2CE0A

Structure of oxidized arabidopsis thaliana cytochrome 6a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
LDIQRGATLFNRACAACHDTGGNIIQPGATLFTKDLERNGVDTEEEIYRVTYFGKGRMPGFGEKCTPRGQCTFGPRLQDEEIKLLAEFVKFQADQGWPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C6
publication title Structure of Cytochrome C(6A), a Novel Dithio-Cytochrome of Arabidopsis Thaliana, and its Reactivity with Plastocyanin: Implications for Function.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Electron transfer
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2ce0A00
1CSWA 2GIWA 1BCCD 5CIBB 1CCRA 5CIDB 2C1VA 2YQBA 1CYJA 1H31B 3PXWA 451CA 2FYNB 1H33A 1CCHA 1OCDA 3O20A 1CYIA 1FJ0A 1NNOA 1VYDA 3ORVA 1ETPA 1GQ1A 2OZ1A 4AAOA 4UB8V 3L74D 1YCCA 2C8SA 1H9YA 4IL6V 1DW1A 3DP5A 3SLEA 1CC5A 5GTIV 1I8OA 3CYTI 1M70A 1S6VB 2ZXYA 1MG3D 1OAEA 3SXTA 1SQXD 4H0KA 1QL4A 1LC2A 2JQRA 1FCDC 3WUIA 1DVHA 3NBTA 1HJ4A 4LJIA 2B11B 3A0HV 3H1JD 2CE1A 1JDLA 1EB7A 1A56A 1DIQC 1L9JC 1I6DA 1SQBD 3CWBD 3SWSA 1I5TA 1F1FA 3NWVA 4EICA 2CA3B 2V07A 3RN1A 3VNWA 2DVHA 2BLFB 3H1KD 1HH7A 4K3IA 1MZ4A 5CIEB 1QYZA 2IBZD 1E29A 3ZBMA 1CRIA 5B66V 1CTZA 2B4ZA 1BL9A 3PH2B 1H33B 5DF5A 5IY51 3DR0A 2LITA 2OZ1B 1YEBA 2BPBB 1C52A 2BGVX 2V08A 3CP5A 1L9BC 4WQAA 3SVWA 4AALA 5GTHV 1EZVD 3DMIA 2N3BA 1C2NA 4GEDB 1FHBA 4FA1A 4GYDA 4WQ8A 1ZZHA 1KV9A 1HCMA 2ZONG 3WFDC 2A06D 3SJLA 4WQ9A 4L3HA 2FWLA 1CXCA 1LFMA 3HQ6A 4FANA 1L0LD 3RN0A 1E2RA 1GJQA 1IZL0 1RAQA 1H32A 1LC1A 2MTAC 5KAIV 2MHMA 4PD4D 5KAFV 1YFCA 4EIFA 3O5CA 1J3SA 4KMGA 4RSZA 1HZUA 5AURA 1R0QA 3BCCD 1CNOA 2GB8B 5CYTR 1K3GA 3PXTA 4V2KA 5CIGB 1E8EA 1H9XA 5EXQA 1FI3A 2AXTV 3X39A 1K3HA 4QAOA 2JTIB 4PWAA 2PACA 1N9CA 4AANA 1AKKA 2GC4D 4O1QA 4PW9B 4AAMA 2FRCA 2C1DA 1CXAA 3KZIV 1AOQA 3L73D 1SQPD 4DY9A 1IRWA 1RAPA 2ZZS1 1U75B 1BE3D 3H1ID 1CIFA 1C6SA 1P84D 1KX2A 2FYUD 3O1YA 1QL3A 2ZBOA 3WFCC 2C9XB 3HQ8A 1I8PA 2AI5A 1H32B 3CX5W 3JBTB 3ZCFA 1CTYA 2C1UA 2DGEA 4XYDB 2GC7D 4N0KA 4WQEA 1DVVA 4H0JA 2N18C 3ZOYA 1MG2D 1QKSA 1HZVA 1A2SA 4AX3A 4EIEA 1CSVA 3CX5D 4Y5RA 1KB0A 3TGUD 2ZOOA 2B0ZB 4D6TD 1A8CA 1CIHA 5CIFB 1YIQA 4JCGA 1KYOW 1IQCA 2D0SA 4Q5PA 1ZRTD 1B7VA 3CXHW 1LMSA 2C1DB 1YTCA 1C7MA 2C2CA 1N15A 1FOCA 2N18B 1KX7A 3C2CA 5C0ZA 1GDVA 2CA4B 1H1OA 5DFSA 3H1LD 1COTA 1CIGA 1CIEA 3OCDA 1PPJD 3A9FA 1DIIC 1HROA 1RZ5A 2LIRA 3O0RC 1CSUA 4J20A 2B12B 3CU4A 1CSXA 1S5LV 4WQ7A 5DJQC 3L72D 3L4MA 1LS9A 2CXBA 3L75D 4XXLA 3HQ9A 4EIDA 1QN2A 5H2FV 2N9JA 3ZOWA 1WEJF 2D0WA 4WQCA 2BH4X 4WQBA 4FAVA 4NFGB 1GU2A 5KLIB 2ORLA 1C6OA 1U74B 155CA 1CHHA 1CRYA 1I55A 1AYGA 3VRDA 5DJQB 1CHIA 1CHJA 1GIWA 1FI7A 2VHDA 1SQVD 1CORA 2XTSB 4UB6V 4U3FD 3HQ7A 1I54A 1M60A 1YEAA 2BCNB 4YE1A 2YK3A 4WQDA 3OCDB 2BH5X 1DW3A 4MU8A 3VYMA 1N90A 2YIUB 3L70D 