9CA 2B0ZB 1YTCA 5AVXB 1JY3N 1JMMA 1DW2A 1JY3O 1GU2A 1GQ1A 1OW7A 3E7KA 3HQ6A 5BU5A 5KJ7D 1CIEA 4DT0A 5B66E 3CP5A 1HRCA 3CX5H 3WMM0 2WSSH 3L75D 3V4WA 1OZHA 1IQCA 2OYHA 1K8AQ 3MZWB 4K3IA 4I6MC 2E74C 1CCRA 3H1LD 3CCVP 2WPVB 1NU1D 1CZQA 1YTZI 3L75G 1J3SA 5CHXA 3CC7P 1NTZE 1NAFA 3BRTB 1LJ2A 1EDIA 1S9KD 1E29A 2K37A 4OGQD 1GW3A 3H1LG 4H44D 4FA1A 2O01N 1S5LH 1NU1G 4D6TE 2N9JA 2HR3A 1PIXA 3CCRP 3OAKA 3JBTB 1FJKA 5GTIH 4WQ8A 3FGAD 1JY2O 3RL0D 3S4RA 1BL9A 2KLVA 1EDJA 3L72E 1H32A 2ZFCA 2KB7P 1OFCX 3WUTA 1I6EA 1IZNB 1IO4A 2E42A 1Q7YQ 3KHUA 1NTKJ 2DGEA 1OVVA 1CRYA 1W2EA 2PAJA 1KYOW 1M1KQ 5AW6B 1ZZHA 2YK3A 3CD6P 2N18B 2BASA 1CYIA 5KAIV 5APVA 2K9JA 3RK2B 2N18C 5E79V 1KILB 2AXTV 2QIWA 3FWLA 2B87B 1URQB 5CCGD 1HVVA 3L70D 2I8DA 3AECC 1SS1A 5EFWB 3D71A 4IFMA 3HD7B 2IYPA 1CIHA 5AURA 3HUSA 1VF5D 1CRCA 4IFDK 2YXQB 3CMEP 2RN0A 1C2RA 4LJIA 4RSZA 2R5DA 2BCNB 1L0ND 2FFDB 1ZRTD 5KAFH 1H0TA 4AX3A 3VMYA 1G2CB 1RE3A 3USSA 4I2LC 1RQVA 2KS1B 4YTPC 3M91A 2W8ZA 2MJZA 1F1CA 1NTKK 3L75J 3PXTA 3CLQA 3ZDMA 4GOEA 3SWKA 1FDOA 3JCUH 3H1LJ 2E76D 4DY9A 1NU1J 2R5BA 1PV3A 4FAVA 3C8VA 4GDOA 1R8EA 3A0HV 4WQ9A 2AXCA 3D70A 1SQQE 2NPSA 1NJIQ 1Q2NA 5GTIE 5AW5B 3AEAC 2QJKB 5K5GB 3H32A 3CCJP 5GTHV 3KZIH 2QJKC 1FCDC 2H8PD 2OQQA 1QLED 3MTUE 1IJDB 1USEA 4JPZB 3A9FA 2LITA 3EFFK 1ZP0C 5DFSA 1KQGB 1C7MA 2B88A 1KD1Q 2M0BA 1FZFA 2Q1KA 1VDFA 5AVYB 2PCCB 2H7HA 4PD4D 1HJ4A 1MFTA 3D6ZA 1MFZA 1JB0J 1MKMA 1SQXK 1UIXA 3S1KA 3VN0A 2YMYA 5AW0B 1SFCA 1A8CA 1VQKP 1RF0A 4P4QB 4EIFA 1QL3A 1CO6A 4AAMA 5AVZB 4GEDB 2A45I 1Y8AA 4EYYQ 2BH4X 3WU2V 4MN4C 1KV4A 1JTHB 4L1QA 5B5EV 1GIWA 1QYZA 1YITP 1LTSC 1M57D 3KYQA 2N3BA 4JBZA 3VMXA 1VQ9P 1G1JA 5KAFE 3C2CA 2OZ1B 3OCDA 1CORA 4PV1B 1SQPD 2L5GB 2PP6A 2ZT9B 4PV1C 2Q6QA 1DVVA 2ZT9C 1HJBA 3B4SA 1S3JA 4C7NA 3B8EB 2OTLP 2W83C 1LTJB 5B66V 3RBZA 2ZOOA 2B4ZA 1SQPG 1PGQA 1NTMD 4EI2A 3T97A 5AW1B 2V7QH 1IFIA 4LC1A 1E8EA 2C9NY 3A7OA 1T6AA 3JCUE 1GDTA 1NU1E 1LTGC 2PRRA 3AEGC 1NTMG 2WTYA 4H13D 4Z1MH 2FWLA 1R5SA 1M70A 1GL2A 3VMZA 3M9BA 1S9KE 1ETPA 2H89C 2Y9YA 3H1HD 1GKSA 2OTJP 4W7ZA 3KZIE 1K3HA 4N3YB 1EXIA 3CXHH 3R4YA 5CJ4A 2UWJE 2ZAEB 1N73B 1Q90D 3HQ7A 3H1HG 3KDPB 4NPEA 4IL6H 1N73C 1SQBD 3RMZA 1YQ4C 3VP8A 1SP4A 3GHGB 2CPBA 1I54A 1E5WA 4IFFA 1L0NK 2ZXXA 3GHGC 4ZNCA 2OYIB 1MG2D 1SQVD 1CSWA 5AW3B 1JOCA 5AVUB 1S6VB 1M1JB 2OYIC 3CXHI 1SQBG 1AQTA 4RKUJ 1M1JC 1R0QA 1BGYD 3JC22 2N1TB 4H0KA 4PD4H 3PLNA 5DF5A 1SQVG 2BEQD 2MTAC 2ZVOB 1LFMA 2N9IA 1BGYG 1H9XA 2Y0DA 2C1UA 3MD0A 1LTIC 1USDA 1KMIZ 1WRGA 1JY2P 4OH8B 3IAOA 4BRYB 2QVAA 3N7NA 4L76A 5H2FH 5E79E 1CC5A 3Q5SA 4XXLA 1ZRTE 3VYIA 3Q5RA 1SQPJ 2E75D 5B6QA 3C9IA 3HTKA 3PTZA 3VNWA 3R2PA 1JDLA 3GF7A 1H31A 5APTA 1CSVA 2C1DB 3IR9A 3RK3E 4AAOA 1AFOA 2W6AA 1NTMJ 3M9HA 2H43A 3SJLA 3JSVC 1LP1A 2BH5X 4WWIA 4ZKPA 2P58A 1KX2A 1RH5B 5TISH 5DJTB 3CWBG 1DVHA 1W5CT 2C1VA 3L4OA 1IFPA 4FB1A 3MHVA 2M8RA 5CIBB 3H1HJ 1P84D 1OVUA 3CXHE 1FZGA 5KLVD 3Q5PA 1BCCG 3ZOWA 1LWUA 1YFCA 3OW2O 4L3GA 5GTIV 1AV1A 3KQGA 1VQMP 2D2CD 4IL6E 3CCSP 2D0WA 4L3HA 1RF1B 1VQ5P 2CA4B 2O1KA 1SQBJ 1H9YA 2PACA 4WY4B 3AE5C 1YI2P 5CCHC 2Y0EA 4WY4C 4RESB 5APYA 1SQVJ 2QJYB 1M7LA 4AUWA 2C8SA 4EIJA 3H1JD 2QJYC 4PD4E 3MUDC 1OIPA 1GD2E 1BGYJ 2WSEH 3TSIA 3UIAA 5C9MA 1N7SB 1N8RQ 3H1JG 5CCGC 3WFEC 1N90A 5H2FE 1S2EA 1OW8A 2P7JA 1ZR2A 1DW1A 1BDDA 1NTKG 1A2SA 4JYCA 1SQPE 1FDMA 4EIDA 5KAFV 1FI7A 1VQPP 4WQBA 5APSA 1M6ZA 1IZL0 3WC8A 3P8CD 1SQBK 3TDKA 2GC4D 1H88A 4GOFA 3RK3B 1NTME 2KIKA 1JNMA 3RK3C 1SQVK 3GLMA 5AW9B 4W7YA 1KN7A 3CWBJ 3AE4C 2YMKA 5TISE 2POHA 2WITA 4H0LB 4HKZH 1GL2D 4MU8A 1E2RA 2E76C 3H1IE 2ITAA 3IN6A 4H0LC 1BCCJ 3HE5B 1CTYA 3H1HE 3M0DC 2YKQA 3ZOOA 3RN0A 1CRHA 3FWNA 2M5AA 2O1JA 1SQXD 2E74B 3DR0A 1AA0A 1NGMB 1BE3D 1P84H 1N7LA 3CCEP 4AQRD 451CA 3GMAA 1LT9C 4BWNA 3KZIV 1WVEC 1JUNA 3TNUB 1KILA 3P7KA 2V08A 1K04A 1LTAC 1NIRA 3RN1A 1TU3F 1SQXG 3PHLA 1BE3G 3QWOC 2HV4A 3CX5I 1LTBC 1S4XA 1N86A 2B87A 1URQA 1L9BC 4LLHA 1L0LK 4WQAA 1SQVE 2Q3EA 3L37A 2YKPA 4L74A 1HJ5A 1PL5A 2Z5HA 1GDVA 3HD7A 1HH0A 2RMZA 2Y9ZA 5KLIB 2Z4EA 1BGYE 4WQCA 3SWYA 2IZ0A 5KLIC 3CCMP 3OA8B 3H1JJ 3PJSK 5APQA 2Q3IA 2AEFA 2A06D 1EZVI 1I8PA 2FFDA 2CPSA 1NH4A 1H33B 4R4MA 1GMJA 4DCKA 4H0JA 1G2CA 2JWAA 2O01H 2O01J 3W68A 2A06G 3CC2P 3P8MC 2V07A 4EIEA 4M3LA 3S9OA 1C6RA 4RJTA 3TGUE 1X22A 3L73D 1CEDA 3O5CA 5KLVK 3K5BA 2FXMA 4GT1A 1ZR4A 1YJNP 4FANA 4BXLA 2L91A 2H88C 5EXQA 2KOGA 1OAEA 3WUIA 3L73G 4U7JA 1FHBA 2VHDA 2ZBOA 2JDIH 3V2RA 2OYHC 3CXHW 3G3ZA 3CWBE 1DEEG 1KZUB 1YEBA 3L70G 4NPDA 3H6PA 3CCQP 1LT1A 2WSFH 2WSFJ 1X79B 1BCCE 1WMKA 3NTNA 3B5ND 3CX5E 1AYGA 1L0NG 1LC1A 1QL1A 1VQLP 1SQXJ 1K73Q 2YO3A 1BE3J 1H32B 1DT1A 4AANA 2KZJA 2WSCH 3OJAB 2WSCJ 4IOIH 1OX3A 1PPJD 4GYDA 4N0KA 2E43A 4JYBA 2W6JH 3H25A 4IL6V 1EZVE 1L4AA 3AEBC 1BSNA 1HTLC 3VYMA 4ASWA 2JP3A 2QRXA 2IBZD 2KNCB 2ZONG 1S5LE 1KQLA 1PPJG 1KYOD 3NBSA 4LGDE 2GIWA 1VPCA 1T3JA 