1SQPD

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 47
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqpD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqpD02
4PWAA 4L3GA 1YFCA 1NMIA 1KYOW 1GDVA 3WUIA 1CIFA 1CXCA 2QJYB 1HZUA 1CIGA 3L70D 3CXHW 1ETPA 1EB7A 2FYUD 3WFCC 3ITKA 3ZBMA 1GU2A 1MZ4A 3PTZA 1L9JC 2PCBB 4O1QA 3HQ9A 3PHLA 5CIHB 1C6OA 1I54A 4WQ8A 2EXVA 1H33B 1DW3A 1RZ6A 3C2CA 2ZZS1 2IBZD 1IO3A 1WEJF 1AYGA 1AKKA 1HZVA 2V07A 1H32B 1GKSA 1KYOD 1COTA 4WQBA 5GTHV 5GTIV 1CCRA 4FB1A 2JQRA 4FA1A 1YTCA 1QN2A 2Y0DA 1KX2A 3SLEA 3CYTI 3PXTA 3A0BV 1K3GA 1KB0A 1N9CA 1RAQA 1FI3A 2C8SA 2BCCD 4J20A 1CTYA 1CORA 1NIRA 1WVEC 3WC8A 4AAMA 1SQPD 3CX5D 1C6SA 2YK3A 1LC1A 2RN0A 155CA 3CXHD 1MG3D 3VYMA 1C52A 3H1ID 1EZVD 1HRCA 1N15A 3TDKA 2CA4B 1CHIA 2B4ZA 3X39A 1CSUA 1CYCA 1L0ND 3SWSA 1CSVA 1I6EA 4DY9A 4U3FD 4KMGA 1QYZA 4EICA 4WQEA 1NMLA 4XYDB 3O0RC 2FWLA 3OCDB 4Q5PA 5DJQB 4A7PA 2GIWA 4JCGA 3PXSA 2A06D 1DIQC 3DR0A 2BGVX 5KAIV 4EIDA 3NWVA 1LFMA 3O20A 1CRJA 1HH7A 3WFBC 2ORLA 1I6DA 3PXWA 5KLVD 1NU1D 5CIFB 3TGUD 2C1UA 2HV4A 3MK7B 1CIHA 3A0HV 1DW0A 4WQ7A 2ZOOA 1PPJD 3PLNA 1K3HA 1HJ3A 1AOFA 2C1DB 2Y0EA 4D6TD 1J3SA 2MTAC 4EDFA 4H0KA 1C75A 4UB8V 5C9MA 2C2CA 1ZRTD 3O5CA 4P4QB 3TYIA 3NBTA 2L91A 3FWLA 3M97X 3OCDA 3ZOOA 1N50A 4WQDA 451CA 1DVVA 2XTSB 1NTKD 4YE1A 4FA4A 2JWAA 4WQ9A 1CNOA 4QAOA 1I8PA 1QL4A 3SJLA 1OCDA 1L9BC 3HQ7A 1FOCA 4N0KA 1I8OA 1FI9A 1DVHA 1E29A 1M6ZA 5EXQA 5TISV 1IRVA 1DIIC 1KIBA 3GW6A 1H9YA 2AXTV 4AAOA 2KS1A 4GEDB 2QJPB 3H1KD 2GB8B 2YCCA 2Q3EA 1QKSA 2N3BA 4IL6V 2I8FA 1GIWA 4L3HA 1CTZA 1CIEA 3RN1A 2GC4D 5IY51 1CYIA 4EIFA 3VNWA 1OAEA 3RMZA 2FYNB 2O3JA 5TJHA 2CA3B 3PRJA 5DF5A 1E2RA 1YICA 3ZIYA 2PCCB 3ZOYA 2ZXYA 1DW1A 2N9IA 1E8EA 1H32A 2BCNB 2C1DA 1CRGA 1B7VA 2B11B 1FHBA 2BH5X 1U75B 5KKZB 1U74B 4RSZA 1KX7A 2VHDA 1YNRA 1LMSA 1RAPA 3H1LD 3L74D 2GC7D 2BH4X 4XXLA 1HJ4A 2L4DA 2YQBA 1F1CA 1CC5A 1NNOA 3L72D 1CXAA 4WQCA 3HQ8A 2N3YA 3CP5A 3ORVA 1YEAA 1M60A 2MHMA 3CU4A 1CSXA 1AOQA 1L0LD 3TF5A 4NFGB 1LS9A 1S5LV 1ZZHA 2CXBA 3MK7C 1BGYD 2N18B 3GG2A 2AIUA 4LJIA 5CYTR 2QJKB 3L73D 4AANA 1CEDA 2B0ZB 1GQ1A 4V2KA 1QL3A 3NBSA 1NTZD 1DW2A 5KLIB 1H9XA 5C0ZA 1HROA 1H33A 4WQAA 1CRYA 1RZ5A 2LITA 2D0WA 4GYDA 3OA8A 4EIEA 1CSWA 5KAFV 1H1OA 2KNCB 351CA 5E79V 4AALA 5H2FV 2PACA 4FA9A 2AI5A 4FA5A 4O1WA 3O1YA 2C1VA 1A56A 3KZIV 1YEBA 3L71D 2OZ1B 5DJQC 2JTIB 1I55A 3H1JD 2DGEA 1A2SA 1C6RA 5B6QA 2LIRA 1C2NA 1SQVD 1H31A 2B12B 3ZOWA 2D0SA 1FCDC 3PH2B 3RN0A 1DT1A 1P84D 2RMZA 3CX5W 3VRDA 1BL9A 2C9XB 1HJ5A 5CIGB 1W5CT 1CTJA 1F1FA 3RLMA 1I5TA 1CCHA 4Y5RA 2Y0CA 1R0QA 4MU8A 2ZBOA 5DFSA 3ZCFA 1VYDA 2YIUB 3CWBD 2CE1A 3H1HD 1CYJA 2CE0A 1C2RA 1NTMD 2N9JA 4AX3A 1SQQD 2BPBB 3WFDC 1IZL0 1FJ0A 1JDLA 5AURA 1BCCD 1MG2D 1M70A 3WU2V 1CRHA 1IRWA 1PP9D 4H0JA 5CIEB 1YIQA 2FRCA 2OZ1A 1N90A 1W2LA 3WFEC 4PD4D 4RJTA 1SQBD 3KHUA 2ZONG 1FI7A 1A8CA 5B66V 1CO6A 3SVWA 4FANA 1C7MA 1HCMA 5CIDB 3L4OA 3DMIA 3SXTA 3HQ6A 1KV9A 2DVHA 2V08A 3OA8B 5CIBB 1CRCA 3VMAA 3BCCD 3DP5A 1GJQA 3L4MA 2N18C 1BE3D 4PJ0V 1CRIA 2K9JB 2B10B 1S6VB 4PW9B 1LC2A 1KB9D 4K3IA 5CICB 2QG4A 1YCCA 4FAVA 1CHHA 1IQCA 4UB6V 3L75D 2N9YB 3JBTB 5B5EV 2BLFB 1H31B 1CHJA 3A9FA 1SQXD 4L1QA 3ZOXA
chains in the Genus database with same CATH superfamily
1NTMJ 2XZRA 1S5LH 1NMIA 1LWUB 1SQPK 1KYOW 1GL2D 1HZUA 2WPQA 1CIGA 2Q1KA 3ITKA 4K35A 3PTZA 1L9JC 3BVHA 5KLVK 3NMDA 4O1QA 3L75J 3PHLA 2Z4EA 3KXDA 1H33B 2N1TD 1RZ6A 3V4QA 2R3CA 1N7SA 3L73G 4Z1MH 4HH2A 1L0LK 2IDBA 2V7QJ 1H32B 3M0AA 1CCRA 5KJ7D 1KB9I 4UB8H 3AE8C 2LXCB 4LLHA 2JQRA 3TGUG 3CCSP 2QM7A 4C46A 3SWFA 2AXCA 3HD7C 3BASA 3A0BV 1RF1B 1KB0A 2Q3IA 3E7KA 4J20A 1CORA 3OAKA 3WC8A 4JPZB 2C0WA 155CA 2Y9YA 1SP4A 1CI6A 1C52A 5B5EE 1HRCA 1N15A 1N86A 1CHIA 1CSUA 3SWSA 1BE3E 1I6EA 4N3YB 4KMGA 4EICA 3M0DC 1NMLA 4XYDB 3OCDB 1VQ5P 5AW0B 5DJQB 1QLED 4DZOA 4A7PA 1DIQC 1JUNA 3H1HG 3NWVA 1LFMA 3H1HE 3AEEC 5B5EH 3M91A 4U3FG 2B89A 3M9QA 1HH7A 2ORLA 2PP6A 3PXWA 1JY2P 1ZR2A 1SQVJ 2C1UA 2HV4A 4Y99B 1R8EA 2ZFCA 3PLNA 1K3HA 1HJ3A 3H32A 4I7ZB 4ZMDA 2C1DB 4GT1A 4BRYA 1JMMA 2E76B 2MTAC 1H8AA 4HJGH 3KZIH 4UB8V 1JCCA 1SFCA 3KYQA 3D6YA 3HE5B 3V2PA 1S1CX 3TYIA 3Q5PA 3FWLA 3L74G 1L2PA 4L75A 3L72J 5CCGC 1AQ5A 4PV1C 1NTKD 1ZLLA 4FA4A 1CNOA 4QAOA 1ZR4A 1HGZA 1FJKA 4I2LC 1QL4A 2YMKA 3VMZA 2P7JA 2Z5IA 1Y8AA 1DIIC 3WUVA 2D2CD 1KILB 4PV1D 1J1DC 1SQXK 1AFOA 1J2JB 1VQ4P 3R2PA 3JCUE 3IAOA 3M9HA 4IL6V 4JF7A 1BGYE 2IFMA 3T97B 1QGKB 4L3HA 1CIEA 5CCGA 4I6MC 1QVGO 3AE6C 3RMZA 5TJHA 1MV8A 2YXQB 2KIKA 3TK1A 3PRJA 5KJ7A 4R4MA 3FWNA 1DEBA 3ZOYA 1YBKA 1PP9E 2BCNB 3MIWA 1AJYA 3BRVB 1EZVI 2NPSB 4QMAA 2GM4A 1CRGA 2BH5X 3AEAC 2VHDA 1YNRA 3RK3E 3H1LD 4H44C 2YKQA 