1BGYD

Cytochrome bc1 complex from bovine
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 58
structure length 241
sequence length 241
chains with identical sequence P
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1bgyD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1bgyD01
1AKKA 2BPBB 3WUIA 1F1FA 1RAPA 1CXCA 2B0ZB 1WVEC 1CHJA 3TYIA 5DFSA 1CHIA 1N15A 1C2NA 4AANA 2QJPB 2D0WA 2VHDA 3HQ9A 3CP5A 2FRCA 5B6QA 3PH2B 1OAEA 1MG3D 1GU2A 2C1UA 1COTA 2YCCA 5CIGB 4AAOA 3RN1A 3WC8A 5TJHA 1H33A 2BGVX 1HROA 2V08A 2EXVA 4FA9A 5CIBB 1YNRA 1FI3A 3TGUD 1BE3D 3NBTA 1J3SA 5KAFV 4N0KA 1NMIA 4MU8A 4EDFA 2ZZS1 3FWLA 3L70D 1ZZHA 1CORA 4XYDB 1DW2A 1DW3A 1N50A 3O5CA 2OZ1A 1MG2D 1CYIA 1CHHA 1DW1A 1CCRA 1M70A 2A06D 2YQBA 1DT1A 2Q3EA 1KIBA 1NU1D 2HV4A 1HZUA 4IL6V 1I5TA 4H0JA 2AI5A 3O20A 1SQBD 2BCCD 4AX3A 4NFGB 1CIEA 3PXWA 3HQ6A 3C2CA 1CRCA 1KX2A 3O0RC 2BCNB 4EIDA 1KX7A 1C52A 4Y5RA 3CWBD 1WEJF 2LIRA 1HRCA 3JBTB 1I55A 1OCDA 3O1YA 4FAVA 1K3HA 2C2CA 3WFDC 3M97X 1W2LA 3H1ID 3ORVA 3ITKA 3ZCFA 1CSXA 4UB8V 2L4DA 1YTCA 1A2SA 1HJ3A 1KV9A 1L9BC 1C6SA 1VYDA 2ZBOA 5B5EV 3H1HD 3H1LD 1QN2A 4WQ8A 1GQ1A 1FHBA 1FCDC 1NTZD 2JWAA 2C9XB 1CSVA 2OZ1B 5TISV 2DGEA 2JQRA 3DMIA 2N3YA 4WQCA 1SQVD 4FA5A 1HCMA 1GKSA 2MTAC 1EZVD 3L4OA 2I8FA 1FOCA 1A8CA 1NTKD 1BGYD 1QL4A 1FI7A 2Y0DA 2B10B 1CC5A 1LC2A 1CCHA 2KS1A 1YEBA 1CSUA 4WQBA 2FYNB 1KYOW 1CEDA 3BCCD 1PPJD 4UB6V 3ZOXA 4P4QB 5B66V 2C1VA 1H9XA 1LFMA 2N18C 2ZXYA 3MK7C 3OCDB 4PWAA 1GIWA 3VMAA 2D0SA 2GC4D 2YIUB 3PHLA 5CIHB 5GTIV 2GC7D 1CRHA 1CRYA 3PTZA 1NMLA 2PCCB 4Q5PA 4K3IA 1C7MA 3A0BV 2GIWA 3OA8B 4O1QA 3HQ7A 1CYJA 2BLFB 2N18B 2DVHA 3MK7B 4A7PA 3L4MA 2LITA 5IY51 351CA 1B7VA 1P84D 2Y0CA 3A0HV 5CIDB 4WQEA 3CYTI 1U75B 1S6VB 1C2RA 4O1WA 2RMZA 2CXBA 5C9MA 1JDLA 1ZRTD 2ORLA 1BCCD 2AXTV 1H31A 3OCDA 1CRIA 2QJYB 3H1KD 4FB1A 3CXHW 1M60A 1HZVA 3WFEC 4FANA 1SQXD 2N9IA 3NWVA 3KHUA 4EIFA 5C0ZA 1YEAA 1NNOA 1AOQA 5KLIB 3L73D 3OA8A 3TF5A 3HQ8A 1NIRA 1HJ5A 1KB9D 4PW9B 2C8SA 1H9YA 1QKSA 2L91A 1E29A 1YCCA 4PJ0V 1CTYA 4YE1A 2N9YB 5H2FV 3SVWA 4JCGA 5E79V 1CTJA 1ETPA 1H32A 1IZL0 1L0ND 1I6EA 1R0QA 2BH5X 1CSWA 4H0KA 1FJ0A 1IQCA 2RN0A 2FWLA 4U3FD 1I8PA 3RMZA 1CTZA 3KZIV 2MHMA 1CNOA 3H1JD 3A9FA 1CRJA 1C6RA 1GJQA 1LMSA 5KLVD 1HH7A 3VNWA 5CIFB 3NBSA 1H1OA 3GW6A 3PXTA 5CIEB 2ZOOA 5EXQA 3ZOYA 1BL9A 1CO6A 2QG4A 1CIHA 5KAIV 2C1DB 2B4ZA 4EIEA 3DR0A 4AAMA 1CYCA 4WQDA 3VRDA 3SJLA 1CXAA 5DJQC 1AYGA 4AALA 1H31B 4PD4D 4J20A 2JTIB 3L71D 3PLNA 1LS9A 1EB7A 3SLEA 5KKZB 3PXSA 5AURA 2ZONG 4L3GA 3RN0A 1I54A 1AOFA 1DW0A 3L75D 4FA4A 1I6DA 1LC1A 3SXTA 3WU2V 2K9JB 1A56A 1DVHA 1SQPD 1KYOD 1RAQA 3L72D 5DJQB 3TDKA 2YK3A 5GTHV 2XTSB 1DIIC 1IRWA 1YICA 4QAOA 2CA4B 2PACA 1QL3A 2C1DA 2FYUD 3L74D 4GYDA 4WQ9A 1E2RA 1DVVA 1H32B 3GG2A 3CU4A 1L9JC 1FI9A 451CA 1IRVA 1CIFA 155CA 3RLMA 4GEDB 1RZ5A 3ZOWA 2AIUA 1IO3A 1C75A 2GB8B 4FA1A 4RSZA 1CRGA 1HJ4A 1QYZA 1YIQA 2N9JA 3PRJA 5DF5A 1KB0A 1W5CT 2B11B 4L1QA 4RJTA 1E8EA 3X39A 3ZIYA 4LJIA 2QJKB 3VYMA 2CE0A 1DIQC 1YFCA 3DP5A 2Y0EA 3CXHD 4WQ7A 2O3JA 4EICA 2IBZD 4DY9A 1N9CA 4V2KA 2V07A 3ZBMA 3CX5W 1K3GA 1SQQD 1I8OA 3WFCC 2CA3B 1F1CA 4D6TD 1H33B 2B12B 5CYTR 1PP9D 1CIGA 2BH4X 5CICB 1L0LD 3SWSA 1GDVA 1RZ6A 2N3BA 4L3HA 1MZ4A 1M6ZA 1NTMD 4KMGA 1C6OA 2CE1A 4XXLA 3WFBC 3CX5D 1S5LV 1N90A 1U74B 4WQAA 3ZOOA 2KNCB 2PCBB
chains in the Genus database with same CATH superfamily
3WUIA 2V7QJ 1RAPA 2W8ZA 3TYIA 4BRYA 1CHIA 1N15A 3H1LG 2P7JA 1COTA 3VP8A 1L4AC 5CIGB 4AAOA 2PAJA 3H1IJ 3F89A 5TJHA 3RK2C 3ZDMA 1H33A 2BGVX 2EXVA 1ZN5A 3H1HJ 3ABVC 2HODB 2Q6QA 1NTKG 4MU8A 3Q5PA 2HLOA 2YKPA 1DW2A 1NTZJ 3MD0A 3EFGA 1GMJA 2KZIA 3D0WA 3RK3D 2OZ1A 1AVYA 2D2CC 3H32A 3HE5B 3D6YA 3H25A 1DW1A 1CCRA 3KPEA 1NAYA 2CPSA 1XTCC 1NU1K 3JCUH 1RE4C 3CC2P 2DW3A 4IL6V 1PP9E 3A5TA 3P7KA 3CCQP 3RBXA 4IL6E 2BCCD 3A7OA 4AQRD 3BCCJ 4NFGB 1MZ9A 1MUUA 3CCLP 1YBKA 1EDIA 3W67A 5M1BA 4HJGH 2C9NY 3M9QA 4EIJA 2BCNB 1HUCA 3SSUA 3CPWO 4Y5RA 1L4AA 1HRCA 3JBTB 1I55A 1OCDA 3O1YA 2FYUG 3VYIA 2LXCB 3CMEP 3O8ZA 4PV1D 1FAVA 2KLUA 4JQ0D 1PL5A 1ZMEC 1EXIA 4PD4I 1IC2A 1OMIA 3H1LD 3L73G 1IFJA 1CZQA 1NVOA 4DZOA 3RK3E 2G8YA 5TISV 2DGEA 1PIXA 1RE4A 4WQCA 2N3YA 1MFTA 4FA5A 3RL0C 2WPQA 5TISE 3VP9A 2YMKA 1Y9BA 1A8CA 1LTGC 5CCGC 2WMMA 1NTKD 1QL4A 1LTTC 2UWJE 2YIUC 1LC2A 2FY8A 1M1JC 1CSUA 2E76B 2BCCE 5AW8B 2FYNB 4C7NB 2VRSA 5APXA 1EQ7A 1H9XA 1LFMA 4WY4C 2ZXYA 2P67A 4PWAA 1NTMG 3VMAA 2NPSD 5CIHB 1RY3A 2E76D 2K1AA 1CRYA 1K73Q 5AVUB 2GIWA 3H1JJ 1JEKA 1IK9A 1N8RQ 1RHZB 4YXWH 1RF1C 3HQ7A 5APUA 2N18B 4B86A 1ZLLA 1LT9B 2H7HA 2IX7C 2Z5IA 1S5LX 1B7VA 2GA1A 2KUBA 1U75B 3H1LE 1C2RA 2OTJP 2AEFA 2P10A 3TGUG 2K37A 5CCGA 2AXTV 3II6A 2B89A 2QM7A 1CRIA 1SQXK 2BASA 2AXTE 1HF9A 4FANA 1M1JA 1NTKE 1IZNB 1YEAA 3V2RA 3L73D 3OA8A 3LIDA 1DEBA 3TF5A 4ZKUA 1NIRA 1BE3J 1SLQA 2FKWB 1URQC 1YI2P 4WY4A 1YJNP 1HJ5A 1KB9D 2IFNA 4XE5B 2BEQD 3B5NC 1DD4A 1NO4A 4YE1A 2FYUJ 5H2FV 4JCGA 1L0NK 2KYVA 4H13B 2N1TB 1LP1B 1H32A 2ZT9C 5H2FE 1QL2A 1RF1A 4IFFA 4I7ZB 1FJ0A 5AVZB 2JWDA 1G2CA 2AEMA 3TNUA 1ZP0C 3A9FA 2OGUA 2Q5UA 1BSHA 1AV1A 2WVRA 1LMSA 2NZ2A 1IFMA 3S9OA 3PXTA 2LKMA 5EXQA 1N73C 5BU8B 1BL9A 1FC2C 3MIWA 2R5DA 1CIHA 3IF4A 2C1DB 1A02F 1T8ZA 1FZCB 3VRDA 1LTJB 3C8VA 5DJQC 1GL2C 1AYGA 2QA4P 2QE7H 4LLHA 5APWA 2JTIB 1FZGA 3I55P 5KKZB 1VQNP 1FU1A 3AE2C 1JMMA 1DH3A 1I6DA 3SXTA 3L73E 3B5NA 1M90Q 1KB9E 5B66H 1Y47A 