1JTHA 4JF7A 2XTSB 3H1JE 4IL6X 4ZMDA 3QH9A 5CBNA 3CI9A 2IBZG 5CMZA 4K3AA 2OZ1A 1T2KD 1YQ3C 1ZW0A 3SWSA 2OARA 1FDIA 3A0BH 1NTKE 2FXPA 2W6BA 3BVHA 5TJHA 2FYNB 2P67A 3HUSC 4PWAA 2GA1A 2FYNC 1LTJA 4QAOA 1DEBA 1H1OA 3AE7C 3KXDA 1SVFA 4DJGA 2LKMA 1H0TB 5H2FV 1COTA 3NFQA 3L73J 3RBXA 4PJ0H 2B11B 3AEEC 1RE3C 1FZCA 1QL4A 2QM8A 2CE0A 1JEKA 4Y5RA 5CBOA 1RE4C 4FA9A 2K88A 3L70J 2KSJA 2ZJSE 1JMBA 3G9RA 1YNRA 2ZZS1 1U7MA 2I1JA 1MUUA 2J5UA 3LIEA 5AVRB 2FRCA 1YCCA 1IFMA 1GW4A 1EC5A 1CYJA 2YNYA 1Y47A 1L0NJ 1OW6A 1RAPA 2NPSB 5TISV 1LS9A 3PXSA 2NPSC 2Q5UA 3WUUA 3H32B 1M60A 1HGZA 1KFNA 3L75E 5KAIH 1SQXE 1HH7A 1BE3E 1IFNA 2NZ2A 1FJPA 3RK2D 2YKOA 2N1TA 1KILD 1OWAA 3H1LE 2D2CC 1XTGB 3D6YA 3SSUA 1PGJA 2XNXA 1URQD 3DMIA 2PFXA 3O6QA 2YQBA 4HB1A 3A5TA 2KXPB 1PP9D 1NAYA 3HD7D 2OTKE 1MV8A 4EICA 1KYOH 5C0ZA 2ZYGA 2C2CA 4BRYA 5CIEB 1JY3P 1RY3A 1SFCB 1PP9G 1X0TA 4DZOA 2A06E 1SFCC 4B86A 1FZAA 1RF0C 1KORA 3A0BE 4Y28J 2QJPB 1CYCA 2WT7B 4XFJA 1QKSA 2QJPC 2JTIB 1MZ9A 2IPPA 1VQ4P 1JO5A 3L36A 1FBMA 2KLUA 3P32A 4FA5A 1OXZA 1R5LA 1FE6A 1AQ5A 3L73E 4C7RA 4PJ0E 4A7PA 1IRWA 2ZVNB 3GW6A 1NTZD 3GF3A 1BDCA 1E79H 2FKWB 3EWKA 1YICA 3A0HH 3AE8C 1ZV8A 3CX5W 4AALA 3L70E 4D6TD 1J1EC 3MP7B 5AVTB 1C2NA 1NTZG 2KSEA 1NNOA 1KC8Q 1CTJA 3AEFC 3WUVA 4PD4I 1YTZT 1JCDA 2DW3A 3NXSA 4I7ZB 1FOSF 2JKVA 1GU5A 3BRVB 1L0NE 1RF1A 2YCCA 1L0LD 1W2LA 2G8YA 4I7ZC 3SFDC 1KB9D 5BU8B 2CA3B 5CCHA 4WY4A 1DX7A 5IY51 5KJ7C 3SVWA 3F89A 3CPWO 3X39A 3PH2B 1LMSA 1DIIC 1L0LG 3MUDA 155CA 1K9MQ 3BASA 2HFED 1YJ9P 2DVHA 1L4AD 1PPJE 1SLQA 1FC2C 1G1IA 1EQ7A 4UB8H 1GK4A 2VRSA 1UIIA 1N7SA 1NMIA 3HQ8A 4L73A 1C6OA 1AJYA 1W2BO 4OGQB 4OWFA 2HPCB 4HH2A 4H44B 1PP9J 3W67A 1M8OB 2JQRA 1NHLA 1XTCC 3B5NA 4OGQC 1KYOE 4H44C 2FYUD 1PGPA 2HODB 1S5LV 5M1BA 4Y99C 3RL0B 1CI6B 1LNQA 1DD3A 4PV1D 3U59A 3RL0C 1YEAA 2JO1A 1KX7A 3Q1MA 1U7JA 2ZT9D 2C0WA 3OA7A 2ZYAA 2FYUG 1Y9BA 5B66H 5KLVG 2JEEA 3AEDC 1B7VA 1S5LX 1NYHA 3CCUP 2Q9IA 2N9YB 2D0SA 1DW3A 3WFCC 2HLOA 1YIJP 5DJUB 1OCDA 5CIFB 2WZ7A 2XU6A 3NWVA 2CK3H 2WPSA 3HTKB 2B12B 1BSHA 1FOSE 1NTZJ 3ABVC 1VQ7P 5KTBA 1Q82Q 1SQQD 4ASVA 3M0DA 1CHIA 3L35A 3HE5A 1FJ0A 2V4HA 1VF5B 2WPRA 1FI9A 1NVOA 1HZVA 1VF5C 2J59M 2CE1A 1SQQG 1VQNP 1IK9A 2ZYDA 3ZCFA 4TLFA 4WQEA 2P1JA 4KT0J 1CIGA 3Q2YA 4R4LA 4KHXA 3TK1A 1CNOA 1L0LJ 2NRGA 1KB9H 3V2PA 3SWFA 1FOCA 2O3JA 1LWUB 1JCCA 2K3RA 1DD4A 4V2KA 3O1YA 1LWUC 3I5CA 1FAVA 1J1DB 2N1TD 3BCCD 2FXOA 1J1DC 3VOPA 1VQ8P 1KILE 1M90Q 2IX7C 4UB8E 5CIHB 1IO3A 2E76B 2QM7A 2FY8A 5AW8B 2LXBA 1C52A 3BCCG 3L71D 4DOJA 1PP9E 1CW5A 2LXCB 1NTZK 2ZXEB 1FZBA 5APUA 1QVFO 4CPGA 1CTZA 1MZ4A 2W27A 1H89A 1LT9B 1U75B 2FYUJ 3L71G 2GC7D 5KLVJ 5AW7B 3KPEA 4Q5PA 2JWDA 1L2PA 1ZN5A 1HGVA 1SQBE 4QMAA 2Q7CA 1FZEA 2E5YA 3U1AA 1EB7A 2IYOA 1L9JC 3L4MA 1T2KC 5CYTR 1Z56A 5AVVB 3G71P 3IF4A 3A0BV 2KYVA 3HE4B 1P84I 3CCLP 1WEJF 3L74D 2P10A 1KV9A 3V2NA 3H1KD 1I6DA 4W80A 2KK7A 4OVNF 1I8OA 3Q3DA 1CRIA 2KUBA 3E1IA 4PJ0V 2BCCD 3F5HA 3V4QA 3L74G 3B71A 3VP9A 3LW5H 3LW5J 3M97X 1A02J 3H1KG 1JY2N 2B9BA 1SQQJ 2KS1A 3MK7B 2EXVA 2MHMA 4GIFA 1DH3A 2KZIA 2BCCG 3MK7C 4UB6H 3ZIYA 2I1KA 4NFGB 1DIPA 2WQYC 1A02F 2FYUK 1L0LE 3O20A 2C9XB 3VTPC 5CCHD 2M3BA 4N78D 1GTWA 4WY4D 3CC4P 1KB9E 1EDKA 3L4FA 1QN2A 2R3CA 4EOTA 1EDLA 3CYTI 2M5AB 3RL0g 3FX0A 2OYHB 2Z5IA 4U3FD 1CSBA 2KNCA 3M0AA 1IFDA 2R44A 3A2AA 1JM0A 1HWTC 3RGUA 4WBAA 5AW4B 2A45G 3BCCJ 4XA4A 3RK2C 1QX8A 2R3SA 1IC2A 1KILC 4U3FG 4C46A 1N7SD 2M3EA 1PZQA 1URQC 4H13B 3G4SP 2QEXP 3AE6C 3L71J 4H13C 1CCHA 3M9QA 3M06A 5APWA 3HD7C 2J58A 3FXDA 2PGDA 1P84E 2AIUA 2FYUE 3C1LA 1SQQK 4HYTB 4O1WA 5KLVE 2BEZF 3ITKA 1H8AA 3WFDC 1CHJA 2AEMA 2K9YA 2FFDC 1ZOYC 351CA 1RZ5A 1RE4A 1I55A 1PGOA 1QGKB 3RK3D 1VYDA 3CU4A 1T8ZA 4YE1A 2K9JB 2YO2A 3L74J 2E5TA 2C9LY 1N15A 3H1KJ 4H0LD 3VRDA 2BCCJ 3ORVA 4K35A 3SXTA 2JJLA 3HUSB 1S72P 3CXHD 1NKNA 2E74D 3PP5A 4UB6E 1W5CE 2B89A 3HQ9A 2OGUA 2BLFB 1CSUA 2QG4A 2N9BA 3SLEA 1LTTC 1A56A 1AOFA 4JCGA 1CXCA 2E75B 1C6SA 2E75C 2A45H 3P8CE 3EQ2A 4U3FJ 4KJMA 3WFBC 3BCCE 3CMAP 1C75A 2GUVA 2N3YA 2FYZA 3O8ZA 1L4AB 2GUSA 1AKKA 1IFJA 1N73A 5CJ0A 1L4AC 1NWQA 1HF9A 1NU1K 4UB8V 4WB4A 1CRGA 3L71E 1LC2A 4TT3H 3GHGA 3PXWA 4NPFX 1CHHA 1FU1A 2WT7A 2OYIA 1M56D 1HZUA 2B10B 1M1JA 2QE7H 1EXJA 1QVGO 5E79H 2W90A 2AXTH 5DJQB 2D2CB 2IZ1A 4HJGH 5DJQC 1KQFB 4KMGA 1AVOA 1N50A 4AYCA 3MGNA 1Q81Q 1VQ6P 2HYNA 1WT6A 3FXEA 1IK7A 3MIWA 1CXAA 3DP5A 1LTJC 2V7QJ 2WVRA 1DIQC 3AE2C 2XDJA 3L74E 1D7MA 1NMLA 4N6JA 4GODA 2R32A 3H1KE 3U1CA 1DW0A 1T3UA 1FZCB 2I8FA 1RAQA 3H1ID 3VMAA 1KIBA 1FZCC 2BCCE 3SFEC 5AW2B 4WQDA 3V2QA 1GK6A 5KJ7A 2LR2A 2IBZI 3H1IG 1KYOI 4YXWH 3O0RC 5APXA 3ZOXA 3HRNA 2C1DA 3OCDB 4WVZA 1HJ0A 1IRVA 1NOHA 4L75A 2C0XA 2BGVX 2GB8B 4N78E 2WWWA 2KP8A 1QL2A 4C7NB 5AVWB 1J1EB 4U3FE 3NMDA 1CRJA 3T97B 2HPCA 2JR8A 1F1FA 2GM4A 4J20A 1J2JB 2YXRB 5GTHH 2OYOA 3AE3C 3NBTA 2N1TC 2HODA 1CI6A 3O6QB 3L72D 4WQ7A 4D6TG 1S1CX 1ZXGA 1GL2B 3GG2A 1GL2C 2SPZA 1RQUA 3L72G 1KB0A 5KAIE 3TGUD 2RH0A 2AXTE 2YIUB 2YIUC 1RZ6A 1YIQA 2ORLA 2AI5A 1GJQA 3TGUG 2IDBA 1YBKA 4EDFA 3EFGA 1HCMA 5CCGA 3WU2H 1K3GA 1OMIA 5AVQB 1I5TA 2IBZE 5B5EH 2RKLA 3CWBD 4O9BA 2XNDH 4Y99B 3V6IA 1YYCA 1HROA 4YPCA 1VL2A 1VQOP 1U74B 1BCCD 3CL3D 1FS0E 2MKVA 4GKGA 3IFMA 1MG3D 3H1IJ 3TYIA 2NPSD 1AOQA 2P2UA 2KI7B 4O1QA 3CX5D 3I55P 1X8YA 1PFIA 1KFMA 5BVZA 1RHZB 2ZXYA 3E1RA 1GZLA 3II6A 3LIDA 1AVYA 4YXDC 1LGHB 1N2DC 1OVRA 2Y0CA 4RO0A 4UB6V