1S9KE 3TNUA 2YQBA 3H6PA 2K1AA 4W7ZA 1JEKA 1CXAA 4WQCA 3VP9A 3KZIE 2ZT9B 1OVRA 2E75B 2XU6A 3RGUA 1NGMB 1VQ9P 2KP8A 3LW5H 2A06G 2AXTH 1CSXA 1AOQA 2R5DA 5CCHA 3H1KJ 4H13D 3TF5A 4NFGB 1LS9A 3R4YA 1ZZHA 5BU8B 3GG2A 5CYTR 2WPSA 3CLQA 4AANA 1CEDA 3MP7B 4D6TG 1AQTA 2YKPA 2PFXA 1IFMA 1EZVG 1H0TA 3CCQP 1EZVE 3AECC 3V2NA 1RZ5A 4GYDA 3BCCE 1VQ7P 1FZEA 1CSWA 4H13B 2W90A 1OX3A 5E79V 1LT9B 3HTKA 2OGUA 1GL2B 2AI5A 2E42A 4FA5A 3RL0B 3O1YA 4YPCA 4OGQD 1VQKP 1A56A 3JSVC 3V2RA 3B5NB 1YEBA 3G3ZA 1YQ3C 5CHXA 3RBZA 3TGUE 1A2SA 2ZVOB 1SQVD 1H31A 4Y28J 1SQPJ 3RN0A 2KB7P 3VRDA 1BL9A 1RE3C 1JY2O 2WT7B 1KB9E 1BGYG 1L0LG 1DX7A 1ZXGA 3M9BA 2BEQD 2OYHA 1S9KD 1QVFO 1NHLA 1QL1A 3FXDA 4JBZA 3PJSK 3RK2C 1C2RA 1NTKJ 1NTMD 2HLOA 5KLVG 3OJAB 1PPJE 1JDLA 2C9LY 3OW2O 1PPJG 4H0JA 2FRCA 3CX5H 1DEEG 3B5NA 2HPCB 2QSIA 1PGJA 2M0BA 1A8CA 3GHGB 1KMIZ 1FJPA 3SVWA 1ZRTE 3USSA 3DMIA 1RQVA 2B87B 2ZVNB 1NWQA 1KFMA 1W2BO 5CIBB 1GK6A 1EDIA 3BCCD 2HYNA 1EXJA 3D71A 2LXBA 1KTMA 1HH0A 2K9JB 5CJ0A 2B10B 1PGQA 3UIAA 4DCKA 1EQ7A 3C8VA 1KN7A 1OIPA 2FYZA 1KV4A 1E5WA 1LTIC 1HGVA 3AE1C 1GMJA 4PWAA 4L3GA 1YFCA 1IFNA 1N73B 5APYA 3F5HA 1GDVA 1SQQG 1ZN5A 1CXCA 2QJYB 3L70D 3CWBG 2OYIB 1NAFA 1ETPA 1EB7A 3WFCC 4KHXA 1GU2A 1CSBA 1KZUB 1U7JA 2PCBB 2E5TA 1M8OB 3TNUB 5AW6B 4D6TE 5CIHB 3U1AA 3OA7A 2VRSA 1I54A 2EXVA 1DW3A 1KQGB 1QEXA 2B9BA 2ZZS1 2W83C 1NU1G 5DJTB 1P84H 2KS1B 3L73E 3GF3A 2WPRA 1COTA 2IZ1A 3Q2YA 5GTHV 1IFPA 4GOEA 4AUWA 1QN2A 1FAVA 3AEBC 2Y0DA 4KT0J 1NTMG 2AEJA 1IFDA 3PXTA 1IFIA 1K3GA 3SWYA 2KYVA 4XFJA 1S2EA 1IK9A 1K04A 3AE3C 2WTYA 2R44A 1K05A 2AEFA 1NIRA 1N7SC 5TISE 2QM8A 1LJ2A 4AAMA 1SQPD 1OW7A 1C6SA 1LC1A 3RK2D 3ABVC 2RN0A 4UB8E 1MG3D 1URQD 1R5LA 1JY3O 2QE7H 3S1KA 3MUDC 3H1ID 2QJKC 1LT9C 2KOGA 1CSVA 4WQEA 1URQA 3LIEA 3O0RC 5CCHC 2FWLA 1L0NK 2D2CC 2GA1A 2G8YA 4L74A 1GU5A 4Q5PA 3TGUJ 2MKVA 2GIWA 1SFCB 2FKWB 2A06D 2BGVX 1EXIA 2Q9IA 2WMMA 1URQB 3RL0g 1K8AQ 3WFBC 1I6DA 3H32B 3L70E 3A0HV 5AVZB 1FC2C 1PP9J 4D6TD 2LR2A 2FBWC 2FY8A 1C75A 2MJZA 2HFED 2W6JH 3O5CA 4P4QB 1IZNB 5B66E 2WSFJ 3OCDA 2IYOA 3ZOOA 3FX0A 3II6A 4WQDA 3BCCJ 3CCJP 1YI2P 1OWAA 1T2KC 2XTSB 1A02F 4YE1A 4IFFA 1EDLA 3VMYA 1G1JA 1I8PA 1L9BC 3H1HJ 2FYUE 3LIDA 3WU2E 4N0KA 2YIUC 1CI6B 4GKGA 1BE3G 1X79B 1XTCC 4U3FJ 5EXQA 5TISV 3GHGC 1M90Q 1Q7YQ 3AE4C 1SQVG 3GW6A 1ZMEC 2AXTV 1M1JC 2KS1A 1DIPA 3P32A 3H1KD 3F89A 1MKMA 1LTJB 4JQ0D 2Q3EA 1SQPE 5L8RJ 1JCDA 3JC22 1CYIA 2ZYAA 1NTZG 2CA3B 4XE5B 2OYIA 1LNQA 4TT3H 4EIJA 1N73A 2ZXYA 3H1IJ 2CPSA 1H32A 4UB6E 1GTWA 5CJ4A 3L4FA 1LTTC 2A06E 5AW2B 1LWUC 1B7VA 1U75B 3H1JG 1U74B 1Q86Q 3WUTA 2BH4X 2ZXXA 3HD7D 2K9JA 3CX5E 1HJ4A 1NKNA 4R4LA 3L71E 3C9IA 4JYBA 5H2FH 5AVRB 1NNOA 2A45H 3A2AA 5AVQB 3HQ8A 2WPVB 4WBAA 4JYCA 3H1LJ 2MHMA 1JNMA 2B87A 1KFNA 2KXPB 4HKZH 2XNXA 4YTPC 3M0DA 4DT0A 1N7LA 4PD4E 2OTKE 3GHGA 1RE4C 3MK7C 1BGYD 1RY3A 2P1JA 2WSSH 2HPCA 1HWTC 1YJNP 5KAFH 1HBWA 5GTIE 4V2KA 1QL3A 4M3LA 1RF1C 5KLIB 1T3JA 3CC2P 5C0ZA 2W6BA 1L0NG 4WQAA 3CC7P 2LITA 1L0NE 1BCCJ 2P67A 1PGOA 1FZGA 1H1OA 2QJYC 3L70J 1FOSE 1SQXG 1ZP0C 5H2FV 2PACA 3S9OA 1IJDB 4FA9A 2Y9ZA 1R5SA 3W67A 3CCMP 3RK3D 2YKOA 1YYCA 2WT7A 1WRGA 1DH3A 4O1WA 2OZ1B 2E76C 1C6RA 2LIRA 1UIIA 2B12B 1FBMA 1FCDC 3PH2B 2QVAA 1KYOH 3CX5W 3C1LA 1GD2E 3D6ZA 2Q6QA 2IYPA 1NTKK 2OARA 1OW6A 3HUSB 4AQRD 1CTJA 3RLMA 1QX8A 1CCHA 1YTZI 1SVFA 1R0QA 5KAIH 3A7OA 1K9MQ 1IO4A 4IOIH 3H1HD 1OZHA 3QH9A 1VF5B 4YXDC 2BPBB 3QWOC 3H1IE 1RQUA 1H0TB 1FJ0A 3WU2V 1CRHA 3IFMA 1YIQA 1W2LA 4IL6X 4PD4D 1G2CB 2WQYC 3SWKA 1FI7A 4RESB 5AVTB 1C7MA 3SSUA 1L4AC 3SXTA 3BATA 2P2UA 1YJ9P 3L75G 3L72E 1KYOE 2NZ2A 2R32A 1T2KD 4GIFA 1SLQA 2M3EA 3VMAA 2E76D 2UWJE 1GJQA 3JCUH 1VQLP 3L4MA 1ZOYC 1KQFB 2N18C 4RO0A 1CRIA 1KB9D 1YCCA 3VTPC 2KLVA 1LTBC 4UB6V 4BWNA 2N9YB 1LTGC 2BLFB 4H44D 1CHJA 3A9FA 1SQXD 4L1QA 1BSNA 1UIXA 2QA4P 1XTGB 2ZJSE 1AVYA 3WUIA 1RH5B 2KUBA 3B5ND 2FYUD 1KILD 1KORA 1MZ4A 2KLUA 4GOFA 4PV1B 3CL3D 4H44B 2P10A 1M56D 1L0LE 1LP1B 1VF5C 1AKKA 4IFDK 3G71P 5H2FE 3H1LE 3NXSA 2ZT9C 2V07A 3O8ZA 2QIWA 1GKSA 2O01N 3HRNA 4L73A 4WQBA 4DOJA 3L37A 3RBXA 4FB1A 4FA1A 1YTCA 3HTKB 1DD3A 3CYTI 1FOSF 1NO4A 3GF7A 1RAQA 3VMXA 3HE5A 1YTZT 2C8SA 5BVZA 1NTZK 1FDMA 3NFQA 1Z56A 3CX5D 4BRYB 2NPSC 1S5LX 3SFEC 3CXHD 3CCUP 1FZFA 3L73J 3VYMA 1NU1J 5APWA 1EZVD 1LTJC 3TDKA 2CA4B 1PL5A 1CYCA 2N1TA 1ZW0A 3H25A 1QYZA 3M06A 3AE5C 1BSHA 3RL0C 2WSFH 2FYNC 2IZ0A 2KZIA 1USEA 3MD0A 1WT6A 5APUA 4JCGA 3PXSA 2LKMA 3P7KA 3DR0A 3CMEP 4NPFX 4C7NB 3I56P 5KAIV 4EIDA 2AXTE 2HODA 1CRJA 2HG5D 2PGDA 3TGUD 1NU1D 1LTJA 3MUDA 1SQQE 2QEXP 3MK7B 1CIHA 1SQVE 1DW0A 3GLMA 2ZOOA 2NPSA 3P8CD 1BCCE 2Y0EA 1J3SA 1SQQK 4EDFA 3VOPA 1S3JA 5KLIC 2JEEA 4TLFA 2BCCG 3AEFC 2XNDH 