1NTMJ 2XTSB 5AW9B 3VTPC 1IRWA 1G1JA 4QAOA 2BEZF 1D7MA 3L74D 3I5CA 3Q1MA 451CA 3MTUE 1KB9I 3HTKB 2XZRA 1VF5B 3M0AA 2WWWA 155CA 1NAFA 4GEDB 3AEEC 3G71P 3ZOWA 1JCCA 3NTNA 4HB1A 2GB8B 3RL0g 1HJ4A 4H44B 2B88A 3PRJA 3TGUJ 3VN0A 1GL2A 1KB0A 1NJIQ 1IO4A 1KILB 1E8EA 3ZIYA 2QJKB 2PFXA 4H44D 4BRYB 1J1DC 3DP5A 2PRRA 1SQBG 2Y0EA 3CXHD 1CW5A 2O3JA 3G9RA 3FXDA 2G3AA 3PJSK 4GOEA 2ZVOB 1SQQK 3BRTB 4RO0A 2CA3B 5KJ7C 1FZFA 2OYIB 1NU1J 1H33B 5CYTR 3AE9C 1VQ4P 3IN6A 1BDCA 1CIGA 1L0LK 2YMYA 1QEXA 4ZNCA 2QJPC 4Y99C 4L3HA 1M6ZA 4KMGA 4XXLA 1OW7A 1OFCX 5AVWB 3BVHA 2XV5A 5E79H 3H1IG 1YQ4C 3L74E 2PCBB 4LC1A 1AKKA 1KYOH 2WSCJ 3CWBJ 1JB0J 3LIEA 4R4LA 1CHJA 3H1HG 5DFSA 5AVTB 1C2NA 4GOFA 5B6QA 2FRCA 1KFMA 2XNDH 1GU2A 2C1UA 1NTZG 2YCCA 3C9IA 3V4WA 2E5TA 3A2AA 3AEDC 2YXQB 2RKLA 2IFMA 5CIBB 1YNRA 1FI3A 1J3SA 1A02J 3JC22 5APQA 3E1IA 2ZZS1 3L70D 1CORA 4XYDB 3RBZA 3CD6P 1L4AB 3CLQA 3N4XA 3CXHE 3BCCG 3RK2B 1CYIA 1CHHA 1S4XA 5AVSB 5KLVJ 2YQBA 2NRGA 1DT1A 1BGYJ 3G4SP 2KOGA 3CXHI 1YTZT 1SQBD 2ITAA 4AX3A 2D2CB 3L72G 5L8RJ 2HPCA 3SWFA 1ZW0A 3O0RC 4DOJA 4EIDA 1HGVA 1KX7A 2QIWA 3L37A 1KD1Q 2GUVA 1WEJF 2LIRA 2D2CD 4GDOA 4IL6H 1KQGB 5APVA 3WUTA 3L71E 2A45I 4HKZH 1W2LA 3H1ID 2ZYDA 2Q3IA 1YITP 3ZCFA 4R4MA 2KI7B 2L4DA 1YTCA 2WQYC 2YKOA 2E42A 2I1JA 1DD3A 1PZQA 5DJUB 5B5EV 3H1HD 2QSIA 1OVRA 4YXDC 3LW5H 1QN2A 1KMIZ 4PD4H 3L70E 1NGMB 5B5EE 1FHBA 1OWAA 1NTZD 1BCCJ 2JJLA 3F5HA 1SQVK 3AE5C 1J1EC 1GKSA 4KHXA 2MTAC 4N6JA 1SQXJ 1FZEA 1FOSF 2IBZG 1VPCA 2B10B 3CCMP 4ZKPA 3QWOC 1SQBE 1YEBA 4EOTA 4WQBA 1KYOW 3BCCD 1KZUB 3P32A 3RL0B 3H1JG 1M57D 1JNMA 1GTWA 2OTLP 3MK7C 1JY3P 1GIWA 1L0NJ 2YIUB 1YHQP 1M1JB 1QLED 3QH9A 2SPZA 4Q5PA 1JY2P 1C7MA 1AJYA 1HVVA 3A0BV 3OA8B 4GKGA 5CCGD 3G6EP 4W7ZA 4WY4B 2J59M 1CYJA 3A0BE 3BASA 1AFOA 4A7PA 3H1IE 5IY51 4RKUJ 1MFZA 1P84D 3NXSA 5KAFH 2GUSA 2QJYC 2Y0CA 3A0HV 3HE4B 3H1HE 4WQEA 1QVFO 4WY4D 2QEXP 3A0HE 1RF1B 3S1KA 1HTLC 1BE3G 3T97A 3CX5E 1NTZE 3KYQA 3OCDA 1G2CB 4IOIH 1UIXA 3TNUB 2E75C 2WT7A 1LWUC 1M60A 2N9IA 4ASVA 3VOPA 3NWVA 3L75J 1NH4A 3AE8C 1NNOA 3CX5I 3L72J 3HQ8A 2A06G 5AVRB 4WWIA 1DIPA 3MUDC 1QKSA 3CCVP 5AW2B 2L91A 3U1AA 2AXTH 4PJ0V 1CTYA 4I1LA 2L5GB 1X8YA 1ETPA 4PJ0E 1I6EA 2O01H 1Q7YQ 1QX8A 1URQB 2YO3A 3Q2YA 4H0LC 4AUWA 3V5BA 1DX7A 3RMZA 1I8PA 1CTZA 2MHMA 3B5NB 3H1JD 1M8OB 2O01N 5KLVK 1AQ5A 1C6RA 5APSA 1SVFA 5CIFB 1H1OA 1PV3A 1URQD 2ZT9B 2ZOOA 3ZOYA 1P84E 2WITA 1CI6A 2B4ZA 1T3UA 1AQTA 1RE3A 4EIEA 4AAMA 2QRXA 1R8EA 3RK3C 1CYCA 3V2PA 1N7SC 2R3CA 3TK1A 1EDLA 1LWUA 1H31B 1P84I 2KSJA 3CCUP 5AVQB 3KQGA 1N73B 1LS9A 3SLEA 3MZWB 3HD7A 5AURA 5AW7B 1SQQJ 3GHGC 1KQFB 1QGKB 3MUDA 1LC1A 1SQPK 4D6TJ 3WU2V 1A56A 5DJQB 1GL2B 1L0LJ 2WSEH 3TDKA 1HGZA 3WU2E 2Q9IA 3JCUE 2KZJA 3U59A 5GTHV 1VQOP 1H0TA 4I6MC 5GTHE 1QL3A 2KLVA 2FYUD 4WQ9A 1K8AQ 3GG2A 3CU4A 1CIFA 1SFCC 1LGHB 2Y9YA 3RLMA 1KB9H 4HH2A 1RZ5A 1YIJP 5CBOA 1USEA 2O01J 3CI9A 4FA1A 2YNYA 3H1JE 3Q5RA 1IJDB 4PV1C 1QYZA 3Q3DA 1N7SA 3VMXA 2ZYAA 3TYYA 2OYHC 1USDA 1YTZI 1W5CT 4XFJA 2B11B 4L1QA 4RJTA 1NU1G 4EYYQ 1DIQC 2LR2A 4NPFX 1YFCA 1HWTC 3GHGA 4WQ7A 4L73A 1RF0A 3VMYA 4V2KA 2V07A 3ZBMA 3HE5A 1K3GA 4ASWA 1MV8A 2H88C 3WFCC 4NPDA 3D6ZA 3IR9A 3CL3D 3VMZA 3CWBG 4H13D 2BH4X 5CICB 1J1DB 2N1TD 3SWSA 1RZ6A 1PGJA 1NTMD 4QMAA 1K04A 2CE1A 2W27A 2WSEJ 1SFCA 3WFBC 2NPSC 2E5YA 1IFIA 1S5LV 4WQAA 3CCJP 2B87B 4RESB 2FYUE 1S5LE 2BPBB 2B0ZB 1WVEC 2O1JA 1Y8AA 3KZIH 2P58A 4OGQC 3CCRP 4AANA 2QJPB 2D0WA 4TLFA 4Y99B 2VHDA 3EFFK 3HQ9A 3M06A 3PH2B 3AE4C 5KJ7D 2OYHA 3R2PA 4U3FG 3RN1A 2H43A 1Q2NA 3U1CA 1HROA 2V08A 1EZVG 5AW1B 2PP6A 4FA9A 2WSSH 5KAIH 4GIFA 1KFNA 3TGUD 1IFNA 5KLVG 4N0KA 1BGYG 3FWLA 3N7NA 2M8RA 1WMKA 1N50A 2W83C 1DEEG 1MG2D 1PPJG 1SQVJ 4JYCA 2KNCA 3O6QB 1KC8Q 1M70A 3AEGC 3I56P 3JSVC 3AEFC 5CBNA 1NU1D 2E74C 2HV4A 1NKNA 2NPSA 3P8CD 2AI5A 3O20A 3E7KA 3CXHH 2OYOA 1NTME 1SQPG 1VF5D 4C7RA 1CIEA 1JY3N 2HG5D 3HQ6A 2IDBA 3C2CA 3C1LA 3UIAA 1N86A 2AEJA 1JY2N 1C52A 1KN7A 3CWBD 1VDFA 1H89A 2WZ7A 4FAVA 2M5AA 5EFWB 4JBZA 3WMM0 2RH0A 2C2CA 1KILD 3WFDC 2FYZA 1BCCG 1KQLA 1LT9A 1LTAC 3ORVA 2A45H 2R3SA 4UB8V 1S3JA 1A2SA 4GODA 1HJ3A 1YYCA 2JDIH 2M3EA 1SQXG 5CHXA 1VYDA 3TGUE 2ZBOA 4UB8E 2FXPA 4ZMDA 1NHLA 1GQ1A 1G1IA 3B71A 5AVVB 3AE6C 2C9XB 2OZ1B 2JQRA 2W90A 3H32B 3H1KJ 1EZVD 1FJKA 2I8FA 1NTKK 3V2QA 1T2KC 1BGYD 1L0NG 3MGNA 3KDPB 1NU1E 2Y0DA 1T3JA 1CC5A 3P8CE 1AA0A 2YO2A 1CCHA 2KS1A 3GF7A 1T6AA 1PPJD 1FJPA 4UB6V 3ZOXA 1J1EB 5B66V 2C1VA 3T97B 2FFDC 1KTMA 4UB6E 5B66E 3OCDB 1OW6A 1JOCA 1TU3F 5GTIV 1PFIA 2WT7B 2GC7D 3CWBE 4KJMA 1CRHA 3SFDC 5GTIE 4U3FJ 2IZ0A 3P8MC 2PCCB 1U7JA 4U7JA 1NOHA 2FXOA 1FDMA 3CCSP 4O1QA 1KILE 2R5BA 3EQ2A 2DVHA 3MK7B 2XNXA 2LITA 1M1KQ 1PGPA 1KV4A 1L4AD 2ZXXA 5CIDB 3RK2D 3L75G 3CYTI 2WPVB 4YPCA 5KLIC 4C46A 1FZCA 1LJ2A 2YXRB 2CXBA 1LTJA 3IFMA 1JDLA 3CCEP 4JYBA 1BCCD 2Z4EA 4Y28J 3L71J 1FBMA 2V4HA 1EDJA 2QJYB 4FB1A 1EZVE 1M56D 3CXHW 1HZVA 1SQXD 4AYCA 2CPBA 4EIFA 5C0ZA 1AOQA 1BGYE 4L75A 1SQPJ 1EXJA 3M9HA 3A0HH 1W5CE 2AXCA 2FFDA 3CX5H 1JTHA 4PW9B 1CI6B 3MP7B 5CCHC 1H9YA 1PPJE 1YCCA 2E75B 1LWUB 1LNQA 3K5BA 2XDJA 5E79V 1CTJA 1VQLP 1L0ND 5APYA 2YKQA 2BH5X 5E79E 4H0KA 2W6JH 4IL6X 2KXPB 3FXEA 1CNOA 4YTPC 1IFDA 3BATA 1GJQA 3VNWA 4L74A 1H0TB 3GW6A 4PJ0H 5CIEB 1NWQA 2WPSA 1U57A 2MKVA 1SQQG 4H0LB 3SWYA 3Q5SA 2Q1KA 3RGUA 4D6TG 3L35A 2R44A 1R5LA 2H8PD 3SJLA 3PH0A 2K3RA 1L0LG 5TISH 2JEEA 1BCCE 2H89C 4PD4D 