chains in the Genus database with same CATH topology
2L4DA 3H1KD 1I6DA 3HQ7A 3ZBMA 1EZVD 1SQBD 3RMZA 2OZ1A 1I8OA 1CRIA 4PJ0V 2BCCD 1I54A 3RLMA 1H31B 3SWSA 3M97X 1MG2D 1SQVD 1CSWA 1CIFA 2FYNB 5TJHA 1S6VB 2LIRA 4FA4A 2KS1A 4PWAA 3MK7B 2EXVA 2MHMA 4QAOA 1R0QA 1BGYD 1H1OA 3PRJA 3MK7C 5CIGB 3ZIYA 4H0KA 3PLNA 5CIDB 5H2FV 1COTA 5CICB 5DF5A 2MTAC 4NFGB 3TF5A 1LFMA 1FI3A 2N9IA 2PCBB 3O20A 2B11B 2C9XB 2BPBB 1QL4A 1NTKD 1QN2A 1H9XA 2Y0DA 2C1UA 3CYTI 2CE0A 4Y5RA 4FA9A 4U3FD 2CXBA 1YNRA 2ZZS1 1CC5A 5KKZB 2FRCA 4XXLA 1YCCA 3OA8A 1CYJA 5B6QA 3PTZA 1RAPA 5TISV 1LS9A 3VNWA 3PXSA 1JDLA 1HJ3A 1H33A 1H31A 1CCHA 1CSVA 4PW9B 3ZOYA 4XYDB 1M60A 1CSXA 1N9CA 2C1DB 2B0ZB 1YTCA 4AAOA 1HH7A 2AIUA 4O1WA 3SJLA 3ITKA 2BH5X 1DW2A 3WFDC 1CHJA 1GU2A 1GQ1A 1KX2A 3DMIA 3HQ6A 351CA 1CIEA 2YQBA 1DVHA 1W5CT 1RZ5A 2C1VA 3CP5A 1HRCA 1PP9D 3L4OA 4FB1A 1I55A 3L75D 4EICA 1VYDA 3CU4A 5CIBB 1IQCA 1P84D 4K3IA 5KLVD 4YE1A 3ZOWA 1CCRA 5C0ZA 2C2CA 1YFCA 2K9JB 5CIEB 4L3GA 5GTIV 3H1LD 2D0WA 1N15A 4L3HA 1NU1D 1J3SA 2CA4B 1H9YA 3VRDA 2PACA 1E29A 2QJPB 3ORVA 1CYCA 2Y0EA 4FA1A 3SXTA 1QKSA 2JTIB 3CXHD 2N9JA 2QJYB 3JBTB 2C8SA 3H1JD 3HQ9A 4WQ8A 4FA5A 2BLFB 1BL9A 1CSUA 2QG4A 4A7PA 1IRWA 3SLEA 3GW6A 1H32A 1NTZD 1A56A 1I6EA 1YICA 1AOFA 4JCGA 1CXCA 5C9MA 3CX5W 4AALA 3KHUA 1C6SA 4D6TD 2DGEA 1CRYA 1C2NA 3WFEC 1NNOA 1N90A 1CTJA 1KYOW 1ZZHA 2YK3A 3WFBC 1DW1A 2N18B 1C75A 1CYIA 5KAIV 2N3YA 2N18C 1A2SA 5E79V 1AKKA 2AXTV 2YCCA 1L0LD 1W2LA 3FWLA 4EIDA 5KAFV 1FI7A 1KB9D 4WQBA 4UB8V 3L70D 1CRGA 1M6ZA 1IZL0 2CA3B 3WC8A 1LC2A 3PXWA 5IY51 3TDKA 1CHHA 3SVWA 2GC4D 1CIHA 3X39A 3PH2B 1LMSA 5AURA 1DIIC 1CRCA 1HZUA 2B10B 155CA 2RN0A 1C2RA 4LJIA 4RSZA 2BCNB 1L0ND 5DJQB 2DVHA 1ZRTD 5DJQC 4MU8A 1E2RA 4KMGA 4AX3A 1N50A 1NMIA 3HQ8A 1C6OA 1CTYA 3ZOOA 2JQRA 3RN0A 1CXAA 1F1CA 3DP5A 1CRHA 1DIQC 1SQXD 3DR0A 1BE3D 2FYUD 1NMLA 1S5LV 3PXTA 451CA 3KZIV 1DW0A 1WVEC 1YEAA 2I8FA 1RAQA 1KX7A 3H1ID 4DY9A 3VMAA 1KIBA 2V08A 1NIRA 3RN1A 3PHLA 2HV4A 4FAVA 1L9BC 4WQDA 4WQAA 3A0HV 2Q3EA 1B7VA 4WQ9A 1HJ5A 1GDVA 2N9YB 2D0SA 1DW3A 3WFCC 2RMZA 5KLIB 3O0RC 2QJKB 4WQCA 3ZOXA 1OCDA 5GTHV 2C1DA 3OA8B 3OCDB 1FCDC 5CIFB 3NWVA 2A06D 1IRVA 3A9FA 2LITA 2B12B 1I8PA 2BGVX 1H33B 2GB8B 5DFSA 1C7MA 4H0JA 1SQQD 2JWAA 1CHIA 1FJ0A 1CRJA 2PCCB 1F1FA 2V07A 4J20A 4EIEA 1FI9A 4PD4D 1HJ4A 1C6RA 4RJTA 1HZVA 3NBTA 3L73D 2CE1A 1CEDA 3O5CA 3ZCFA 3L72D 4WQ7A 1A8CA 4WQEA 1CIGA 1CNOA 4P4QB 4FANA 2L91A 3GG2A 4EIFA 1QL3A 5EXQA 1CO6A 4AAMA 4GEDB 1OAEA 3WUIA 1FOCA 1FHBA 2O3JA 2VHDA 2ZBOA 2BH4X 3WU2V 4V2KA 4L1QA 1KB0A 3CXHW 3O1YA 3TGUD 5B5EV 1GIWA 1QYZA 3BCCD 2N3BA 1YEBA 2YIUB 3C2CA 2OZ1B 3OCDA 1CORA 1RZ6A 1SQPD 1YIQA 5CIHB 1IO3A 2ORLA 2AI5A 1GJQA 1DVVA 1C52A 3L71D 4EDFA 1HCMA 1K3GA 1I5TA 1AYGA 5B66V 2ZOOA 2B4ZA 1LC1A 1CTZA 1MZ4A 1NTMD 3CWBD 1E8EA 1U75B 1H32B 2GC7D 1DT1A 4AANA 1HROA 4Q5PA 1PPJD 4GYDA 4N0KA 1U74B 1BCCD 4IL6V 1MG3D 3TYIA 1AOQA 4O1QA 2FWLA 3CX5D 1M70A 1EB7A 1L9JC 3L4MA 1ETPA 5CYTR 3VYMA 2IBZD 3H1HD 2KNCB 2ZXYA 2ZONG 3A0BV 1GKSA 1KYOD 3NBSA 1WEJF 2GIWA 3L74D 1K3HA 2XTSB 2Y0CA 1KV9A 4UB6V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4D A;  3H1K D;  1I6D A;  3HQ7 A;  3ZBM A;  1EZV D;  1SQB D;  3RMZ A;  2OZ1 A;  1I8O A;  1CRI A;  4PJ0 V;  2BCC D;  1I54 A;  3RLM A;  1H31 B;  3SWS A;  3M97 X;  1MG2 D;  1SQV D;  1CSW A;  1CIF A;  2FYN B;  5TJH A;  1S6V B;  2LIR A;  4FA4 A;  2KS1 A;  4PWA A;  3MK7 B;  2EXV A;  2MHM A;  4QAO A;  1R0Q A;  1BGY D;  1H1O A;  3PRJ A;  3MK7 C;  5CIG B;  3ZIY A;  4H0K A;  3PLN A;  5CID B;  5H2F V;  1COT A;  5CIC B;  5DF5 A;  2MTA C;  4NFG B;  3TF5 A;  1LFM A;  1FI3 A;  2N9I A;  2PCB B;  3O20 A;  2B11 B;  2C9X B;  2BPB B;  1QL4 A;  1NTK D;  1QN2 A;  1H9X A;  2Y0D A;  2C1U A;  3CYT I;  2CE0 A;  4Y5R A;  4FA9 A;  4U3F D;  2CXB A;  1YNR A;  2ZZS 1;  1CC5 A;  5KKZ B;  2FRC A;  4XXL A;  1YCC A;  3OA8 A;  1CYJ A;  5B6Q A;  3PTZ A;  1RAP A;  5TIS V;  1LS9 A;  3VNW A;  3PXS A;  1JDL A;  1HJ3 A;  1H33 A;  1H31 A;  1CCH A;  1CSV A;  4PW9 B;  3ZOY A;  4XYD B;  1M60 A;  1CSX A;  1N9C A;  2C1D B;  2B0Z B;  1YTC A;  4AAO A;  1HH7 A;  2AIU A;  4O1W A;  3SJL A;  3ITK A;  2BH5 X;  1DW2 A;  3WFD C;  1CHJ A;  1GU2 A;  1GQ1 A;  1KX2 A;  3DMI A;  3HQ6 A;  351C A;  1CIE A;  2YQB A;  1DVH A;  1W5C T;  1RZ5 A;  2C1V A;  3CP5 A;  1HRC A;  1PP9 D;  3L4O A;  