1JY3N 3RK2B 1EDJA 2FYUJ 3E1RA 3FXEA 3KQGA 3M97X 2HR3A 1N50A 1DVVA 1M1KQ 1FZCC 4WQ9A 3G4SP 3MTUE 5AVXB 1FOCA 4H0LD 3CMAP 1DVHA 1M6ZA 1IRVA 1HJBA 2IBZG 5CMZA 1KILA 4I1LA 2KI7B 4AAOA 1SQBJ 1VQMP 1SQVK 3EWKA 5CCGD 2E74D 2IBZE 3L71G 2FFDA 2GB8B 5CCHD 5AVUB 1QKSA 2N3BA 2I8FA 1OW8A 3RN1A 2WSCH 5IY51 2R5BA 1YJWP 4EIFA 2IBZI 4O9BA 1OAEA 2O3JA 2FYNB 1E2RA 4UB6H 1VQ8P 3L74J 3ZIYA 2PCCB 5AW1B 1E8EA 2E74B 2P58A 4HYTB 2C1DA 5GTHH 2OTLP 2G3AA 2B11B 4L76A 1RAPA 1SS1A 3L74D 1MFZA 1X9VA 3O6QA 3EFFK 4XXLA 1W5CE 3HD7B 3I5CA 1PZQA 1CC5A 2FXPA 3L72D 3V5BA 3GMAA 3ORVA 2YMYA 2I1KA 1OXZA 1L4AB 3U1CA 4WY4D 4AYCA 1OMIA 3IF4A 2WSCJ 1DD4A 2FXMA 1NTZJ 2K88A 1IC2A 3H1KE 4DJGA 1BDDA 2M5AA 1S4XA 1G1IA 1SQBE 3NTNA 4EI2A 2CXBA 1VDFA 2AIUA 3VN0A 1SQPG 3L73D 1GK4A 1GQ1A 3V4WA 3Q5SA 3NBSA 3EFGA 1LTSC 1NTZD 3G6EP 1DW2A 3CXHI 3H1JJ 1PV3A 1VQNP 4PJ0H 1H9XA 1GW3A 1BGYJ 1CRYA 2D0WA 2OTJP 3OA8A 1AVOA 4EIEA 2W27A 3EQ2A 1NOHA 3A5TA 2OYHC 1CW5A 1JO5A 2I1JA 4AALA 1NH4A 1GDTA 3H1LG 3CCVP 1AA0A 1FDIA 5AVYB 3H1KG 3KZIV 3L71D 1RHZB 5DJQC 2NRGA 5EFWB 2JTIB 3H1JD 2E74C 1SQBK 5B6QA 1E79H 2A45I 4WB4A 1Q82Q 1VQPP 3MHVA 2ZXEB 3Q1MA 1P84D 4D6TJ 2RMZA 2J59M 4WWIA 2B88A 4WY4A 2Q7CA 3A0HH 3S4RA 2ZYDA 1HJ5A 4H0LC 1KD1Q 5CIGB 4N6JA 1YHQP 4ZNCA 5CBOA 2Y0CA 4LGDE 1I5TA 4Y5RA 1JTHB 2XKMA 4MU8A 3WUUA 1H88A 1K73Q 2Q5UA 1VYDA 3CWBD 3L70G 2CE1A 1SQXJ 1CYJA 1TU3F 2CE0A 1M1JA 1NTKE 2H7HA 4RKUJ 5AW7B 4EYYQ 2N9JA 4AX3A 3A0HE 3WFDC 1IZL0 5AURA 2IPPA 1MG2D 1M70A 1IRWA 5CIEB 1M57D 5CBNA 3A0BH 3IR9A 4C7RA 4KJMA 3CX5I 1SQBD 3KHUA 2ZONG 1LGHB 1KQLA 3D0WA 1CO6A 2IFNA 4FANA 2BCCE 3CWBJ 3TYYA 1HCMA 5CIDB 3CCRP 3L4OA 1J1DB 1FZAA 3Q3DA 1L0LJ 2DVHA 1HUCA 2QJPC 2OYHB 3OA8B 5APSA 4CPGA 2RH0A 1FZCA 3WMM0 1FDOA 3MGNA 3N7NA 2PRRA 5APTA 3B4SA 1GU4A 1KC8Q 2WSEH 4U3FE 1S6VB 4PW9B 4K3AA 1NU1K 4K3IA 5CICB 5KLVJ 2QG4A 3CD6P 1N7SD 1IQCA 1NKZB 3L75D 5B5EV 1H31B 4IL6E 1RF0C 3I55P 3ZOXA 3H1JE 5AW8B 1FZBA 5BU5A 5E79H 3KDPB 1CIFA 3CXHH 4OVNF 5GTHE 1GL2A 5AW4B 1NYHA 3CXHW 3CPWO 1LT9A 1Q90D 2JJLA 3ZBMA 1VQ6P 1Y47A 2KK7A 1D7MA 3HQ9A 3HE4B 3O6QB 1Y9BA 1C6OA 3W68A 4WQ8A 2N9BA 2YO2A 4WY4C 1HJ0A 5APQA 3V2QA 3TSIA 4BXLA 1IFJA 3C2CA 2IBZD 2KSJA 1IO3A 4EOTA 1WEJF 1AYGA 1LT1A 2WSEJ 1HZVA 5C39A 1IK7A 3RK3C 1KYOD 2RKLA 1YIJP 2GUVA 3VYIA 4WVZA 5GTIV 1PFIA 1KX2A 2OQQA 1J1EC 3CCLP 3SLEA 2KNCA 1NAYA 1N9CA 1SQQJ 3AEDC 5GTIH 3B5NC 1FI3A 2W8ZA 2BASA 2FFDB 2CK3H 2K37A 2BCCD 1CTYA 3FGAD 1WVEC 3L74E 1PP9G 1OVUA 2YK3A 3B71A 1Q2NA 1KILE 3P8MC 5AVWB 2B4ZA 3X39A 1N8RQ 1L0ND 1EC5A 4DY9A 4U3FD 2O01H 3MZWB 1S72P 2C0XA 1S5LE 1EDKA 3L72G 3L75E 1KYOI 1VL2A 1U7MA 3AE7C 2O1JA 3U59A 2IX7C 1L4AD 2WZ7A 3L36A 5K5GB 2E75D 3O20A 3T97A 2ZAEB 1GL2C 5KLVD 1GZLA 5CIFB 1PIXA 1NTME 5M1BA 1Q81Q 1NTZE 1GW4A 1NJIQ 5KAFE 4WQ7A 1OVVA 1PPJD 4ASVA 1AOFA 2YNYA 2YXRB 1RF0A 2HODB 4N78E 3RK3B 5KTBA 4XA4A 4H0KA 4C7NA 1X22A 1JB0J 1T8ZA 2BEZF 2JO1A 1VQOP 2O01J 5C9MA 2KSEA 2C2CA 1ZRTD 5AVSB 2OYIC 3NBTA 2L91A 3SFDC 4NPEA 5APVA 451CA 2H43A 3H1IG 5AW5B 2N1TB 2JWAA 3SJLA 1OCDA 3HQ7A 3AE9C 1I8OA 1FI9A 3WU2H 5AW9B 4U7JA 1P84E 1E29A 4HB1A 3K5BA 1AV1A 2O1KA 1KIBA 1H9YA 3RL0D 3Q5RA 4GEDB 2QJPB 2Z5HA 1N2DC 2PAJA 3PH0A 2YCCA 1JM0A 2J5UA 1YQ4C 1GIWA 3HE4A 1A02J 1CTZA 1U57A 2BCCJ 1NU1E 2GC4D 3CWBE 4ASWA 3HUSC 1RE4A 3VNWA 2WVRA 1RE3A 1MZ9A 2KZJA 2WWWA 3D70A 2JDIH 2J58A 2FYUG 5DF5A 2JP3A 1YICA 4W80A 1OFCX 5DJUB 2M3BA 3BCCG 1H89A 2K9YA 1DW1A 2N9IA 4OWFA 2WITA 2I8DA 3N4XA 1BE3J 1P84I 1LP1A 4W7YA 1X0TA 1FHBA 5KKZB 2E5YA 4RSZA 1KX7A 3V6IA 1SQXE 1LMSA 1L0NJ 5KJ7C 2GC7D 2YO3A 2XV5A 1KQSO 1SQBG 4H0LB 2L4DA 3CI9A 4IFMA 1F1CA 1JY3P 2DW3A 1HTLC 1CZQA 3L71J 2H8PD 2ZT9D 3CCEP 2A45G 4PD4I 4OGQB 2N3YA 3CP5A 1YEAA 1QL2A 1USDA 1M60A 3CU4A 1N73C 2ITAA 1RF1A 4N78D 2POHA 1URQC 2GUSA 1YITP 1VF5D 1L0LD 2N1TC 4MN4C 3BRTB 1S5LV 2W6AA 1NTMK 4Y99C 2N18B 3B8EB 2H89C 4LJIA 2QJKB 1SFCD 4NPDA 2B0ZB 1KILC 1N7SB 1HROA 1H33A 1HF9A 1JOCA 5TISH 1KB9H 1MFTA 1SFCC 5KAFV 3VP8A 2KNCB 351CA 2C9NY 2JKVA 1FU1A 3ZDMA 1JTHA 2OYOA 2M8RA 1NTKG 3LW5J 1PGPA 2AEMA 1LWUA 2C1VA 1G2CA 2D2CB 2SPZA 3CC4P 4PJ0E 2CPBA 2L5GB 1I55A 4WY4B 2DGEA 1JMBA 1VPCA 3CXHE 1C2NA 3ZOWA 4GODA 2D0SA 1FE6A 4B86A 1DT1A 1HVVA 5KKZC 2FXOA 1MUUA 2C9XB 1T6AA 2QRXA 1W5CT 1F1FA 4I7ZC 4LC1A 1BCCG 2ZBOA 4OGQC 5DFSA 4IL6H 3HUSA 1X8YA 3ZCFA 5KAIE 2YIUB 5APXA 4YXWH 1T3UA 1M7LA 2FFDC 2NPSD 1W2EA 1SQQD 1ZV8A 3P8CE 5E79E 1BCCD 2E43A 1PP9D 2ZYGA 2OZ1A 1N90A 1LTAC 5AVVB 3WFEC 1WMKA 3AE2C 4RJTA 3IN6A 4GDOA 1FZCB 5B66V 1J1EB 2M5AB 2JWDA 1NVOA 2E75C 3PP5A 2XDJA 3HQ6A 4H13C 1KV9A 3E1IA 1JY2N 1L4AA 2V08A 2H88C 5AW3B 5KLVE 1FS0E 4PD4H 2JR8A 1CRCA 3DP5A 3G9RA 3A3YB 2V4HA 3L35A 3HD7A 2K3RA 1BE3D 4PJ0V 1LC2A 2V7QH 3KPEA 2FYUK 3AEGC 4FAVA 2R3SA 1CHHA 5B66H 3JBTB 4OH8B 4ZKPA 3A0BE 1BDCA 4ZKUA 1M1JB