1F1CA 2N3YA 1I6EA 1SQQD 3A0BV 2B10B 2QJYB 1N50A 3PXSA 2HV4A 1HJ5A 4PJ0V 1DW2A 2QJPB 1CRCA 1NTMD 3WU2V 5KKZB 2PCBB 1DW0A 1IRVA 1NMIA 1HRCA 2QJKB 1NTKD 2YCCA 1CTJA 1CRJA 5CICB 1W5CT 3RMZA 2BCCD 1WVEC 1KIBA 3WC8A 5C9MA 4P4QB 4FA5A 3RLMA 3WFBC 1CEDA 3L4OA 3OA8A 3NBSA 3L71D 1GKSA 4L3GA 1NTZD 5TISV 1CRGA 1CYCA 1NIRA 3TYIA 1HJ3A 5B5EV 1W2LA 1NMLA 1KYOD 4L1QA 1H31A 3CXHD 1CRHA 5KLVD 1YICA 3M97X 3ZOOA 5CIHB 1FI9A 2I8FA 4FA9A 1BGYD 4O1WA 3WFEC 1PP9D 2L4DA 5E79V 2CE0A 1C6RA 3MK7C 1L0ND 2AIUA 1C75A 1RZ6A 4FB1A 2PCCB 2N9IA 1IO3A 1YNRA 1NU1D 5B6QA 1C2RA 1KB9D 2EXVA 4FA4A 3H1HD 3ZOXA 1M6ZA 3OA8B 3ZIYA 1CO6A 1DT1A 1AOFA 351CA 3MK7B
chains in the Genus database with same CATH superfamily
1CSWA 2GIWA 1BCCD 5CIBB 1CCRA 5CIDB 2C1VA 2YQBA 1CYJA 1H31B 3PXWA 451CA 2FYNB 1H33A 1CCHA 1OCDA 3O20A 1CYIA 1FJ0A 1NNOA 1VYDA 3ORVA 1ETPA 1GQ1A 2OZ1A 4AAOA 4UB8V 3L74D 1YCCA 2C8SA 1H9YA 4IL6V 1DW1A 3DP5A 3SLEA 1CC5A 5GTIV 1I8OA 3CYTI 1M70A 1S6VB 2ZXYA 1MG3D 1OAEA 3SXTA 1SQXD 4H0KA 1QL4A 1LC2A 2JQRA 1FCDC 3WUIA 1DVHA 3NBTA 1HJ4A 4LJIA 2B11B 3A0HV 3H1JD 2CE1A 1JDLA 1EB7A 1A56A 1DIQC 1L9JC 1I6DA 1SQBD 3CWBD 3SWSA 1I5TA 1F1FA 3NWVA 4EICA 2CA3B 2V07A 3RN1A 3VNWA 2DVHA 2BLFB 3H1KD 1HH7A 4K3IA 1MZ4A 5CIEB 1QYZA 2IBZD 1E29A 3ZBMA 1CRIA 5B66V 1CTZA 2B4ZA 1BL9A 3PH2B 1H33B 5DF5A 5IY51 3DR0A 2LITA 2OZ1B 1YEBA 2BPBB 1C52A 2BGVX 2V08A 3CP5A 1L9BC 4WQAA 3SVWA 4AALA 5GTHV 1EZVD 3DMIA 2N3BA 1C2NA 4GEDB 1FHBA 4FA1A 4GYDA 4WQ8A 1ZZHA 1KV9A 1HCMA 2ZONG 3WFDC 2A06D 3SJLA 4WQ9A 4L3HA 2FWLA 1CXCA 1LFMA 3HQ6A 4FANA 1L0LD 3RN0A 1E2RA 1GJQA 1IZL0 1RAQA 1H32A 1LC1A 2MTAC 5KAIV 2MHMA 4PD4D 5KAFV 1YFCA 4EIFA 3O5CA 1J3SA 4KMGA 4RSZA 1HZUA 5AURA 1R0QA 3BCCD 1CNOA 2GB8B 5CYTR 1K3GA 3PXTA 4V2KA 5CIGB 1E8EA 1H9XA 5EXQA 1FI3A 2AXTV 3X39A 1K3HA 4QAOA 2JTIB 4PWAA 2PACA 1N9CA 4AANA 1AKKA 2GC4D 4O1QA 4PW9B 4AAMA 2FRCA 2C1DA 1CXAA 3KZIV 1AOQA 3L73D 1SQPD 4DY9A 1IRWA 1RAPA 2ZZS1 1U75B 1BE3D 3H1ID 1CIFA 1C6SA 1P84D 1KX2A 2FYUD 3O1YA 1QL3A 2ZBOA 3WFCC 2C9XB 3HQ8A 1I8PA 2AI5A 1H32B 3CX5W 3JBTB 3ZCFA 1CTYA 2C1UA 2DGEA 4XYDB 2GC7D 4N0KA 4WQEA 1DVVA 4H0JA 2N18C 3ZOYA 1MG2D 1QKSA 1HZVA 1A2SA 4AX3A 4EIEA 1CSVA 3CX5D 4Y5RA 1KB0A 3TGUD 2ZOOA 2B0ZB 4D6TD 1A8CA 1CIHA 5CIFB 1YIQA 4JCGA 1KYOW 1IQCA 2D0SA 4Q5PA 1ZRTD 3D0WA 1B7VA 3CXHW 1LMSA 2C1DB 1YTCA 1C7MA 2C2CA 1N15A 1FOCA 2N18B 1KX7A 3C2CA 5C0ZA 1GDVA 2CA4B 1H1OA 5DFSA 3H1LD 1COTA 1CIGA 1CIEA 3OCDA 1PPJD 3A9FA 1DIIC 1HROA 1RZ5A 2LIRA 3O0RC 1CSUA 4J20A 2B12B 3CU4A 1CSXA 1S5LV 4WQ7A 5DJQC 3L72D 3L4MA 1LS9A 2CXBA 3L75D 4XXLA 3HQ9A 4EIDA 1QN2A 5H2FV 2N9JA 3ZOWA 1WEJF 2D0WA 4WQCA 2BH4X 4WQBA 4FAVA 4NFGB 1GU2A 5KLIB 2ORLA 1C6OA 1U74B 155CA 1CHHA 1CRYA 1I55A 1AYGA 3VRDA 5DJQB 1CHIA 1CHJA 1GIWA 1FI7A 2VHDA 1SQVD 1CORA 