4J20A 5K5GB 4H0LD 1JY3O 3B8EB 3PXSA 1P84H 3V2NA 2ZONG 1SQXE 3RN0A 1I54A 1AOFA 4OH8B 5CCHA 3RL0D 4EI2A 3L75D 4FA4A 2J5UA 2OYIA 3RK3B 1PP9J 1N7SB 1DVHA 4MN4C 3L72D 1JY2O 1YJWP 3W68A 1NYHA 1YJ9P 2M3BA 2HFED 1DIIC 1GK4A 1VL2A 3CMAP 3GHGB 1N7SD 2JKVA 1HJ0A 3V6IA 1H32B 1ZOYC 1L0NE 2B9BA 1FZAA 1SS1A 2KP8A 1H8AA 3WU2H 3LW5J 2QM8A 3E1RA 1RE3C 1FE6A 4RSZA 1OVVA 5GTHH 1CRGA 5DJTB 1R5SA 3AEBC 2K9JA 2N9JA 1SFCB 5DF5A 3HD7C 1LTIC 2JO1A 1FS0E 5AW3B 3AE1C 1WT6A 2Y9ZA 3X39A 4LJIA 3VYMA 3BCCE 2KSEA 2K88A 4PV1B 4JPZB 4BXLA 4EICA 4PD4E 2IBZD 1SFCD 1N9CA 3CX5W 2OYHB 3V4QA 1SQQD 1OX3A 2C0WA 3KXDA 3HUSC 3L75E 2KK7A 4D6TD 3BRVB 3L72E 1L0LD 2BCCJ 3OW2O 1MZ4A 1GD2E 2KIKA 2IYPA 3CC7P 5H2FH 1OVUA 1Q81Q 3ZOOA 3B5ND 2QVAA 2WSFH 5AW4B 2KNCB 4JF7A 1F1FA 1CXCA 2MJZA 1HH0A 2ZFCA 2ZT9D 1IFPA 1RH5B 2N9BA 3CP5A 1VQMP 3B4SA 1W2EA 1OAEA 1MG3D 1N7LA 2NPSB 4IFMA 1KQSO 1RF0C 3WC8A 3AECC 1SQVG 1Q86Q 1S5LH 4K3AA 1RQVA 4OGQB 1BE3D 3NBTA 5KAFV 1H88A 1NMIA 3H1LJ 4EDFA 1W2BO 1ZZHA 5KAFE 1DW3A 1GU5A 1CSBA 2J58A 3O5CA 3HUSA 2M5AB 2IBZE 1GL2D 4OGQD 1SP4A 1JO5A 1OXZA 1FOSE 3FWNA 1AVOA 1SQQE 2A06D 1NTKJ 3FX0A 3WUVA 2Q3EA 1OIPA 1VQPP 1KIBA 4D6TE 1X79B 1FZBA 1HZUA 1I5TA 4H0JA 1SQBK 1HJBA 2IBZI 1L0LE 1VQKP 1VQ8P 1Q90D 3PXWA 2HODA 1S1CX 3A3YB 5C39A 1CRCA 1KX2A 4WVZA 2E74B 5AVYB 1X9VA 3L74G 2WSFJ 4IFDK 1Z56A 2C9LY 1K3HA 2PGDA 4O9BA 3M97X 2KS1B 2E74D 3ITKA 1CSXA 3H1KG 1QVGO 1KV9A 1L9BC 1C6SA 4Z1MH 1LTSC 3G3ZA 1BE3E 3HE4A 2Z5HA 3AE3C 4WQ8A 5AW5B 1NTZK 5CJ0A 4WBAA 1L2PA 1JM0A 5CJ4A 1FCDC 2JWAA 1CSVA 2ZVNB 2E76C 2FBWC 2FYNC 1PGOA 2ZJSE 3DMIA 1FDOA 1SQVD 1HCMA 3L4OA 2O1KA 3L4FA 1YQ3C 1FOCA 2A06E 2I8DA 1ZXGA 4UB8H 2GM4A 3L73J 5APTA 1WRGA 1FI7A 2ZAEB 1CEDA 1BDDA 2ZYGA 1JUNA 4W7YA 4P4QB 3AEAC 4LGDE 2HPCB 1VQ7P 4KT0J 2N18C 1S9KD 1LT9C 4DCKA 1ZR4A 2D0SA 2GC4D 3PHLA 1URQA 3PTZA 2A45G 1JCDA 1NMLA 4K3IA 3M9BA 1HBWA 4DT0A 1T2KD 2FFDB 4K35A 2W6BA 2BLFB 1JTHB 2XKMA 4UB6H 4CPGA 1VQ9P 3L4MA 2IYOA 1KORA 3PP5A 351CA 3L71G 2OQQA 5BVZA 3D70A 2WSCH 2JP3A 5GTIH 3M0DC 1E79H 1S6VB 4C7NA 4O1WA 3EWKA 2RMZA 1BSNA 5C9MA 1RQUA 1ZRTD 2ORLA 3SFEC 1H31A 3L70G 1S2EA 3H6PA 1SQVE 1N73A 3H1KD 1UIIA 3WFEC 1K9MQ 3KHUA 2IZ1A 4H13C 2N1TC 5KLIB 3SWKA 5AW0B 1K05A 4I7ZC 4TT3H 4WB4A 2C8SA 3TSIA 2HR3A 1E29A 1GW3A 4XA4A 2N9YB 3L74J 3SVWA 1S9KE 4M3LA 1ZV8A 2LXBA 1IZL0 1GW4A 1R0QA 1E5WA 1CSWA 1IQCA 2RN0A 3OA7A 2FWLA 4U3FD 3KZIV 1FZCC 1QL1A 1LTJC 1CRJA 3KZIE 1N2DC 1XTGB 5KLVD 1HH7A 3NBSA 3M0DA 2FXMA 3USSA 2HYNA 1EDKA 5CMZA 5B5EH 5CCHD 5KKZC 1CO6A 2OTKE 3AE7C 4N78D 2QG4A 5KAIV 2K9YA 3DR0A 4I2LC 1LT1A 2JR8A 1PP9G 4WQDA 5KAIE 1CXAA 1PGQA 2W6AA 3FGAD 1ZRTE 4AALA 2N1TA 1LP1A 1VQ6P 1U7MA 3L71D 3PLNA 1EB7A 4OVNF 3H1KE 4L3GA 2Q7CA 2KB7P 4HYTB 1DW0A 3NMDA 1GK6A 5BU5A 2K9JB 2ZXEB 1SQPD 1KYOD 1RAQA 4GT1A 1MKMA 1VF5C 3S4RA 2YK3A 1LTBC 3OAKA 2C0XA 2P1JA 3HRNA 4DJGA 3CC4P 1YICA 2V7QH 2FYUK 2CA4B 1NKZB 2PACA 1Q82Q 2B87A 2OARA 2WTYA 2R32A 2C1DA 3GMAA 4GYDA 5KJ7A 2WPRA 4H44C 1DVVA 1E2RA 3WUUA 4N3YB 1M7LA 1L9JC 1FI9A 1IRVA 5AW6B 3A0BH 4U3FE 1KILC 4L76A 2AIUA 1IO3A 2QJKC 1C75A 3MHVA 4BWNA 3IAOA 5KLVE 3D71A 4W80A 1ZR2A 1YIQA 3R4YA 1IK7A 4N78E 1X0TA 3L70J 1EZVI 2OYIC 2CE0A 5KTBA 2BCCG 2M0BA 2I1KA 1OZHA 3GF3A 2IPPA 4DY9A 2P2UA 3O6QA 3HD7B 3HTKA 2E43A 3M91A 1I8OA 1S72P 2E75D 1X22A 1F1CA 1OW8A 2B12B 1PP9D 1SQPE 1KYOE 1J2JB 1GU4A 2POHA 1GZLA 1SQBJ 1GDVA 1NTMK 1FDIA 3NFQA 2N3BA 3GLMA 3HD7D 3L36A 1C6OA 1EC5A 2XU6A 2CK3H 3CX5D 1GDTA 1N90A 1U74B 1VQ5P 1JMBA 4NPEA 3HUSB 1KYOI 1KILA 4OWFA 5AVXB 3OJAB
chains in the Genus database with same CATH topology
1AKKA 2BPBB 3WUIA 1F1FA 1RAPA 1CXCA 2B0ZB 1WVEC 1CHJA 3TYIA 5DFSA 1CHIA 1N15A 1C2NA 4AANA 2QJPB 2D0WA 2VHDA 3HQ9A 3CP5A 2FRCA 5B6QA 3PH2B 1OAEA 1MG3D 1GU2A 2C1UA 1COTA 2YCCA 5CIGB 4AAOA 3RN1A 3WC8A 5TJHA 1H33A 2BGVX 1HROA 2V08A 2EXVA 4FA9A 5CIBB 1YNRA 1FI3A 3TGUD 1BE3D 3NBTA 1J3SA 5KAFV 4N0KA 1NMIA 4MU8A 4EDFA 2ZZS1 3FWLA 3L70D 1ZZHA 1CORA 4XYDB 1DW2A 1DW3A 1N50A 3O5CA 2OZ1A 1MG2D 1CYIA 1CHHA 1DW1A 1CCRA 1M70A 2A06D 2YQBA 1DT1A 2Q3EA 1KIBA 1NU1D 2HV4A 1HZUA 4IL6V 1I5TA 4H0JA 2AI5A 3O20A 1SQBD 2BCCD 4AX3A 4NFGB 1CIEA 3PXWA 3HQ6A 3C2CA 1CRCA 1KX2A 3O0RC 2BCNB 4EIDA 1KX7A 1C52A 4Y5RA 3CWBD 1WEJF 2LIRA 1HRCA 3JBTB 1I55A 1OCDA 3O1YA 4FAVA 1K3HA 2C2CA 3WFDC 3M97X 1W2LA 3H1ID 3ORVA 3ITKA 3ZCFA 1CSXA 4UB8V 2L4DA 1YTCA 1A2SA 1HJ3A 1KV9A 1L9BC 1C6SA 1VYDA 2ZBOA 5B5EV 3H1HD 3H1LD 1QN2A 4WQ8A 1GQ1A 1FHBA 1FCDC 1NTZD 2JWAA 2C9XB 1CSVA 2OZ1B 5TISV 2DGEA 2JQRA 3DMIA 2N3YA 4WQCA 1SQVD 4FA5A 1HCMA 1GKSA 2MTAC 1EZVD 3L4OA 2I8FA 1FOCA 1A8CA 1NTKD 1BGYD 1QL4A 1FI7A 2Y0DA 2B10B 1CC5A 1LC2A 1CCHA 2KS1A 1YEBA 1CSUA 4WQBA 2FYNB 1KYOW 1CEDA 3BCCD 1PPJD 4UB6V 3ZOXA 4P4QB 5B66V 2C1VA 1H9XA 1LFMA 2N18C 2ZXYA 3MK7C 3OCDB 4PWAA 1GIWA 3VMAA 2D0SA 2GC4D 2YIUB 3PHLA 5CIHB 5GTIV 2GC7D 1CRHA 1CRYA 3PTZA 1NMLA 2PCCB 4Q5PA 4K3IA 1C7MA 3A0BV 2GIWA 3OA8B 4O1QA 3HQ7A 1CYJA 2BLFB 2N18B 2DVHA 3MK7B 4A7PA 3L4MA 2LITA 5IY51 351CA 1B7VA 1P84D 2Y0CA 3A0HV 5CIDB 4WQEA 3CYTI 1U75B 1S6VB 1C2RA 4O1WA 2RMZA 2CXBA 5C9MA 1JDLA 1ZRTD 2ORLA 1BCCD 2AXTV 1H31A 3OCDA 1CRIA 2QJYB 3H1KD 4FB1A 3CXHW 1M60A 1HZVA 3WFEC 4FANA 1SQXD 2N9IA 3NWVA 3KHUA 4EIFA 5C0ZA 1YEAA 1NNOA 1AOQA 5KLIB 3L73D 3OA8A 3TF5A 3HQ8A 1NIRA 1HJ5A 1KB9D 4PW9B 2C8SA 1H9YA 1QKSA 2L91A 1E29A 1YCCA 4PJ0V 1CTYA 4YE1A 2N9YB 5H2FV 3SVWA 4JCGA 5E79V 1CTJA 