chains in the Genus database with same CATH topology
4PWAA 4L3GA 1YFCA 1NMIA 1KYOW 1GDVA 3WUIA 1CIFA 1CXCA 2QJYB 1HZUA 1CIGA 3L70D 3CXHW 1ETPA 1EB7A 2FYUD 3WFCC 3ITKA 3ZBMA 1GU2A 1MZ4A 3PTZA 1L9JC 2PCBB 4O1QA 3HQ9A 3PHLA 5CIHB 1C6OA 1I54A 4WQ8A 2EXVA 1H33B 1DW3A 1RZ6A 3C2CA 2ZZS1 2IBZD 1IO3A 1WEJF 1AYGA 1AKKA 1HZVA 2V07A 1H32B 1GKSA 1KYOD 1COTA 4WQBA 5GTHV 5GTIV 1CCRA 4FB1A 2JQRA 4FA1A 1YTCA 1QN2A 2Y0DA 1KX2A 3SLEA 3CYTI 3PXTA 3A0BV 1K3GA 1KB0A 1N9CA 1RAQA 1FI3A 2C8SA 2BCCD 4J20A 1CTYA 1CORA 1NIRA 1WVEC 3WC8A 4AAMA 1SQPD 3CX5D 1C6SA 2YK3A 1LC1A 2RN0A 155CA 3CXHD 1MG3D 3VYMA 1C52A 3H1ID 1EZVD 1HRCA 1N15A 3TDKA 2CA4B 1CHIA 2B4ZA 3X39A 1CSUA 1CYCA 1L0ND 3SWSA 1CSVA 1I6EA 4DY9A 4U3FD 4KMGA 1QYZA 4EICA 4WQEA 1NMLA 4XYDB 3O0RC 2FWLA 3OCDB 4Q5PA 5DJQB 4A7PA 2GIWA 4JCGA 3PXSA 2A06D 1DIQC 3DR0A 2BGVX 5KAIV 4EIDA 3NWVA 1LFMA 3O20A 1CRJA 1HH7A 3WFBC 2ORLA 1I6DA 3PXWA 5KLVD 1NU1D 5CIFB 3TGUD 2C1UA 2HV4A 3MK7B 1CIHA 3A0HV 1DW0A 4WQ7A 2ZOOA 1PPJD 3PLNA 1K3HA 1HJ3A 1AOFA 2C1DB 2Y0EA 4D6TD 1J3SA 2MTAC 4EDFA 4H0KA 1C75A 4UB8V 5C9MA 2C2CA 1ZRTD 3O5CA 4P4QB 3TYIA 3NBTA 2L91A 3FWLA 3M97X 3OCDA 3ZOOA 1N50A 4WQDA 451CA 1DVVA 2XTSB 1NTKD 4YE1A 4FA4A 2JWAA 4WQ9A 1CNOA 4QAOA 1I8PA 1QL4A 3SJLA 1OCDA 1L9BC 3HQ7A 1FOCA 4N0KA 1I8OA 1FI9A 1DVHA 1E29A 1M6ZA 5EXQA 5TISV 1IRVA 1DIIC 1KIBA 3GW6A 1H9YA 2AXTV 4AAOA 2KS1A 4GEDB 2QJPB 3H1KD 2GB8B 2YCCA 2Q3EA 1QKSA 2N3BA 4IL6V 2I8FA 1GIWA 4L3HA 1CTZA 1CIEA 3RN1A 2GC4D 5IY51 1CYIA 4EIFA 3VNWA 1OAEA 3RMZA 2FYNB 2O3JA 5TJHA 2CA3B 3PRJA 5DF5A 1E2RA 1YICA 3ZIYA 2PCCB 3ZOYA 2ZXYA 1DW1A 2N9IA 1E8EA 1H32A 2BCNB 2C1DA 1CRGA 1B7VA 2B11B 1FHBA 2BH5X 1U75B 5KKZB 1U74B 4RSZA 1KX7A 2VHDA 1YNRA 1LMSA 1RAPA 3H1LD 3L74D 2GC7D 2BH4X 4XXLA 1HJ4A 2L4DA 2YQBA 1F1CA 1CC5A 1NNOA 3L72D 1CXAA 4WQCA 3HQ8A 2N3YA 3CP5A 3ORVA 1YEAA 1M60A 2MHMA 3CU4A 1CSXA 1AOQA 1L0LD 3TF5A 4NFGB 1LS9A 1S5LV 1ZZHA 2CXBA 3MK7C 1BGYD 2N18B 3GG2A 2AIUA 4LJIA 5CYTR 2QJKB 3L73D 4AANA 1CEDA 2B0ZB 1GQ1A 4V2KA 1QL3A 3NBSA 1NTZD 1DW2A 5KLIB 1H9XA 5C0ZA 1HROA 1H33A 4WQAA 1CRYA 1RZ5A 2LITA 2D0WA 4GYDA 3OA8A 4EIEA 1CSWA 5KAFV 1H1OA 2KNCB 351CA 5E79V 4AALA 5H2FV 2PACA 4FA9A 2AI5A 4FA5A 4O1WA 3O1YA 2C1VA 1A56A 3KZIV 1YEBA 3L71D 2OZ1B 5DJQC 2JTIB 1I55A 3H1JD 2DGEA 1A2SA 1C6RA 5B6QA 2LIRA 1C2NA 1SQVD 1H31A 2B12B 3ZOWA 2D0SA 1FCDC 3PH2B 3RN0A 1DT1A 1P84D 2RMZA 3CX5W 3VRDA 1BL9A 2C9XB 1HJ5A 5CIGB 1W5CT 1CTJA 1F1FA 3RLMA 1I5TA 1CCHA 4Y5RA 2Y0CA 1R0QA 4MU8A 2ZBOA 5DFSA 3ZCFA 1VYDA 2YIUB 3CWBD 2CE1A 3H1HD 1CYJA 2CE0A 1C2RA 1NTMD 2N9JA 4AX3A 1SQQD 2BPBB 3WFDC 1IZL0 1FJ0A 1JDLA 5AURA 1BCCD 1MG2D 1M70A 3WU2V 1CRHA 1IRWA 1PP9D 4H0JA 5CIEB 1YIQA 2FRCA 2OZ1A 1N90A 1W2LA 3WFEC 4PD4D 4RJTA 1SQBD 3KHUA 2ZONG 1FI7A 1A8CA 5B66V 1CO6A 3SVWA 4FANA 1C7MA 1HCMA 5CIDB 3L4OA 3DMIA 3SXTA 3HQ6A 1KV9A 2DVHA 2V08A 3OA8B 5CIBB 1CRCA 3VMAA 3BCCD 3DP5A 1GJQA 3L4MA 2N18C 1BE3D 4PJ0V 1CRIA 2K9JB 2B10B 1S6VB 4PW9B 1LC2A 1KB9D 4K3IA 5CICB 2QG4A 1YCCA 4FAVA 1CHHA 1IQCA 4UB6V 3L75D 2N9YB 3JBTB 5B5EV 2BLFB 1H31B 1CHJA 3A9FA 1SQXD 4L1QA 3ZOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWA A;  4L3G A;  1YFC A;  1NMI A;  1KYO W;  1GDV A;  3WUI A;  1CIF A;  1CXC A;  2QJY B;  1HZU A;  1CIG A;  3L70 D;  3CXH W;  1ETP A;  1EB7 A;  2FYU D;  3WFC C;  3ITK A;  3ZBM A;  1GU2 A;  1MZ4 A;  3PTZ A;  1L9J C;  2PCB B;  4O1Q A;  3HQ9 A;  3PHL A;  5CIH B;  1C6O A;  1I54 A;  4WQ8 A;  2EXV A;  1H33 B;  1DW3 A;  1RZ6 A;  3C2C A;  2ZZS 1;  2IBZ D;  1IO3 A;  1WEJ F;  1AYG A;  1AKK A;  1HZV A;  2V07 A;  1H32 B;  1GKS A;  1KYO D;  1COT A;  4WQB A;  5GTH V;  5GTI V;  1CCR A;  4FB1 A;  2JQR A;  4FA1 A;  1YTC A;  1QN2 A;  2Y0D A;  1KX2 A;  3SLE A;  3CYT I;  3PXT A;  3A0B V;  1K3G A;  1KB0 A;  1N9C A;  1RAQ A;  1FI3 A;  2C8S A;  2BCC D;  4J20 A;  1CTY A;  1COR A;  1NIR A;  1WVE C;  3WC8 A;  4AAM A;  1SQP D;  3CX5 D;  1C6S A;  2YK3 A;  1LC1 A;  2RN0 A;  155C A;  3CXH D;  1MG3 D;  3VYM A;  1C52 A;  3H1I D;  1EZV D;  1HRC A;  1N15 A;  3TDK A;  2CA4 B;  1CHI A;  2B4Z A;  3X39 A;  1CSU A;  1CYC A;  1L0N D;  3SWS A;  1CSV A;  1I6E A;  4DY9 A;  4U3F D;  4KMG A;  1QYZ A;  4EIC A;  4WQE A;  1NML A;  4XYD B;  3O0R C;  2FWL A;  3OCD B;  4Q5P A;  5DJQ B;  4A7P A;  2GIW A;  4JCG A;  3PXS A;  2A06 D;  1DIQ C;  3DR0 A;  2BGV X;  5KAI V;  4EID A;  3NWV A;  1LFM A;  3O20 A;  1CRJ A;  1HH7 A;  3WFB C;  2ORL A;  1I6D A;  3PXW A;  5KLV D;  1NU1 D;  5CIF B;  3TGU D;  2C1U A;  2HV4 A;  3MK7 B;  1CIH A;  3A0H V;  1DW0 A;  4WQ7 A;  2ZOO A;  1PPJ D;  3PLN A;  1K3H A;  1HJ3 A;  1AOF