2XTSB 4UB6V 4U3FD 3HQ7A 1I54A 1M60A 1YEAA 2BCNB 4YE1A 2YK3A 4WQDA 3OCDB 2BH5X 1DW3A 4MU8A 3VYMA 1N90A 2YIUB 3L70D 1F1CA 2N3YA 1I6EA 1SQQD 3A0BV 2B10B 2QJYB 1N50A 3PXSA 2HV4A 1HJ5A 4PJ0V 1DW2A 2QJPB 1CRCA 1NTMD 3WU2V 5KKZB 2PCBB 1DW0A 1IRVA 1NMIA 1HRCA 2QJKB 1NTKD 2YCCA 1CTJA 1CRJA 5CICB 1W5CT 3RMZA 2BCCD 1WVEC 1KIBA 3WC8A 5C9MA 4P4QB 4FA5A 3RLMA 3WFBC 1CEDA 3L4OA 3OA8A 3NBSA 3L71D 1GKSA 4L3GA 1NTZD 5TISV 1CRGA 1CYCA 1NIRA 3TYIA 1HJ3A 5B5EV 1W2LA 1NMLA 1KYOD 4L1QA 1H31A 3CXHD 1CRHA 5KLVD 1YICA 3M97X 3ZOOA 5CIHB 1FI9A 2I8FA 4FA9A 1BGYD 4O1WA 3WFEC 1PP9D 2L4DA 5E79V 2CE0A 1C6RA 3MK7C 1L0ND 2AIUA 1C75A 1RZ6A 4FB1A 2PCCB 2N9IA 1IO3A 1YNRA 1NU1D 5B6QA 1C2RA 1KB9D 2EXVA 4FA4A 3H1HD 3ZOXA 1M6ZA 3OA8B 3ZIYA 1CO6A 1DT1A 1AOFA 351CA 3MK7B
chains in the Genus database with same CATH topology
1CSWA 2GIWA 1BCCD 5CIBB 1CCRA 5CIDB 2C1VA 2YQBA 1CYJA 1H31B 3PXWA 451CA 2FYNB 1H33A 1CCHA 1OCDA 3O20A 1CYIA 1FJ0A 1NNOA 1VYDA 3ORVA 1ETPA 1GQ1A 2OZ1A 4AAOA 4UB8V 3L74D 1YCCA 2C8SA 1H9YA 4IL6V 1DW1A 3DP5A 3SLEA 1CC5A 5GTIV 1I8OA 3CYTI 1M70A 1S6VB 2ZXYA 1MG3D 1OAEA 3SXTA 1SQXD 4H0KA 1QL4A 1LC2A 2JQRA 1FCDC 3WUIA 1DVHA 3NBTA 1HJ4A 4LJIA 2B11B 3A0HV 3H1JD 2CE1A 1JDLA 1EB7A 1A56A 1DIQC 1L9JC 1I6DA 1SQBD 3CWBD 3SWSA 1I5TA 1F1FA 3NWVA 4EICA 2CA3B 2V07A 3RN1A 3VNWA 2DVHA 2BLFB 3H1KD 1HH7A 4K3IA 1MZ4A 5CIEB 1QYZA 2IBZD 1E29A 3ZBMA 1CRIA 5B66V 1CTZA 2B4ZA 1BL9A 3PH2B 1H33B 5DF5A 5IY51 3DR0A 2LITA 2OZ1B 1YEBA 2BPBB 1C52A 2BGVX 2V08A 3CP5A 1L9BC 4WQAA 3SVWA 4AALA 5GTHV 1EZVD 3DMIA 2N3BA 1C2NA 4GEDB 1FHBA 4FA1A 4GYDA 4WQ8A 1ZZHA 1KV9A 1HCMA 2ZONG 3WFDC 2A06D 3SJLA 4WQ9A 4L3HA 2FWLA 1CXCA 1LFMA 3HQ6A 4FANA 1L0LD 3RN0A 1E2RA 1GJQA 1IZL0 1RAQA 1H32A 1LC1A 2MTAC 5KAIV 2MHMA 4PD4D 5KAFV 1YFCA 4EIFA 3O5CA 1J3SA 4KMGA 4RSZA 1HZUA 5AURA 1R0QA 3BCCD 1CNOA 2GB8B 5CYTR 1K3GA 3PXTA 4V2KA 5CIGB 1E8EA 1H9XA 5EXQA 1FI3A 2AXTV 3X39A 1K3HA 4QAOA 2JTIB 4PWAA 2PACA 1N9CA 4AANA 1AKKA 2GC4D 4O1QA 4PW9B 4AAMA 2FRCA 2C1DA 1CXAA 3KZIV 1AOQA 3L73D 1SQPD 4DY9A 1IRWA 1RAPA 2ZZS1 1U75B 1BE3D 3H1ID 1CIFA 1C6SA 1P84D 1KX2A 2FYUD 3O1YA 1QL3A 2ZBOA 3WFCC 2C9XB 3HQ8A 1I8PA 2AI5A 1H32B 3CX5W 3JBTB 3ZCFA 1CTYA 2C1UA 2DGEA 4XYDB 2GC7D 4N0KA 4WQEA 1DVVA 4H0JA 2N18C 3ZOYA 1MG2D 1QKSA 1HZVA 1A2SA 4AX3A 4EIEA 1CSVA 3CX5D 4Y5RA 1KB0A 3TGUD 2ZOOA 2B0ZB 4D6TD 1A8CA 1CIHA 5CIFB 1YIQA 4JCGA 1KYOW 1IQCA 2D0SA 4Q5PA 1ZRTD 1B7VA 3CXHW 1LMSA 2C1DB 1YTCA 1C7MA 2C2CA 1N15A 1FOCA 2N18B 1KX7A 3C2CA 5C0ZA 1GDVA 2CA4B 1H1OA 5DFSA 3H1LD 1COTA 1CIGA 1CIEA 3OCDA 1PPJD 3A9FA 1DIIC 1HROA 1RZ5A 2LIRA 3O0RC 1CSUA 4J20A 2B12B 3CU4A 1CSXA 1S5LV 4WQ7A 5DJQC 3L72D 3L4MA 1LS9A 2CXBA 3L75D 4XXLA 3HQ9A 4EIDA 1QN2A 5H2FV 2N9JA 3ZOWA 1WEJF 2D0WA 4WQCA 2BH4X 4WQBA 4FAVA 4NFGB 1GU2A 