1BGYD

Cytochrome bc1 complex from bovine
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 58
structure length 241
sequence length 241
chains with identical sequence P
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1bgyD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1bgyD01
1LC1A 1KB0A 3ZBMA 4FB1A 1H33A 3PXTA 1CRJA 1U75B 4EIDA 4FAVA 5CIFB 5KAFV 1A2SA 1IZL0 2AIUA 2CXBA 1DIQC 3C2CA 3O20A 4RJTA 3TF5A 4WQCA 1HROA 1KV9A 4WQ7A 1RZ6A 4YE1A 1QL4A 1EZVD 2FYNB 1QL3A 1QYZA 5DF5A 2B12B 3A9FA 3CXHD 1CNOA 1I8OA 3H1ID 2C8SA 3M97X 1I55A 5TJHA 4MU8A 1WVEC 4LJIA 1GQ1A 2YK3A 2HV4A 1L0ND 1PPJD 1CIEA 2C1UA 1I6DA 1CRGA 4PW9B 3H1JD 1I54A 4L3GA 1SQQD 5DJQC 4AALA 1CC5A 3ORVA 4FA5A 1LC2A 3VRDA 1K3HA 2GB8B 2D0SA 3VNWA 2BCCD 1H1OA 1OCDA 3OA8B 1H32A 1L0LD 3TGUD 1HRCA 3FWLA 2GC4D 1NTZD 3CX5W 2LITA 1CHIA 1N9CA 451CA 1YTCA 2FRCA 2PCCB 4DY9A 1NMLA 3MK7B 2MTAC 5B5EV 1H31A 1HH7A 1CYIA 1LS9A 2C1DA 3HQ6A 1A56A 4JCGA 4EICA 1YIQA 4PJ0V 4WQDA 2A06D 4K3IA 4Y5RA 2BCNB 5TISV 3CYTI 1CCHA 1C75A 4AAMA 3PRJA 3SXTA 1ETPA 3ZOWA 5CYTR 3HQ7A 4GYDA 3SWSA 2BH5X 2OZ1B 1YEAA 1HJ4A 4FA9A 1DVVA 1RZ5A 1BGYD 1U74B 1SQXD 2N3YA 1OAEA 3A0HV 3SLEA 2MHMA 1S6VB 1RAQA 5C0ZA 3CWBD 1CEDA 1A8CA 1CIHA 2N3BA 3RN0A 1AKKA 2IBZD 1I6EA 1LMSA 1S5LV 1GKSA 2BLFB 4KMGA 4NFGB 1B7VA 1P84D 1KYOD 1FI9A 3H1KD 1CRYA 1HZUA 1N90A 2N18B 1NTKD 2O3JA 1C7MA 5GTIV 4QAOA 4WQ9A 1F1CA 1CO6A 1F1FA 3L74D 155CA 1CYJA 1WEJF 4H0KA 1CIFA 1H9YA 1DW1A 3WU2V 3MK7C 1I8PA 2Y0CA 3HQ8A 1W2LA 5CIBB 4D6TD 3O1YA 1CTJA 3OCDB 4PWAA 1ZRTD 1CHHA 1KYOW 3WC8A 2AXTV 3SVWA 2C9XB 3GG2A 1GIWA 4V2KA 1KB9D 1MG2D 1CXAA 1R0QA 3L71D 4O1WA 3CU4A 1ZZHA 1CSXA 3HQ9A 3WUIA 1N15A 1FOCA 3ZIYA 4EIFA 3L70D 2BH4X 1L9JC 1COTA 3CXHW 2B4ZA 5GTHV 3WFEC 4UB6V 1KX2A 3X39A 1N50A 2ZBOA 4O1QA 1M60A 2CE0A 1LFMA 2B10B 3BCCD 3PLNA 3H1LD 1FI7A 3L72D 4L1QA 3OA8A 1DIIC 2FYUD 2RN0A 4Q5PA 5E79V 5CIEB 1YFCA 1AYGA 1VYDA 1MZ4A 3L4OA 5CIDB 4IL6V 1PP9D 3WFDC 2JTIB 3ZCFA 2ZZS1 4UB8V 2N9YB 3WFCC 1IO3A 1E29A 1CYCA 1DT1A 3RMZA 4P4QB 3PXWA 1J3SA 1FHBA 2YIUB 3RN1A 4WQBA 1HZVA 2YCCA 2BPBB 5CICB 1FJ0A 1CXCA 1CCRA 1MG3D 3L4MA 5KKZB 1CHJA 2FWLA 2V08A 4AAOA 2OZ1A 1I5TA 1YEBA 2BGVX 5DJQB 1C2NA 2N9JA 2PCBB 4PD4D 2C2CA 2QJKB 1C6SA 2ZXYA 5CIHB 1CTZA 1C6RA 3H1HD 3ITKA 2CA4B 2L91A 1IQCA 4L3HA 1H33B 2DGEA 1NNOA 1C52A 5B6QA 1YICA 1CORA 1M6ZA 4XYDB 4EDFA 2KNCB 1GDVA 1AOQA 4N0KA 1BL9A 2V07A 3ZOYA 3TYIA 1K3GA 1NMIA 4XXLA 2ZOOA 3GW6A 3VYMA 1CSVA 3DR0A 3KHUA 5CIGB 1NU1D 3L73D 2QJPB 1DW2A 1JDLA 4A7PA 1SQBD 2YQBA 3ZOOA 2B11B 2RMZA 1L9BC 2N9IA 3OCDA 5C9MA 3CP5A 1NIRA 4FANA 1BCCD 2B0ZB 4WQEA 1SQVD 2L4DA 2Y0DA 3PHLA 1RAPA 2CA3B 5AURA 3CX5D 1DVHA 2KS1A 1W5CT 4WQAA 1BE3D 2ZONG 1HJ3A 4FA4A 3PH2B 5DFSA 1SQPD 1CRHA 3NWVA 1AOFA 1H32B 5IY51 3JBTB 2JQRA 3TDKA 3RLMA 1DW3A 2K9JB 1CSWA 1FI3A 1HJ5A 1HCMA 4H0JA 1DW0A 2C1VA 3L75D 2CE1A 3DP5A 1FCDC 2N18C 1QN2A 4RSZA 1H31B 1YNRA 3VMAA 2C1DB 3KZIV 1NTMD 2D0WA 5EXQA 1E8EA 5B66V 1GU2A 1E2RA 3O5CA 1EB7A 1YCCA 2QJYB 5KLIB 4AX3A 1H9XA 2LIRA 3PXSA 1QKSA 1GJQA 3NBTA 2Q3EA 3PTZA 2DVHA 1KX7A 4J20A 3SJLA 2EXVA 3DMIA 4AANA 2GC7D 2ORLA 351CA 2I8FA 3WFBC 1CSUA 2JWAA 1CIGA 5H2FV 3NBSA 4U3FD 5KLVD 4FA1A 1CTYA 3O0RC 4WQ8A 1IRWA 3ZOXA 1IRVA 2PACA 2QG4A 2Y0EA 4EIEA 1CRIA 4GEDB 1M70A 2AI5A 1CRCA 2GIWA 3A0BV 1C6OA 2XTSB 2VHDA 5KAIV 1C2RA 1KIBA
chains in the Genus database with same CATH superfamily
2QM7A 4FB1A 1BSNA 2Q3IA 4H13C 4WY4A 4TT3H 1FZBA 1A2SA 2WT7A 2AIUA 1NU1J 3P8CD 4XA4A 1HVVA 1DIQC 1SQBJ 3TF5A 2J59M 5APWA 4YE1A 1BCCJ 2E74C 1JY3N 1EC5A 2C8SA 3M97X 2WSCJ 4PJ0H 3M06A 4LJIA 5GTHE 5AVRB 1A02F 1GQ1A 2YK3A 1L0ND 1Q2NA 2FYZA 4I2LC 5AW3B 3CC7P 1SQQD 1NVOA 2XV5A 1QL2A 3U59A 3D6YA 2KSJA 4AALA 2XDJA 3Q5SA 4FA5A 1YQ4C 5E79E 2QJKC 1X9VA 3L75J 2YKPA 1NAFA 2GB8B 3IN6A 2IX7C 3VNWA 2BCCD 4W7YA 1T2KC 3G6EP 1H32A 3TGUD 2FXOA 3CCSP 1KFNA 1NTZD 1Q82Q 1NTMJ 1GMJA 1N9CA 1ZP0C 1YTCA 1BDCA 5AVSB 1NU1G 2KZIA 1GZLA 3WMM0 4NPDA 4H0LC 5AVYB 1SQBG 1QGKB 1EXJA 2NZ2A 2I1JA 1BCCG 4L76A 1HTLC 3MUDC 2WQYC 1RE4A 3CC4P 4U3FJ 3GF3A 4C7NB 2WSEJ 4AAMA 1VQ4P 3ZOWA 5L8RJ 1HJ4A 1VQ5P 3Q1MA 1N2DC 1S72P 4WWIA 4H13D 1VDFA 1AKKA 2IBZD 2BCCG 1S5LV 3L75G 2WWWA 1BSHA 1L2PA 1GDTA 1P84H 2O01J 1Q86Q 1LTJB 1P84D 1NTMG 1HZUA 2N18B 1NTKD 3W68A 3VP9A 1C7MA 5GTIV 1EDKA 1ZN5A 2OYHC 2ZT9C 3VP8A 1NGMB 2E5YA 1M57D 3H25A 1F1CA 2E74D 1CO6A 3L74D 1WEJF 3H1IJ 3CD6P 1H9YA 2B87A 1DW1A 3WU2V 1QEXA 2HR3A 1RQUA 1M7LA 2Y0CA 3VN0A 1K8AQ 1JCCA 4UB8H 3M9QA 3MTUE 2KIKA 1GL2A 1CHHA 3WC8A 2AXTV 2C9XB 4U3FG 1DEEG 3H1JJ 1EDIA 2JP3A 2JKVA 2KS1B 1URQA 3VMYA 1ZZHA 2OTKE 2QVAA 1JMMA 3ZIYA 1NKZB 1ZW0A 3A0HH 1IFJA 1RF1C 2BH4X 1T2KD 1COTA 1KQLA 1L0LJ 3S4RA 5APXA 2H8PD 3X39A 2MKVA 1MV8A 2MJZA 2C9LY 3F89A 1RE3C 3PLNA 2ZXEB 4H13B 2V7QJ 4JYCA 3OA8A 1DIIC 2M8RA 5B66E 2FYUD 4Q5PA 3CCVP 3TSIA 4TLFA 3Q5PA 1MZ4A 2Q9IA 5CIDB 4IL6V 3E1IA 1PP9D 3H1IG 4AQRD 2YO2A 4I6MC 1L4AA 2N9YB 2BASA 1JTHA 3RK3C 2E74B 3V2RA 1T3UA 1SQPE 2FYNC 3AEGC 3VTPC 2O01N 2H43A 4P4QB 2FXMA 3HUSA 1U7JA 3V2QA 1HF9A 2IDBA 1HZVA 4O9BA 2Q5UA 5AW5B 2Y9ZA 1FJ0A 3KYQA 2CPSA 3H1JG 1AQ5A 4ASVA 1CI6B 4Y99C 4DZOA 2HPCA 2FFDA 1T3JA 5KAIE 2FWLA 4AAOA 1YEBA 2M3EA 2G8YA 3D6ZA 2SPZA 1M1JA 2PCBB 1QVGO 2QJKB 3B8EB 3CCUP 1IFPA 5CIHB 3H1KJ 1C6RA 2Z5HA 2CA4B 2ZT9D 1CZQA 2DGEA 1NNOA 1VL2A 1W5CE 2GA1A 2P58A 3RL0C 4XYDB 2VRSA 1AFOA 1PP9G 3G3ZA 4N0KA 4H0LB 5KLVE 