A;  2C1D B;  2Y0E A;  4D6T D;  1J3S A;  2MTA C;  4EDF A;  4H0K A;  1C75 A;  4UB8 V;  5C9M A;  2C2C A;  1ZRT D;  3O5C A;  4P4Q B;  3TYI A;  3NBT A;  2L91 A;  3FWL A;  3M97 X;  3OCD A;  3ZOO A;  1N50 A;  4WQD A;  451C A;  1DVV A;  2XTS B;  1NTK D;  4YE1 A;  4FA4 A;  2JWA A;  4WQ9 A;  1CNO A;  4QAO A;  1I8P A;  1QL4 A;  3SJL A;  1OCD A;  1L9B C;  3HQ7 A;  1FOC A;  4N0K A;  1I8O A;  1FI9 A;  1DVH A;  1E29 A;  1M6Z A;  5EXQ A;  5TIS V;  1IRV A;  1DII C;  1KIB A;  3GW6 A;  1H9Y A;  2AXT V;  4AAO A;  2KS1 A;  4GED B;  2QJP B;  3H1K D;  2GB8 B;  2YCC A;  2Q3E A;  1QKS A;  2N3B A;  4IL6 V;  2I8F A;  1GIW A;  4L3H A;  1CTZ A;  1CIE A;  3RN1 A;  2GC4 D;  5IY5 1;  1CYI A;  4EIF A;  3VNW A;  1OAE A;  3RMZ A;  2FYN B;  2O3J A;  5TJH A;  2CA3 B;  3PRJ A;  5DF5 A;  1E2R A;  1YIC A;  3ZIY A;  2PCC B;  3ZOY A;  2ZXY A;  1DW1 A;  2N9I A;  1E8E A;  1H32 A;  2BCN B;  2C1D A;  1CRG A;  1B7V A;  2B11 B;  1FHB A;  2BH5 X;  1U75 B;  5KKZ B;  1U74 B;  4RSZ A;  1KX7 A;  2VHD A;  1YNR A;  1LMS A;  1RAP A;  3H1L D;  3L74 D;  2GC7 D;  2BH4 X;  4XXL A;  1HJ4 A;  2L4D A;  2YQB A;  1F1C A;  1CC5 A;  1NNO A;  3L72 D;  1CXA A;  4WQC A;  3HQ8 A;  2N3Y A;  3CP5 A;  3ORV A;  1YEA A;  1M60 A;  2MHM A;  3CU4 A;  1CSX A;  1AOQ A;  1L0L D;  3TF5 A;  4NFG B;  1LS9 A;  1S5L V;  1ZZH A;  2CXB A;  3MK7 C;  1BGY D;  2N18 B;  3GG2 A;  2AIU A;  4LJI A;  5CYT R;  2QJK B;  3L73 D;  4AAN A;  1CED A;  2B0Z B;  1GQ1 A;  4V2K A;  1QL3 A;  3NBS A;  1NTZ D;  1DW2 A;  5KLI B;  1H9X A;  5C0Z A;  1HRO A;  1H33 A;  4WQA A;  1CRY A;  1RZ5 A;  2LIT A;  2D0W A;  4GYD A;  3OA8 A;  4EIE A;  1CSW A;  5KAF V;  1H1O A;  2KNC B;  351C A;  5E79 V;  4AAL A;  5H2F V;  2PAC A;  4FA9 A;  2AI5 A;  4FA5 A;  4O1W A;  3O1Y A;  2C1V A;  1A56 A;  3KZI V;  1YEB A;  3L71 D;  2OZ1 B;  5DJQ C;  2JTI B;  1I55 A;  3H1J D;  2DGE A;  1A2S A;  1C6R A;  5B6Q A;  2LIR A;  1C2N A;  1SQV D;  1H31 A;  2B12 B;  3ZOW A;  2D0S A;  1FCD C;  3PH2 B;  3RN0 A;  1DT1 A;  1P84 D;  2RMZ A;  3CX5 W;  3VRD A;  1BL9 A;  2C9X B;  1HJ5 A;  5CIG B;  1W5C T;  1CTJ A;  1F1F A;  3RLM A;  1I5T A;  1CCH A;  4Y5R A;  2Y0C A;  1R0Q A;  4MU8 A;  2ZBO A;  5DFS A;  3ZCF A;  1VYD A;  2YIU B;  3CWB D;  2CE1 A;  3H1H D;  1CYJ A;  2CE0 A;  1C2R A;  1NTM D;  2N9J A;  4AX3 A;  1SQQ D;  2BPB B;  3WFD C;  1IZL 0;  1FJ0 A;  1JDL A;  5AUR A;  1BCC D;  1MG2 D;  1M70 A;  3WU2 V;  1CRH A;  1IRW A;  1PP9 D;  4H0J A;  5CIE B;  1YIQ A;  2FRC A;  2OZ1 A;  1N90 A;  1W2L A;  3WFE C;  4PD4 D;  4RJT A;  1SQB D;  3KHU A;  2ZON G;  1FI7 A;  1A8C A;  5B66 V;  1CO6 A;  3SVW A;  4FAN A;  1C7M A;  1HCM A;  5CID B;  3L4O A;  3DMI A;  3SXT A;  3HQ6 A;  1KV9 A;  2DVH A;  2V08 A;  3OA8 B;  5CIB B;  1CRC A;  3VMA A;  3BCC D;  3DP5 A;  1GJQ A;  3L4M A;  2N18 C;  1BE3 D;  4PJ0 V;  1CRI A;  2K9J B;  2B10 B;  1S6V B;  4PW9 B;  1LC2 A;  1KB9 D;  4K3I A;  5CIC B;  2QG4 A;  1YCC A;  4FAV A;  1CHH A;  1IQC A;  4UB6 V;  3L75 D;  2N9Y B;  3JBT B;  5B5E V;  2BLF B;  1H31 B;  1CHJ A;  3A9F A;  1SQX D;  4L1Q A;  3ZOX A; 
#chains in the Genus database with same CATH topology
 1NTM J;  2XZR A;  1S5L H;  1NMI A;  1LWU B;  1SQP K;  1KYO W;  1GL2 D;  1HZU A;  2WPQ A;  1CIG A;  2Q1K A;  3ITK A;  4K35 A;  3PTZ A;  1L9J C;  3BVH A;  5KLV K;  3NMD A;  4O1Q A;  3L75 J;  3PHL A;  2Z4E A;  3KXD A;  1H33 B;  2N1T D;  1RZ6 A;  3V4Q A;  2R3C A;  1N7S A;  3L73 G;  4Z1M H;  4HH2 A;  1L0L K;  2IDB A;  2V7Q J;  1H32 B;  3M0A A;  1CCR A;  5KJ7 D;  1KB9 I;  4UB8 H;  3AE8 C;  2LXC B;  4LLH A;  2JQR A;  3TGU G;  3CCS P;  2QM7 A;  4C46 A;  3SWF A;  2AXC A;  3HD7 C;  3BAS A;  3A0B V;  1RF1 B;  1KB0 A;  2Q3I A;  3E7K A;  4J20 A;  1COR A;  3OAK A;  3WC8 A;  4JPZ B;  2C0W A;  155C A;  2Y9Y A;  1SP4 A;  1CI6 A;  1C52 A;  5B5E E;  1HRC A;  1N15 A;  1N86 A;  1CHI A;  1CSU A;  3SWS A;  1BE3 E;  1I6E A;  4N3Y B;  4KMG A;  4EIC A;  3M0D C;  1NML A;  4XYD B;  3OCD B;  1VQ5 P;  5AW0 B;  5DJQ B;  1QLE D;  4DZO A;  4A7P A;  1DIQ C;  1JUN A;  3H1H G;  3NWV A;  1LFM A;  3H1H E;  3AEE C;  5B5E H;  3M91 A;  4U3F G;  2B89 A;  3M9Q A;  1HH7 A;  2ORL A;  2PP6 A;  3PXW A;  1JY2 P;  1ZR2 A;  1SQV J;  2C1U A;  2HV4 A;  4Y99 B;  1R8E A;  2ZFC A;  3PLN A;  1K3H A;  1HJ3 A;  3H32 A;  4I7Z B;  4ZMD A;  2C1D B;  4GT1 A;  4BRY A;  1JMM A;  2E76 B;  2MTA C;  1H8A A;  4HJG H;  3KZI H;  4UB8 V;  1JCC A;  1SFC A;  3KYQ A;  3D6Y A;  3HE5 B;  3V2P A;  1S1C X;  3TYI A;  3Q5P A;  3FWL A;  3L74 G;  1L2P A;  4L75 A;  3L72 J;  5CCG C;  1AQ5 A;  4PV1 C;  1NTK D;  1ZLL A;  4FA4 A;  1CNO A;  4QAO A;  1ZR4 A;  1HGZ A;  1FJK A;  4I2L C;  1QL4 A;  2YMK A;  3VMZ A;  