5KLIB 2ORLA 1C6OA 1U74B 155CA 1CHHA 1CRYA 1I55A 1AYGA 3VRDA 5DJQB 1CHIA 1CHJA 1GIWA 1FI7A 2VHDA 1SQVD 1CORA 2XTSB 4UB6V 4U3FD 3HQ7A 1I54A 1M60A 1YEAA 2BCNB 4YE1A 2YK3A 4WQDA 3OCDB 2BH5X 1DW3A 4MU8A 3VYMA 1N90A 2YIUB 3L70D 1F1CA 2N3YA 1I6EA 1SQQD 3A0BV 2B10B 2QJYB 1N50A 3PXSA 2HV4A 1HJ5A 4PJ0V 1DW2A 2QJPB 1CRCA 1NTMD 3WU2V 5KKZB 2PCBB 1DW0A 1IRVA 1NMIA 1HRCA 2QJKB 1NTKD 2YCCA 1CTJA 1CRJA 5CICB 1W5CT 3RMZA 2BCCD 1WVEC 1KIBA 3WC8A 5C9MA 4P4QB 4FA5A 3RLMA 3WFBC 1CEDA 3L4OA 3OA8A 3NBSA 3L71D 1GKSA 4L3GA 1NTZD 5TISV 1CRGA 1CYCA 1NIRA 3TYIA 1HJ3A 5B5EV 1W2LA 1NMLA 1KYOD 4L1QA 1H31A 3CXHD 1CRHA 5KLVD 1YICA 3M97X 3ZOOA 5CIHB 1FI9A 2I8FA 4FA9A 1BGYD 4O1WA 3WFEC 1PP9D 2L4DA 5E79V 2CE0A 1C6RA 3MK7C 1L0ND 2AIUA 1C75A 1RZ6A 4FB1A 2PCCB 2N9IA 1IO3A 1YNRA 1NU1D 5B6QA 1C2RA 1KB9D 2EXVA 4FA4A 3H1HD 3ZOXA 1M6ZA 3OA8B 3ZIYA 1CO6A 1DT1A 1AOFA 351CA 3MK7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSW A;  2GIW A;  1BCC D;  5CIB B;  1CCR A;  5CID B;  2C1V A;  2YQB A;  1CYJ A;  1H31 B;  3PXW A;  451C A;  2FYN B;  1H33 A;  1CCH A;  1OCD A;  3O20 A;  1CYI A;  1FJ0 A;  1NNO A;  1VYD A;  3ORV A;  1ETP A;  1GQ1 A;  2OZ1 A;  4AAO A;  4UB8 V;  3L74 D;  1YCC A;  2C8S A;  1H9Y A;  4IL6 V;  1DW1 A;  3DP5 A;  3SLE A;  1CC5 A;  5GTI V;  1I8O A;  3CYT I;  1M70 A;  1S6V B;  2ZXY A;  1MG3 D;  1OAE A;  3SXT A;  1SQX D;  4H0K A;  1QL4 A;  1LC2 A;  2JQR A;  1FCD C;  3WUI A;  1DVH A;  3NBT A;  1HJ4 A;  4LJI A;  2B11 B;  3A0H V;  3H1J D;  2CE1 A;  1JDL A;  1EB7 A;  1A56 A;  1DIQ C;  1L9J C;  1I6D A;  1SQB D;  3CWB D;  3SWS A;  1I5T A;  1F1F A;  3NWV A;  4EIC A;  2CA3 B;  2V07 A;  3RN1 A;  3VNW A;  2DVH A;  2BLF B;  3H1K D;  1HH7 A;  4K3I A;  1MZ4 A;  5CIE B;  1QYZ A;  2IBZ D;  1E29 A;  3ZBM A;  1CRI A;  5B66 V;  1CTZ A;  2B4Z A;  1BL9 A;  3PH2 B;  1H33 B;  5DF5 A;  5IY5 1;  3DR0 A;  2LIT A;  2OZ1 B;  1YEB A;  2BPB B;  1C52 A;  2BGV X;  2V08 A;  3CP5 A;  1L9B C;  4WQA A;  3SVW A;  4AAL A;  5GTH V;  1EZV D;  3DMI A;  2N3B A;  1C2N A;  4GED B;  1FHB A;  4FA1 A;  4GYD A;  4WQ8 A;  1ZZH A;  1KV9 A;  1HCM A;  2ZON G;  3WFD C;  2A06 D;  3SJL A;  4WQ9 A;  4L3H A;  2FWL A;  1CXC A;  1LFM A;  3HQ6 A;  4FAN A;  1L0L D;  3RN0 A;  1E2R A;  1GJQ A;  1IZL 0;  1RAQ A;  1H32 A;  1LC1 A;  2MTA C;  5KAI V;  2MHM A;  4PD4 D;  5KAF V;  1YFC A;  4EIF A;  3O5C A;  1J3S A;  4KMG A;  4RSZ A;  1HZU A;  5AUR A;  1R0Q A;  3BCC D;  1CNO A;  2GB8 B;  5CYT R;  1K3G A;  3PXT A;  4V2K A;  5CIG B;  1E8E A;  1H9X A;  5EXQ A;  1FI3 A;  2AXT V;  3X39 A;  1K3H A;  4QAO A;  2JTI B;  4PWA A;  2PAC A;  1N9C A;  4AAN A;  1AKK A;  2GC4 D;  4O1Q A;  4PW9 B;  4AAM A;  2FRC A;  2C1D A;  1CXA A;  3KZI V;  1AOQ A;  3L73 D;  1SQP D;  4DY9 A;  1IRW A;  1RAP A;  