1NMIA 4XXLA 3GW6A 1JY3P 3DR0A 2KP8A 1SQXE 1LGHB 1DX7A 3KZIH 3CWBE 1JDLA 1MFTA 2W6JH 1YTZI 2B11B 2N9IA 3L70J 1JUNA 1FC2C 3C1LA 3CP5A 2L4DA 1JY2N 1OIPA 3P8CE 2XU6A 1KYOE 2XZRA 2CPBA 2ZONG 5H2FH 4RESB 4C7RA 1K04A 3BCCJ 3H1LJ 2WPVB 2R5BA 5DFSA 3I55P 1CRHA 2WZ7A 3NWVA 3H1KG 3TNUA 2JQRA 2M0BA 3TDKA 1NOHA 1SS1A 3B4SA 1HJ5A 1EQ7A 4H0JA 2V4HA 1BDDA 3RK3D 1LTBC 4PJ0E 2OYHB 2ZT9B 4EIJA 4IL6X 1MUUA 1L0NE 1OWAA 4YXWH 1Y47A 1NJIQ 4H44B 5EXQA 1E8EA 1SQQE 1E2RA 3O5CA 3EWKA 3WUTA 1IFDA 2KLUA 3SSUA 1LTGC 3L35A 3I56P 3VMZA 2PAJA 1KX7A 3SJLA 4AANA 2M3BA 3TGUE 3NFQA 3L70G 1NTZE 3V5BA 2WTYA 3I5CA 1U57A 3H1HJ 1IRWA 1RF1B 3T97A 5KJ7C 4WB4A 2E75C 1OVUA 1ZV8A 3RL0D 1C6OA 2XTSB 2FKWB 3OJAB 5AW2B 1AVOA 2HODB 1NYHA 2WPRA 2XNDH 1KB0A 1HJ0A 3JSVC 1H33A 1FDMA 1CRJA 1U75B 1Y9BA 2IFMA 5KAFV 5BVZA 4I7ZC 5CCGA 2CXBA 3LW5H 3L73J 3C2CA 1YJNP 3O20A 2KNCA 2JWDA 4NPFX 3S1KA 4WQ7A 3CXHH 1KYOI 5B5EH 1QL4A 2FYNB 1QL3A 2IBZE 2B12B 1SQVJ 1VF5C 3CXHD 1I55A 4OVNF 1SQBK 5AVTB 1P84E 1ZLLA 4Y99B 3WUUA 1NTKE 1SQPJ 2C1UA 2W6BA 3G9RA 2JEEA 2LXBA 3MP7B 2WSFJ 3H1HG 2KUBA 4PW9B 4L3GA 2K1AA 1KILA 3KDPB 5APUA 3MHVA 1H89A 1K3HA 2OTLP 2GUSA 3SWKA 1OZHA 5KAIH 3O8ZA 3EQ2A 1H1OA 1W2EA 5BU5A 3FWLA 2GC4D 3CX5W 3RL0B 2D2CC 4UB8E 1IO4A 3FX0A 4AYCA 1N7SA 2HG5D 2PCCB 1S4XA 3L73G 2JJLA 1H31A 1KV4A 2C1DA 1NTMK 2IFNA 3AE3C 3CCQP 3HQ6A 4JCGA 1TU3F 2N1TC 1IFMA 5M1BA 4B86A 1BE3E 2E5TA 2A06D 2WITA 4XE5B 5AVQB 5KLVJ 5TISV 1FZAA 1CCHA 1GL2C 1DD4A 5CCHA 5KJ7D 1ETPA 3HQ7A 2FYUE 2E75D 4GYDA 2OZ1B 3K5BA 1SQPG 1U74B 1SQXD 1LWUA 1GU4A 3A0HV 3GHGA 1N73C 2MHMA 1S6VB 1RAQA 3CWBD 2BEZF 5EFWB 3NMDA 1HH0A 3U1CA 2OYIC 1LMSA 3L36A 3R2PA 1S9KE 3HTKA 2BLFB 4KMGA 1KYOH 5CBNA 4NFGB 1KYOD 2IBZI 2WT7B 4QAOA 3GMAA 1F1FA 1VF5D 1P84I 4H0KA 2QM8A 3D0WA 3AEAC 3AE6C 3MK7C 1I8PA 1L4AC 5KLIC 2XNXA 5CIBB 4D6TD 1VQNP 1CTJA 1L0NJ 3OCDB 1ZMEC 4PWAA 1LTTC 1JY2P 4HJGH 2P67A 5KLVG 4OGQC 1A02J 4V2KA 1FU1A 2YO3A 1SQQJ 1R0QA 3L71D 4O1WA 1CSXA 2WSCH 3M0DA 1N15A 1FOCA 4R4MA 2BCCJ 4BXLA 2O1KA 2E75B 3TGUJ 5GTHV 2R32A 1NTZJ 2D2CD 3SFDC 1M60A 1IZNB 1MZ9A 2CE0A 5K5GB 2ZAEB 2UWJE 3KZIE 3BATA 2L5GB 1L0LK 1HWTC 3A3YB 4HYTB 3V2NA 5E79V 4I7ZB 2B9BA 1AYGA 1PIXA 2N1TD 2P1JA 2HYNA 3CMAP 4HKZH 2JTIB 4YPCA 3ZCFA 2ZZS1 1GL2D 5H2FE 1VF5B 1PGOA 1FHBA 4EI2A 1L0NG 4L75A 2YCCA 2BPBB 2N9BA 1PL5A 1SQQG 1CCRA 1MG3D 4C7NA 1H0TB 3L4MA 3HD7C 1CHJA 1JM0A 3ABVC 3RK3E 4PD4H 2V08A 4BRYB 1I5TA 3HE5B 1YBKA 1JCDA 2WSEH 4PD4D 2G3AA 1YIJP 3TGUG 1NTZG 3AECC 1NTKJ 2HFED 1IQCA 5DJUB 4JPZB 2FBWC 3FXDA 3L74J 1C52A 2KI7B 4DOJA 3IAOA 1CORA 1LTJA 4EDFA 2JO1A 1L4AD 1GDVA 2V07A 1IK9A 1K3GA 5BU8B 1CSVA 3KHUA 4OGQD 3O6QB 1BGYE 2N1TB 1M1KQ 4OWFA 1JY3O 5APQA 2OQQA 1DW2A 3AEFC 3ZOOA 2KXPB 1EXIA 2AEJA 1GL2B 1KQSO 1QX8A 1L9BC 2YXQB 2Q1KA 1NIRA 1N86A 2Q6QA 3KXDA 1LT9C 2K37A 2IBZG 5AURA 1N73B 2KS1A 1BE3D 1SFCA 2GM4A 2OYIB 4FA4A 1NHLA 3PH2B 2FYUJ 4BWNA 4PV1C 2K88A 3JBTB 1NTKG 1USDA 1FDOA 3RLMA 1RHZB 2K9JB 3CXHE 3H32A 1CSWA 1LNQA 3Q3DA 5B5EE 3A0BH 1PP9J 3L74G 1DW0A 1FCDC 1NKNA 4RSZA 1M56D 5CCGC 3ZDMA 3FWNA 1NH4A 1J1DC 3VMAA 1D7MA 5APYA 5AW1B 1S9KD 2W27A 1OW7A 3A7OA 5B66V 3NTNA 3G71P 1EB7A 5KLIB 4AX3A 1H9XA 1DH3A 1QKSA 1OX3A 3HD7D 2Q3EA 3CPWO 3PTZA 4J20A 4OGQB 2GC7D 351CA 1GW3A 2YMKA 1CSUA 4GOEA 3GLMA 1LTAC 4RO0A 3NBSA 3L72E 1BE3G 1CI6A 3ZOXA 2C0XA 1S5LX 3KPEA 2R3SA 2B89A 1CRIA 2KSEA 4IFDK 2AI5A 2FYUG 2VHDA 5KAIV 1GD2E 1FJPA 5KTBA 5CMZA 1J2JB 3JC22 3E7KA 2LXCB 2A06E 1SP4A 3MD0A 1LC1A 3Q2YA 2E43A 3RBXA 3AEDC 4EIDA 2P7JA 3NXSA 5CIFB 1IZL0 4MN4C 1GK6A 2KLVA 1PZQA 1LP1B 4RJTA 2JDIH 2IYOA 1Q81Q 2H88C 1HROA 1KV9A 1M8OB 2QRXA 1EZVD 3B71A 1HGVA 4GODA 3A9FA 1I8OA 1CSBA 3Q5RA 1FZCC 3N4XA 2NRGA 1WVEC 2AXCA 4UB6E 1G2CB 3HD7B 4IFMA 3CXHI 1PPJD 1SQVK 4JYBA 1CIEA 1R8EA 4PV1D 1I6DA 3CMEP 1K73Q 1I54A 3GHGC 5DJQC 1WT6A 1CC5A 3ORVA 3P8MC 2WSSH 3VRDA 4JQ0D 1PGJA 1HJBA 3V4QA 2NPSA 1SQPK 1YJWP 2D0SA 2QSIA 3EFFK 1OCDA 4WY4C 5CCGD 2IZ0A 4D6TE 1VQMP 1S5LH 2OYOA 1VQOP 1W2BO 1RF0A 1OXZA 3PH0A 1EDLA 2Z5IA 2FRCA 2ZYDA 3L71E 4DY9A 1NMLA 2R44A 3CC2P 2MTAC 1IFNA 1LS9A 1DEBA 3V2PA 5GTIH 1HUCA 3AE2C 3CX5E 2W90A 1FZEA 1YIQA 4PJ0V 4WQDA 4Z1MH 2QJPC 4K3IA 3WU2H 2BCNB 4IFFA 3CYTI 1QVFO 3SXTA 1FS0E 3SWSA 1OMIA 2AXTH 1LT9B 4FA9A 3B5NA 1RZ5A 1BGYD 2N3YA 1ZOYC 3L75E 5KLVK 3G4SP 5C0ZA 1VQKP 1CEDA 2E76C 1XTCC 3E1RA 2N3BA 4Y28J 1LJ2A 1RF1A 3RN0A 1KQGB 5APVA 1KN7A 1HBWA 3L4FA 1NTME 3AE1C 1GKSA 4EYYQ 3OW2O 3R4YA 4GOFA 1VQ8P 1B7VA 3LW5J 3CI9A 2HODA 1RE3A 4GIFA 1N90A 1T8ZA 1KZUB 1JNMA 3RK3B 1VQPP 2M5AB 1NU1K 3JCUH 2QE7H 4PD4E 4IL6H 4U3FE 1AV1A 1NWQA 2A45H 1J1EC 3MIWA 1RE4C 1X22A 1ZRTD 1KB9H 1KYOW 3GG2A 3RBZA 1KB9D 3HE4B 1BGYG 2B88A 2ZYGA 1PV3A 3CU4A 3HQ9A 1LTIC 1L0NK 3UIAA 5AVZB 4WY4D 3EFGA 1SQQK 1KX2A 1FDIA 5DJTB 2J5UA 5APSA 1LFMA 3OAKA 1NO4A 1KC8Q 1FI7A 3L72D 4L1QA 1MKMA 2RN0A 3SWYA 1NTZK 4HH2A 5CIEB 1UIIA 1YFCA 2IYPA 3L4OA 3CCEP 4LGDE 3SWFA 2ZVNB 1Q7YQ 3WFDC 2HLOA 4N78E 4UB8V 4KJMA 3WFCC 4LLHA 1IO3A 5AW6B 3TK1A 3USSA 2C0WA 1E29A 3H1JE 1CYCA 1K05A 1DT1A 2PRRA 2IZ1A 1CW5A 3PXWA 1J3SA 1FZCB 3RN1A 1SQXJ 4WQBA 5CICB 2POHA 2PP6A 1CXCA 3CWBJ 2E76D 1URQC 2CK3H 1L0LE 3U1AA 3A0BE 3V4WA 2OZ1A 3A5TA 5AW4B 5DJQB 1KQFB 4WBAA 1C2NA 3RK2C 2C2CA 1SFCC 4UB6H 2I1KA 3M9BA 5C39A 1OVRA 3AE5C 2L91A 4WY4B 3L72G 4ZMDA 4PD4I 3VYIA 1VPCA 2RKLA 1GU5A 1M6ZA 3BASA 1NTKK 1R5LA 1AOQA 1JB0J 1BL9A 3ZOYA 3TYIA 2FXPA 4JF7A 