1ETPA 1H32A 1IZL0 1L0ND 1I6EA 1R0QA 2BH5X 1CSWA 4H0KA 1FJ0A 1IQCA 2RN0A 2FWLA 4U3FD 1I8PA 3RMZA 1CTZA 3KZIV 2MHMA 1CNOA 3H1JD 3A9FA 1CRJA 1C6RA 1GJQA 1LMSA 5KLVD 1HH7A 3VNWA 5CIFB 3NBSA 1H1OA 3GW6A 3PXTA 5CIEB 2ZOOA 5EXQA 3ZOYA 1BL9A 1CO6A 2QG4A 1CIHA 5KAIV 2C1DB 2B4ZA 4EIEA 3DR0A 4AAMA 1CYCA 4WQDA 3VRDA 3SJLA 1CXAA 5DJQC 1AYGA 4AALA 1H31B 4PD4D 4J20A 2JTIB 3L71D 3PLNA 1LS9A 1EB7A 3SLEA 5KKZB 3PXSA 5AURA 2ZONG 4L3GA 3RN0A 1I54A 1AOFA 1DW0A 3L75D 4FA4A 1I6DA 1LC1A 3SXTA 3WU2V 2K9JB 1A56A 1DVHA 1SQPD 1KYOD 1RAQA 3L72D 5DJQB 3TDKA 2YK3A 5GTHV 2XTSB 1DIIC 1IRWA 1YICA 4QAOA 2CA4B 2PACA 1QL3A 2C1DA 2FYUD 3L74D 4GYDA 4WQ9A 1E2RA 1DVVA 1H32B 3GG2A 3CU4A 1L9JC 1FI9A 451CA 1IRVA 1CIFA 155CA 3RLMA 4GEDB 1RZ5A 3ZOWA 2AIUA 1IO3A 1C75A 2GB8B 4FA1A 4RSZA 1CRGA 1HJ4A 1QYZA 1YIQA 2N9JA 3PRJA 5DF5A 1KB0A 1W5CT 2B11B 4L1QA 4RJTA 1E8EA 3X39A 3ZIYA 4LJIA 2QJKB 3VYMA 2CE0A 1DIQC 1YFCA 3DP5A 2Y0EA 3CXHD 4WQ7A 2O3JA 4EICA 2IBZD 4DY9A 1N9CA 4V2KA 2V07A 3ZBMA 3CX5W 1K3GA 1SQQD 1I8OA 3WFCC 2CA3B 1F1CA 4D6TD 1H33B 2B12B 5CYTR 1PP9D 1CIGA 2BH4X 5CICB 1L0LD 3SWSA 1GDVA 1RZ6A 2N3BA 4L3HA 1MZ4A 1M6ZA 1NTMD 4KMGA 1C6OA 2CE1A 4XXLA 3WFBC 3CX5D 1S5LV 1N90A 1U74B 4WQAA 3ZOOA 2KNCB 2PCBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AKK A;  2BPB B;  3WUI A;  1F1F A;  1RAP A;  1CXC A;  2B0Z B;  1WVE C;  1CHJ A;  3TYI A;  5DFS A;  1CHI A;  1N15 A;  1C2N A;  4AAN A;  2QJP B;  2D0W A;  2VHD A;  3HQ9 A;  3CP5 A;  2FRC A;  5B6Q A;  3PH2 B;  1OAE A;  1MG3 D;  1GU2 A;  2C1U A;  1COT A;  2YCC A;  5CIG B;  4AAO A;  3RN1 A;  3WC8 A;  5TJH A;  1H33 A;  2BGV X;  1HRO A;  2V08 A;  2EXV A;  4FA9 A;  5CIB B;  1YNR A;  1FI3 A;  3TGU D;  1BE3 D;  3NBT A;  1J3S A;  5KAF V;  4N0K A;  1NMI A;  4MU8 A;  4EDF A;  2ZZS 1;  3FWL A;  3L70 D;  1ZZH A;  1COR A;  4XYD B;  1DW2 A;  1DW3 A;  1N50 A;  3O5C A;  2OZ1 A;  1MG2 D;  1CYI A;  1CHH A;  1DW1 A;  1CCR A;  1M70 A;  2A06 D;  2YQB A;  1DT1 A;  2Q3E A;  1KIB A;  1NU1 D;  2HV4 A;  1HZU A;  4IL6 V;  1I5T A;  4H0J A;  2AI5 A;  3O20 A;  1SQB D;  2BCC D;  4AX3 A;  4NFG B;  1CIE A;  3PXW A;  3HQ6 A;  3C2C A;  1CRC A;  1KX2 A;  3O0R C;  2BCN B;  4EID A;  1KX7 A;  1C52 A;  4Y5R A;  3CWB D;  1WEJ F;  2LIR A;  1HRC A;  3JBT B;  1I55 A;  1OCD A;  3O1Y A;  4FAV A;  1K3H A;  2C2C A;  3WFD C;  3M97 X;  1W2L A;  3H1I D;  3ORV A;  3ITK A;  3ZCF A;  1CSX A;  4UB8 V;  2L4D A;  1YTC A;  1A2S A;  1HJ3 A;  1KV9 A;  1L9B C;  1C6S A;  1VYD A;  2ZBO A;  5B5E V;  3H1H D;  3H1L D;  1QN2 A;  4WQ8 A;  1GQ1 A;  1FHB A;  1FCD C;  1NTZ D;  2JWA A;  2C9X B;  1CSV A;  2OZ1 B;  5TIS V;  2DGE A;  2JQR A;  3DMI A;  2N3Y A;  4WQC A;  1SQV D;  4FA5 A;  1HCM A;  1GKS A;  2MTA C;  1EZV D;  3L4O A;  2I8F A;  1FOC A;  1A8C A;  1NTK D;  1BGY D;  1QL4 A;  1FI7 A;  2Y0D A;  2B10 B;  1CC5 A;  1LC2 A;  1CCH A;  2KS1 A;  1YEB A;  1CSU A;  4WQB A;  2FYN B;  1KYO W;  1CED A;  3BCC D;  1PPJ D;  4UB6 V;  3ZOX A;  4P4Q B;  5B66 V;  2C1V A;  1H9X A;  1LFM A;  2N18 C;  2ZXY A;  3MK7 C;  3OCD B;  4PWA A;  1GIW A;  3VMA A;  2D0S A;  2GC4 D;  2YIU B;  3PHL A;  5CIH B;  5GTI V;  2GC7 D;  1CRH A;  1CRY A;  3PTZ A;  1NML A;  2PCC B;  4Q5P A;  4K3I A;  1C7M A;  3A0B V;  2GIW A;  3OA8 B;  4O1Q A;  3HQ7 A;  1CYJ A;  2BLF B;  2N18 B;  2DVH A;  3MK7 B;  4A7P A;  3L4M A;  2LIT A;  5IY5 1;  351C A;  1B7V A;  1P84 D;  2Y0C A;  3A0H V;  5CID B;  4WQE A;  3CYT I;  1U75 B;  1S6V B;  1C2R A;  4O1W A;  2RMZ A;  2CXB A;  5C9M A;  1JDL A;  1ZRT D;  2ORL A;  1BCC D;  2AXT V;  1H31 A;  3OCD A;  1CRI A;  2QJY B;  3H1K D;  4FB1 A;  3CXH W;  1M60 A;  1HZV A;  3WFE C;  4FAN A;  1SQX D;  2N9I A;  3NWV A;  3KHU A;  4EIF A;  5C0Z A;  1YEA A;  1NNO A;  1AOQ A;  5KLI B;  3L73 D;  3OA8 A;  3TF5 A;  3HQ8 A;  1NIR A;  1HJ5 A;  1KB9 D;  4PW9 B;  2C8S A;  1H9Y A;  1QKS A;  2L91 A;  1E29 A;  1YCC A;  4PJ0 V;  1CTY A;  4YE1 A;  2N9Y B;  5H2F V;  3SVW A;  4JCG A;  5E79 V;  1CTJ A;  1ETP A;  1H32 A;  1IZL 0;  1L0N D;  1I6E A;  1R0Q A;  2BH5 X;  1CSW A;  4H0K A;  1FJ0 A;  1IQC A;  2RN0 A;  2FWL A;  4U3F D;  1I8P A;  3RMZ A;  1CTZ A;  3KZI V;  2MHM A;  1CNO A;  3H1J D;  3A9F A;  1CRJ A;  1C6R A;  1GJQ A;  1LMS A;  5KLV D;  1HH7 A;  3VNW A;  5CIF B;  3NBS A;  1H1O A;  3GW6 A;  3PXT A;  5CIE B;  2ZOO A;  5EXQ A;  3ZOY A;  1BL9 A;  1CO6 A;  2QG4 A;  1CIH A;  5KAI V;  2C1D B;  2B4Z A;  4EIE A;  3DR0 A;  4AAM A;  1CYC A;  4WQD A;  3VRD A;  3SJL A;  1CXA A;  5DJQ C;  1AYG A;  4AAL A;  1H31 B;  4PD4 D;  4J20 A;  2JTI B;  3L71 D;  3PLN A;  1LS9 A;  1EB7 A;  3SLE A;  5KKZ B;  3PXS A;  5AUR A;  2ZON G;  4L3G A;  3RN0 A;  1I54 A;  1AOF A;  1DW0 A;  3L75 D;  4FA4 A;  1I6D A;  1LC1 A;  3SXT A;  3WU2 V;  2K9J B;  1A56 A;  1DVH A;  1SQP D;  1KYO D;  1RAQ A;  3L72 D;  5DJQ B;  3TDK A;  2YK3 A;  5GTH V;  2XTS B;  1DII C;  1IRW A;  1YIC A;  4QAO A;  2CA4 B;  2PAC A;  1QL3 A;  2C1D A;  2FYU D;  3L74 D;  4GYD A;  4WQ9 A;  1E2R A;  1DVV A;  1H32 B;  3GG2 A;  3CU4 A;  1L9J C;  1FI9 A;  451C A;  1IRV A;  1CIF A;  155C A;  3RLM A;  4GED B;  1RZ5 A;  3ZOW A;  2AIU A;  1IO3 A;  1C75 A;  2GB8 B;  4FA1 A;  4RSZ A;  1CRG A;  1HJ4 A;  1QYZ A;  1YIQ A;  2N9J A;  3PRJ A;  5DF5 A;  1KB0 A;  1W5C T;  2B11 B;  4L1Q A;  4RJT A;  1E8E A;  3X39 A;  3ZIY A;  4LJI A;  2QJK B;  3VYM A;  2CE0 A;  1DIQ C;  1YFC A;  3DP5 A;  2Y0E A;  3CXH D;  4WQ7 A;  2O3J A;  4EIC A;  2IBZ D;  4DY9 A;  1N9C A;  4V2K A;  2V07 A;  3ZBM A;  3CX5 W;  1K3G A;  1SQQ D;  1I8O A;  3WFC C;  2CA3 B;  1F1C A;  4D6T D;  1H33 B;  2B12 B;  5CYT R;  1PP9 D;  1CIG A;  2BH4 X;  5CIC B;  1L0L D;  3SWS A;  1GDV A;  1RZ6 A;  2N3B A;  4L3H A;  1MZ4 A;  1M6Z A;  1NTM D;  4KMG A;  1C6O A;  2CE1 A;  4XXL A;  3WFB C;  3CX5 D;  1S5L V;  1N90 A;  1U74 B;  4WQA A;  3ZOO A;  2KNC B;  2PCB B; 