2ZZS 1;  1U75 B;  1BE3 D;  3H1I D;  1CIF A;  1C6S A;  1P84 D;  1KX2 A;  2FYU D;  3O1Y A;  1QL3 A;  2ZBO A;  3WFC C;  2C9X B;  3HQ8 A;  1I8P A;  2AI5 A;  1H32 B;  3CX5 W;  3JBT B;  3ZCF A;  1CTY A;  2C1U A;  2DGE A;  4XYD B;  2GC7 D;  4N0K A;  4WQE A;  1DVV A;  4H0J A;  2N18 C;  3ZOY A;  1MG2 D;  1QKS A;  1HZV A;  1A2S A;  4AX3 A;  4EIE A;  1CSV A;  3CX5 D;  4Y5R A;  1KB0 A;  3TGU D;  2ZOO A;  2B0Z B;  4D6T D;  1A8C A;  1CIH A;  5CIF B;  1YIQ A;  4JCG A;  1KYO W;  1IQC A;  2D0S A;  4Q5P A;  1ZRT D;  1B7V A;  3CXH W;  1LMS A;  2C1D B;  1YTC A;  1C7M A;  2C2C A;  1N15 A;  1FOC A;  2N18 B;  1KX7 A;  3C2C A;  5C0Z A;  1GDV A;  2CA4 B;  1H1O A;  5DFS A;  3H1L D;  1COT A;  1CIG A;  1CIE A;  3OCD A;  1PPJ D;  3A9F A;  1DII C;  1HRO A;  1RZ5 A;  2LIR A;  3O0R C;  1CSU A;  4J20 A;  2B12 B;  3CU4 A;  1CSX A;  1S5L V;  4WQ7 A;  5DJQ C;  3L72 D;  3L4M A;  1LS9 A;  2CXB A;  3L75 D;  4XXL A;  3HQ9 A;  4EID A;  1QN2 A;  5H2F V;  2N9J A;  3ZOW A;  1WEJ F;  2D0W A;  4WQC A;  2BH4 X;  4WQB A;  4FAV A;  4NFG B;  1GU2 A;  5KLI B;  2ORL A;  1C6O A;  1U74 B;  155C A;  1CHH A;  1CRY A;  1I55 A;  1AYG A;  3VRD A;  5DJQ B;  1CHI A;  1CHJ A;  1GIW A;  1FI7 A;  2VHD A;  1SQV D;  1COR A;  2XTS B;  4UB6 V;  4U3F D;  3HQ7 A;  1I54 A;  1M60 A;  1YEA A;  2BCN B;  4YE1 A;  2YK3 A;  4WQD A;  3OCD B;  2BH5 X;  1DW3 A;  4MU8 A;  3VYM A;  1N90 A;  2YIU B;  3L70 D;  1F1C A;  2N3Y A;  1I6E A;  1SQQ D;  3A0B V;  2B10 B;  2QJY B;  1N50 A;  3PXS A;  2HV4 A;  1HJ5 A;  4PJ0 V;  1DW2 A;  2QJP B;  1CRC A;  1NTM D;  3WU2 V;  5KKZ B;  2PCB B;  1DW0 A;  1IRV A;  1NMI A;  1HRC A;  2QJK B;  1NTK D;  2YCC A;  1CTJ A;  1CRJ A;  5CIC B;  1W5C T;  3RMZ A;  2BCC D;  1WVE C;  1KIB A;  3WC8 A;  5C9M A;  4P4Q B;  4FA5 A;  3RLM A;  3WFB C;  1CED A;  3L4O A;  3OA8 A;  3NBS A;  3L71 D;  1GKS A;  4L3G A;  1NTZ D;  5TIS V;  1CRG A;  1CYC A;  1NIR A;  3TYI A;  1HJ3 A;  5B5E V;  1W2L A;  1NML A;  1KYO D;  4L1Q A;  1H31 A;  3CXH D;  1CRH A;  5KLV D;  1YIC A;  3M97 X;  3ZOO A;  5CIH B;  1FI9 A;  2I8F A;  4FA9 A;  1BGY D;  4O1W A;  3WFE C;  1PP9 D;  2L4D A;  5E79 V;  2CE0 A;  1C6R A;  3MK7 C;  1L0N D;  2AIU A;  1C75 A;  1RZ6 A;  4FB1 A;  2PCC B;  2N9I A;  1IO3 A;  1YNR A;  1NU1 D;  5B6Q A;  1C2R A;  1KB9 D;  2EXV A;  4FA4 A;  3H1H D;  3ZOX A;  1M6Z A;  3OA8 B;  3ZIY A;  1CO6 A;  1DT1 A;  1AOF A;  351C A;  3MK7 B; 
#chains in the Genus database with same CATH topology