4D6TJ 2ZOOA 2A06G 1E5WA 1ZR2A 2LR2A 1VQ6P 5CIGB 1NU1D 3PP5A 2Y9YA 2K9YA 2QJPB 1IK7A 3HUSC 1LT1A 2OARA 3L71J 1SQBD 1T6AA 3CLQA 3CL3D 1RH5B 2J58A 1SQXG 4ZKPA 3OCDA 5C9MA 3QH9A 2FFDC 3CWBG 1FOSF 1BCCD 2W83C 4WQEA 2Y0DA 3CX5H 3WUVA 3PHLA 4YTPC 1RAPA 3CX5D 1DVHA 1M1JC 5AVWB 2YNYA 3H1KE 2E76B 4WQAA 1HJ3A 3II6A 5KJ7A 1H32B 1G1IA 1EZVE 4QMAA 1DW3A 1FI3A 1VQ7P 3S9OA 1N7LA 3H6PA 4ASWA 5AVVB 5AW8B 3L75D 4ZKUA 2FYUK 1Q90D 1FJKA 1AVYA 1YNRA 1PPJE 5KAFH 3KZIV 1NTMD 3V6IA 4D6TG 1OVVA 3IFMA 1FZGA 1H88A 1J1EB 1URQD 4C46A 2LIRA 1OW8A 3PXSA 3L70E 3CCJP 3NBTA 3L71G 1U7MA 4W7ZA 5CHXA 2EXVA 3DMIA 2ORLA 2I8FA 3RK2D 2JWAA 1IFIA 2YXRB 1CIGA 2H7HA 1SFCD 3BCCE 5H2FV 1S5LE 3H1LE 1VQ9P 4U3FD 3P7KA 1H0TA 4FA1A 4WQ8A 1XTGB 1IRVA 2PACA 2Y0EA 4BRYA 4EIEA 3HE5A 1CRCA 3FGAD 3C9IA 5GTIE 1PFIA 1YI2P 1OW6A 2D2CB 2NPSC 2IPPA 1AQTA 3GF7A 2PFXA 1LTSC 2KK7A 1YJ9P 3ZBMA 2WPSA 3RGUA 1X8YA 3PXTA 3C8VA 3IF4A 4FAVA 2O01H 1RF0C 3WU2E 5AW9B 1E79H 1KILE 1SVFA 3AE8C 1FBMA 1ZXGA 2B87B 4WQCA 4EOTA 2AXTE 1YITP 2Q7CA 1PGPA 1JO5A 2I8DA 1RZ6A 3SFEC 1QYZA 4H44C 5DF5A 3O6QA 2N1TA 1WMKA 2AEFA 1CNOA 3H1ID 1FZFA 2YIUC 3AEBC 5TJHA 4MU8A 3H1HE 1URQB 1BE3J 1EZVI 5TISH 2HV4A 2E42A 4N78D 5KKZC 3B5NC 1CRGA 3RK2B 3H1JD 1GK4A 1N73A 1SFCB 1LC2A 1IC2A 2OYIA 4DT0A 3AE4C 3VMXA 3JCUE 3OA8B 4IL6E 1L0LD 2ZFCA 1HRCA 3H32B 1ZRTE 2K9JA 3L73E 2LITA 1CHIA 451CA 2AEMA 2KOGA 1KB9E 4H0LD 3QWOC 2V7QH 3MK7B 5AVUB 3L37A 5B5EV 1L4AB 1HH7A 1JTHB 1SQVE 5CBOA 1CYIA 3P32A 1A56A 4GDOA 4EICA 4R4LA 3HUSB 2W6AA 5APTA 4Y5RA 3TYYA 2Z4EA 4GKGA 1C75A 2HPCB 2FFDB 3PRJA 4HB1A 1KMIZ 5CYTR 2P10A 2BH5X 1YEAA 1DVVA 2WMMA 1R5SA 1M1JB 3BVHA 1OAEA 3SLEA 2BEQD 1FE6A 1KILC 2NPSD 1A8CA 1CIHA 1AA0A 2ZJSE 1JMBA 1I6EA 4L74A 1L0LG 4IOIH 5GTHH 1Z56A 4RKUJ 1FI9A 4DJGA 3BRVB 3H1KD 1CRYA 1N7SC 1Y8AA 2WPQA 2O3JA 4WQ9A 4H44D 5E79H 2YKOA 3LIEA 155CA 1CYJA 1LP1A 2QEXP 3MGNA 1CIFA 1S1CX 2ZYAA 2LKMA 1JOCA 3MZWB 2QJYC 2H89C 1YHQP 3HQ8A 1W2LA 3MUDA 3CCMP 4CPGA 3O1YA 5CCHC 1RQVA 3B5ND 3SVWA 2YMYA 1GIWA 2KYVA 3FXEA 1MG2D 1CXAA 2R3CA 1LWUC 1RY3A 1G2CA 2A45I 3WUIA 3HD7A 2KZJA 4EIFA 5CJ0A 3HRNA 3L70D 1L9JC 3CXHW 5AVXB 2B4ZA 1KB9I 3WFEC 4UB6V 3TNUB 1N50A 2ZBOA 4O1QA 1NU1E 3BRTB 1UIXA 2KB7P 2NPSB 4ZNCA 3PJSK 3W67A 1SQBE 2B10B 3BCCD 3H1LD 3F5HA 1YQ3C 2OYHA 4DCKA 1BCCE 1X0TA 1VYDA 1IJDB 1EZVG 1FOSE 1JEKA 1ZR4A 3D71A 5AW7B 1USEA 2R5DA 5AW0B 3RMZA 3A2AA 2DW3A 4K3AA 1YTZT 2YIUB 1PPJG 1BGYJ 1KILD 3M0AA 3AE9C 2BCCE 3M0DC 5KKZB 1KORA 3T97B 3B5NB 4LC1A 2QA4P 1LT9A 2BGVX 1SQXK 4AUWA 4PV1B 2N9JA 2P2UA 1H8AA 1X79B 5KAFE 1C6SA 2ZXYA 1CTZA 1N7SD 3H1HD 4YXDC 3ITKA 2YKQA 3BCCG 2JR8A 3H1LG 4L3HA 1H33B 1KFMA 5B6QA 1YICA 4NPEA 1J1DB 1AJYA 1YYCA 5CJ4A 2KNCB 1DIPA 2OTJP 2K3RA 4GT1A 3VYMA 3M9HA 5CCHD 2M5AA 4L73A 3L73D 5B66H 1KD1Q 4A7PA 3D70A 2YQBA 2ZVOB 3CCLP 1JY2O 1OFCX 2RMZA 1KTMA 4FANA 2B0ZB 1SQVD 2W8ZA 4WVZA 3HE4A 4M3LA 2CA3B 2ITAA 1KILB 1W5CT 3VOPA 4KT0J 3L72J 2WSFH 3RL0g 1SQPD 1S3JA 3L74E 1AOFA 2O1JA 5IY51 4K35A 3CX5I 3H1IE 3IR9A 1LTJC 1HCMA 2C1VA 2RH0A 1N7SB 2CE1A 2WVRA 3DP5A 1VQLP 3AE7C 3OA7A 1QLED 2N18C 1QN2A 1SLQA 1H31B 4N3YB 2C1DB 3M91A 1QL1A 4XFJA 1G1JA 5TISE 2D0WA 2A45G 2OGUA 1GU2A 4KHXA 4I1LA 1YCCA 2QJYB 2PGDA 1GJQA 1GW4A 3N7NA 4U7JA 3A0HE 2DVHA 1EDJA 1N8RQ 1FZCA 1SQVG 2XKMA 3KQGA 3WFBC 1FAVA 1LWUB 3GHGB 1NAYA 3LIDA 5KLVD 1GTWA 2GUVA 1CTYA 3O0RC 1HGZA 1MFZA 2QG4A 3CCRP 2ZXXA 4N6JA 2QIWA 4GEDB 3AEEC 3HTKB 1M70A 4OH8B 1PGQA 1WRGA 2GIWA 3A0BV 1PP9E 1K9MQ 4JBZA 1C2RA 2FY8A 1M90Q 1KIBA 1DD3A 2C9NY 1S2EA 4W80A
chains in the Genus database with same CATH topology
1LC1A 1KB0A 3ZBMA 4FB1A 1H33A 3PXTA 1CRJA 1U75B 4EIDA 4FAVA 5CIFB 5KAFV 1A2SA 1IZL0 2AIUA 2CXBA 1DIQC 3C2CA 3O20A 4RJTA 3TF5A 4WQCA 1HROA 1KV9A 4WQ7A 1RZ6A 4YE1A 1QL4A 1EZVD 2FYNB 1QL3A 1QYZA 5DF5A 2B12B 3A9FA 3CXHD 1CNOA 1I8OA 3H1ID 2C8SA 3M97X 1I55A 5TJHA 4MU8A 1WVEC 4LJIA 1GQ1A 2YK3A 2HV4A 1L0ND 1PPJD 1CIEA 2C1UA 1I6DA 1CRGA 4PW9B 3H1JD 1I54A 4L3GA 1SQQD 5DJQC 4AALA 1CC5A 3ORVA 4FA5A 1LC2A 3VRDA 1K3HA 2GB8B 2D0SA 3VNWA 2BCCD 1H1OA 1OCDA 3OA8B 1H32A 1L0LD 3TGUD 1HRCA 3FWLA 2GC4D 1NTZD 3CX5W 2LITA 1CHIA 1N9CA 451CA 1YTCA 2FRCA 2PCCB 4DY9A 1NMLA 3MK7B 2MTAC 5B5EV 1H31A 1HH7A 1CYIA 1LS9A 2C1DA 3HQ6A 1A56A 4JCGA 4EICA 1YIQA 4PJ0V 4WQDA 2A06D 4K3IA 4Y5RA 2BCNB 5TISV 3CYTI 1CCHA 1C75A 4AAMA 3PRJA 3SXTA 1ETPA 3ZOWA 5CYTR 3HQ7A 4GYDA 3SWSA 2BH5X 2OZ1B 1YEAA 1HJ4A 4FA9A 1DVVA 1RZ5A 1BGYD 1U74B 1SQXD 2N3YA 1OAEA 3A0HV 3SLEA 2MHMA 1S6VB 1RAQA 5C0ZA 3CWBD 1CEDA 1A8CA 1CIHA 2N3BA 3RN0A 1AKKA 2IBZD 1I6EA 1LMSA 1S5LV 1GKSA 2BLFB 4KMGA 4NFGB 1B7VA 1P84D 1KYOD 1FI9A 3H1KD 1CRYA 1HZUA 1N90A 2N18B 1NTKD 2O3JA 1C7MA 5GTIV 4QAOA 4WQ9A 1F1CA 1CO6A 1F1FA 3L74D 155CA 1CYJA 1WEJF 4H0KA 1CIFA 1H9YA 1DW1A 3WU2V 3MK7C 1I8PA 2Y0CA 3HQ8A 1W2LA 5CIBB 4D6TD 3O1YA 1CTJA 3OCDB 4PWAA 1ZRTD 1CHHA 1KYOW 3WC8A 2AXTV 3SVWA 2C9XB 3GG2A 1GIWA 4V2KA 1KB9D 1MG2D 1CXAA 1R0QA 3L71D 4O1WA 3CU4A 1ZZHA 1CSXA 3HQ9A 3WUIA 1N15A 1FOCA 3ZIYA 4EIFA 3L70D 2BH4X 1L9JC 1COTA 3CXHW 2B4ZA 5GTHV 3WFEC 4UB6V 1KX2A 3X39A 1N50A 2ZBOA 4O1QA 1M60A 2CE0A 1LFMA 2B10B 3BCCD 3PLNA 3H1LD 1FI7A 3L72D 4L1QA 3OA8A 1DIIC 2FYUD 2RN0A 4Q5PA 5E79V 5CIEB 1YFCA 1AYGA 1VYDA 1MZ4A 3L4OA 5CIDB 4IL6V 1PP9D 3WFDC 2JTIB 3ZCFA 2ZZS1 4UB8V 2N9YB 3WFCC 1IO3A 1E29A 1CYCA 1DT1A 3RMZA 4P4QB 3PXWA 1J3SA 1FHBA 2YIUB 3RN1A 4WQBA 1HZVA 2YCCA 2BPBB 