4FB1 A;  1I55 A;  3L75 D;  4EIC A;  1VYD A;  3CU4 A;  5CIB B;  1IQC A;  1P84 D;  4K3I A;  5KLV D;  4YE1 A;  3ZOW A;  1CCR A;  5C0Z A;  2C2C A;  1YFC A;  2K9J B;  5CIE B;  4L3G A;  5GTI V;  3H1L D;  2D0W A;  1N15 A;  4L3H A;  1NU1 D;  1J3S A;  2CA4 B;  1H9Y A;  3VRD A;  2PAC A;  1E29 A;  2QJP B;  3ORV A;  1CYC A;  2Y0E A;  4FA1 A;  3SXT A;  1QKS A;  2JTI B;  3CXH D;  2N9J A;  2QJY B;  3JBT B;  2C8S A;  3H1J D;  3HQ9 A;  4WQ8 A;  4FA5 A;  2BLF B;  1BL9 A;  1CSU A;  2QG4 A;  4A7P A;  1IRW A;  3SLE A;  3GW6 A;  1H32 A;  1NTZ D;  1A56 A;  1I6E A;  1YIC A;  1AOF A;  4JCG A;  1CXC A;  5C9M A;  3CX5 W;  4AAL A;  3KHU A;  1C6S A;  4D6T D;  2DGE A;  1CRY A;  1C2N A;  3WFE C;  1NNO A;  1N90 A;  1CTJ A;  1KYO W;  1ZZH A;  2YK3 A;  3WFB C;  1DW1 A;  2N18 B;  1C75 A;  1CYI A;  5KAI V;  2N3Y A;  2N18 C;  1A2S A;  5E79 V;  1AKK A;  2AXT V;  2YCC A;  1L0L D;  1W2L A;  3FWL A;  4EID A;  5KAF V;  1FI7 A;  1KB9 D;  4WQB A;  4UB8 V;  3L70 D;  1CRG A;  1M6Z A;  1IZL 0;  2CA3 B;  3WC8 A;  1LC2 A;  3PXW A;  5IY5 1;  3TDK A;  1CHH A;  3SVW A;  2GC4 D;  1CIH A;  3X39 A;  3PH2 B;  1LMS A;  5AUR A;  1DII C;  1CRC A;  1HZU A;  2B10 B;  155C A;  2RN0 A;  1C2R A;  4LJI A;  4RSZ A;  2BCN B;  1L0N D;  5DJQ B;  2DVH A;  1ZRT D;  5DJQ C;  4MU8 A;  1E2R A;  4KMG A;  4AX3 A;  1N50 A;  1NMI A;  3HQ8 A;  1C6O A;  1CTY A;  3ZOO A;  2JQR A;  3RN0 A;  1CXA A;  1F1C A;  3DP5 A;  1CRH A;  1DIQ C;  1SQX D;  3DR0 A;  1BE3 D;  2FYU D;  1NML A;  1S5L V;  3PXT A;  451C A;  3KZI V;  1DW0 A;  1WVE C;  1YEA A;  2I8F A;  1RAQ A;  1KX7 A;  3H1I D;  4DY9 A;  3VMA A;  1KIB A;  2V08 A;  1NIR A;  3RN1 A;  3PHL A;  2HV4 A;  4FAV A;  1L9B C;  4WQD A;  4WQA A;  3A0H V;  2Q3E A;  1B7V A;  4WQ9 A;  1HJ5 A;  1GDV A;  2N9Y B;  2D0S A;  1DW3 A;  3WFC C;  2RMZ A;  5KLI B;  3O0R C;  2QJK B;  4WQC A;  3ZOX A;  1OCD A;  5GTH V;  2C1D A;  3OA8 B;  3OCD B;  1FCD C;  5CIF B;  3NWV A;  2A06 D;  1IRV A;  3A9F A;  2LIT A;  2B12 B;  1I8P A;  2BGV X;  1H33 B;  2GB8 B;  5DFS A;  1C7M A;  4H0J A;  1SQQ D;  2JWA A;  1CHI A;  1FJ0 A;  1CRJ A;  2PCC B;  1F1F A;  2V07 A;  4J20 A;  4EIE A;  1FI9 A;  4PD4 D;  1HJ4 A;  1C6R A;  4RJT A;  1HZV A;  3NBT A;  3L73 D;  2CE1 A;  1CED A;  3O5C A;  3ZCF A;  3L72 D;  4WQ7 A;  1A8C A;  4WQE A;  1CIG A;  1CNO A;  4P4Q B;  4FAN A;  2L91 A;  3GG2 A;  4EIF A;  1QL3 A;  5EXQ A;  1CO6 A;  4AAM A;  4GED B;  1OAE A;  3WUI A;  1FOC A;  1FHB A;  2O3J A;  2VHD A;  2ZBO A;  2BH4 X;  3WU2 V;  4V2K A;  4L1Q A;  1KB0 A;  3CXH W;  3O1Y A;  3TGU D;  5B5E V;  1GIW A;  1QYZ A;  3BCC D;  2N3B A;  1YEB A;  2YIU B;  3C2C A;  2OZ1 B;  3OCD A;  1COR A;  1RZ6 A;  1SQP D;  1YIQ A;  5CIH B;  1IO3 A;  2ORL A;  2AI5 A;  1GJQ A;  1DVV A;  1C52 A;  3L71 D;  4EDF A;  1HCM A;  1K3G A;  1I5T A;  1AYG A;  5B66 V;  2ZOO A;  2B4Z A;  1LC1 A;  1CTZ A;  1MZ4 A;  1NTM D;  3CWB D;  1E8E A;  1U75 B;  1H32 B;  2GC7 D;  1DT1 A;  4AAN A;  1HRO A;  4Q5P A;  1PPJ D;  4GYD A;  4N0K A;  1U74 B;  1BCC D;  4IL6 V;  1MG3 D;  3TYI A;  1AOQ A;  4O1Q A;  2FWL A;  3CX5 D;  1M70 A;  1EB7 A;  1L9J C;  3L4M A;  1ETP A;  5CYT R;  3VYM A;  2IBZ D;  3H1H D;  2KNC B;  2ZXY A;  2ZON G;  3A0B V;  1GKS A;  1KYO D;  3NBS A;  1WEJ F;  2GIW A;  3L74 D;  1K3H A;  2XTS B;  2Y0C A;  1KV9 A;  4UB6 V; 
#chains in the Genus database with same CATH topology
 2L4D A;  1KTM A;  1Q86 Q;  3ZBM A;  4I1L A;  1RF1 C;  1EZV D;  3AE9 C;  3BAT A;  2QSI A;  3V5B A;  3A0H E;  3A3Y B;  3AE1 C;  1HBW A;  3RLM A;  5AVS B;  3TYY A;  1SQP K;  1H31 B;  1YHQ P;  2XV5 A;  1CIF A;  2G3A A;  1KQS O;  2LIR A;  4FA4 A;  1NO4 A;  4JQ0 D;  5GTH E;  1EZV G;  1YJW P;  4D6T J;  3PRJ A;  5CIG B;  1LP1 B;  2WSE J;  1SFC D;  1GU4 A;  1ZLL A;  1NTM K;  5CID B;  1LT9 A;  5CIC B;  2WMM A;  2IFM A;  3G6E P;  3TF5 A;  1FI3 A;  1QEX A;  2PCB B;  3L72 J;  2IFN A;  2AEJ A;  2K1A A;  2XZR A;  2BPB B;  1N7S C;  1NTK D;  3TNU A;  3B5N B;  3PH0 A;  2FBW C;  1ZME C;  2QA4 P;  3B5N C;  3HE4 A;  2CXB A;  1K05 A;  2WPQ A;  1HUC A;  3TGU J;  3I56 P;  5C39 A;  3D0W A;  4ZKU A;  5KKZ B;  1U57 A;  1X9V A;  2HG5 D;  3OA8 A;  5KKZ C;  5L8R J;  1KB9 I;  3WU2 E;  3N4X A;  4XE5 B;  1HJ3 A;  1H33 A;  5B5E E;  4PW9 B;  1NKZ B;  3ZOY A;  4XYD B;  2XKM A;  1CSX A;  1N9C A;  2B0Z B;  1YTC A;  5AVX B;  1JY3 N;  1JMM A;  1DW2 A;  1JY3 O;  1GU2 A;  1GQ1 A;  1OW7 A;  3E7K A;  3HQ6 A;  5BU5 A;  5KJ7 D;  1CIE A;  4DT0 A;  5B66 E;  3CP5 A;  1HRC A;  3CX5 H;  3WMM 0;  2WSS H;  3L75 D;  3V4W A;  1OZH A;  1IQC A;  2OYH A;  1K8A Q;  3MZW B;  4K3I A;  4I6M C;  2E74 C;  1CCR A;  3H1L D;  3CCV P;  2WPV B;  1NU1 D;  1CZQ A;  1YTZ I;  3L75 G;  1J3S A;  5CHX A;  3CC7 P;  1NTZ E;  1NAF A;  3BRT B;  1LJ2 A;  1EDI A;  1S9K D;  1E29 A;  2K37 A;  4OGQ D;  1GW3 A;  3H1L G;  4H44 D;  4FA1 A;  2O01 N;  1S5L H;  