 1CSW A;  2GIW A;  1BCC D;  5CIB B;  1CCR A;  5CID B;  2C1V A;  2YQB A;  1CYJ A;  1H31 B;  3PXW A;  451C A;  2FYN B;  1H33 A;  1CCH A;  1OCD A;  3O20 A;  1CYI A;  1FJ0 A;  1NNO A;  1VYD A;  3ORV A;  1ETP A;  1GQ1 A;  2OZ1 A;  4AAO A;  4UB8 V;  3L74 D;  1YCC A;  2C8S A;  1H9Y A;  4IL6 V;  1DW1 A;  3DP5 A;  3SLE A;  1CC5 A;  5GTI V;  1I8O A;  3CYT I;  1M70 A;  1S6V B;  2ZXY A;  1MG3 D;  1OAE A;  3SXT A;  1SQX D;  4H0K A;  1QL4 A;  1LC2 A;  2JQR A;  1FCD C;  3WUI A;  1DVH A;  3NBT A;  1HJ4 A;  4LJI A;  2B11 B;  3A0H V;  3H1J D;  2CE1 A;  1JDL A;  1EB7 A;  1A56 A;  1DIQ C;  1L9J C;  1I6D A;  1SQB D;  3CWB D;  3SWS A;  1I5T A;  1F1F A;  3NWV A;  4EIC A;  2CA3 B;  2V07 A;  3RN1 A;  3VNW A;  2DVH A;  2BLF B;  3H1K D;  1HH7 A;  4K3I A;  1MZ4 A;  5CIE B;  1QYZ A;  2IBZ D;  1E29 A;  3ZBM A;  1CRI A;  5B66 V;  1CTZ A;  2B4Z A;  1BL9 A;  3PH2 B;  1H33 B;  5DF5 A;  5IY5 1;  3DR0 A;  2LIT A;  2OZ1 B;  1YEB A;  2BPB B;  1C52 A;  2BGV X;  2V08 A;  3CP5 A;  1L9B C;  4WQA A;  3SVW A;  4AAL A;  5GTH V;  1EZV D;  3DMI A;  2N3B A;  1C2N A;  4GED B;  1FHB A;  4FA1 A;  4GYD A;  4WQ8 A;  1ZZH A;  1KV9 A;  1HCM A;  2ZON G;  3WFD C;  2A06 D;  3SJL A;  4WQ9 A;  4L3H A;  2FWL A;  1CXC A;  1LFM A;  3HQ6 A;  4FAN A;  1L0L D;  3RN0 A;  1E2R A;  1GJQ A;  1IZL 0;  1RAQ A;  1H32 A;  1LC1 A;  2MTA C;  5KAI V;  2MHM A;  4PD4 D;  5KAF V;  1YFC A;  4EIF A;  3O5C A;  1J3S A;  4KMG A;  4RSZ A;  1HZU A;  5AUR A;  1R0Q A;  3BCC D;  1CNO A;  2GB8 B;  5CYT R;  1K3G A;  3PXT A;  4V2K A;  5CIG B;  1E8E A;  1H9X A;  5EXQ A;  1FI3 A;  2AXT V;  3X39 A;  1K3H A;  4QAO A;  2JTI B;  4PWA A;  2PAC A;  1N9C A;  4AAN A;  1AKK A;  2GC4 D;  4O1Q A;  4PW9 B;  4AAM A;  2FRC A;  2C1D A;  1CXA A;  3KZI V;  1AOQ A;  3L73 D;  1SQP D;  4DY9 A;  1IRW A;  1RAP A;  2ZZS 1;  1U75 B;  1BE3 D;  3H1I D;  1CIF A;  1C6S A;  1P84 D;  1KX2 A;  2FYU D;  3O1Y A;  1QL3 A;  2ZBO A;  3WFC C;  2C9X B;  3HQ8 A;  1I8P A;  2AI5 A;  1H32 B;  3CX5 W;  3JBT B;  3ZCF A;  1CTY A;  2C1U A;  2DGE A;  4XYD B;  2GC7 D;  4N0K A;  4WQE A;  1DVV A;  4H0J A;  2N18 C;  3ZOY A;  1MG2 D;  1QKS A;  1HZV A;  1A2S A;  4AX3 A;  4EIE A;  1CSV A;  3CX5 D;  4Y5R A;  1KB0 A;  3TGU D;  2ZOO A;  2B0Z B;  4D6T D;  1A8C A;  1CIH A;  5CIF B;  1YIQ A;  4JCG A;  1KYO W;  1IQC A;  2D0S A;  4Q5P A;  1ZRT D;  3D0W A;  1B7V A;  3CXH W;  1LMS A;  2C1D B;  1YTC A;  1C7M A;  2C2C A;  1N15 A;  1FOC A;  2N18 B;  1KX7 A;  3C2C A;  5C0Z A;  1GDV A;  2CA4 B;  1H1O A;  5DFS A;  3H1L D;  1COT A;  1CIG A;  1CIE A;  3OCD A;  1PPJ D;  3A9F A;  1DII C;  1HRO A;  1RZ5 A;  2LIR A;  3O0R C;  1CSU A;  4J20 A;  2B12 B;  3CU4 A;  1CSX A;  1S5L V;  4WQ7 A;  5DJQ C;  3L72 D;  3L4M A;  1LS9 A;  2CXB A;  3L75 D;  4XXL A;  3HQ9 A;  4EID A;  1QN2 A;  5H2F V;  2N9J A;  3ZOW A;  1WEJ F;  2D0W A;  4WQC A;  2BH4 X;  4WQB A;  4FAV A;  4NFG B;  1GU2 A;  5KLI B;  2ORL A;  1C6O A;  1U74 B;  155C A;  1CHH A;  1CRY A;  1I55 A;  1AYG A;  3VRD A;  5DJQ B;  1CHI A;  1CHJ A;  1GIW A;  1FI7 A;  2VHD A;  