5CICB 1FJ0A 1CXCA 1CCRA 1MG3D 3L4MA 5KKZB 1CHJA 2FWLA 2V08A 4AAOA 2OZ1A 1I5TA 1YEBA 2BGVX 5DJQB 1C2NA 2N9JA 2PCBB 4PD4D 2C2CA 2QJKB 1C6SA 2ZXYA 5CIHB 1CTZA 1C6RA 3H1HD 3ITKA 2CA4B 2L91A 1IQCA 4L3HA 1H33B 2DGEA 1NNOA 1C52A 5B6QA 1YICA 1CORA 1M6ZA 4XYDB 4EDFA 2KNCB 1GDVA 1AOQA 4N0KA 1BL9A 2V07A 3ZOYA 3TYIA 1K3GA 1NMIA 4XXLA 2ZOOA 3GW6A 3VYMA 1CSVA 3DR0A 3KHUA 5CIGB 1NU1D 3L73D 2QJPB 1DW2A 1JDLA 4A7PA 1SQBD 2YQBA 3ZOOA 2B11B 2RMZA 1L9BC 2N9IA 3OCDA 5C9MA 3CP5A 1NIRA 4FANA 1BCCD 2B0ZB 4WQEA 1SQVD 2L4DA 2Y0DA 3PHLA 1RAPA 2CA3B 5AURA 3CX5D 1DVHA 2KS1A 1W5CT 4WQAA 1BE3D 2ZONG 1HJ3A 4FA4A 3PH2B 5DFSA 1SQPD 1CRHA 3NWVA 1AOFA 1H32B 5IY51 3JBTB 2JQRA 3TDKA 3RLMA 1DW3A 2K9JB 1CSWA 1FI3A 1HJ5A 1HCMA 4H0JA 1DW0A 2C1VA 3L75D 2CE1A 3DP5A 1FCDC 2N18C 1QN2A 4RSZA 1H31B 1YNRA 3VMAA 2C1DB 3KZIV 1NTMD 2D0WA 5EXQA 1E8EA 5B66V 1GU2A 1E2RA 3O5CA 1EB7A 1YCCA 2QJYB 5KLIB 4AX3A 1H9XA 2LIRA 3PXSA 1QKSA 1GJQA 3NBTA 2Q3EA 3PTZA 2DVHA 1KX7A 4J20A 3SJLA 2EXVA 3DMIA 4AANA 2GC7D 2ORLA 351CA 2I8FA 3WFBC 1CSUA 2JWAA 1CIGA 5H2FV 3NBSA 4U3FD 5KLVD 4FA1A 1CTYA 3O0RC 4WQ8A 1IRWA 3ZOXA 1IRVA 2PACA 2QG4A 2Y0EA 4EIEA 1CRIA 4GEDB 1M70A 2AI5A 1CRCA 2GIWA 3A0BV 1C6OA 2XTSB 2VHDA 5KAIV 1C2RA 1KIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LC1 A;  1KB0 A;  3ZBM A;  4FB1 A;  1H33 A;  3PXT A;  1CRJ A;  1U75 B;  4EID A;  4FAV A;  5CIF B;  5KAF V;  1A2S A;  1IZL 0;  2AIU A;  2CXB A;  1DIQ C;  3C2C A;  3O20 A;  4RJT A;  3TF5 A;  4WQC A;  1HRO A;  1KV9 A;  4WQ7 A;  1RZ6 A;  4YE1 A;  1QL4 A;  1EZV D;  2FYN B;  1QL3 A;  1QYZ A;  5DF5 A;  2B12 B;  3A9F A;  3CXH D;  1CNO A;  1I8O A;  3H1I D;  2C8S A;  3M97 X;  1I55 A;  5TJH A;  4MU8 A;  1WVE C;  4LJI A;  1GQ1 A;  2YK3 A;  2HV4 A;  1L0N D;  1PPJ D;  1CIE A;  2C1U A;  1I6D A;  1CRG A;  4PW9 B;  3H1J D;  1I54 A;  4L3G A;  1SQQ D;  5DJQ C;  4AAL A;  1CC5 A;  3ORV A;  4FA5 A;  1LC2 A;  3VRD A;  1K3H A;  2GB8 B;  2D0S A;  3VNW A;  2BCC D;  1H1O A;  1OCD A;  3OA8 B;  1H32 A;  1L0L D;  3TGU D;  1HRC A;  3FWL A;  2GC4 D;  1NTZ D;  3CX5 W;  2LIT A;  1CHI A;  1N9C A;  451C A;  1YTC A;  2FRC A;  2PCC B;  4DY9 A;  1NML A;  3MK7 B;  2MTA C;  5B5E V;  1H31 A;  1HH7 A;  1CYI A;  1LS9 A;  2C1D A;  3HQ6 A;  1A56 A;  4JCG A;  4EIC A;  1YIQ A;  4PJ0 V;  4WQD A;  2A06 D;  4K3I A;  4Y5R A;  2BCN B;  5TIS V;  3CYT I;  1CCH A;  1C75 A;  4AAM A;  3PRJ A;  3SXT A;  1ETP A;  3ZOW A;  5CYT R;  3HQ7 A;  4GYD A;  3SWS A;  2BH5 X;  2OZ1 B;  1YEA A;  1HJ4 A;  4FA9 A;  1DVV A;  1RZ5 A;  1BGY D;  1U74 B;  1SQX D;  2N3Y A;  1OAE A;  3A0H V;  3SLE A;  2MHM A;  1S6V B;  1RAQ A;  5C0Z A;  3CWB D;  1CED A;  1A8C A;  1CIH A;  2N3B A;  3RN0 A;  1AKK A;  2IBZ D;  1I6E A;  1LMS A;  1S5L V;  1GKS A;  2BLF B;  4KMG A;  4NFG B;  1B7V A;  1P84 D;  1KYO D;  1FI9 A;  3H1K D;  1CRY A;  1HZU A;  1N90 A;  2N18 B;  1NTK D;  2O3J A;  1C7M A;  5GTI V;  4QAO A;  4WQ9 A;  1F1C A;  1CO6 A;  1F1F A;  3L74 D;  155C A;  1CYJ A;  1WEJ F;  4H0K A;  1CIF A;  1H9Y A;  1DW1 A;  3WU2 V;  3MK7 C;  1I8P A;  2Y0C A;  3HQ8 A;  1W2L A;  5CIB B;  4D6T D;  3O1Y A;  1CTJ A;  3OCD B;  4PWA A;  1ZRT D;  1CHH A;  1KYO W;  3WC8 A;  2AXT V;  3SVW A;  2C9X B;  3GG2 A;  1GIW A;  4V2K A;  1KB9 D;  1MG2 D;  1CXA A;  1R0Q A;  3L71 D;  4O1W A;  3CU4 A;  1ZZH A;  1CSX A;  3HQ9 A;  3WUI A;  1N15 A;  1FOC A;  3ZIY A;  4EIF A;  3L70 D;  2BH4 X;  1L9J C;  1COT A;  3CXH W;  2B4Z A;  5GTH V;  3WFE C;  4UB6 V;  1KX2 A;  3X39 A;  1N50 A;  2ZBO A;  4O1Q A;  1M60 A;  2CE0 A;  1LFM A;  2B10 B;  3BCC D;  3PLN A;  3H1L D;  1FI7 A;  3L72 D;  4L1Q A;  3OA8 A;  1DII C;  2FYU D;  2RN0 A;  4Q5P A;  5E79 V;  5CIE B;  1YFC A;  1AYG A;  1VYD A;  1MZ4 A;  3L4O A;  5CID B;  4IL6 V;  1PP9 D;  3WFD C;  2JTI B;  3ZCF A;  2ZZS 1;  4UB8 V;  2N9Y B;  3WFC C;  1IO3 A;  1E29 A;  1CYC A;  1DT1 A;  3RMZ A;  4P4Q B;  3PXW A;  1J3S A;  1FHB A;  2YIU B;  3RN1 A;  4WQB A;  1HZV A;  2YCC A;  2BPB B;  5CIC B;  1FJ0 A;  1CXC A;  1CCR A;  1MG3 D;  3L4M A;  5KKZ B;  1CHJ A;  2FWL A;  2V08 A;  4AAO A;  2OZ1 A;  1I5T A;  1YEB A;  2BGV X;  5DJQ B;  1C2N A;  2N9J A;  2PCB B;  4PD4 D;  2C2C A;  2QJK B;  1C6S A;  2ZXY A;  5CIH B;  1CTZ A;  1C6R A;  3H1H D;  3ITK A;  2CA4 B;  2L91 A;  1IQC A;  4L3H A;  1H33 B;  2DGE A;  1NNO A;  1C52 A;  5B6Q A;  1YIC A;  1COR A;  1M6Z A;  4XYD B;  4EDF A;  2KNC B;  1GDV A;  1AOQ A;  4N0K A;  1BL9 A;  2V07 A;  3ZOY A;  3TYI A;  1K3G A;  1NMI A;  4XXL A;  2ZOO A;  3GW6 A;  3VYM A;  1CSV A;  3DR0 A;  3KHU A;  5CIG B;  1NU1 D;  3L73 D;  2QJP B;  1DW2 A;  1JDL A;  4A7P A;  1SQB D;  2YQB A;  3ZOO A;  2B11 B;  2RMZ A;  1L9B C;  2N9I A;  3OCD A;  5C9M A;  3CP5 A;  1NIR A;  4FAN A;  1BCC D;  2B0Z B;  4WQE A;  1SQV D;  2L4D A;  2Y0D A;  3PHL A;  1RAP A;  2CA3 B;  5AUR A;  3CX5 D;  1DVH A;  2KS1 A;  1W5C T;  4WQA A;  1BE3 D;  2ZON G;  1HJ3 A;  4FA4 A;  3PH2 B;  5DFS A;  1SQP D;  1CRH A;  3NWV A;  1AOF A;  1H32 B;  5IY5 1;  3JBT B;  2JQR A;  3TDK A;  3RLM A;  1DW3 A;  2K9J B;  1CSW A;  1FI3 A;  1HJ5 A;  1HCM A;  4H0J A;  1DW0 A;  2C1V A;  3L75 D;  2CE1 A;  3DP5 A;  1FCD C;  2N18 C;  1QN2 A;  4RSZ A;  1H31 B;  1YNR A;  3VMA A;  2C1D B;  3KZI V;  1NTM D;  2D0W A;  5EXQ A;  1E8E A;  5B66 V;  1GU2 A;  1E2R A;  3O5C A;  1EB7 A;  1YCC A;  2QJY B;  5KLI B;  4AX3 A;  1H9X A;  2LIR A;  3PXS A;  1QKS A;  1GJQ A;  3NBT A;  2Q3E A;  3PTZ A;  2DVH A;  1KX7 A;  4J20 A;  3SJL A;  2EXV A;  3DMI A;  4AAN A;  2GC7 D;  2ORL A;  351C A;  2I8F A;  3WFB C;  1CSU A;  2JWA A;  1CIG A;  5H2F V;  3NBS A;  4U3F D;  5KLV D;  4FA1 A;  1CTY A;  3O0R C;  4WQ8 A;  1IRW A;  3ZOX A;  1IRV A;  2PAC A;  2QG4 A;  2Y0E A;  4EIE A;  1CRI A;  4GED B;  1M70 A;  2AI5 A;  1CRC A;  2GIW A;  3A0B V;  1C6O A;  2XTS B;  2VHD A;  5KAI V;  1C2R A;  1KIB A; 