#chains in the Genus database with same CATH topology
 3WUI A;  2V7Q J;  1RAP A;  2W8Z A;  3TYI A;  4BRY A;  1CHI A;  1N15 A;  3H1L G;  2P7J A;  1COT A;  3VP8 A;  1L4A C;  5CIG B;  4AAO A;  2PAJ A;  3H1I J;  3F89 A;  5TJH A;  3RK2 C;  3ZDM A;  1H33 A;  2BGV X;  2EXV A;  1ZN5 A;  3H1H J;  3ABV C;  2HOD B;  2Q6Q A;  1NTK G;  4MU8 A;  3Q5P A;  2HLO A;  2YKP A;  1DW2 A;  1NTZ J;  3MD0 A;  3EFG A;  1GMJ A;  2KZI A;  3D0W A;  3RK3 D;  2OZ1 A;  1AVY A;  2D2C C;  3H32 A;  3HE5 B;  3D6Y A;  3H25 A;  1DW1 A;  1CCR A;  3KPE A;  1NAY A;  2CPS A;  1XTC C;  1NU1 K;  3JCU H;  1RE4 C;  3CC2 P;  2DW3 A;  4IL6 V;  1PP9 E;  3A5T A;  3P7K A;  3CCQ P;  3RBX A;  4IL6 E;  2BCC D;  3A7O A;  4AQR D;  3BCC J;  4NFG B;  1MZ9 A;  1MUU A;  3CCL P;  1YBK A;  1EDI A;  3W67 A;  5M1B A;  4HJG H;  2C9N Y;  3M9Q A;  4EIJ A;  2BCN B;  1HUC A;  3SSU A;  3CPW O;  4Y5R A;  1L4A A;  1HRC A;  3JBT B;  1I55 A;  1OCD A;  3O1Y A;  2FYU G;  3VYI A;  2LXC B;  3CME P;  3O8Z A;  4PV1 D;  1FAV A;  2KLU A;  4JQ0 D;  1PL5 A;  1ZME C;  1EXI A;  4PD4 I;  1IC2 A;  1OMI A;  3H1L D;  3L73 G;  1IFJ A;  1CZQ A;  1NVO A;  4DZO A;  3RK3 E;  2G8Y A;  5TIS V;  2DGE A;  1PIX A;  1RE4 A;  4WQC A;  2N3Y A;  1MFT A;  4FA5 A;  3RL0 C;  2WPQ A;  5TIS E;  3VP9 A;  2YMK A;  1Y9B A;  1A8C A;  1LTG C;  5CCG C;  2WMM A;  1NTK D;  1QL4 A;  1LTT C;  2UWJ E;  2YIU C;  1LC2 A;  2FY8 A;  1M1J C;  1CSU A;  2E76 B;  2BCC E;  5AW8 B;  2FYN B;  4C7N B;  2VRS A;  5APX A;  1EQ7 A;  1H9X A;  1LFM A;  4WY4 C;  2ZXY A;  2P67 A;  4PWA A;  1NTM G;  3VMA A;  2NPS D;  5CIH B;  1RY3 A;  2E76 D;  2K1A A;  1CRY A;  1K73 Q;  5AVU B;  2GIW A;  3H1J J;  1JEK A;  1IK9 A;  1N8R Q;  1RHZ B;  4YXW H;  1RF1 C;  3HQ7 A;  5APU A;  2N18 B;  4B86 A;  1ZLL A;  1LT9 B;  2H7H A;  2IX7 C;  2Z5I A;  1S5L X;  1B7V A;  2GA1 A;  2KUB A;  1U75 B;  3H1L E;  1C2R A;  2OTJ P;  2AEF A;  2P10 A;  3TGU G;  2K37 A;  5CCG A;  2AXT V;  3II6 A;  2B89 A;  2QM7 A;  1CRI A;  1SQX K;  2BAS A;  2AXT E;  1HF9 A;  4FAN A;  1M1J A;  1NTK E;  1IZN B;  1YEA A;  3V2R A;  3L73 D;  3OA8 A;  3LID A;  1DEB A;  3TF5 A;  4ZKU A;  1NIR A;  1BE3 J;  1SLQ A;  2FKW B;  1URQ C;  1YI2 P;  4WY4 A;  1YJN P;  1HJ5 A;  1KB9 D;  2IFN A;  4XE5 B;  2BEQ D;  3B5N C;  1DD4 A;  1NO4 A;  4YE1 A;  2FYU J;  5H2F V;  4JCG A;  1L0N K;  2KYV A;  4H13 B;  2N1T B;  1LP1 B;  1H32 A;  2ZT9 C;  5H2F E;  1QL2 A;  1RF1 A;  4IFF A;  4I7Z B;  1FJ0 A;  5AVZ B;  2JWD A;  1G2C A;  2AEM A;  3TNU A;  1ZP0 C;  3A9F A;  2OGU A;  2Q5U A;  1BSH A;  1AV1 A;  2WVR A;  1LMS A;  2NZ2 A;  1IFM A;  3S9O A;  3PXT A;  2LKM A;  5EXQ A;  1N73 C;  5BU8 B;  1BL9 A;  1FC2 C;  3MIW A;  2R5D A;  1CIH A;  3IF4 A;  2C1D B;  1A02 F;  1T8Z A;  1FZC B;  3VRD A;  1LTJ B;  3C8V A;  5DJQ C;  1GL2 C;  1AYG A;  2QA4 P;  2QE7 H;  4LLH A;  5APW A;  2JTI B;  1FZG A;  3I55 P;  5KKZ B;  1VQN P;  1FU1 A;  3AE2 C;  1JMM A;  1DH3 A;  1I6D A;  3SXT A;  3L73 E;  3B5N A;  1M90 Q;  1KB9 E;  5B66 H;  1Y47 A;  1NTM J;  2XTS B;  5AW9 B;  3VTP C;  1IRW A;  1G1J A;  4QAO A;  2BEZ F;  1D7M A;  3L74 D;  3I5C A;  3Q1M A;  451C A;  3MTU E;  1KB9 I;  3HTK B;  2XZR A;  1VF5 B;  3M0A A;  2WWW A;  155C A;  1NAF A;  4GED B;  3AEE C;  3G71 P;  3ZOW A;  1JCC A;  3NTN A;  4HB1 A;  2GB8 B;  3RL0 g;  1HJ4 A;  4H44 B;  2B88 A;  3PRJ A;  3TGU J;  3VN0 A;  1GL2 A;  1KB0 A;  1NJI Q;  1IO4 A;  1KIL B;  1E8E A;  3ZIY A;  2QJK B;  2PFX A;  4H44 D;  4BRY B;  1J1D C;  3DP5 A;  2PRR A;  1SQB G;  2Y0E A;  3CXH D;  1CW5 A;  2O3J A;  3G9R A;  3FXD A;  2G3A A;  3PJS K;  4GOE A;  2ZVO B;  1SQQ K;  3BRT B;  4RO0 A;  2CA3 B;  5KJ7 C;  1FZF A;  2OYI B;  1NU1 J;  1H33 B;  5CYT R;  3AE9 C;  1VQ4 P;  3IN6 A;  1BDC A;  1CIG A;  1L0L K;  2YMY A;  1QEX A;  4ZNC A;  2QJP C;  4Y99 C;  4L3H A;  1M6Z A;  4KMG A;  4XXL A;  1OW7 A;  1OFC X;  5AVW B;  3BVH A;  2XV5 A;  5E79 H;  3H1I G;  1YQ4 C;  3L74 E;  2PCB B;  4LC1 A;  1AKK A;  1KYO H;  2WSC J;  3CWB J;  1JB0 J;  3LIE A;  4R4L A;  1CHJ A;  3H1H G;  5DFS A;  5AVT B;  1C2N A;  4GOF A;  5B6Q A;  2FRC A;  1KFM A;  2XND H;  1GU2 A;  2C1U A;  1NTZ G;  2YCC A;  3C9I A;  3V4W A;  2E5T A;  3A2A A;  3AED C;  2YXQ B;  2RKL A;  2IFM A;  5CIB B;  1YNR A;  1FI3 A;  1J3S A;  1A02 J;  3JC2 2;  5APQ A;  3E1I A;  2ZZS 1;  3L70 D;  1COR A;  4XYD B;  3RBZ A;  3CD6 P;  1L4A B;  3CLQ A;  3N4X A;  3CXH E;  3BCC G;  3RK2 B;  1CYI A;  1CHH A;  1S4X A;  5AVS B;  5KLV J;  2YQB A;  2NRG A;  1DT1 A;  1BGY J;  3G4S P;  2KOG A;  3CXH I;  1YTZ T;  1SQB D;  2ITA A;  4AX3 A;  2D2C B;  3L72 G;  5L8R J;  2HPC A;  3SWF A;  1ZW0 A;  3O0R C;  4DOJ A;  4EID A;  1HGV A;  1KX7 A;  2QIW A;  3L37 A;  1KD1 Q;  2GUV A;  1WEJ F;  2LIR A;  2D2C D;  4GDO A;  4IL6 H;  1KQG B;  5APV A;  3WUT A;  3L71 E;  2A45 I;  4HKZ H;  1W2L A;  3H1I D;  2ZYD A;  2Q3I A;  1YIT P;  3ZCF A;  4R4M A;  2KI7 B;  2L4D