2P7J A;  2Z5I A;  1Y8A A;  1DII C;  3WUV A;  2D2C D;  1KIL B;  4PV1 D;  1J1D C;  1SQX K;  1AFO A;  1J2J B;  1VQ4 P;  3R2P A;  3JCU E;  3IAO A;  3M9H A;  4IL6 V;  4JF7 A;  1BGY E;  2IFM A;  3T97 B;  1QGK B;  4L3H A;  1CIE A;  5CCG A;  4I6M C;  1QVG O;  3AE6 C;  3RMZ A;  5TJH A;  1MV8 A;  2YXQ B;  2KIK A;  3TK1 A;  3PRJ A;  5KJ7 A;  4R4M A;  3FWN A;  1DEB A;  3ZOY A;  1YBK A;  1PP9 E;  2BCN B;  3MIW A;  1AJY A;  3BRV B;  1EZV I;  2NPS B;  4QMA A;  2GM4 A;  1CRG A;  2BH5 X;  3AEA C;  2VHD A;  1YNR A;  3RK3 E;  3H1L D;  4H44 C;  2YKQ A;  1S9K E;  3TNU A;  2YQB A;  3H6P A;  2K1A A;  4W7Z A;  1JEK A;  1CXA A;  4WQC A;  3VP9 A;  3KZI E;  2ZT9 B;  1OVR A;  2E75 B;  2XU6 A;  3RGU A;  1NGM B;  1VQ9 P;  2KP8 A;  3LW5 H;  2A06 G;  2AXT H;  1CSX A;  1AOQ A;  2R5D A;  5CCH A;  3H1K J;  4H13 D;  3TF5 A;  4NFG B;  1LS9 A;  3R4Y A;  1ZZH A;  5BU8 B;  3GG2 A;  5CYT R;  2WPS A;  3CLQ A;  4AAN A;  1CED A;  3MP7 B;  4D6T G;  1AQT A;  2YKP A;  2PFX A;  1IFM A;  1EZV G;  1H0T A;  3CCQ P;  1EZV E;  3AEC C;  3V2N A;  1RZ5 A;  4GYD A;  3BCC E;  1VQ7 P;  1FZE A;  1CSW A;  4H13 B;  2W90 A;  1OX3 A;  5E79 V;  1LT9 B;  3HTK A;  2OGU A;  1GL2 B;  2AI5 A;  2E42 A;  4FA5 A;  3RL0 B;  3O1Y A;  4YPC A;  4OGQ D;  1VQK P;  1A56 A;  3JSV C;  3V2R A;  3B5N B;  1YEB A;  3G3Z A;  1YQ3 C;  5CHX A;  3RBZ A;  3TGU E;  1A2S A;  2ZVO B;  1SQV D;  1H31 A;  4Y28 J;  1SQP J;  3RN0 A;  2KB7 P;  3VRD A;  1BL9 A;  1RE3 C;  1JY2 O;  2WT7 B;  1KB9 E;  1BGY G;  1L0L G;  1DX7 A;  1ZXG A;  3M9B A;  2BEQ D;  2OYH A;  1S9K D;  1QVF O;  1NHL A;  1QL1 A;  3FXD A;  4JBZ A;  3PJS K;  3RK2 C;  1C2R A;  1NTK J;  1NTM D;  2HLO A;  5KLV G;  3OJA B;  1PPJ E;  1JDL A;  2C9L Y;  3OW2 O;  1PPJ G;  4H0J A;  2FRC A;  3CX5 H;  1DEE G;  3B5N A;  2HPC B;  2QSI A;  1PGJ A;  2M0B A;  1A8C A;  3GHG B;  1KMI Z;  1FJP A;  3SVW A;  1ZRT E;  3USS A;  3DMI A;  1RQV A;  2B87 B;  2ZVN B;  1NWQ A;  1KFM A;  1W2B O;  5CIB B;  1GK6 A;  1EDI A;  3BCC D;  2HYN A;  1EXJ A;  3D71 A;  2LXB A;  1KTM A;  1HH0 A;  2K9J B;  5CJ0 A;  2B10 B;  1PGQ A;  3UIA A;  4DCK A;  1EQ7 A;  3C8V A;  1KN7 A;  1OIP A;  2FYZ A;  1KV4 A;  1E5W A;  1LTI C;  1HGV A;  3AE1 C;  1GMJ A;  4PWA A;  4L3G A;  1YFC A;  1IFN A;  1N73 B;  5APY A;  3F5H A;  1GDV A;  1SQQ G;  1ZN5 A;  1CXC A;  2QJY B;  3L70 D;  3CWB G;  2OYI B;  1NAF A;  1ETP A;  1EB7 A;  3WFC C;  4KHX A;  1GU2 A;  1CSB A;  1KZU B;  1U7J A;  2PCB B;  2E5T A;  1M8O B;  3TNU B;  5AW6 B;  4D6T E;  5CIH B;  3U1A A;  3OA7 A;  2VRS A;  1I54 A;  2EXV A;  1DW3 A;  1KQG B;  1QEX A;  2B9B A;  2ZZS 1;  2W83 C;  1NU1 G;  5DJT B;  1P84 H;  2KS1 B;  3L73 E;  3GF3 A;  2WPR A;  1COT A;  2IZ1 A;  3Q2Y A;  5GTH V;  1IFP A;  4GOE A;  4AUW A;  1QN2 A;  1FAV A;  3AEB C;  2Y0D A;  4KT0 J;  1NTM G;  2AEJ A;  1IFD A;  3PXT A;  1IFI A;  1K3G A;  3SWY A;  2KYV A;  4XFJ A;  1S2E A;  1IK9 A;  1K04 A;  3AE3 C;  2WTY A;  2R44 A;  1K05 A;  2AEF A;  1NIR A;  1N7S C;  5TIS E;  2QM8 A;  1LJ2 A;  4AAM A;  1SQP D;  1OW7 A;  1C6S A;  1LC1 A;  3RK2 D;  3ABV C;  2RN0 A;  4UB8 E;  1MG3 D;  1URQ D;  1R5L A;  1JY3 O;  2QE7 H;  3S1K A;  3MUD C;  3H1I D;  2QJK C;  1LT9 C;  2KOG A;  1CSV A;  4WQE A;  1URQ A;  3LIE A;  3O0R C;  5CCH C;  2FWL A;  1L0N K;  2D2C C;  2GA1 A;  2G8Y A;  4L74 A;  1GU5 A;  4Q5P A;  3TGU J;  2MKV A;  2GIW A;  1SFC B;  2FKW B;  2A06 D;  2BGV X;  1EXI A;  2Q9I A;  2WMM A;  1URQ B;  3RL0 g;  1K8A Q;  3WFB C;  1I6D A;  3H32 B;  3L70 E;  3A0H V;  5AVZ B;  1FC2 C;  1PP9 J;  4D6T D;  2LR2 A;  2FBW C;  2FY8 A;  1C75 A;  2MJZ A;  2HFE D;  2W6J H;  3O5C A;  4P4Q B;  1IZN B;  5B66 E;  2WSF J;  3OCD A;  2IYO A;  3ZOO A;  3FX0 A;  3II6 A;  4WQD A;  3BCC J;  3CCJ P;  1YI2 P;  1OWA A;  1T2K C;  2XTS B;  1A02 F;  4YE1 A;  4IFF A;  1EDL A;  3VMY A;  1G1J A;  1I8P A;  1L9B C;  3H1H J;  2FYU E;  3LID A;  3WU2 E;  4N0K A;  2YIU C;  1CI6 B;  4GKG A;  1BE3 G;  1X79 B;  1XTC C;  4U3F J;  5EXQ A;  5TIS V;  3GHG C;  1M90 Q;  1Q7Y Q;  3AE4 C;  1SQV G;  3GW6 A;  1ZME C;  2AXT V;  1M1J C;  2KS1 A;  1DIP A;  3P32 A;  3H1K D;  3F89 A;  1MKM A;  1LTJ B;  4JQ0 D;  2Q3E A;  1SQP E;  5L8R J;  1JCD A;  3JC2 2;  1CYI A;  2ZYA A;  1NTZ G;  2CA3 B;  4XE5 B;  2OYI A;  1LNQ A;  4TT3 H;  4EIJ A;  1N73 A;  2ZXY A;  3H1I J;  2CPS A;  1H32 A;  4UB6 E;  1GTW A;  5CJ4 A;  3L4F A;  1LTT C;  2A06 E;  5AW2 B;  1LWU C;  1B7V A;  1U75 B;  3H1J G;  1U74 B;  1Q86 Q;  3WUT A;  2BH4 X;  2ZXX A;  3HD7 D;  2K9J A;  3CX5 E;  1HJ4 A;  1NKN A;  4R4L A;  3L71 E;  3C9I A;  4JYB A;  5H2F H;  5AVR B;  1NNO A;  2A45 H;  3A2A A;  5AVQ B;  3HQ8 A;  2WPV B;  4WBA A;  4JYC A;  3H1L J;  2MHM A;  1JNM A;  2B87 A;  1KFN A;  2KXP B;  4HKZ H;  2XNX A;  4YTP C;  3M0D A;  4DT0 A;  1N7L A;  4PD4 E;  2OTK E;  3GHG A;  1RE4 C;  3MK7 C;  1BGY D;  1RY3 A;  2P1J A;  2WSS H;  2HPC A;  1HWT C;  1YJN P;  5KAF H;  1HBW A;  5GTI E;  4V2K A;  1QL3 A;  4M3L A;  1RF1 C;  5KLI B;  1T3J A;  3CC2 P;  5C0Z A;  2W6B A;  1L0N G;  4WQA A;  3CC7 P;  2LIT A;  1L0N E;  1BCC J;  2P67 A;  1PGO A;  1FZG A;  1H1O A;  2QJY C;  3L70 J;  1FOS E;  1SQX G;  1ZP0 C;  5H2F V;  2PAC A;  3S9O A;  1IJD B;  4FA9 A;  2Y9Z A;  1R5S A;  3W67 A;  3CCM P;  3RK3 D;  2YKO A;  1YYC A;  2WT7 A;  1WRG A;  1DH3 A;  4O1W A;  2OZ1 B;  2E76 C;  1C6R A;  2LIR A;  1UII A;  2B12 B;  1FBM A;  1FCD C;  3PH2 B;  2QVA A;  1KYO H;  3CX5 W;  3C1L A;  1GD2 E;  3D6Z A;  2Q6Q A;  2IYP A;  1NTK K;  2OAR A;  1OW6 A;  3HUS B;  4AQR D;  1CTJ A;  3RLM A;  1QX8 A;  1CCH A;  1YTZ I;  1SVF A;  1R0Q A;  5KAI H;  3A7O A;  1K9M Q;  1IO4 A;  4IOI H;  3H1H D;  1OZH A;  3QH9 A;  1VF5 B;  4YXD C;  2BPB B;  3QWO C;  3H1I E;  1RQU A;  1H0T B;  1FJ0 A;  3WU2 V;  1CRH A;  3IFM A;  1YIQ A;  1W2L A;  4IL6 X;  4PD4 D;  1G2C B;  2WQY C;  3SWK A;  1FI7 A;  4RES B;  5AVT B;  1C7M A;  3SSU A;  1L4A C;  3SXT A;  3BAT A;  2P2U A;  1YJ9 P;  3L75 G;  3L72 E;  1KYO E;  2NZ2 A;  2R32 A;  1T2K D;  4GIF A;  1SLQ A;  2M3E A;  3VMA A;  2E76 D;  2UWJ E;  1GJQ A;  3JCU H;  1VQL P;  3L4M A;  1ZOY C;  1KQF B;  2N18 C;  4RO0 A;  1CRI A;  1KB9 D;  1YCC A;  3VTP C;  2KLV A;  1LTB C;  4UB6 V;  4BWN A;  2N9Y B;  1LTG C;  2BLF B;  4H44 D;  1CHJ A;  3A9F A;  1SQX D;  4L1Q A;  1BSN A;  1UIX A;  2QA4 P;  1XTG B;  2ZJS E;  1AVY A;  3WUI A;  1RH5 B;  2KUB A;  3B5N D;  2FYU D;  1KIL D;  1KOR A;  1MZ4 A;  2KLU A;  4GOF A;  4PV1 B;  3CL3 D;  4H44 B;  2P10 A;  1M56 D;  1L0L E;  1LP1 B;  1VF5 C;  1AKK A;  4IFD K;  3G71 P;  5H2F E;  3H1L E;  3NXS A;  2ZT9 C;  2V07 A;  3O8Z A;  2QIW A;  1GKS A;  2O01 N;  3HRN A;  4L73 A;  4WQB A;  4DOJ A;  3L37 A;  3RBX A;  4FB1 A;  4FA1 A;  1YTC A;  3HTK B;  1DD3 A;  3CYT I;  1FOS F;  1NO4 A;  3GF7 A;  1RAQ A;  3VMX A;  3HE5 A;  1YTZ T;  2C8S A;  5BVZ A;  1NTZ K;  1FDM A;  3NFQ A;  1Z56 A;  3CX5 D;  4BRY B;  2NPS C;  1S5L X;  3SFE C;  3CXH D;  3CCU P;  1FZF A;  3L73 J;  3VYM A;  1NU1 J;  5APW A;  1EZV D;  1LTJ C;  3TDK A;  2CA4 B;  1PL5 A;  1CYC A;  2N1T A;  1ZW0 A;  3H25 A;  1QYZ A;  3M06 A;  3AE5 C;  1BSH A;  3RL0 C;  2WSF H;  2FYN C;  2IZ0 A;  2KZI A;  1USE A;  3MD0 A;  1WT6 A;  5APU A;  4JCG A;  3PXS A;  2LKM A;  3P7K A;  3DR0 A;  3CME P;  4NPF X;  4C7N B;  3I56 P;  5KAI V;  4EID A;  2AXT E;  2HOD A;  1CRJ A;  2HG5 D;  2PGD A;  3TGU D;  1NU1 D;  1LTJ A;  3MUD A;  1SQQ E;  2QEX P;  3MK7 B;  1CIH A;  1SQV E;  1DW0 A;  3GLM A;  2ZOO A;  2NPS A;  3P8C D;  1BCC E;  2Y0E A;  1J3S A;  1SQQ K;  4EDF A;  3VOP A;  1S3J A;  5KLI C;  2JEE A;  4TLF A;  2BCC G;  3AEF C;  2XND H;  1JY3 N;  3RK2 B;  1EDJ A;  2FYU J;  3E1R A;  3FXE A;  3KQG A;  3M97 X;  2HR3 A;  1N50 A;  1DVV A;  1M1K Q;  1FZC C;  4WQ9 A;  3G4S P;  3MTU E;  5AVX B;  1FOC A;  4H0L D;  3CMA P;  1DVH A;  1M6Z A;  1IRV A;  1HJB A;  2IBZ G;  5CMZ A;  1KIL A;  4I1L A;  2KI7 B;  4AAO A;  1SQB J;  1VQM P;  1SQV K;  3EWK A;  5CCG D;  2E74 D;  2IBZ E;  3L71 G;  2FFD A;  2GB8 B;  5CCH D;  5AVU B;  1QKS A;  2N3B A;  2I8F A;  1OW8 A;  3RN1 A;  2WSC H;  5IY5 1;  2R5B A;  1YJW P;  4EIF A;  2IBZ I;  4O9B A;  1OAE A;  2O3J A;  2FYN B;  1E2R A;  4UB6 H;  1VQ8 P;  3L74 J;  3ZIY A;  2PCC B;  5AW1 B;  1E8E A;  2E74 B;  2P58 A;  4HYT B;  2C1D A;  5GTH H;  2OTL P;  2G3A A;  2B11 B;  4L76 A;  1RAP A;  1SS1 A;  3L74 D;  1MFZ A;  1X9V A;  3O6Q A;  3EFF K;  4XXL A;  1W5C E;  3HD7 B;  3I5C A;  1PZQ A;  1CC5 A;  2FXP A;  3L72 D;  3V5B A;  3GMA A;  3ORV A;  2YMY A;  2I1K A;  1OXZ A;  1L4A B;  3U1C A;  4WY4 D;  4AYC A;  1OMI A;  3IF4 A;  2WSC J;  1DD4 A;  2FXM A;  1NTZ J;  2K88 A;  1IC2 A;  3H1K E;  4DJG A;  1BDD A;  2M5A A;  1S4X A;  1G1I A;  1SQB E;  3NTN A;  4EI2 A;  2CXB A;  1VDF A;  2AIU A;  3VN0 A;  1SQP G;  3L73 D;  1GK4 A;  1GQ1 A;  3V4W A;  3Q5S A;  3NBS A;  3EFG A;  1LTS C;  1NTZ D;  3G6E P;  1DW2 A;  3CXH I;  3H1J J;  1PV3 A;  1VQN P;  4PJ0 H;  1H9X A;  1GW3 A;  1BGY J;  1CRY A;  2D0W A;  2OTJ P;  3OA8 A;  1AVO A;  4EIE A;  2W27 A;  3EQ2 A;  1NOH A;  3A5T A;  2OYH C;  1CW5 A;  1JO5 A;  2I1J A;  4AAL A;  1NH4 A;  1GDT A;  3H1L G;  3CCV P;  1AA0 A;  1FDI A;  5AVY B;  3H1K G;  3KZI V;  3L71 D;  1RHZ B;  5DJQ C;  2NRG A;  5EFW B;  2JTI B;  3H1J D;  2E74 C;  1SQB K;  5B6Q A;  1E79 H;  2A45 I;  4WB4 A;  1Q82 Q;  1VQP P;  3MHV A;  2ZXE B;  3Q1M A;  1P84 D;  4D6T J;  2RMZ A;  2J59 