#chains in the Genus database with same CATH topology
 2QM7 A;  4FB1 A;  1BSN A;  2Q3I A;  4H13 C;  4WY4 A;  4TT3 H;  1FZB A;  1A2S A;  2WT7 A;  2AIU A;  1NU1 J;  3P8C D;  4XA4 A;  1HVV A;  1DIQ C;  1SQB J;  3TF5 A;  2J59 M;  5APW A;  4YE1 A;  1BCC J;  2E74 C;  1JY3 N;  1EC5 A;  2C8S A;  3M97 X;  2WSC J;  4PJ0 H;  3M06 A;  4LJI A;  5GTH E;  5AVR B;  1A02 F;  1GQ1 A;  2YK3 A;  1L0N D;  1Q2N A;  2FYZ A;  4I2L C;  5AW3 B;  3CC7 P;  1SQQ D;  1NVO A;  2XV5 A;  1QL2 A;  3U59 A;  3D6Y A;  2KSJ A;  4AAL A;  2XDJ A;  3Q5S A;  4FA5 A;  1YQ4 C;  5E79 E;  2QJK C;  1X9V A;  3L75 J;  2YKP A;  1NAF A;  2GB8 B;  3IN6 A;  2IX7 C;  3VNW A;  2BCC D;  4W7Y A;  1T2K C;  3G6E P;  1H32 A;  3TGU D;  2FXO A;  3CCS P;  1KFN A;  1NTZ D;  1Q82 Q;  1NTM J;  1GMJ A;  1N9C A;  1ZP0 C;  1YTC A;  1BDC A;  5AVS B;  1NU1 G;  2KZI A;  1GZL A;  3WMM 0;  4NPD A;  4H0L C;  5AVY B;  1SQB G;  1QGK B;  1EXJ A;  2NZ2 A;  2I1J A;  1BCC G;  4L76 A;  1HTL C;  3MUD C;  2WQY C;  1RE4 A;  3CC4 P;  4U3F J;  3GF3 A;  4C7N B;  2WSE J;  4AAM A;  1VQ4 P;  3ZOW A;  5L8R J;  1HJ4 A;  1VQ5 P;  3Q1M A;  1N2D C;  1S72 P;  4WWI A;  4H13 D;  1VDF A;  1AKK A;  2IBZ D;  2BCC G;  1S5L V;  3L75 G;  2WWW A;  1BSH A;  1L2P A;  1GDT A;  1P84 H;  2O01 J;  1Q86 Q;  1LTJ B;  1P84 D;  1NTM G;  1HZU A;  2N18 B;  1NTK D;  3W68 A;  3VP9 A;  1C7M A;  5GTI V;  1EDK A;  1ZN5 A;  2OYH C;  2ZT9 C;  3VP8 A;  1NGM B;  2E5Y A;  1M57 D;  3H25 A;  1F1C A;  2E74 D;  1CO6 A;  3L74 D;  1WEJ F;  3H1I J;  3CD6 P;  1H9Y A;  2B87 A;  1DW1 A;  3WU2 V;  1QEX A;  2HR3 A;  1RQU A;  1M7L A;  2Y0C A;  3VN0 A;  1K8A Q;  1JCC A;  4UB8 H;  3M9Q A;  3MTU E;  2KIK A;  1GL2 A;  1CHH A;  3WC8 A;  2AXT V;  2C9X B;  4U3F G;  1DEE G;  3H1J J;  1EDI A;  2JP3 A;  2JKV A;  2KS1 B;  1URQ A;  3VMY A;  1ZZH A;  2OTK E;  2QVA A;  1JMM A;  3ZIY A;  1NKZ B;  1ZW0 A;  3A0H H;  1IFJ A;  1RF1 C;  2BH4 X;  1T2K D;  1COT A;  1KQL A;  1L0L J;  3S4R A;  5APX A;  2H8P D;  3X39 A;  2MKV A;  1MV8 A;  2MJZ A;  2C9L Y;  3F89 A;  1RE3 C;  3PLN A;  2ZXE B;  4H13 B;  2V7Q J;  4JYC A;  3OA8 A;  1DII C;  2M8R A;  5B66 E;  2FYU D;  4Q5P A;  3CCV P;  3TSI A;  4TLF A;  3Q5P A;  1MZ4 A;  2Q9I A;  5CID B;  4IL6 V;  3E1I A;  1PP9 D;  3H1I G;  4AQR D;  2YO2 A;  4I6M C;  1L4A A;  2N9Y B;  2BAS A;  1JTH A;  3RK3 C;  2E74 B;  3V2R A;  1T3U A;  1SQP E;  2FYN C;  3AEG C;  3VTP C;  2O01 N;  2H43 A;  4P4Q B;  2FXM A;  3HUS A;  1U7J A;  3V2Q A;  1HF9 A;  2IDB A;  1HZV A;  4O9B A;  2Q5U A;  5AW5 B;  2Y9Z A;  1FJ0 A;  3KYQ A;  2CPS A;  3H1J G;  1AQ5 A;  4ASV A;  1CI6 B;  4Y99 C;  4DZO A;  2HPC A;  2FFD A;  1T3J A;  5KAI E;  2FWL A;  4AAO A;  1YEB A;  2M3E A;  2G8Y A;  3D6Z A;  2SPZ A;  1M1J A;  2PCB B;  1QVG O;  2QJK B;  3B8E B;  3CCU P;  1IFP A;  5CIH B;  3H1K J;  1C6R A;  2Z5H A;  2CA4 B;  2ZT9 D;  1CZQ A;  2DGE A;  1NNO A;  1VL2 A;  1W5C E;  2GA1 A;  2P58 A;  3RL0 C;  4XYD B;  2VRS A;  1AFO A;  1PP9 G;  3G3Z A;  4N0K A;  4H0L B;  5KLV E;  1NMI A;  4XXL A;  3GW6 A;  1JY3 P;  3DR0 A;  2KP8 A;  1SQX E;  1LGH B;  1DX7 A;  3KZI H;  3CWB E;  1JDL A;  1MFT A;  2W6J H;  1YTZ I;  2B11 B;  2N9I A;  3L70 J;  1JUN A;  1FC2 C;  3C1L A;  3CP5 A;  2L4D A;  1JY2 N;  1OIP A;  3P8C E;  2XU6 A;  1KYO E;  2XZR A;  2CPB A;  2ZON G;  5H2F H;  4RES B;  4C7R A;  1K04 A;  3BCC J;  3H1L J;  2WPV B;  2R5B A;  5DFS A;  3I55 P;  1CRH A;  2WZ7 A;  3NWV A;  3H1K G;  3TNU A;  2JQR A;  2M0B A;  3TDK A;  1NOH A;  1SS1 A;  3B4S A;  1HJ5 A;  1EQ7 A;  4H0J A;  2V4H A;  1BDD A;  3RK3 D;  1LTB C;  4PJ0 E;  2OYH B;  2ZT9 B;  4EIJ A;  4IL6 X;  1MUU A;  1L0N E;  1OWA A;  4YXW H;  1Y47 A;  1NJI Q;  4H44 B;  5EXQ A;  1E8E A;  1SQQ E;  1E2R A;  3O5C A;  3EWK A;  3WUT A;  1IFD A;  2KLU A;  3SSU A;  1LTG C;  3L35 A;  3I56 P;  3VMZ A;  2PAJ A;  1KX7 A;  3SJL A;  4AAN A;  2M3B A;  3TGU E;  3NFQ A;  3L70 G;  1NTZ E;  3V5B A;  2WTY A;  3I5C A;  1U57 A;  3H1H J;  1IRW A;  1RF1 B;  3T97 A;  5KJ7 C;  4WB4 A;  2E75 C;  1OVU A;  1ZV8 A;  3RL0 D;  1C6O A;  2XTS B;  2FKW B;  3OJA B;  5AW2 B;  1AVO A;  2HOD B;  1NYH A;  2WPR A;  2XND H;  1KB0 A;  1HJ0 A;  3JSV C;  1H33 A;  1FDM A;  1CRJ A;  1U75 B;  1Y9B A;  2IFM A;  5KAF V;  5BVZ A;  4I7Z C;  5CCG A;  2CXB A;  3LW5 H;  3L73 J;  3C2C A;  1YJN P;  3O20 A;  2KNC A;  2JWD A;  4NPF X;  3S1K A;  4WQ7 A;  3CXH H;  1KYO I;  5B5E H;  1QL4 A;  2FYN B;  1QL3 A;  2IBZ E;  2B12 B;  1SQV J;  1VF5 C;  3CXH D;  1I55 A;  4OVN F;  1SQB K;  5AVT B;  1P84 E;  1ZLL A;  4Y99 B;  3WUU A;  1NTK E;  1SQP J;  2C1U A;  2W6B A;  3G9R A;  2JEE A;  2LXB A;  3MP7 B;  2WSF J;  3H1H G;  2KUB A;  4PW9 B;  4L3G A;  2K1A A;  1KIL A;  3KDP B;  5APU A;  3MHV A;  1H89 A;  1K3H A;  2OTL P;  2GUS A;  3SWK A;  1OZH A;  5KAI H;  3O8Z A;  3EQ2 A;  1H1O A;  1W2E A;  5BU5 A;  3FWL A;  2GC4 D;  3CX5 W;  3RL0 B;  2D2C C;  4UB8 E;  1IO4 