A;  1YTC A;  2WQY C;  2YKO A;  2E42 A;  2I1J A;  1DD3 A;  1PZQ A;  5DJU B;  5B5E V;  3H1H D;  2QSI A;  1OVR A;  4YXD C;  3LW5 H;  1QN2 A;  1KMI Z;  4PD4 H;  3L70 E;  1NGM B;  5B5E E;  1FHB A;  1OWA A;  1NTZ D;  1BCC J;  2JJL A;  3F5H A;  1SQV K;  3AE5 C;  1J1E C;  1GKS A;  4KHX A;  2MTA C;  4N6J A;  1SQX J;  1FZE A;  1FOS F;  2IBZ G;  1VPC A;  2B10 B;  3CCM P;  4ZKP A;  3QWO C;  1SQB E;  1YEB A;  4EOT A;  4WQB A;  1KYO W;  3BCC D;  1KZU B;  3P32 A;  3RL0 B;  3H1J G;  1M57 D;  1JNM A;  1GTW A;  2OTL P;  3MK7 C;  1JY3 P;  1GIW A;  1L0N J;  2YIU B;  1YHQ P;  1M1J B;  1QLE D;  3QH9 A;  2SPZ A;  4Q5P A;  1JY2 P;  1C7M A;  1AJY A;  1HVV A;  3A0B V;  3OA8 B;  4GKG A;  5CCG D;  3G6E P;  4W7Z A;  4WY4 B;  2J59 M;  1CYJ A;  3A0B E;  3BAS A;  1AFO A;  4A7P A;  3H1I E;  5IY5 1;  4RKU J;  1MFZ A;  1P84 D;  3NXS A;  5KAF H;  2GUS A;  2QJY C;  2Y0C A;  3A0H V;  3HE4 B;  3H1H E;  4WQE A;  1QVF O;  4WY4 D;  2QEX P;  3A0H E;  1RF1 B;  3S1K A;  1HTL C;  1BE3 G;  3T97 A;  3CX5 E;  1NTZ E;  3KYQ A;  3OCD A;  1G2C B;  4IOI H;  1UIX A;  3TNU B;  2E75 C;  2WT7 A;  1LWU C;  1M60 A;  2N9I A;  4ASV A;  3VOP A;  3NWV A;  3L75 J;  1NH4 A;  3AE8 C;  1NNO A;  3CX5 I;  3L72 J;  3HQ8 A;  2A06 G;  5AVR B;  4WWI A;  1DIP A;  3MUD C;  1QKS A;  3CCV P;  5AW2 B;  2L91 A;  3U1A A;  2AXT H;  4PJ0 V;  1CTY A;  4I1L A;  2L5G B;  1X8Y A;  1ETP A;  4PJ0 E;  1I6E A;  2O01 H;  1Q7Y Q;  1QX8 A;  1URQ B;  2YO3 A;  3Q2Y A;  4H0L C;  4AUW A;  3V5B A;  1DX7 A;  3RMZ A;  1I8P A;  1CTZ A;  2MHM A;  3B5N B;  3H1J D;  1M8O B;  2O01 N;  5KLV K;  1AQ5 A;  1C6R A;  5APS A;  1SVF A;  5CIF B;  1H1O A;  1PV3 A;  1URQ D;  2ZT9 B;  2ZOO A;  3ZOY A;  1P84 E;  2WIT A;  1CI6 A;  2B4Z A;  1T3U A;  1AQT A;  1RE3 A;  4EIE A;  4AAM A;  2QRX A;  1R8E A;  3RK3 C;  1CYC A;  3V2P A;  1N7S C;  2R3C A;  3TK1 A;  1EDL A;  1LWU A;  1H31 B;  1P84 I;  2KSJ A;  3CCU P;  5AVQ B;  3KQG A;  1N73 B;  1LS9 A;  3SLE A;  3MZW B;  3HD7 A;  5AUR A;  5AW7 B;  1SQQ J;  3GHG C;  1KQF B;  1QGK B;  3MUD A;  1LC1 A;  1SQP K;  4D6T J;  3WU2 V;  1A56 A;  5DJQ B;  1GL2 B;  1L0L J;  2WSE H;  3TDK A;  1HGZ A;  3WU2 E;  2Q9I A;  3JCU E;  2KZJ A;  3U59 A;  5GTH V;  1VQO P;  1H0T A;  4I6M C;  5GTH E;  1QL3 A;  2KLV A;  2FYU D;  4WQ9 A;  1K8A Q;  3GG2 A;  3CU4 A;  1CIF A;  1SFC C;  1LGH B;  2Y9Y A;  3RLM A;  1KB9 H;  4HH2 A;  1RZ5 A;  1YIJ P;  5CBO A;  1USE A;  2O01 J;  3CI9 A;  4FA1 A;  2YNY A;  3H1J E;  3Q5R A;  1IJD B;  4PV1 C;  1QYZ A;  3Q3D A;  1N7S A;  3VMX A;  2ZYA A;  3TYY A;  2OYH C;  1USD A;  1YTZ I;  1W5C T;  4XFJ A;  2B11 B;  4L1Q A;  4RJT A;  1NU1 G;  4EYY Q;  1DIQ C;  2LR2 A;  4NPF X;  1YFC A;  1HWT C;  3GHG A;  4WQ7 A;  4L73 A;  1RF0 A;  3VMY A;  4V2K A;  2V07 A;  3ZBM A;  3HE5 A;  1K3G A;  4ASW A;  1MV8 A;  2H88 C;  3WFC C;  4NPD A;  3D6Z A;  3IR9 A;  3CL3 D;  3VMZ A;  3CWB G;  4H13 D;  2BH4 X;  5CIC B;  1J1D B;  2N1T D;  3SWS A;  1RZ6 A;  1PGJ A;  1NTM D;  4QMA A;  1K04 A;  2CE1 A;  2W27 A;  2WSE J;  1SFC A;  3WFB C;  2NPS C;  2E5Y A;  1IFI A;  1S5L V;  4WQA A;  3CCJ P;  2B87 B;  4RES B;  2FYU E;  1S5L E;  2BPB B;  2B0Z B;  1WVE C;  2O1J A;  1Y8A A;  3KZI H;  2P58 A;  4OGQ C;  3CCR P;  4AAN A;  2QJP B;  2D0W A;  4TLF A;  4Y99 B;  2VHD A;  3EFF K;  3HQ9 A;  3M06 A;  3PH2 B;  3AE4 C;  5KJ7 D;  2OYH A;  3R2P A;  4U3F G;  3RN1 A;  2H43 A;  1Q2N A;  3U1C A;  1HRO A;  2V08 A;  1EZV G;  5AW1 B;  2PP6 A;  4FA9 A;  2WSS H;  5KAI H;  4GIF A;  1KFN A;  3TGU D;  1IFN A;  5KLV G;  4N0K A;  1BGY G;  3FWL A;  3N7N A;  2M8R A;  1WMK A;  1N50 A;  2W83 C;  1DEE G;  1MG2 D;  1PPJ G;  1SQV J;  4JYC A;  2KNC A;  3O6Q B;  1KC8 Q;  1M70 A;  3AEG C;  3I56 P;  3JSV C;  3AEF C;  5CBN A;  1NU1 D;  2E74 C;  2HV4 A;  1NKN A;  2NPS A;  3P8C D;  2AI5 A;  3O20 A;  3E7K A;  3CXH H;  2OYO A;  1NTM E;  1SQP G;  1VF5 D;  4C7R A;  1CIE A;  1JY3 N;  2HG5 D;  3HQ6 A;  2IDB A;  3C2C A;  3C1L A;  3UIA A;  1N86 A;  2AEJ A;  1JY2 N;  1C52 A;  1KN7 A;  3CWB D;  1VDF A;  1H89 A;  2WZ7 A;  4FAV A;  2M5A A;  5EFW B;  4JBZ A;  3WMM 0;  2RH0 A;  2C2C A;  1KIL D;  3WFD C;  2FYZ A;  1BCC G;  1KQL A;  1LT9 A;  1LTA C;  3ORV A;  2A45 H;  2R3S A;  4UB8 V;  1S3J A;  1A2S A;  4GOD A;  1HJ3 A;  1YYC A;  2JDI H;  2M3E A;  1SQX G;  5CHX A;  1VYD A;  3TGU E;  2ZBO A;  4UB8 E;  2FXP A;  4ZMD A;  1NHL A;  1GQ1 A;  1G1I A;  3B71 A;  5AVV B;  3AE6 C;  2C9X B;  2OZ1 B;  2JQR A;  2W90 A;  3H32 B;  3H1K J;  1EZV D;  1FJK A;  2I8F A;  1NTK K;  3V2Q A;  1T2K C;  1BGY D;  1L0N G;  3MGN A;  3KDP B;  1NU1 E;  2Y0D A;  1T3J A;  1CC5 A;  3P8C E;  1AA0 A;  2YO2 A;  1CCH A;  2KS1 A;  3GF7 A;  1T6A A;  1PPJ D;  1FJP A;  4UB6 V;  3ZOX A;  1J1E B;  5B66 V;  2C1V A;  3T97 B;  2FFD C;  1KTM A;  4UB6 E;  5B66 E;  3OCD B;  1OW6 A;  1JOC A;  1TU3 F;  5GTI V;  1PFI A;  2WT7 B;  2GC7 D;  3CWB E;  4KJM A;  1CRH A;  3SFD C;  5GTI E;  4U3F J;  2IZ0 A;  3P8M C;  2PCC B;  1U7J A;  4U7J A;  1NOH A;  2FXO A;  1FDM A;  3CCS P;  4O1Q A;  1KIL E;  2R5B A;  3EQ2 A;  2DVH A;  3MK7 B;  2XNX A;  2LIT A;  1M1K Q;  1PGP A;  1KV4 A;  1L4A D;  2ZXX A;  5CID B;  3RK2 D;  3L75 G;  3CYT I;  2WPV B;  4YPC A;  5KLI C;  4C46 A;  1FZC A;  1LJ2 A;  2YXR B;  2CXB A;  1LTJ A;  3IFM A;  1JDL A;  3CCE P;  4JYB A;  1BCC D;  2Z4E A;  4Y28 J;  3L71 J;  1FBM A;  2V4H A;  1EDJ A;  2QJY B;  4FB1 A;  1EZV E;  1M56 D;  3CXH W;  1HZV A;  1SQX D;  4AYC A;  2CPB A;  4EIF A;  5C0Z A;  1AOQ A;  1BGY E;  4L75 A;  1SQP J;  1EXJ A;  3M9H A;  3A0H H;  1W5C E;  2AXC A;  2FFD A;  3CX5 H;  1JTH A;  4PW9 B;  1CI6 B;  3MP7 B;  5CCH C;  1H9Y A;  1PPJ E;  1YCC A;  2E75 B;  1LWU B;  1LNQ A;  3K5B A;  2XDJ A;  5E79 V;  1CTJ A;  1VQL P;  1L0N D;  5APY A;  2YKQ A;  2BH5 X;  5E79 E;  4H0K A;  2W6J H;  4IL6 X;  2KXP B;  3FXE A;  1CNO A;  4YTP C;  1IFD A;  3BAT A;  1GJQ A;  3VNW A;  4L74 A;  1H0T B;  3GW6 A;  4PJ0 H;  5CIE B;  1NWQ A;  2WPS A;  1U57 A;  2MKV A;  1SQQ G;  4H0L B;  3SWY A;  3Q5S A;  2Q1K A;  3RGU A;  4D6T G;  3L35 A;  2R44 A;  1R5L A;  2H8P D;  3SJL A;  3PH0 A;  2K3R A;  1L0L G;  5TIS H;  2JEE A;  1BCC E;  2H89 C;  4PD4 D;  4J20 A;  5K5G B;  4H0L D;  1JY3 O;  3B8E B;  3PXS A;  1P84 H;  3V2N A;  2ZON G;  1SQX E;  3RN0 A;  1I54 A;  1AOF A;  4OH8 B;  5CCH A;  3RL0 D;  4EI2 A;  3L75 D;  4FA4 A;  2J5U A;  2OYI A;  3RK3 B;  1PP9 J;  1N7S B;  1DVH A;  4MN4 C;  3L72 D;  1JY2 O;  1YJW P;  3W68 A;  1NYH A;  1YJ9 P;  2M3B A;  2HFE D;  1DII C;  1GK4 A;  1VL2 A;  3CMA P;  3GHG B;  1N7S D;  2JKV A;  1HJ0 A;  3V6I A;  1H32 B;  1ZOY C;  1L0N E;  2B9B A;  1FZA A;  1SS1 A;  2KP8 A;  1H8A A;  3WU2 H;  3LW5 J;  2QM8 A;  3E1R A;  1RE3 C;  1FE6 A;  4RSZ A;  1OVV A;  5GTH H;  1CRG A;  5DJT B;  1R5S A;  3AEB C;  2K9J A;  2N9J A;  1SFC B;  5DF5 A;  3HD7 C;  1LTI C;  2JO1 A;  1FS0 E;  5AW3 B;  3AE1 C;  1WT6 A;  2Y9Z A;  3X39 A;  4LJI A;  3VYM A;  3BCC E;  2KSE A;  2K88 A;  4PV1 B;  4JPZ B;  4BXL A;  4EIC A;  4PD4 E;  2IBZ D;  1SFC D;  1N9C A;  3CX5 W;  2OYH B;  3V4Q A;  1SQQ D;  1OX3 A;  2C0W A;  3KXD A;  3HUS C;  3L75 E;  2KK7 A;  4D6T D;  3BRV B;  3L72 E;  1L0L D;  2BCC J;  3OW2 O;  1MZ4 A;  1GD2 E;  2KIK A;  2IYP A;  3CC7 P;  5H2F H;  1OVU A;  1Q81 Q;  3ZOO A;  3B5N D;  2QVA A;  2WSF H;  5AW4 B;  2KNC B;  4JF7 A;  1F1F A;  1CXC A;  2MJZ A;  1HH0 A;  2ZFC A;  2ZT9 D;  1IFP A;  1RH5 B;  2N9B A;  3CP5 A;  1VQM P;  3B4S A;  1W2E A;  1OAE A;  1MG3 D;  1N7L A;  2NPS B;  4IFM A;  1KQS O;  1RF0 C;  3WC8 A;  3AEC C;  1SQV G;  1Q86 Q;  1S5L H;  4K3A A;  1RQV A;  4OGQ B;  1BE3 D;  3NBT A;  5KAF V;  1H88 A;  1NMI A;  3H1L J;  4EDF A;  1W2B O;  1ZZH A;  5KAF E;  1DW3 A;  1GU5 A;  1CSB A;  2J58 A;  3O5C A;  3HUS A;  2M5A B;  2IBZ E;  1GL2 D;  4OGQ D;  1SP4 A;  1JO5 A;  1OXZ A;  1FOS E;  3FWN A;  1AVO A;  1SQQ E;  2A06 D;  1NTK J;  3FX0 A;  3WUV A;  2Q3E A;  1OIP A;  1VQP P;  1KIB A;  4D6T E;  1X79 B;  1FZB A;  1HZU A;  1I5T A;  4H0J A;  1SQB K;  1HJB A;  2IBZ I;  1L0L E;  1VQK P;  1VQ8 P;  1Q90 D;  3PXW A;  2HOD A;  1S1C X;  3A3Y B;  5C39 A;  1CRC A;  1KX2 A;  4WVZ A;  2E74 B;  5AVY B;  1X9V A;  3L74 G;  2WSF J;  4IFD K;  1Z56 A;  2C9L Y;  1K3H A;  2PGD A;  4O9B A;  3M97 X;  2KS1 B;  2E74 D;  3ITK A;  1CSX A;  3H1K G;  1QVG O;  1KV9 A;  1L9B C;  1C6S A;  4Z1M H;  1LTS C;  3G3Z A;  1BE3 E;  3HE4 A;  2Z5H A;  3AE3 C;  4WQ8 A;  5AW5 B;  1NTZ K;  5CJ0 A;  4WBA A;  1L2P A;  1JM0 A;  5CJ4 A;  1FCD C;  2JWA A;  1CSV A;  2ZVN B;  2E76 C;  2FBW C;  2FYN C;  1PGO A;  2ZJS E;  3DMI A;  1FDO A;  1SQV D;  1HCM A;  3L4O A;  2O1K A;  3L4F A;  1YQ3 C;  1FOC A;  2A06 E;  2I8D A;  1ZXG A;  4UB8 H;  2GM4 A;  3L73 J;  5APT A;  1WRG A;  1FI7 A;  2ZAE B;  1CED A;  1BDD A;  2ZYG A;  1JUN A;  4W7Y A;  4P4Q B;  3AEA C;  4LGD E;  2HPC B;  1VQ7 P;  4KT0 J;  2N18 C;  1S9K D;  1LT9 C;  4DCK A;  1ZR4 A;  2D0S A;  2GC4 D;  3PHL A;  1URQ A;  3PTZ A;  2A45 G;  1JCD A;  1NML A;  4K3I A;  3M9B A;  1HBW A;  4DT0 A;  1T2K D;  2FFD B;  4K35 A;  2W6B A;  2BLF B;  1JTH B;  2XKM A;  4UB6 H;  4CPG A;  1VQ9 P;  3L4M A;  2IYO A;  1KOR A;  3PP5 A;  351C A;  3L71 G;  2OQQ A;  5BVZ A;  3D70 A;  2WSC H;  2JP3 A;  5GTI H;  3M0D C;  1E79 H;  1S6V B;  4C7N A;  4O1W A;  3EWK A;  2RMZ A;  1BSN A;  5C9M A;  1RQU A;  1ZRT D;  2ORL A;  3SFE C;  1H31 A;  3L70 G;  1S2E A;  3H6P A;  1SQV E;  1N73 A;  3H1K D;  1UII A;  3WFE C;  1K9M Q;  3KHU A;  2IZ1 A;  4H13 C;  2N1T C;  5KLI B;  3SWK A;  5AW0 B;  1K05 A;  4I7Z C;  4TT3 H;  4WB4 A;  2C8S A;  3TSI A;  2HR3 A;  1E29 A;  1GW3 A;  4XA4 A;  2N9Y B;  3L74 J;  3SVW A;  1S9K E;  4M3L A;  1ZV8 A;  2LXB A;  1IZL 0;  1GW4 A;  1R0Q A;  1E5W A;  1CSW A;  1IQC A;  2RN0 A;  3OA7 A;  2FWL A;  4U3F D;  3KZI V;  1FZC C;  1QL1 A;  1LTJ C;  1CRJ A;  3KZI E;  1N2D C;  1XTG B;  5KLV D;  1HH7 A;  3NBS A;  3M0D A;  2FXM A;  3USS A;  2HYN A;  1EDK A;  5CMZ A;  5B5E H;  5CCH D;  5KKZ C;  1CO6 A;  2OTK E;  3AE7 C;  4N78 D;  2QG4 A;  5KAI V;  2K9Y A;  3DR0 A;  4I2L C;  1LT1 A;  2JR8 A;  1PP9 G;  4WQD A;  5KAI E;  1CXA A;  1PGQ A;  2W6A A;  3FGA D;  1ZRT E;  4AAL A;  2N1T A;  1LP1 A;  1VQ6 P;  1U7M A;  3L71 D;  3PLN A;  1EB7 A;  4OVN F;  3H1K E;  4L3G A;  2Q7C A;  2KB7 P;  4HYT B;  1DW0 A;  3NMD A;  1GK6 A;  5BU5 A;  2K9J B;  2ZXE B;  1SQP D;  1KYO D;  1RAQ A;  4GT1 A;  1MKM A;  1VF5 C;  3S4R A;  2YK3 A;  1LTB C;  3OAK A;  2C0X A;  2P1J A;  3HRN A;  4DJG A;  3CC4 P;  1YIC A;  2V7Q H;  2FYU K;  2CA4 B;  1NKZ B;  2PAC A;  1Q82 Q;  2B87 A;  2OAR A;  2WTY A;  2R32 A;  2C1D A;  3GMA A;  4GYD A;  5KJ7 A;  2WPR A;  4H44 C;  1DVV A;  1E2R A;  3WUU A;  4N3Y B;  1M7L A;  1L9J C;  1FI9 A;  1IRV A;  5AW6 B;  3A0B H;  4U3F E;  1KIL C;  4L76 A;  2AIU A;  1IO3 A;  2QJK C;  1C75 A;  3MHV A;  4BWN A;  3IAO A;  5KLV E;  3D71 A;  4W80 A;  1ZR2 A;  1YIQ A;  3R4Y A;  1IK7 A;  4N78 E;  1X0T A;  3L70 J;  1EZV I;  2OYI C;  2CE0 A;  5KTB A;  2BCC G;  2M0B A;  2I1K A;  1OZH A;  3GF3 A;  2IPP A;  4DY9 A;  2P2U A;  3O6Q A;  3HD7 B;  3HTK A;  2E43 A;  3M91 A;  1I8O A;  1S72 P;  2E75 D;  1X22 A;  1F1C A;  1OW8 A;  2B12 B;  1PP9 D;  1SQP E;  1KYO E;  1J2J B;  1GU4 A;  2POH A;  1GZL A;  1SQB J;  1GDV A;  1NTM K;  1FDI A;  3NFQ A;  2N3B A;  3GLM A;  3HD7 D;  3L36 A;  1C6O A;  1EC5 A;  2XU6 A;  2CK3 H;  3CX5 D;  1GDT A;  1N90 A;  1U74 B;  1VQ5 P;  1JMB A;  4NPE A;  3HUS B;  1KYO I;  1KIL A;  4OWF A;  5AVX B;  3OJA B; 