1NU1 G;  4D6T E;  2N9J A;  2HR3 A;  1PIX A;  3CCR P;  3OAK A;  3JBT B;  1FJK A;  5GTI H;  4WQ8 A;  3FGA D;  1JY2 O;  3RL0 D;  3S4R A;  1BL9 A;  2KLV A;  1EDJ A;  3L72 E;  1H32 A;  2ZFC A;  2KB7 P;  1OFC X;  3WUT A;  1I6E A;  1IZN B;  1IO4 A;  2E42 A;  1Q7Y Q;  3KHU A;  1NTK J;  2DGE A;  1OVV A;  1CRY A;  1W2E A;  2PAJ A;  1KYO W;  1M1K Q;  5AW6 B;  1ZZH A;  2YK3 A;  3CD6 P;  2N18 B;  2BAS A;  1CYI A;  5KAI V;  5APV A;  2K9J A;  3RK2 B;  2N18 C;  5E79 V;  1KIL B;  2AXT V;  2QIW A;  3FWL A;  2B87 B;  1URQ B;  5CCG D;  1HVV A;  3L70 D;  2I8D A;  3AEC C;  1SS1 A;  5EFW B;  3D71 A;  4IFM A;  3HD7 B;  2IYP A;  1CIH A;  5AUR A;  3HUS A;  1VF5 D;  1CRC A;  4IFD K;  2YXQ B;  3CME P;  2RN0 A;  1C2R A;  4LJI A;  4RSZ A;  2R5D A;  2BCN B;  1L0N D;  2FFD B;  1ZRT D;  5KAF H;  1H0T A;  4AX3 A;  3VMY A;  1G2C B;  1RE3 A;  3USS A;  4I2L C;  1RQV A;  2KS1 B;  4YTP C;  3M91 A;  2W8Z A;  2MJZ A;  1F1C A;  1NTK K;  3L75 J;  3PXT A;  3CLQ A;  3ZDM A;  4GOE A;  3SWK A;  1FDO A;  3JCU H;  3H1L J;  2E76 D;  4DY9 A;  1NU1 J;  2R5B A;  1PV3 A;  4FAV A;  3C8V A;  4GDO A;  1R8E A;  3A0H V;  4WQ9 A;  2AXC A;  3D70 A;  1SQQ E;  2NPS A;  1NJI Q;  1Q2N A;  5GTI E;  5AW5 B;  3AEA C;  2QJK B;  5K5G B;  3H32 A;  3CCJ P;  5GTH V;  3KZI H;  2QJK C;  1FCD C;  2H8P D;  2OQQ A;  1QLE D;  3MTU E;  1IJD B;  1USE A;  4JPZ B;  3A9F A;  2LIT A;  3EFF K;  1ZP0 C;  5DFS A;  1KQG B;  1C7M A;  2B88 A;  1KD1 Q;  2M0B A;  1FZF A;  2Q1K A;  1VDF A;  5AVY B;  2PCC B;  2H7H A;  4PD4 D;  1HJ4 A;  1MFT A;  3D6Z A;  1MFZ A;  1JB0 J;  1MKM A;  1SQX K;  1UIX A;  3S1K A;  3VN0 A;  2YMY A;  5AW0 B;  1SFC A;  1A8C A;  1VQK P;  1RF0 A;  4P4Q B;  4EIF A;  1QL3 A;  1CO6 A;  4AAM A;  5AVZ B;  4GED B;  2A45 I;  1Y8A A;  4EYY Q;  2BH4 X;  3WU2 V;  4MN4 C;  1KV4 A;  1JTH B;  4L1Q A;  5B5E V;  1GIW A;  1QYZ A;  1YIT P;  1LTS C;  1M57 D;  3KYQ A;  2N3B A;  4JBZ A;  3VMX A;  1VQ9 P;  1G1J A;  5KAF E;  3C2C A;  2OZ1 B;  3OCD A;  1COR A;  4PV1 B;  1SQP D;  2L5G B;  2PP6 A;  2ZT9 B;  4PV1 C;  2Q6Q A;  1DVV A;  2ZT9 C;  1HJB A;  3B4S A;  1S3J A;  4C7N A;  3B8E B;  2OTL P;  2W83 C;  1LTJ B;  5B66 V;  3RBZ A;  2ZOO A;  2B4Z A;  1SQP G;  1PGQ A;  1NTM D;  4EI2 A;  3T97 A;  5AW1 B;  2V7Q H;  1IFI A;  4LC1 A;  1E8E A;  2C9N Y;  3A7O A;  1T6A A;  3JCU E;  1GDT A;  1NU1 E;  1LTG C;  2PRR A;  3AEG C;  1NTM G;  2WTY A;  4H13 D;  4Z1M H;  2FWL A;  1R5S A;  1M70 A;  1GL2 A;  3VMZ A;  3M9B A;  1S9K E;  1ETP A;  2H89 C;  2Y9Y A;  3H1H D;  1GKS A;  2OTJ P;  4W7Z A;  3KZI E;  1K3H A;  4N3Y B;  1EXI A;  3CXH H;  3R4Y A;  5CJ4 A;  2UWJ E;  2ZAE B;  1N73 B;  1Q90 D;  3HQ7 A;  3H1H G;  3KDP B;  4NPE A;  4IL6 H;  1N73 C;  1SQB D;  3RMZ A;  1YQ4 C;  3VP8 A;  1SP4 A;  3GHG B;  2CPB A;  1I54 A;  1E5W A;  4IFF A;  1L0N K;  2ZXX A;  3GHG C;  4ZNC A;  2OYI B;  1MG2 D;  1SQV D;  1CSW A;  5AW3 B;  1JOC A;  5AVU B;  1S6V B;  1M1J B;  2OYI C;  3CXH I;  1SQB G;  1AQT A;  4RKU J;  1M1J C;  1R0Q A;  1BGY D;  3JC2 2;  2N1T B;  4H0K A;  4PD4 H;  3PLN A;  5DF5 A;  1SQV G;  2BEQ D;  2MTA C;  2ZVO B;  1LFM A;  2N9I A;  1BGY G;  1H9X A;  2Y0D A;  2C1U A;  3MD0 A;  1LTI C;  1USD A;  1KMI Z;  1WRG A;  1JY2 P;  4OH8 B;  3IAO A;  4BRY B;  2QVA A;  3N7N A;  4L76 A;  5H2F H;  5E79 E;  1CC5 A;  3Q5S A;  4XXL A;  1ZRT E;  3VYI A;  3Q5R A;  1SQP J;  2E75 D;  5B6Q A;  3C9I A;  3HTK A;  3PTZ A;  3VNW A;  3R2P A;  1JDL A;  3GF7 A;  1H31 A;  5APT A;  1CSV A;  2C1D B;  3IR9 A;  3RK3 E;  4AAO A;  1AFO A;  2W6A A;  1NTM J;  3M9H A;  2H43 A;  3SJL A;  3JSV C;  1LP1 A;  2BH5 X;  4WWI A;  4ZKP A;  2P58 A;  1KX2 A;  1RH5 B;  5TIS H;  5DJT B;  3CWB G;  1DVH A;  1W5C T;  2C1V A;  3L4O A;  1IFP A;  4FB1 A;  3MHV A;  2M8R A;  5CIB B;  3H1H J;  1P84 D;  1OVU A;  3CXH E;  1FZG A;  5KLV D;  3Q5P A;  1BCC G;  3ZOW A;  1LWU A;  1YFC A;  3OW2 O;  4L3G A;  5GTI V;  1AV1 A;  3KQG A;  1VQM P;  2D2C D;  4IL6 E;  3CCS P;  2D0W A;  4L3H A;  1RF1 B;  1VQ5 P;  2CA4 B;  2O1K A;  1SQB J;  1H9Y A;  2PAC A;  4WY4 B;  3AE5 C;  1YI2 P;  5CCH C;  2Y0E A;  4WY4 C;  4RES B;  5APY A;  1SQV J;  2QJY B;  1M7L A;  4AUW A;  2C8S A;  4EIJ A;  3H1J D;  2QJY C;  4PD4 E;  3MUD C;  1OIP A;  1GD2 E;  1BGY J;  2WSE H;  3TSI A;  3UIA A;  5C9M A;  1N7S B;  1N8R Q;  3H1J G;  5CCG C;  3WFE C;  1N90 A;  5H2F E;  1S2E A;  1OW8 A;  2P7J A;  1ZR2 A;  1DW1 A;  1BDD A;  1NTK G;  1A2S A;  4JYC A;  1SQP E;  1FDM A;  4EID A;  5KAF V;  1FI7 A;  1VQP P;  4WQB A;  5APS A;  1M6Z A;  1IZL 0;  3WC8 A;  3P8C D;  1SQB K;  3TDK A;  2GC4 D;  1H88 A;  4GOF A;  3RK3 B;  1NTM E;  2KIK A;  1JNM A;  3RK3 C;  1SQV K;  3GLM A;  5AW9 B;  4W7Y A;  1KN7 A;  3CWB J;  3AE4 C;  2YMK A;  5TIS E;  2POH A;  2WIT A;  4H0L B;  4HKZ H;  1GL2 D;  4MU8 A;  1E2R A;  2E76 C;  3H1I E;  2ITA A;  3IN6 A;  4H0L C;  1BCC J;  3HE5 