A;  3FX0 A;  4AYC A;  1N7S A;  2HG5 D;  2PCC B;  1S4X A;  3L73 G;  2JJL A;  1H31 A;  1KV4 A;  2C1D A;  1NTM K;  2IFN A;  3AE3 C;  3CCQ P;  3HQ6 A;  4JCG A;  1TU3 F;  2N1T C;  1IFM A;  5M1B A;  4B86 A;  1BE3 E;  2E5T A;  2A06 D;  2WIT A;  4XE5 B;  5AVQ B;  5KLV J;  5TIS V;  1FZA A;  1CCH A;  1GL2 C;  1DD4 A;  5CCH A;  5KJ7 D;  1ETP A;  3HQ7 A;  2FYU E;  2E75 D;  4GYD A;  2OZ1 B;  3K5B A;  1SQP G;  1U74 B;  1SQX D;  1LWU A;  1GU4 A;  3A0H V;  3GHG A;  1N73 C;  2MHM A;  1S6V B;  1RAQ A;  3CWB D;  2BEZ F;  5EFW B;  3NMD A;  1HH0 A;  3U1C A;  2OYI C;  1LMS A;  3L36 A;  3R2P A;  1S9K E;  3HTK A;  2BLF B;  4KMG A;  1KYO H;  5CBN A;  4NFG B;  1KYO D;  2IBZ I;  2WT7 B;  4QAO A;  3GMA A;  1F1F A;  1VF5 D;  1P84 I;  4H0K A;  2QM8 A;  3D0W A;  3AEA C;  3AE6 C;  3MK7 C;  1I8P A;  1L4A C;  5KLI C;  2XNX A;  5CIB B;  4D6T D;  1VQN P;  1CTJ A;  1L0N J;  3OCD B;  1ZME C;  4PWA A;  1LTT C;  1JY2 P;  4HJG H;  2P67 A;  5KLV G;  4OGQ C;  1A02 J;  4V2K A;  1FU1 A;  2YO3 A;  1SQQ J;  1R0Q A;  3L71 D;  4O1W A;  1CSX A;  2WSC H;  3M0D A;  1N15 A;  1FOC A;  4R4M A;  2BCC J;  4BXL A;  2O1K A;  2E75 B;  3TGU J;  5GTH V;  2R32 A;  1NTZ J;  2D2C D;  3SFD C;  1M60 A;  1IZN B;  1MZ9 A;  2CE0 A;  5K5G B;  2ZAE B;  2UWJ E;  3KZI E;  3BAT A;  2L5G B;  1L0L K;  1HWT C;  3A3Y B;  4HYT B;  3V2N A;  5E79 V;  4I7Z B;  2B9B A;  1AYG A;  1PIX A;  2N1T D;  2P1J A;  2HYN A;  3CMA P;  4HKZ H;  2JTI B;  4YPC A;  3ZCF A;  2ZZS 1;  1GL2 D;  5H2F E;  1VF5 B;  1PGO A;  1FHB A;  4EI2 A;  1L0N G;  4L75 A;  2YCC A;  2BPB B;  2N9B A;  1PL5 A;  1SQQ G;  1CCR A;  1MG3 D;  4C7N A;  1H0T B;  3L4M A;  3HD7 C;  1CHJ A;  1JM0 A;  3ABV C;  3RK3 E;  4PD4 H;  2V08 A;  4BRY B;  1I5T A;  3HE5 B;  1YBK A;  1JCD A;  2WSE H;  4PD4 D;  2G3A A;  1YIJ P;  3TGU G;  1NTZ G;  3AEC C;  1NTK J;  2HFE D;  1IQC A;  5DJU B;  4JPZ B;  2FBW C;  3FXD A;  3L74 J;  1C52 A;  2KI7 B;  4DOJ A;  3IAO A;  1COR A;  1LTJ A;  4EDF A;  2JO1 A;  1L4A D;  1GDV A;  2V07 A;  1IK9 A;  1K3G A;  5BU8 B;  1CSV A;  3KHU A;  4OGQ D;  3O6Q B;  1BGY E;  2N1T B;  1M1K Q;  4OWF A;  1JY3 O;  5APQ A;  2OQQ A;  1DW2 A;  3AEF C;  3ZOO A;  2KXP B;  1EXI A;  2AEJ A;  1GL2 B;  1KQS O;  1QX8 A;  1L9B C;  2YXQ B;  2Q1K A;  1NIR A;  1N86 A;  2Q6Q A;  3KXD A;  1LT9 C;  2K37 A;  2IBZ G;  5AUR A;  1N73 B;  2KS1 A;  1BE3 D;  1SFC A;  2GM4 A;  2OYI B;  4FA4 A;  1NHL A;  3PH2 B;  2FYU J;  4BWN A;  4PV1 C;  2K88 A;  3JBT B;  1NTK G;  1USD A;  1FDO A;  3RLM A;  1RHZ B;  2K9J B;  3CXH E;  3H32 A;  1CSW A;  1LNQ A;  3Q3D A;  5B5E E;  3A0B H;  1PP9 J;  3L74 G;  1DW0 A;  1FCD C;  1NKN A;  4RSZ A;  1M56 D;  5CCG C;  3ZDM A;  3FWN A;  1NH4 A;  1J1D C;  3VMA A;  1D7M A;  5APY A;  5AW1 B;  1S9K D;  2W27 A;  1OW7 A;  3A7O A;  5B66 V;  3NTN A;  3G71 P;  1EB7 A;  5KLI B;  4AX3 A;  1H9X A;  1DH3 A;  1QKS A;  1OX3 A;  3HD7 D;  2Q3E A;  3CPW O;  3PTZ A;  4J20 A;  4OGQ B;  2GC7 D;  351C A;  1GW3 A;  2YMK A;  1CSU A;  4GOE A;  3GLM A;  1LTA C;  4RO0 A;  3NBS A;  3L72 E;  1BE3 G;  1CI6 A;  3ZOX A;  2C0X A;  1S5L X;  3KPE A;  2R3S A;  2B89 A;  1CRI A;  2KSE A;  4IFD K;  2AI5 A;  2FYU G;  2VHD A;  5KAI V;  1GD2 E;  1FJP A;  5KTB A;  5CMZ A;  1J2J B;  3JC2 2;  3E7K A;  2LXC B;  2A06 E;  1SP4 A;  3MD0 A;  1LC1 A;  3Q2Y A;  2E43 A;  3RBX A;  3AED C;  4EID A;  2P7J A;  3NXS A;  5CIF B;  1IZL 0;  4MN4 C;  1GK6 A;  2KLV A;  1PZQ A;  1LP1 B;  4RJT A;  2JDI H;  2IYO A;  1Q81 Q;  2H88 C;  1HRO A;  1KV9 A;  1M8O B;  2QRX A;  1EZV D;  3B71 A;  1HGV A;  4GOD A;  3A9F A;  1I8O A;  1CSB A;  3Q5R A;  1FZC C;  3N4X A;  2NRG A;  1WVE C;  2AXC A;  4UB6 E;  1G2C B;  3HD7 B;  4IFM A;  3CXH I;  1PPJ D;  1SQV K;  4JYB A;  1CIE A;  1R8E A;  4PV1 D;  1I6D A;  3CME P;  1K73 Q;  1I54 A;  3GHG C;  5DJQ C;  1WT6 A;  1CC5 A;  3ORV A;  3P8M C;  2WSS H;  3VRD A;  4JQ0 D;  1PGJ A;  1HJB A;  3V4Q A;  2NPS A;  1SQP K;  1YJW P;  2D0S A;  2QSI A;  3EFF K;  1OCD A;  4WY4 C;  5CCG D;  2IZ0 A;  4D6T E;  1VQM P;  1S5L H;  2OYO A;  1VQO P;  1W2B O;  1RF0 A;  1OXZ A;  3PH0 A;  1EDL A;  2Z5I A;  2FRC A;  2ZYD A;  3L71 E;  4DY9 A;  1NML A;  2R44 A;  3CC2 P;  2MTA C;  1IFN A;  1LS9 A;  1DEB A;  3V2P A;  5GTI H;  1HUC A;  3AE2 C;  3CX5 E;  2W90 A;  1FZE A;  1YIQ A;  4PJ0 V;  4WQD A;  4Z1M H;  2QJP C;  4K3I A;  3WU2 H;  2BCN B;  4IFF A;  3CYT I;  1QVF O;  3SXT A;  1FS0 E;  3SWS A;  1OMI A;  2AXT H;  1LT9 B;  4FA9 A;  3B5N A;  1RZ5 A;  1BGY D;  2N3Y A;  1ZOY C;  3L75 E;  5KLV K;  3G4S P;  5C0Z A;  1VQK P;  1CED A;  2E76 C;  1XTC C;  3E1R A;  2N3B A;  4Y28 J;  1LJ2 A;  1RF1 A;  3RN0 A;  1KQG B;  5APV A;  1KN7 A;  1HBW A;  3L4F A;  1NTM E;  3AE1 C;  1GKS A;  4EYY Q;  3OW2 O;  3R4Y A;  4GOF A;  1VQ8 P;  1B7V A;  3LW5 J;  3CI9 A;  2HOD A;  1RE3 A;  4GIF A;  1N90 A;  1T8Z A;  1KZU B;  1JNM A;  3RK3 B;  1VQP P;  2M5A B;  1NU1 K;  3JCU H;  2QE7 H;  4PD4 E;  4IL6 H;  4U3F E;  1AV1 A;  1NWQ A;  2A45 H;  1J1E C;  3MIW A;  1RE4 C;  1X22 A;  1ZRT D;  1KB9 H;  1KYO W;  3GG2 A;  3RBZ A;  1KB9 D;  3HE4 B;  1BGY G;  2B88 A;  2ZYG A;  1PV3 A;  3CU4 A;  3HQ9 A;  1LTI C;  1L0N K;  3UIA A;  5AVZ B;  4WY4 D;  3EFG A;  1SQQ K;  1KX2 A;  1FDI A;  5DJT B;  2J5U A;  5APS A;  1LFM A;  3OAK A;  1NO4 A;  1KC8 Q;  1FI7 A;  3L72 D;  4L1Q A;  1MKM A;  2RN0 A;  3SWY A;  1NTZ K;  4HH2 A;  5CIE