#chains in the Genus database with same CATH homology
 1AKK A;  2BPB B;  3WUI A;  1F1F A;  1RAP A;  1CXC A;  2B0Z B;  1WVE C;  1CHJ A;  3TYI A;  5DFS A;  1CHI A;  1N15 A;  1C2N A;  4AAN A;  2QJP B;  2D0W A;  2VHD A;  3HQ9 A;  3CP5 A;  2FRC A;  5B6Q A;  3PH2 B;  1OAE A;  1MG3 D;  1GU2 A;  2C1U A;  1COT A;  2YCC A;  5CIG B;  4AAO A;  3RN1 A;  3WC8 A;  5TJH A;  1H33 A;  2BGV X;  1HRO A;  2V08 A;  2EXV A;  4FA9 A;  5CIB B;  1YNR A;  1FI3 A;  3TGU D;  1BE3 D;  3NBT A;  1J3S A;  5KAF V;  4N0K A;  1NMI A;  4MU8 A;  4EDF A;  2ZZS 1;  3FWL A;  3L70 D;  1ZZH A;  1COR A;  4XYD B;  1DW2 A;  1DW3 A;  1N50 A;  3O5C A;  2OZ1 A;  1MG2 D;  1CYI A;  1CHH A;  1DW1 A;  1CCR A;  1M70 A;  2A06 D;  2YQB A;  1DT1 A;  2Q3E A;  1KIB A;  1NU1 D;  2HV4 A;  1HZU A;  4IL6 V;  1I5T A;  4H0J A;  2AI5 A;  3O20 A;  1SQB D;  2BCC D;  4AX3 A;  4NFG B;  1CIE A;  3PXW A;  3HQ6 A;  3C2C A;  1CRC A;  1KX2 A;  3O0R C;  2BCN B;  4EID A;  1KX7 A;  1C52 A;  4Y5R A;  3CWB D;  1WEJ F;  2LIR A;  1HRC A;  3JBT B;  1I55 A;  1OCD A;  3O1Y A;  4FAV A;  1K3H A;  2C2C A;  3WFD C;  3M97 X;  1W2L A;  3H1I D;  3ORV A;  3ITK A;  3ZCF A;  1CSX A;  4UB8 V;  2L4D A;  1YTC A;  1A2S A;  1HJ3 A;  1KV9 A;  1L9B C;  1C6S A;  1VYD A;  2ZBO A;  5B5E V;  3H1H D;  3H1L D;  1QN2 A;  4WQ8 A;  1GQ1 A;  1FHB A;  1FCD C;  1NTZ D;  2JWA A;  2C9X B;  1CSV A;  2OZ1 B;  5TIS V;  2DGE A;  2JQR A;  3DMI A;  2N3Y A;  4WQC A;  1SQV D;  4FA5 A;  1HCM A;  1GKS A;  2MTA C;  1EZV D;  3L4O A;  2I8F A;  1FOC A;  1A8C A;  1NTK D;  1BGY D;  1QL4 A;  1FI7 A;  2Y0D A;  2B10 B;  1CC5 A;  1LC2 A;  1CCH A;  2KS1 A;  1YEB A;  1CSU A;  4WQB A;  2FYN B;  1KYO W;  1CED A;  3BCC D;  1PPJ D;  4UB6 V;  3ZOX A;  4P4Q B;  5B66 V;  2C1V A;  1H9X A;  1LFM A;  2N18 C;  2ZXY A;  3MK7 C;  3OCD B;  4PWA A;  1GIW A;  3VMA A;  2D0S A;  2GC4 D;  2YIU B;  3PHL A;  5CIH B;  5GTI V;  2GC7 D;  1CRH A;  1CRY A;  3PTZ A;  1NML A;  2PCC B;  4Q5P A;  4K3I A;  1C7M A;  3A0B V;  2GIW A;  3OA8 B;  4O1Q A;  3HQ7 A;  1CYJ A;  2BLF B;  2N18 B;  2DVH A;  3MK7 B;  4A7P A;  3L4M A;  2LIT A;  5IY5 1;  351C A;  1B7V A;  1P84 D;  2Y0C A;  3A0H V;  5CID B;  4WQE A;  3CYT I;  1U75 B;  1S6V B;  1C2R A;  4O1W A;  2RMZ A;  2CXB A;  5C9M A;  1JDL A;  1ZRT D;  2ORL A;  1BCC D;  2AXT V;  1H31 A;  3OCD A;  1CRI A;  2QJY B;  3H1K D;  4FB1 A;  3CXH W;  1M60 A;  1HZV A;  3WFE C;  4FAN A;  1SQX D;  2N9I A;  3NWV A;  3KHU A;  4EIF A;  5C0Z A;  1YEA A;  1NNO A;  1AOQ A;  5KLI B;  3L73 D;  3OA8 A;  3TF5 A;  3HQ8 A;  1NIR A;  1HJ5 A;  1KB9 D;  4PW9 B;  2C8S A;  1H9Y A;  1QKS A;  2L91 A;  1E29 A;  1YCC A;  4PJ0 V;  1CTY A;  4YE1 A;  2N9Y B;  5H2F V;  3SVW A;  4JCG A;  5E79 V;  1CTJ A;  1ETP A;  1H32 A;  1IZL 0;  1L0N D;  1I6E A;  1R0Q A;  2BH5 X;  1CSW A;  4H0K A;  1FJ0 A;  1IQC A;  2RN0 A;  2FWL A;  4U3F D;  1I8P A;  3RMZ A;  1CTZ A;  3KZI V;  2MHM A;  1CNO A;  3H1J D;  3A9F A;  1CRJ A;  1C6R A;  1GJQ A;  1LMS A;  5KLV D;  1HH7 A;  3VNW A;  5CIF B;  3NBS A;  1H1O A;  3GW6 A;  3PXT A;  5CIE B;  2ZOO A;  5EXQ A;  3ZOY A;  1BL9 A;  1CO6 A;  2QG4 A;  1CIH A;  5KAI V;  2C1D B;  2B4Z A;  4EIE A;  3DR0 A;  4AAM A;  1CYC A;  4WQD A;  3VRD A;  3SJL A;  1CXA A;  5DJQ C;  1AYG A;  4AAL A;  1H31 B;  4PD4 D;  4J20 A;  2JTI B;  3L71 D;  3PLN A;  1LS9 A;  1EB7 A;  3SLE A;  5KKZ B;  3PXS A;  5AUR A;  2ZON G;  4L3G A;  3RN0 A;  1I54 A;  1AOF A;  1DW0 A;  3L75 D;  4FA4 A;  1I6D A;  1LC1 A;  3SXT A;  3WU2 V;  2K9J B;  1A56 A;  1DVH A;  1SQP D;  1KYO D;  1RAQ A;  3L72 D;  5DJQ B;  3TDK A;  2YK3 A;  5GTH V;  2XTS B;  1DII C;  1IRW A;  1YIC A;  4QAO A;  2CA4 B;  2PAC A;  1QL3 A;  2C1D A;  2FYU D;  3L74 D;  4GYD A;  4WQ9 A;  1E2R A;  1DVV A;  1H32 B;  3GG2 A;  3CU4 A;  1L9J C;  1FI9 A;  451C A;  1IRV A;  1CIF A;  155C A;  3RLM A;  4GED B;  1RZ5 A;  3ZOW A;  2AIU A;  1IO3 A;  1C75 A;  2GB8 B;  4FA1 A;  4RSZ A;  1CRG A;  1HJ4 A;  1QYZ A;  1YIQ A;  2N9J A;  3PRJ A;  5DF5 A;  1KB0 A;  1W5C T;  2B11 B;  4L1Q A;  4RJT A;  1E8E A;  3X39 A;  3ZIY A;  4LJI A;  2QJK B;  3VYM A;  2CE0 A;  1DIQ C;  1YFC A;  3DP5 A;  2Y0E A;  3CXH D;  4WQ7 A;  2O3J A;  4EIC A;  2IBZ D;  4DY9 A;  1N9C A;  4V2K A;  2V07 A;  3ZBM A;  3CX5 W;  1K3G A;  1SQQ D;  1I8O A;  3WFC C;  2CA3 B;  1F1C A;  4D6T D;  1H33 B;  2B12 B;  5CYT R;  1PP9 D;  1CIG A;  2BH4 X;  5CIC B;  1L0L D;  3SWS A;  1GDV A;  1RZ6 A;  2N3B A;  4L3H A;  1MZ4 A;  1M6Z A;  1NTM D;  4KMG A;  1C6O A;  2CE1 A;  4XXL A;  3WFB C;  3CX5 D;  1S5L V;  1N90 A;  1U74 B;  4WQA A;  3ZOO A;  2KNC B;  2PCB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...