B;  1CTY A;  3H1H E;  3M0D C;  2YKQ A;  3ZOO A;  3RN0 A;  1CRH A;  3FWN A;  2M5A A;  2O1J A;  1SQX D;  2E74 B;  3DR0 A;  1AA0 A;  1NGM B;  1BE3 D;  1P84 H;  1N7L A;  3CCE P;  4AQR D;  451C A;  3GMA A;  1LT9 C;  4BWN A;  3KZI V;  1WVE C;  1JUN A;  3TNU B;  1KIL A;  3P7K A;  2V08 A;  1K04 A;  1LTA C;  1NIR A;  3RN1 A;  1TU3 F;  1SQX G;  3PHL A;  1BE3 G;  3QWO C;  2HV4 A;  3CX5 I;  1LTB C;  1S4X A;  1N86 A;  2B87 A;  1URQ A;  1L9B C;  4LLH A;  1L0L K;  4WQA A;  1SQV E;  2Q3E A;  3L37 A;  2YKP A;  4L74 A;  1HJ5 A;  1PL5 A;  2Z5H A;  1GDV A;  3HD7 A;  1HH0 A;  2RMZ A;  2Y9Z A;  5KLI B;  2Z4E A;  1BGY E;  4WQC A;  3SWY A;  2IZ0 A;  5KLI C;  3CCM P;  3OA8 B;  3H1J J;  3PJS K;  5APQ A;  2Q3I A;  2AEF A;  2A06 D;  1EZV I;  1I8P A;  2FFD A;  2CPS A;  1NH4 A;  1H33 B;  4R4M A;  1GMJ A;  4DCK A;  4H0J A;  1G2C A;  2JWA A;  2O01 H;  2O01 J;  3W68 A;  2A06 G;  3CC2 P;  3P8M C;  2V07 A;  4EIE A;  4M3L A;  3S9O A;  1C6R A;  4RJT A;  3TGU E;  1X22 A;  3L73 D;  1CED A;  3O5C A;  5KLV K;  3K5B A;  2FXM A;  4GT1 A;  1ZR4 A;  1YJN P;  4FAN A;  4BXL A;  2L91 A;  2H88 C;  5EXQ A;  2KOG A;  1OAE A;  3WUI A;  3L73 G;  4U7J A;  1FHB A;  2VHD A;  2ZBO A;  2JDI H;  3V2R A;  2OYH C;  3CXH W;  3G3Z A;  3CWB E;  1DEE G;  1KZU B;  1YEB A;  3L70 G;  4NPD A;  3H6P A;  3CCQ P;  1LT1 A;  2WSF H;  2WSF J;  1X79 B;  1BCC E;  1WMK A;  3NTN A;  3B5N D;  3CX5 E;  1AYG A;  1L0N G;  1LC1 A;  1QL1 A;  1VQL P;  1SQX J;  1K73 Q;  2YO3 A;  1BE3 J;  1H32 B;  1DT1 A;  4AAN A;  2KZJ A;  2WSC H;  3OJA B;  2WSC J;  4IOI H;  1OX3 A;  1PPJ D;  4GYD A;  4N0K A;  2E43 A;  4JYB A;  2W6J H;  3H25 A;  4IL6 V;  1EZV E;  1L4A A;  3AEB C;  1BSN A;  1HTL C;  3VYM A;  4ASW A;  2JP3 A;  2QRX A;  2IBZ D;  2KNC B;  2ZON G;  1S5L E;  1KQL A;  1PPJ G;  1KYO D;  3NBS A;  4LGD E;  2GIW A;  1VPC A;  1T3J A;  1JTH A;  4JF7 A;  2XTS B;  3H1J E;  4IL6 X;  4ZMD A;  3QH9 A;  5CBN A;  3CI9 A;  2IBZ G;  5CMZ A;  4K3A A;  2OZ1 A;  1T2K D;  1YQ3 C;  1ZW0 A;  3SWS A;  2OAR A;  1FDI A;  3A0B H;  1NTK E;  2FXP A;  2W6B A;  3BVH A;  5TJH A;  2FYN B;  2P67 A;  3HUS C;  4PWA A;  2GA1 A;  2FYN C;  1LTJ A;  4QAO A;  1DEB A;  1H1O A;  3AE7 C;  3KXD A;  1SVF A;  4DJG A;  2LKM A;  1H0T B;  5H2F V;  1COT A;  3NFQ A;  3L73 J;  3RBX A;  4PJ0 H;  2B11 B;  3AEE C;  1RE3 C;  1FZC A;  1QL4 A;  2QM8 A;  2CE0 A;  1JEK A;  4Y5R A;  5CBO A;  1RE4 C;  4FA9 A;  2K88 A;  3L70 J;  2KSJ A;  2ZJS E;  1JMB A;  3G9R A;  1YNR A;  2ZZS 1;  1U7M A;  2I1J A;  1MUU A;  2J5U A;  3LIE A;  5AVR B;  2FRC A;  1YCC A;  1IFM A;  1GW4 A;  1EC5 A;  1CYJ A;  2YNY A;  1Y47 A;  1L0N J;  1OW6 A;  1RAP A;  2NPS B;  5TIS V;  1LS9 A;  3PXS A;  2NPS C;  2Q5U A;  3WUU A;  3H32 B;  1M60 A;  1HGZ A;  1KFN A;  3L75 E;  5KAI H;  1SQX E;  1HH7 A;  1BE3 E;  1IFN A;  2NZ2 A;  1FJP A;  3RK2 D;  2YKO A;  2N1T A;  1KIL D;  1OWA A;  3H1L E;  2D2C C;  1XTG B;  3D6Y A;  3SSU A;  1PGJ A;  2XNX A;  1URQ D;  3DMI A;  2PFX A;  3O6Q A;  2YQB A;  4HB1 A;  3A5T A;  2KXP B;  1PP9 D;  1NAY A;  3HD7 D;  2OTK E;  1MV8 A;  4EIC A;  1KYO H;  5C0Z A;  2ZYG A;  2C2C A;  4BRY A;  5CIE B;  1JY3 P;  1RY3 A;  1SFC B;  1PP9 G;  1X0T A;  4DZO A;  2A06 E;  1SFC C;  4B86 A;  1FZA A;  1RF0 C;  1KOR A;  3A0B E;  4Y28 J;  2QJP B;  1CYC A;  2WT7 B;  4XFJ A;  1QKS A;  2QJP C;  2JTI B;  1MZ9 A;  2IPP A;  1VQ4 P;  1JO5 A;  3L36 A;  1FBM A;  2KLU A;  3P32 A;  4FA5 A;  1OXZ A;  1R5L A;  1FE6 A;  1AQ5 A;  3L73 E;  4C7R A;  4PJ0 E;  4A7P A;  1IRW A;  2ZVN B;  3GW6 A;  1NTZ D;  3GF3 A;  1BDC A;  1E79 H;  2FKW B;  3EWK A;  1YIC A;  3A0H H;  3AE8 C;  1ZV8 A;  3CX5 W;  4AAL A;  3L70 E;  4D6T D;  1J1E C;  3MP7 B;  5AVT B;  1C2N A;  1NTZ G;  2KSE A;  1NNO A;  1KC8 Q;  1CTJ A;  3AEF C;  3WUV A;  4PD4 I;  1YTZ T;  1JCD A;  2DW3 A;  3NXS A;  4I7Z B;  1FOS F;  2JKV A;  1GU5 A;  3BRV B;  1L0N E;  1RF1 A;  2YCC A;  1L0L D;  1W2L A;  2G8Y A;  4I7Z C;  3SFD C;  1KB9 D;  5BU8 B;  2CA3 B;  5CCH A;  4WY4 A;  1DX7 A;  5IY5 1;  5KJ7 C;  3SVW A;  3F89 A;  3CPW O;  3X39 A;  3PH2 B;  1LMS A;  1DII C;  1L0L G;  3MUD A;  155C A;  1K9M Q;  3BAS A;  2HFE D;  1YJ9 P;  2DVH A;  1L4A D;  1PPJ E;  1SLQ A;  1FC2 C;  1G1I A;  1EQ7 A;  4UB8 H;  1GK4 A;  2VRS A;  1UII A;  1N7S A;  1NMI A;  3HQ8 A;  4L73 A;  1C6O A;  1AJY A;  1W2B O;  4OGQ B;  4OWF A;  2HPC B;  4HH2 A;  4H44 B;  1PP9 J;  3W67 A;  1M8O B;  2JQR A;  1NHL A;  1XTC C;  3B5N A;  4OGQ C;  1KYO E;  4H44 C;  2FYU D;  1PGP A;  2HOD B;  1S5L V;  5M1B A;  4Y99 C;  3RL0 B;  1CI6 B;  1LNQ A;  1DD3 A;  4PV1 D;  3U59 A;  3RL0 C;  1YEA A;  2JO1 A;  1KX7 A;  3Q1M A;  1U7J A;  2ZT9 D;  2C0W A;  3OA7 A;  2ZYA A;  2FYU G;  1Y9B A;  5B66 H;  5KLV G;  2JEE A;  3AED C;  1B7V A;  1S5L X;  1NYH A;  3CCU P;  2Q9I A;  2N9Y B;  2D0S A;  1DW3 A;  3WFC C;  2HLO A;  1YIJ P;  5DJU