B;  1UII A;  1YFC A;  2IYP A;  3L4O A;  3CCE P;  4LGD E;  3SWF A;  2ZVN B;  1Q7Y Q;  3WFD C;  2HLO A;  4N78 E;  4UB8 V;  4KJM A;  3WFC C;  4LLH A;  1IO3 A;  5AW6 B;  3TK1 A;  3USS A;  2C0W A;  1E29 A;  3H1J E;  1CYC A;  1K05 A;  1DT1 A;  2PRR A;  2IZ1 A;  1CW5 A;  3PXW A;  1J3S A;  1FZC B;  3RN1 A;  1SQX J;  4WQB A;  5CIC B;  2POH A;  2PP6 A;  1CXC A;  3CWB J;  2E76 D;  1URQ C;  2CK3 H;  1L0L E;  3U1A A;  3A0B E;  3V4W A;  2OZ1 A;  3A5T A;  5AW4 B;  5DJQ B;  1KQF B;  4WBA A;  1C2N A;  3RK2 C;  2C2C A;  1SFC C;  4UB6 H;  2I1K A;  3M9B A;  5C39 A;  1OVR A;  3AE5 C;  2L91 A;  4WY4 B;  3L72 G;  4ZMD A;  4PD4 I;  3VYI A;  1VPC A;  2RKL A;  1GU5 A;  1M6Z A;  3BAS A;  1NTK K;  1R5L A;  1AOQ A;  1JB0 J;  1BL9 A;  3ZOY A;  3TYI A;  2FXP A;  4JF7 A;  4D6T J;  2ZOO A;  2A06 G;  1E5W A;  1ZR2 A;  2LR2 A;  1VQ6 P;  5CIG B;  1NU1 D;  3PP5 A;  2Y9Y A;  2K9Y A;  2QJP B;  1IK7 A;  3HUS C;  1LT1 A;  2OAR A;  3L71 J;  1SQB D;  1T6A A;  3CLQ A;  3CL3 D;  1RH5 B;  2J58 A;  1SQX G;  4ZKP A;  3OCD A;  5C9M A;  3QH9 A;  2FFD C;  3CWB G;  1FOS F;  1BCC D;  2W83 C;  4WQE A;  2Y0D A;  3CX5 H;  3WUV A;  3PHL A;  4YTP C;  1RAP A;  3CX5 D;  1DVH A;  1M1J C;  5AVW B;  2YNY A;  3H1K E;  2E76 B;  4WQA A;  1HJ3 A;  3II6 A;  5KJ7 A;  1H32 B;  1G1I A;  1EZV E;  4QMA A;  1DW3 A;  1FI3 A;  1VQ7 P;  3S9O A;  1N7L A;  3H6P A;  4ASW A;  5AVV B;  5AW8 B;  3L75 D;  4ZKU A;  2FYU K;  1Q90 D;  1FJK A;  1AVY A;  1YNR A;  1PPJ E;  5KAF H;  3KZI V;  1NTM D;  3V6I A;  4D6T G;  1OVV A;  3IFM A;  1FZG A;  1H88 A;  1J1E B;  1URQ D;  4C46 A;  2LIR A;  1OW8 A;  3PXS A;  3L70 E;  3CCJ P;  3NBT A;  3L71 G;  1U7M A;  4W7Z A;  5CHX A;  2EXV A;  3DMI A;  2ORL A;  2I8F A;  3RK2 D;  2JWA A;  1IFI A;  2YXR B;  1CIG A;  2H7H A;  1SFC D;  3BCC E;  5H2F V;  1S5L E;  3H1L E;  1VQ9 P;  4U3F D;  3P7K A;  1H0T A;  4FA1 A;  4WQ8 A;  1XTG B;  1IRV A;  2PAC A;  2Y0E A;  4BRY A;  4EIE A;  3HE5 A;  1CRC A;  3FGA D;  3C9I A;  5GTI E;  1PFI A;  1YI2 P;  1OW6 A;  2D2C B;  2NPS C;  2IPP A;  1AQT A;  3GF7 A;  2PFX A;  1LTS C;  2KK7 A;  1YJ9 P;  3ZBM A;  2WPS A;  3RGU A;  1X8Y A;  3PXT A;  3C8V A;  3IF4 A;  4FAV A;  2O01 H;  1RF0 C;  3WU2 E;  5AW9 B;  1E79 H;  1KIL E;  1SVF A;  3AE8 C;  1FBM A;  1ZXG A;  2B87 B;  4WQC A;  4EOT A;  2AXT E;  1YIT P;  2Q7C A;  1PGP A;  1JO5 A;  2I8D A;  1RZ6 A;  3SFE C;  1QYZ A;  4H44 C;  5DF5 A;  3O6Q A;  2N1T A;  1WMK A;  2AEF A;  1CNO A;  3H1I D;  1FZF A;  2YIU C;  3AEB C;  5TJH A;  4MU8 A;  3H1H E;  1URQ B;  1BE3 J;  1EZV I;  5TIS H;  2HV4 A;  2E42 A;  4N78 D;  5KKZ C;  3B5N C;  1CRG A;  3RK2 B;  3H1J D;  1GK4 A;  1N73 A;  1SFC B;  1LC2 A;  1IC2 A;  2OYI A;  4DT0 A;  3AE4 C;  3VMX A;  3JCU E;  3OA8 B;  4IL6 E;  1L0L D;  2ZFC A;  1HRC A;  3H32 B;  1ZRT E;  2K9J A;  3L73 E;  2LIT A;  1CHI A;  451C A;  2AEM A;  2KOG A;  1KB9 E;  4H0L D;  3QWO C;  2V7Q H;  3MK7 B;  5AVU B;  3L37 A;  5B5E V;  1L4A B;  1HH7 A;  1JTH B;  1SQV E;  5CBO A;  1CYI A;  3P32 A;  1A56 A;  4GDO A;  4EIC A;  4R4L A;  3HUS B;  2W6A A;  5APT A;  4Y5R A;  3TYY A;  2Z4E A;  4GKG A;  1C75 A;  2HPC B;  2FFD B;  3PRJ A;  4HB1 A;  1KMI Z;  5CYT R;  2P10 A;  2BH5 X;  1YEA A;  1DVV A;  2WMM A;  1R5S A;  1M1J B;  3BVH A;  1OAE A;  3SLE A;  2BEQ D;  1FE6 A;  1KIL C;  2NPS D;  1A8C A;  1CIH A;  1AA0 A;  2ZJS E;  1JMB A;  1I6E A;  4L74 A;  1L0L G;  4IOI H;  5GTH H;  1Z56 A;  4RKU J;  1FI9 A;  4DJG A;  3BRV B;  3H1K D;  1CRY A;  1N7S C;  1Y8A A;  2WPQ A;  2O3J A;  4WQ9 A;  4H44 D;  5E79 H;  2YKO A;  3LIE A;  155C A;  1CYJ A;  1LP1 A;  2QEX P;  3MGN A;  1CIF A;  1S1C X;  2ZYA A;  2LKM A;  1JOC A;  3MZW B;  2QJY C;  2H89 C;  1YHQ P;  3HQ8 A;  1W2L A;  3MUD A;  3CCM P;  4CPG A;  3O1Y A;  5CCH C;  1RQV A;  3B5N D;  3SVW A;  2YMY A;  1GIW A;  2KYV A;  3FXE A;  1MG2 D;  1CXA A;  2R3C A;  1LWU C;  1RY3 A;  1G2C A;  2A45 I;  3WUI A;  3HD7 A;  2KZJ A;  4EIF A;  5CJ0 A;  3HRN A;  3L70 D;  1L9J C;  3CXH W;  5AVX B;  2B4Z A;  1KB9 I;  3WFE C;  4UB6 V;  3TNU B;  1N50 A;  2ZBO A;  4O1Q A;  1NU1 E;  3BRT B;  1UIX A;  2KB7 P;  2NPS B;  4ZNC A;  3PJS K;  3W67 A;  1SQB E;  2B10 B;  3BCC D;  3H1L D;  3F5H A;  1YQ3 C;  2OYH A;  4DCK A;  1BCC E;  1X0T A;  1VYD A;  1IJD B;  1EZV G;  1FOS E;  1JEK A;  1ZR4 A;  3D71 A;  5AW7 B;  1USE A;  2R5D A;  5AW0 B;  3RMZ A;  3A2A A;  2DW3 A;  4K3A A;  1YTZ T;  2YIU B;  1PPJ G;  1BGY J;  1KIL D;  3M0A A;  3AE9 C;  2BCC E;  3M0D C;  5KKZ B;  1KOR A;  3T97 B;  3B5N B;  4LC1 A;  2QA4 P;  1LT9 A;  2BGV X;  1SQX K;  4AUW A;  4PV1 B;  2N9J A;  2P2U A;  1H8A A;  1X79 B;  5KAF E;  1C6S A;  2ZXY A;  1CTZ A;  1N7S D;  3H1H D;  4YXD C;  3ITK A;  2YKQ A;  3BCC G;  2JR8 A;  3H1L G;  4L3H A;  1H33 B;  1KFM A;  5B6Q A;  1YIC A;  4NPE A;  1J1D B;  1AJY A;  1YYC A;  5CJ4 A;  2KNC B;  1DIP A;  2OTJ P;  2K3R A;  4GT1 A;  3VYM A;  3M9H A;  5CCH D;  2M5A A;  4L73 A;  3L73 D;  5B66 H;  1KD1 Q;  4A7P A;  3D70 A;  2YQB A;  2ZVO B;  3CCL P;  1JY2 O;  1OFC X;  2RMZ A;  1KTM A;  4FAN A;  2B0Z B;  1SQV D;  2W8Z A;  4WVZ A;  3HE4 A;  4M3L A;  2CA3 B;  2ITA A;  1KIL B;  1W5C T;  3VOP A;  4KT0 J;  3L72 J;  2WSF H;  3RL0 g;  1SQP D;  1S3J A;  3L74 E;  1AOF A;  2O1J A;  5IY5 1;  4K35 A;  3CX5 I;  3H1I E;  3IR9 A;  1LTJ C;  1HCM A;  2C1V A;  2RH0 A;  1N7S B;  2CE1 A;  2WVR A;  3DP5 A;  1VQL P;  3AE7 C;  3OA7 A;  1QLE D;  2N18 C;  1QN2 A;  1SLQ A;  1H31 B;  4N3Y B;  2C1D B;  3M91 A;  1QL1 A;  4XFJ A;  1G1J A;  5TIS E;  2D0W A;  2A45 G;  2OGU A;  1GU2 A;  4KHX A;  4I1L A;  1YCC A;  2QJY B;  2PGD A;  1GJQ A;  1GW4 A;  3N7N A;  4U7J A;  3A0H E;  2DVH A;  1EDJ A;  1N8R Q;  1FZC A;  1SQV G;  2XKM A;  3KQG A;  3WFB C;  1FAV A;  1LWU B;  3GHG B;  1NAY A;  3LID A;  5KLV D;  1GTW A;  2GUV A;  1CTY A;  3O0R C;  1HGZ A;  1MFZ A;  2QG4 A;  3CCR P;  2ZXX A;  4N6J A;  2QIW A;  4GED B;  3AEE C;  3HTK B;  1M70 A;  4OH8 B;  1PGQ A;  1WRG A;  2GIW A;  3A0B V;  1PP9 E;  1K9M Q;  4JBZ A;  1C2R A;  2FY8 A;  1M90 Q;  1KIB A;  1DD3 A;  2C9N Y;  1S2E A;  4W80 A; 