1SQV D;  1COR A;  2XTS B;  4UB6 V;  4U3F D;  3HQ7 A;  1I54 A;  1M60 A;  1YEA A;  2BCN B;  4YE1 A;  2YK3 A;  4WQD A;  3OCD B;  2BH5 X;  1DW3 A;  4MU8 A;  3VYM A;  1N90 A;  2YIU B;  3L70 D;  1F1C A;  2N3Y A;  1I6E A;  1SQQ D;  3A0B V;  2B10 B;  2QJY B;  1N50 A;  3PXS A;  2HV4 A;  1HJ5 A;  4PJ0 V;  1DW2 A;  2QJP B;  1CRC A;  1NTM D;  3WU2 V;  5KKZ B;  2PCB B;  1DW0 A;  1IRV A;  1NMI A;  1HRC A;  2QJK B;  1NTK D;  2YCC A;  1CTJ A;  1CRJ A;  5CIC B;  1W5C T;  3RMZ A;  2BCC D;  1WVE C;  1KIB A;  3WC8 A;  5C9M A;  4P4Q B;  4FA5 A;  3RLM A;  3WFB C;  1CED A;  3L4O A;  3OA8 A;  3NBS A;  3L71 D;  1GKS A;  4L3G A;  1NTZ D;  5TIS V;  1CRG A;  1CYC A;  1NIR A;  3TYI A;  1HJ3 A;  5B5E V;  1W2L A;  1NML A;  1KYO D;  4L1Q A;  1H31 A;  3CXH D;  1CRH A;  5KLV D;  1YIC A;  3M97 X;  3ZOO A;  5CIH B;  1FI9 A;  2I8F A;  4FA9 A;  1BGY D;  4O1W A;  3WFE C;  1PP9 D;  2L4D A;  5E79 V;  2CE0 A;  1C6R A;  3MK7 C;  1L0N D;  2AIU A;  1C75 A;  1RZ6 A;  4FB1 A;  2PCC B;  2N9I A;  1IO3 A;  1YNR A;  1NU1 D;  5B6Q A;  1C2R A;  1KB9 D;  2EXV A;  4FA4 A;  3H1H D;  3ZOX A;  1M6Z A;  3OA8 B;  3ZIY A;  1CO6 A;  1DT1 A;  1AOF A;  351C A;  3MK7 B; 
#chains in the Genus database with same CATH homology
 1CSW A;  2GIW A;  1BCC D;  5CIB B;  1CCR A;  5CID B;  2C1V A;  2YQB A;  1CYJ A;  1H31 B;  3PXW A;  451C A;  2FYN B;  1H33 A;  1CCH A;  1OCD A;  3O20 A;  1CYI A;  1FJ0 A;  1NNO A;  1VYD A;  3ORV A;  1ETP A;  1GQ1 A;  2OZ1 A;  4AAO A;  4UB8 V;  3L74 D;  1YCC A;  2C8S A;  1H9Y A;  4IL6 V;  1DW1 A;  3DP5 A;  3SLE A;  1CC5 A;  5GTI V;  1I8O A;  3CYT I;  1M70 A;  1S6V B;  2ZXY A;  1MG3 D;  1OAE A;  3SXT A;  1SQX D;  4H0K A;  1QL4 A;  1LC2 A;  2JQR A;  1FCD C;  3WUI A;  1DVH A;  3NBT A;  1HJ4 A;  4LJI A;  2B11 B;  3A0H V;  3H1J D;  2CE1 A;  1JDL A;  1EB7 A;  1A56 A;  1DIQ C;  1L9J C;  1I6D A;  1SQB D;  3CWB D;  3SWS A;  1I5T A;  1F1F A;  3NWV A;  4EIC A;  2CA3 B;  2V07 A;  3RN1 A;  3VNW A;  2DVH A;  2BLF B;  3H1K D;  1HH7 A;  4K3I A;  1MZ4 A;  5CIE B;  1QYZ A;  2IBZ D;  1E29 A;  3ZBM A;  1CRI A;  5B66 V;  1CTZ A;  2B4Z A;  1BL9 A;  3PH2 B;  1H33 B;  5DF5 A;  5IY5 1;  3DR0 A;  2LIT A;  2OZ1 B;  1YEB A;  2BPB B;  1C52 A;  2BGV X;  2V08 A;  3CP5 A;  1L9B C;  4WQA A;  3SVW A;  4AAL A;  5GTH V;  1EZV D;  3DMI A;  2N3B A;  1C2N A;  4GED B;  1FHB A;  4FA1 A;  4GYD A;  4WQ8 A;  1ZZH A;  1KV9 A;  1HCM A;  2ZON G;  3WFD C;  2A06 D;  3SJL A;  4WQ9 A;  4L3H A;  2FWL A;  1CXC A;  1LFM A;  3HQ6 A;  4FAN A;  1L0L D;  3RN0 A;  1E2R A;  1GJQ A;  1IZL 0;  1RAQ A;  1H32 A;  1LC1 A;  2MTA C;  5KAI V;  2MHM A;  4PD4 D;  5KAF V;  1YFC A;  4EIF A;  3O5C A;  1J3S A;  4KMG A;  4RSZ A;  1HZU A;  5AUR A;  1R0Q A;  3BCC D;  1CNO A;  2GB8 B;  5CYT R;  1K3G