B;  1OCD A;  5CIF B;  2WZ7 A;  2XU6 A;  3NWV A;  2CK3 H;  2WPS A;  3HTK B;  2B12 B;  1BSH A;  1FOS E;  1NTZ J;  3ABV C;  1VQ7 P;  5KTB A;  1Q82 Q;  1SQQ D;  4ASV A;  3M0D A;  1CHI A;  3L35 A;  3HE5 A;  1FJ0 A;  2V4H A;  1VF5 B;  2WPR A;  1FI9 A;  1NVO A;  1HZV A;  1VF5 C;  2J59 M;  2CE1 A;  1SQQ G;  1VQN P;  1IK9 A;  2ZYD A;  3ZCF A;  4TLF A;  4WQE A;  2P1J A;  4KT0 J;  1CIG A;  3Q2Y A;  4R4L A;  4KHX A;  3TK1 A;  1CNO A;  1L0L J;  2NRG A;  1KB9 H;  3V2P A;  3SWF A;  1FOC A;  2O3J A;  1LWU B;  1JCC A;  2K3R A;  1DD4 A;  4V2K A;  3O1Y A;  1LWU C;  3I5C A;  1FAV A;  1J1D B;  2N1T D;  3BCC D;  2FXO A;  1J1D C;  3VOP A;  1VQ8 P;  1KIL E;  1M90 Q;  2IX7 C;  4UB8 E;  5CIH B;  1IO3 A;  2E76 B;  2QM7 A;  2FY8 A;  5AW8 B;  2LXB A;  1C52 A;  3BCC G;  3L71 D;  4DOJ A;  1PP9 E;  1CW5 A;  2LXC B;  1NTZ K;  2ZXE B;  1FZB A;  5APU A;  1QVF O;  4CPG A;  1CTZ A;  1MZ4 A;  2W27 A;  1H89 A;  1LT9 B;  1U75 B;  2FYU J;  3L71 G;  2GC7 D;  5KLV J;  5AW7 B;  3KPE A;  4Q5P A;  2JWD A;  1L2P A;  1ZN5 A;  1HGV A;  1SQB E;  4QMA A;  2Q7C A;  1FZE A;  2E5Y A;  3U1A A;  1EB7 A;  2IYO A;  1L9J C;  3L4M A;  1T2K C;  5CYT R;  1Z56 A;  5AVV B;  3G71 P;  3IF4 A;  3A0B V;  2KYV A;  3HE4 B;  1P84 I;  3CCL P;  1WEJ F;  3L74 D;  2P10 A;  1KV9 A;  3V2N A;  3H1K D;  1I6D A;  4W80 A;  2KK7 A;  4OVN F;  1I8O A;  3Q3D A;  1CRI A;  2KUB A;  3E1I A;  4PJ0 V;  2BCC D;  3F5H A;  3V4Q A;  3L74 G;  3B71 A;  3VP9 A;  3LW5 H;  3LW5 J;  3M97 X;  1A02 J;  3H1K G;  1JY2 N;  2B9B A;  1SQQ J;  2KS1 A;  3MK7 B;  2EXV A;  2MHM A;  4GIF A;  1DH3 A;  2KZI A;  2BCC G;  3MK7 C;  4UB6 H;  3ZIY A;  2I1K A;  4NFG B;  1DIP A;  2WQY C;  1A02 F;  2FYU K;  1L0L E;  3O20 A;  2C9X B;  3VTP C;  5CCH D;  2M3B A;  4N78 D;  1GTW A;  4WY4 D;  3CC4 P;  1KB9 E;  1EDK A;  3L4F A;  1QN2 A;  2R3C A;  4EOT A;  1EDL A;  3CYT I;  2M5A B;  3RL0 g;  3FX0 A;  2OYH B;  2Z5I A;  4U3F D;  1CSB A;  2KNC A;  3M0A A;  1IFD A;  2R44 A;  3A2A A;  1JM0 A;  1HWT C;  3RGU A;  4WBA A;  5AW4 B;  2A45 G;  3BCC J;  4XA4 A;  3RK2 C;  1QX8 A;  2R3S A;  1IC2 A;  1KIL C;  4U3F G;  4C46 A;  1N7S D;  2M3E A;  1PZQ A;  1URQ C;  4H13 B;  3G4S P;  2QEX P;  3AE6 C;  3L71 J;  4H13 C;  1CCH A;  3M9Q A;  3M06 A;  5APW A;  3HD7 C;  2J58 A;  3FXD A;  2PGD A;  1P84 E;  2AIU A;  2FYU E;  3C1L A;  1SQQ K;  4HYT B;  4O1W A;  5KLV E;  2BEZ F;  3ITK A;  1H8A A;  3WFD C;  1CHJ A;  2AEM A;  2K9Y A;  2FFD C;  1ZOY C;  351C A;  1RZ5 A;  1RE4 A;  1I55 A;  1PGO A;  1QGK B;  3RK3 D;  1VYD A;  3CU4 A;  1T8Z A;  4YE1 A;  2K9J B;  2YO2 A;  3L74 J;  2E5T A;  2C9L Y;  1N15 A;  3H1K J;  4H0L D;  3VRD A;  2BCC J;  3ORV A;  4K35 A;  3SXT A;  2JJL A;  3HUS B;  1S72 P;  3CXH D;  1NKN A;  2E74 D;  3PP5 A;  4UB6 E;  1W5C E;  2B89 A;  3HQ9 A;  2OGU A;  2BLF B;  1CSU A;  2QG4 A;  2N9B A;  3SLE A;  1LTT C;  1A56 A;  1AOF A;  4JCG A;  1CXC A;  2E75 B;  1C6S A;  2E75 C;  2A45 H;  3P8C E;  3EQ2 A;  4U3F J;  4KJM A;  3WFB C;  3BCC E;  3CMA P;  1C75 A;  2GUV A;  2N3Y A;  2FYZ A;  3O8Z A;  1L4A B;  2GUS A;  1AKK A;  1IFJ A;  1N73 A;  5CJ0 A;  1L4A C;  1NWQ A;  1HF9 A;  1NU1 K;  4UB8 V;  4WB4 A;  1CRG A;  3L71 E;  1LC2 A;  4TT3 H;  3GHG A;  3PXW A;  4NPF X;  1CHH A;  1FU1 A;  2WT7 A;  2OYI A;  1M56 D;  1HZU A;  2B10 B;  1M1J A;  2QE7 H;  1EXJ A;  1QVG O;  5E79 H;  2W90 A;  2AXT H;  5DJQ B;  2D2C B;  2IZ1 A;  4HJG H;  5DJQ C;  1KQF B;  4KMG A;  1AVO A;  1N50 A;  4AYC A;  3MGN A;  1Q81 Q;  1VQ6 P;  2HYN A;  1WT6 A;  3FXE A;  1IK7 A;  3MIW A;  1CXA A;  3DP5 A;  1LTJ C;  2V7Q J;  2WVR A;  1DIQ C;  3AE2 C;  2XDJ A;  3L74 E;  1D7M A;  1NML A;  4N6J A;  4GOD A;  2R32 A;  3H1K E;  3U1C A;  1DW0 A;  1T3U A;  1FZC B;  2I8F A;  1RAQ A;  3H1I D;  3VMA A;  1KIB A;  1FZC C;  2BCC E;  3SFE C;  5AW2 B;  4WQD A;  3V2Q A;  1GK6 A;  5KJ7 A;  2LR2 A;  2IBZ I;  3H1I G;  1KYO I;  4YXW H;  3O0R C;  5APX A;  3ZOX A;  3HRN A;  2C1D A;  3OCD B;  4WVZ A;  1HJ0 A;  1IRV A;  1NOH A;  4L75 A;  2C0X A;  2BGV X;  2GB8 B;  4N78 E;  2WWW A;  2KP8 A;  1QL2 A;  4C7N B;  5AVW B;  1J1E B;  4U3F E;  3NMD A;  1CRJ A;  3T97 B;  2HPC A;  2JR8 A;  1F1F A;  2GM4 A;  4J20 A;  1J2J B;  2YXR B;  5GTH H;  2OYO A;  3AE3 C;  3NBT A;  2N1T C;  2HOD A;  1CI6 A;  3O6Q B;  3L72 D;  4WQ7 A;  4D6T G;  1S1C X;  1ZXG A;  1GL2 B;  3GG2 A;  1GL2 C;  2SPZ A;  1RQU A;  3L72 G;  1KB0 A;  5KAI E;  3TGU D;  2RH0 A;  2AXT E;  2YIU B;  2YIU C;  1RZ6 A;  1YIQ A;  2ORL A;  2AI5 A;  1GJQ A;  3TGU G;  2IDB A;  1YBK A;  4EDF A;  3EFG A;  1HCM A;  5CCG A;  3WU2 H;  1K3G A;  1OMI A;  5AVQ B;  1I5T A;  2IBZ E;  5B5E H;  2RKL A;  3CWB D;  4O9B A;  2XND H;  4Y99 B;  3V6I A;  1YYC A;  1HRO A;  4YPC A;  1VL2 A;  1VQO P;  1U74 B;  1BCC D;  3CL3 D;  1FS0 E;  2MKV A;  4GKG A;  3IFM A;  1MG3 D;  3H1I J;  3TYI A;  2NPS D;  1AOQ A;  2P2U A;  2KI7 B;  4O1Q A;  3CX5 D;  3I55 P;  1X8Y A;  1PFI A;  1KFM A;  5BVZ A;  1RHZ B;  2ZXY A;  3E1R A;  1GZL A;  3II6 A;  3LID A;  1AVY A;  4YXD C;  1LGH B;  1N2D C;  1OVR A;  2Y0C A;  4RO0 A;  4UB6 V; 