#chains in the Genus database with same CATH homology
 1LC1 A;  1KB0 A;  3ZBM A;  4FB1 A;  1H33 A;  3PXT A;  1CRJ A;  1U75 B;  4EID A;  4FAV A;  5CIF B;  5KAF V;  1A2S A;  1IZL 0;  2AIU A;  2CXB A;  1DIQ C;  3C2C A;  3O20 A;  4RJT A;  3TF5 A;  4WQC A;  1HRO A;  1KV9 A;  4WQ7 A;  1RZ6 A;  4YE1 A;  1QL4 A;  1EZV D;  2FYN B;  1QL3 A;  1QYZ A;  5DF5 A;  2B12 B;  3A9F A;  3CXH D;  1CNO A;  1I8O A;  3H1I D;  2C8S A;  3M97 X;  1I55 A;  5TJH A;  4MU8 A;  1WVE C;  4LJI A;  1GQ1 A;  2YK3 A;  2HV4 A;  1L0N D;  1PPJ D;  1CIE A;  2C1U A;  1I6D A;  1CRG A;  4PW9 B;  3H1J D;  1I54 A;  4L3G A;  1SQQ D;  5DJQ C;  4AAL A;  1CC5 A;  3ORV A;  4FA5 A;  1LC2 A;  3VRD A;  1K3H A;  2GB8 B;  2D0S A;  3VNW A;  2BCC D;  1H1O A;  1OCD A;  3OA8 B;  1H32 A;  1L0L D;  3TGU D;  1HRC A;  3FWL A;  2GC4 D;  1NTZ D;  3CX5 W;  2LIT A;  1CHI A;  1N9C A;  451C A;  1YTC A;  2FRC A;  2PCC B;  4DY9 A;  1NML A;  3MK7 B;  2MTA C;  5B5E V;  1H31 A;  1HH7 A;  1CYI A;  1LS9 A;  2C1D A;  3HQ6 A;  1A56 A;  4JCG A;  4EIC A;  1YIQ A;  4PJ0 V;  4WQD A;  2A06 D;  4K3I A;  4Y5R A;  2BCN B;  5TIS V;  3CYT I;  1CCH A;  1C75 A;  4AAM A;  3PRJ A;  3SXT A;  1ETP A;  3ZOW A;  5CYT R;  3HQ7 A;  4GYD A;  3SWS A;  2BH5 X;  2OZ1 B;  1YEA A;  1HJ4 A;  4FA9 A;  1DVV A;  1RZ5 A;  1BGY D;  1U74 B;  1SQX D;  2N3Y A;  1OAE A;  3A0H V;  3SLE A;  2MHM A;  1S6V B;  1RAQ A;  5C0Z A;  3CWB D;  1CED A;  1A8C A;  1CIH A;  2N3B A;  3RN0 A;  1AKK A;  2IBZ D;  1I6E A;  1LMS A;  1S5L V;  1GKS A;  2BLF B;  4KMG A;  4NFG B;  1B7V A;  1P84 D;  1KYO D;  1FI9 A;  3H1K D;  1CRY A;  1HZU A;  1N90 A;  2N18 B;  1NTK D;  2O3J A;  1C7M A;  5GTI V;  4QAO A;  4WQ9 A;  1F1C A;  1CO6 A;  1F1F A;  3L74 D;  155C A;  1CYJ A;  1WEJ F;  4H0K A;  1CIF A;  1H9Y A;  1DW1 A;  3WU2 V;  3MK7 C;  1I8P A;  2Y0C A;  3HQ8 A;  1W2L A;  5CIB B;  4D6T D;  3O1Y A;  1CTJ A;  3OCD B;  4PWA A;  1ZRT D;  1CHH A;  1KYO W;  3WC8 A;  2AXT V;  3SVW A;  2C9X B;  3GG2 A;  1GIW A;  4V2K A;  1KB9 D;  1MG2 D;  1CXA A;  1R0Q A;  3L71 D;  4O1W A;  3CU4 A;  1ZZH A;  1CSX A;  3HQ9 A;  3WUI A;  1N15 A;  1FOC A;  3ZIY A;  4EIF A;  3L70 D;  2BH4 X;  1L9J C;  1COT A;  3CXH W;  2B4Z A;  5GTH V;  3WFE C;  4UB6 V;  1KX2 A;  3X39 A;  1N50 A;  2ZBO A;  4O1Q A;  1M60 A;  2CE0 A;  1LFM A;  2B10 B;  3BCC D;  3PLN A;  3H1L D;  1FI7 A;  3L72 D;  4L1Q A;  3OA8 A;  1DII C;  2FYU D;  2RN0 A;  4Q5P A;  5E79 V;  5CIE B;  1YFC A;  1AYG A;  1VYD A;  1MZ4 A;  3L4O A;  5CID B;  4IL6 V;  1PP9 D;  3WFD C;  2JTI B;  3ZCF A;  2ZZS 1;  4UB8 V;  2N9Y B;  3WFC C;  1IO3 A;  1E29 A;  1CYC A;  1DT1 A;  3RMZ A;  4P4Q B;  3PXW A;  1J3S A;  1FHB A;  2YIU B;  3RN1 A;  4WQB A;  1HZV A;  2YCC A;  2BPB B;  5CIC B;  1FJ0 A;  1CXC A;  1CCR A;  1MG3 D;  3L4M A;  5KKZ B;  1CHJ A;  2FWL A;  2V08 A;  4AAO A;  2OZ1 A;  1I5T A;  1YEB A;  2BGV X;  5DJQ B;  1C2N A;  2N9J A;  2PCB B;  4PD4 D;  2C2C A;  2QJK B;  1C6S A;  2ZXY A;  5CIH B;  1CTZ A;  1C6R A;  3H1H D;  3ITK A;  2CA4 B;  2L91 A;  1IQC A;  4L3H A;  1H33 B;  2DGE A;  1NNO A;  1C52 A;  5B6Q A;  1YIC A;  1COR A;  1M6Z A;  4XYD B;  4EDF A;  2KNC B;  1GDV A;  1AOQ A;  4N0K A;  1BL9 A;  2V07 A;  3ZOY A;  3TYI A;  1K3G A;  1NMI A;  4XXL A;  2ZOO A;  3GW6 A;  3VYM A;  1CSV A;  3DR0 A;  3KHU A;  5CIG B;  1NU1 D;  3L73 D;  2QJP B;  1DW2 A;  1JDL A;  4A7P A;  1SQB D;  2YQB A;  3ZOO A;  2B11 B;  2RMZ A;  1L9B C;  2N9I A;  3OCD A;  5C9M A;  3CP5 A;  1NIR A;  4FAN A;  1BCC D;  2B0Z B;  4WQE A;  1SQV D;  2L4D A;  2Y0D A;  3PHL A;  1RAP A;  2CA3 B;  5AUR A;  3CX5 D;  1DVH A;  2KS1 A;  1W5C T;  4WQA A;  1BE3 D;  2ZON G;  1HJ3 A;  4FA4 A;  3PH2 B;  5DFS A;  1SQP D;  1CRH A;  3NWV A;  1AOF A;  1H32 B;  5IY5 1;  3JBT B;  2JQR A;  3TDK A;  3RLM A;  1DW3 A;  2K9J B;  1CSW A;  1FI3 A;  1HJ5 A;  1HCM A;  4H0J A;  1DW0 A;  2C1V A;  3L75 D;  2CE1 A;  3DP5 A;  1FCD C;  2N18 C;  1QN2 A;  4RSZ A;  1H31 B;  1YNR A;  3VMA A;  2C1D B;  3KZI V;  1NTM D;  2D0W A;  5EXQ A;  1E8E A;  5B66 V;  1GU2 A;  1E2R A;  3O5C A;  1EB7 A;  1YCC A;  2QJY B;  5KLI B;  4AX3 A;  1H9X A;  2LIR A;  3PXS A;  1QKS A;  1GJQ A;  3NBT A;  2Q3E A;  3PTZ A;  2DVH A;  1KX7 A;  4J20 A;  3SJL A;  2EXV A;  3DMI A;  4AAN A;  2GC7 D;  2ORL A;  351C A;  2I8F A;  3WFB C;  1CSU A;  2JWA A;  1CIG A;  5H2F V;  3NBS A;  4U3F D;  5KLV D;  4FA1 A;  1CTY A;  3O0R C;  4WQ8 A;  1IRW A;  3ZOX A;  1IRV A;  2PAC A;  2QG4 A;  2Y0E A;  4EIE A;  1CRI A;  4GED B;  1M70 A;  2AI5 A;  1CRC A;  2GIW A;  3A0B V;  1C6O A;  2XTS B;  2VHD A;  5KAI V;  1C2R A;  1KIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...