A;  3PXT A;  4V2K A;  5CIG B;  1E8E A;  1H9X A;  5EXQ A;  1FI3 A;  2AXT V;  3X39 A;  1K3H A;  4QAO A;  2JTI B;  4PWA A;  2PAC A;  1N9C A;  4AAN A;  1AKK A;  2GC4 D;  4O1Q A;  4PW9 B;  4AAM A;  2FRC A;  2C1D A;  1CXA A;  3KZI V;  1AOQ A;  3L73 D;  1SQP D;  4DY9 A;  1IRW A;  1RAP A;  2ZZS 1;  1U75 B;  1BE3 D;  3H1I D;  1CIF A;  1C6S A;  1P84 D;  1KX2 A;  2FYU D;  3O1Y A;  1QL3 A;  2ZBO A;  3WFC C;  2C9X B;  3HQ8 A;  1I8P A;  2AI5 A;  1H32 B;  3CX5 W;  3JBT B;  3ZCF A;  1CTY A;  2C1U A;  2DGE A;  4XYD B;  2GC7 D;  4N0K A;  4WQE A;  1DVV A;  4H0J A;  2N18 C;  3ZOY A;  1MG2 D;  1QKS A;  1HZV A;  1A2S A;  4AX3 A;  4EIE A;  1CSV A;  3CX5 D;  4Y5R A;  1KB0 A;  3TGU D;  2ZOO A;  2B0Z B;  4D6T D;  1A8C A;  1CIH A;  5CIF B;  1YIQ A;  4JCG A;  1KYO W;  1IQC A;  2D0S A;  4Q5P A;  1ZRT D;  1B7V A;  3CXH W;  1LMS A;  2C1D B;  1YTC A;  1C7M A;  2C2C A;  1N15 A;  1FOC A;  2N18 B;  1KX7 A;  3C2C A;  5C0Z A;  1GDV A;  2CA4 B;  1H1O A;  5DFS A;  3H1L D;  1COT A;  1CIG A;  1CIE A;  3OCD A;  1PPJ D;  3A9F A;  1DII C;  1HRO A;  1RZ5 A;  2LIR A;  3O0R C;  1CSU A;  4J20 A;  2B12 B;  3CU4 A;  1CSX A;  1S5L V;  4WQ7 A;  5DJQ C;  3L72 D;  3L4M A;  1LS9 A;  2CXB A;  3L75 D;  4XXL A;  3HQ9 A;  4EID A;  1QN2 A;  5H2F V;  2N9J A;  3ZOW A;  1WEJ F;  2D0W A;  4WQC A;  2BH4 X;  4WQB A;  4FAV A;  4NFG B;  1GU2 A;  5KLI B;  2ORL A;  1C6O A;  1U74 B;  155C A;  1CHH A;  1CRY A;  1I55 A;  1AYG A;  3VRD A;  5DJQ B;  1CHI A;  1CHJ A;  1GIW A;  1FI7 A;  2VHD A;  1SQV D;  1COR A;  2XTS B;  4UB6 V;  4U3F D;  3HQ7 A;  1I54 A;  1M60 A;  1YEA A;  2BCN B;  4YE1 A;  2YK3 A;  4WQD A;  3OCD B;  2BH5 X;  1DW3 A;  4MU8 A;  3VYM A;  1N90 A;  2YIU B;  3L70 D;  1F1C A;  2N3Y A;  1I6E A;  1SQQ D;  3A0B V;  2B10 B;  2QJY B;  1N50 A;  3PXS A;  2HV4 A;  1HJ5 A;  4PJ0 V;  1DW2 A;  2QJP B;  1CRC A;  1NTM D;  3WU2 V;  5KKZ B;  2PCB B;  1DW0 A;  1IRV A;  1NMI A;  1HRC A;  2QJK B;  1NTK D;  2YCC A;  1CTJ A;  1CRJ A;  5CIC B;  1W5C T;  3RMZ A;  2BCC D;  1WVE C;  1KIB A;  3WC8 A;  5C9M A;  4P4Q B;  4FA5 A;  3RLM A;  3WFB C;  1CED A;  3L4O A;  3OA8 A;  3NBS A;  3L71 D;  1GKS A;  4L3G A;  1NTZ D;  5TIS V;  1CRG A;  1CYC A;  1NIR A;  3TYI A;  1HJ3 A;  5B5E V;  1W2L A;  1NML A;  1KYO D;  4L1Q A;  1H31 A;  3CXH D;  1CRH A;  5KLV D;  1YIC A;  3M97 X;  3ZOO A;  5CIH B;  1FI9 A;  2I8F A;  4FA9 A;  1BGY D;  4O1W A;  3WFE C;  1PP9 D;  2L4D A;  5E79 V;  2CE0 A;  1C6R A;  3MK7 C;  1L0N D;  2AIU A;  1C75 A;  1RZ6 A;  4FB1 A;  2PCC B;  2N9I A;  1IO3 A;  1YNR A;  1NU1 D;  5B6Q A;  1C2R A;  1KB9 D;  2EXV A;  4FA4 A;  3H1H D;  3ZOX A;  1M6Z A;  3OA8 B;  3ZIY A;  1CO6 A;  1DT1 A;  1AOF A;  351C A;  3MK7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...