#chains in the Genus database with same CATH homology
 2L4D A;  3H1K D;  1I6D A;  3HQ7 A;  3ZBM A;  1EZV D;  1SQB D;  3RMZ A;  2OZ1 A;  1I8O A;  1CRI A;  4PJ0 V;  2BCC D;  1I54 A;  3RLM A;  1H31 B;  3SWS A;  3M97 X;  1MG2 D;  1SQV D;  1CSW A;  1CIF A;  2FYN B;  5TJH A;  1S6V B;  2LIR A;  4FA4 A;  2KS1 A;  4PWA A;  3MK7 B;  2EXV A;  2MHM A;  4QAO A;  1R0Q A;  1BGY D;  1H1O A;  3PRJ A;  3MK7 C;  5CIG B;  3ZIY A;  4H0K A;  3PLN A;  5CID B;  5H2F V;  1COT A;  5CIC B;  5DF5 A;  2MTA C;  4NFG B;  3TF5 A;  1LFM A;  1FI3 A;  2N9I A;  2PCB B;  3O20 A;  2B11 B;  2C9X B;  2BPB B;  1QL4 A;  1NTK D;  1QN2 A;  1H9X A;  2Y0D A;  2C1U A;  3CYT I;  2CE0 A;  4Y5R A;  4FA9 A;  4U3F D;  2CXB A;  1YNR A;  2ZZS 1;  1CC5 A;  5KKZ B;  2FRC A;  4XXL A;  1YCC A;  3OA8 A;  1CYJ A;  5B6Q A;  3PTZ A;  1RAP A;  5TIS V;  1LS9 A;  3VNW A;  3PXS A;  1JDL A;  1HJ3 A;  1H33 A;  1H31 A;  1CCH A;  1CSV A;  4PW9 B;  3ZOY A;  4XYD B;  1M60 A;  1CSX A;  1N9C A;  2C1D B;  2B0Z B;  1YTC A;  4AAO A;  1HH7 A;  2AIU A;  4O1W A;  3SJL A;  3ITK A;  2BH5 X;  1DW2 A;  3WFD C;  1CHJ A;  1GU2 A;  1GQ1 A;  1KX2 A;  3DMI A;  3HQ6 A;  351C A;  1CIE A;  2YQB A;  1DVH A;  1W5C T;  1RZ5 A;  2C1V A;  3CP5 A;  1HRC A;  1PP9 D;  3L4O A;  4FB1 A;  1I55 A;  3L75 D;  4EIC A;  1VYD A;  3CU4 A;  5CIB B;  1IQC A;  1P84 D;  4K3I A;  5KLV D;  4YE1 A;  3ZOW A;  1CCR A;  5C0Z A;  2C2C A;  1YFC A;  2K9J B;  5CIE B;  4L3G A;  5GTI V;  3H1L D;  2D0W A;  1N15 A;  4L3H A;  1NU1 D;  1J3S A;  2CA4 B;  1H9Y A;  3VRD A;  2PAC A;  1E29 A;  2QJP B;  3ORV A;  1CYC A;  2Y0E A;  4FA1 A;  3SXT A;  1QKS A;  2JTI B;  3CXH D;  2N9J A;  2QJY B;  3JBT B;  2C8S A;  3H1J D;  3HQ9 A;  4WQ8 A;  4FA5 A;  2BLF B;  1BL9 A;  1CSU A;  2QG4 A;  4A7P A;  1IRW A;  3SLE A;  3GW6 A;  1H32 A;  1NTZ D;  1A56 A;  1I6E A;  1YIC A;  1AOF A;  4JCG A;  1CXC A;  5C9M A;  3CX5 W;  4AAL A;  3KHU A;  1C6S A;  4D6T D;  2DGE A;  1CRY A;  1C2N A;  3WFE C;  1NNO A;  1N90 A;  1CTJ A;  1KYO W;  1ZZH A;  2YK3 A;  3WFB C;  1DW1 A;  2N18 B;  1C75 A;  1CYI A;  5KAI V;  2N3Y A;  2N18 C;  1A2S A;  5E79 V;  1AKK A;  2AXT V;  2YCC A;  1L0L D;  1W2L A;  3FWL A;  4EID A;  5KAF V;  1FI7 A;  1KB9 D;  4WQB A;  4UB8 V;  3L70 D;  1CRG A;  1M6Z A;  1IZL 0;  2CA3 B;  3WC8 A;  1LC2 A;  3PXW A;  5IY5 1;  3TDK A;  1CHH A;  3SVW A;  2GC4 D;  1CIH A;  3X39 A;  3PH2 B;  1LMS A;  5AUR A;  1DII C;  1CRC A;  1HZU A;  2B10 B;  155C A;  2RN0 A;  1C2R A;  4LJI A;  4RSZ A;  2BCN B;  1L0N D;  5DJQ B;  2DVH A;  1ZRT D;  5DJQ C;  4MU8 A;  1E2R A;  4KMG A;  4AX3 A;  1N50 A;  1NMI A;  3HQ8 A;  1C6O A;  1CTY A;  3ZOO A;  2JQR A;  3RN0 A;  1CXA A;  1F1C A;  3DP5 A;  1CRH A;  1DIQ C;  1SQX D;  3DR0 A;  1BE3 D;  2FYU D;  1NML A;  1S5L V;  3PXT A;  451C A;  3KZI V;  1DW0 A;  1WVE C;  1YEA A;  2I8F A;  1RAQ A;  1KX7 A;  3H1I D;  4DY9 A;  3VMA A;  1KIB A;  2V08 A;  1NIR A;  3RN1 A;  3PHL A;  2HV4 A;  4FAV A;  1L9B C;  4WQD A;  4WQA A;  3A0H V;  2Q3E A;  1B7V A;  4WQ9 A;  1HJ5 A;  1GDV A;  2N9Y B;  2D0S A;  1DW3 A;  3WFC C;  2RMZ A;  5KLI B;  3O0R C;  2QJK B;  4WQC A;  3ZOX A;  1OCD A;  5GTH V;  2C1D A;  3OA8 B;  3OCD B;  1FCD C;  5CIF B;  3NWV A;  2A06 D;  1IRV A;  3A9F A;  2LIT A;  2B12 B;  1I8P A;  2BGV X;  1H33 B;  2GB8 B;  5DFS A;  1C7M A;  4H0J A;  1SQQ D;  2JWA A;  1CHI A;  1FJ0 A;  1CRJ A;  2PCC B;  1F1F A;  2V07 A;  4J20 A;  4EIE A;  1FI9 A;  4PD4 D;  1HJ4 A;  1C6R A;  4RJT A;  1HZV A;  3NBT A;  3L73 D;  2CE1 A;  1CED A;  3O5C A;  3ZCF A;  3L72 D;  4WQ7 A;  1A8C A;  4WQE A;  1CIG A;  1CNO A;  4P4Q B;  4FAN A;  2L91 A;  3GG2 A;  4EIF A;  1QL3 A;  5EXQ A;  1CO6 A;  4AAM A;  4GED B;  1OAE A;  3WUI A;  1FOC A;  1FHB A;  2O3J A;  2VHD A;  2ZBO A;  2BH4 X;  3WU2 V;  4V2K A;  4L1Q A;  1KB0 A;  3CXH W;  3O1Y A;  3TGU D;  5B5E V;  1GIW A;  1QYZ A;  3BCC D;  2N3B A;  1YEB A;  2YIU B;  3C2C A;  2OZ1 B;  3OCD A;  1COR A;  1RZ6 A;  1SQP D;  1YIQ A;  5CIH B;  1IO3 A;  2ORL A;  2AI5 A;  1GJQ A;  1DVV A;  1C52 A;  3L71 D;  4EDF A;  1HCM A;  1K3G A;  1I5T A;  1AYG A;  5B66 V;  2ZOO A;  2B4Z A;  1LC1 A;  1CTZ A;  1MZ4 A;  1NTM D;  3CWB D;  1E8E A;  1U75 B;  1H32 B;  2GC7 D;  1DT1 A;  4AAN A;  1HRO A;  4Q5P A;  1PPJ D;  4GYD A;  4N0K A;  1U74 B;  1BCC D;  4IL6 V;  1MG3 D;  3TYI A;  1AOQ A;  4O1Q A;  2FWL A;  3CX5 D;  1M70 A;  1EB7 A;  1L9J C;  3L4M A;  1ETP A;  5CYT R;  3VYM A;  2IBZ D;  3H1H D;  2KNC B;  2ZXY A;  2ZON G;  3A0B V;  1GKS A;  1KYO D;  3NBS A;  1WEJ F;  2GIW A;  3L74 D;  1K3H A;  2XTS B;  2Y0C A;  1KV9 A;  4UB6 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...