M;  4WWI A;  2B88 A;  4WY4 A;  2Q7C A;  3A0H H;  3S4R A;  2ZYD A;  1HJ5 A;  4H0L C;  1KD1 Q;  5CIG B;  4N6J A;  1YHQ P;  4ZNC A;  5CBO A;  2Y0C A;  4LGD E;  1I5T A;  4Y5R A;  1JTH B;  2XKM A;  4MU8 A;  3WUU A;  1H88 A;  1K73 Q;  2Q5U A;  1VYD A;  3CWB D;  3L70 G;  2CE1 A;  1SQX J;  1CYJ A;  1TU3 F;  2CE0 A;  1M1J A;  1NTK E;  2H7H A;  4RKU J;  5AW7 B;  4EYY Q;  2N9J A;  4AX3 A;  3A0H E;  3WFD C;  1IZL 0;  5AUR A;  2IPP A;  1MG2 D;  1M70 A;  1IRW A;  5CIE B;  1M57 D;  5CBN A;  3A0B H;  3IR9 A;  4C7R A;  4KJM A;  3CX5 I;  1SQB D;  3KHU A;  2ZON G;  1LGH B;  1KQL A;  3D0W A;  1CO6 A;  2IFN A;  4FAN A;  2BCC E;  3CWB J;  3TYY A;  1HCM A;  5CID B;  3CCR P;  3L4O A;  1J1D B;  1FZA A;  3Q3D A;  1L0L J;  2DVH A;  1HUC A;  2QJP C;  2OYH B;  3OA8 B;  5APS A;  4CPG A;  2RH0 A;  1FZC A;  3WMM 0;  1FDO A;  3MGN A;  3N7N A;  2PRR A;  5APT A;  3B4S A;  1GU4 A;  1KC8 Q;  2WSE H;  4U3F E;  1S6V B;  4PW9 B;  4K3A A;  1NU1 K;  4K3I A;  5CIC B;  5KLV J;  2QG4 A;  3CD6 P;  1N7S D;  1IQC A;  1NKZ B;  3L75 D;  5B5E V;  1H31 B;  4IL6 E;  1RF0 C;  3I55 P;  3ZOX A;  3H1J E;  5AW8 B;  1FZB A;  5BU5 A;  5E79 H;  3KDP B;  1CIF A;  3CXH H;  4OVN F;  5GTH E;  1GL2 A;  5AW4 B;  1NYH A;  3CXH W;  3CPW O;  1LT9 A;  1Q90 D;  2JJL A;  3ZBM A;  1VQ6 P;  1Y47 A;  2KK7 A;  1D7M A;  3HQ9 A;  3HE4 B;  3O6Q B;  1Y9B A;  1C6O A;  3W68 A;  4WQ8 A;  2N9B A;  2YO2 A;  4WY4 C;  1HJ0 A;  5APQ A;  3V2Q A;  3TSI A;  4BXL A;  1IFJ A;  3C2C A;  2IBZ D;  2KSJ A;  1IO3 A;  4EOT A;  1WEJ F;  1AYG A;  1LT1 A;  2WSE J;  1HZV A;  5C39 A;  1IK7 A;  3RK3 C;  1KYO D;  2RKL A;  1YIJ P;  2GUV A;  3VYI A;  4WVZ A;  5GTI V;  1PFI A;  1KX2 A;  2OQQ A;  1J1E C;  3CCL P;  3SLE A;  2KNC A;  1NAY A;  1N9C A;  1SQQ J;  3AED C;  5GTI H;  3B5N C;  1FI3 A;  2W8Z A;  2BAS A;  2FFD B;  2CK3 H;  2K37 A;  2BCC D;  1CTY A;  3FGA D;  1WVE C;  3L74 E;  1PP9 G;  1OVU A;  2YK3 A;  3B71 A;  1Q2N A;  1KIL E;  3P8M C;  5AVW B;  2B4Z A;  3X39 A;  1N8R Q;  1L0N D;  1EC5 A;  4DY9 A;  4U3F D;  2O01 H;  3MZW B;  1S72 P;  2C0X A;  1S5L E;  1EDK A;  3L72 G;  3L75 E;  1KYO I;  1VL2 A;  1U7M A;  3AE7 C;  2O1J A;  3U59 A;  2IX7 C;  1L4A D;  2WZ7 A;  3L36 A;  5K5G B;  2E75 D;  3O20 A;  3T97 A;  2ZAE B;  1GL2 C;  5KLV D;  1GZL A;  5CIF B;  1PIX A;  1NTM E;  5M1B A;  1Q81 Q;  1NTZ E;  1GW4 A;  1NJI Q;  5KAF E;  4WQ7 A;  1OVV A;  1PPJ D;  4ASV A;  1AOF A;  2YNY A;  2YXR B;  1RF0 A;  2HOD B;  4N78 E;  3RK3 B;  5KTB A;  4XA4 A;  4H0K A;  4C7N A;  1X22 A;  1JB0 J;  1T8Z A;  2BEZ F;  2JO1 A;  1VQO P;  2O01 J;  5C9M A;  2KSE A;  2C2C A;  1ZRT D;  5AVS B;  2OYI C;  3NBT A;  2L91 A;  3SFD C;  4NPE A;  5APV A;  451C A;  2H43 A;  3H1I G;  5AW5 B;  2N1T B;  2JWA A;  3SJL A;  1OCD A;  3HQ7 A;  3AE9 C;  1I8O A;  1FI9 A;  3WU2 H;  5AW9 B;  4U7J A;  1P84 E;  1E29 A;  4HB1 A;  3K5B A;  1AV1 A;  2O1K A;  1KIB A;  1H9Y A;  3RL0 D;  3Q5R A;  4GED B;  2QJP B;  2Z5H A;  1N2D C;  2PAJ A;  3PH0 A;  2YCC A;  1JM0 A;  2J5U A;  1YQ4 C;  1GIW A;  3HE4 A;  1A02 J;  1CTZ A;  1U57 A;  2BCC J;  1NU1 E;  2GC4 D;  3CWB E;  4ASW A;  3HUS C;  1RE4 A;  3VNW A;  2WVR A;  1RE3 A;  1MZ9 A;  2KZJ A;  2WWW A;  3D70 A;  2JDI H;  2J58 A;  2FYU G;  5DF5 A;  2JP3 A;  1YIC A;  4W80 A;  1OFC X;  5DJU B;  2M3B A;  3BCC G;  1H89 A;  2K9Y A;  1DW1 A;  2N9I A;  4OWF A;  2WIT A;  2I8D A;  3N4X A;  1BE3 J;  1P84 I;  1LP1 A;  4W7Y A;  1X0T A;  1FHB A;  5KKZ B;  2E5Y A;  4RSZ A;  1KX7 A;  3V6I A;  1SQX E;  1LMS A;  1L0N J;  5KJ7 C;  2GC7 D;  2YO3 A;  2XV5 A;  1KQS O;  1SQB G;  4H0L B;  2L4D A;  3CI9 A;  4IFM A;  1F1C A;  1JY3 P;  2DW3 A;  1HTL C;  1CZQ A;  3L71 J;  2H8P D;  2ZT9 D;  3CCE P;  2A45 G;  4PD4 I;  4OGQ B;  2N3Y A;  3CP5 A;  1YEA A;  1QL2 A;  1USD A;  1M60 A;  3CU4 A;  1N73 C;  2ITA A;  1RF1 A;  4N78 D;  2POH A;  1URQ C;  2GUS A;  1YIT P;  1VF5 D;  1L0L D;  2N1T C;  4MN4 C;  3BRT B;  1S5L V;  2W6A A;  1NTM K;  4Y99 C;  2N18 B;  3B8E B;  2H89 C;  4LJI A;  2QJK B;  1SFC D;  4NPD A;  2B0Z B;  1KIL C;  1N7S B;  1HRO A;  1H33 A;  1HF9 A;  1JOC A;  5TIS H;  1KB9 H;  1MFT A;  1SFC C;  5KAF V;  3VP8 A;  2KNC B;  351C A;  2C9N Y;  2JKV A;  1FU1 A;  3ZDM A;  1JTH A;  2OYO A;  2M8R A;  1NTK G;  3LW5 J;  1PGP A;  2AEM A;  1LWU A;  2C1V A;  1G2C A;  2D2C B;  2SPZ A;  3CC4 P;  4PJ0 E;  2CPB A;  2L5G B;  1I55 A;  4WY4 B;  2DGE A;  1JMB A;  1VPC A;  3CXH E;  1C2N A;  3ZOW A;  4GOD A;  2D0S A;  1FE6 A;  4B86 A;  1DT1 A;  1HVV A;  5KKZ C;  2FXO A;  1MUU A;  2C9X B;  1T6A A;  2QRX A;  1W5C T;  1F1F A;  4I7Z C;  4LC1 A;  1BCC G;  2ZBO A;  4OGQ C;  5DFS A;  4IL6 H;  3HUS A;  1X8Y A;  3ZCF A;  5KAI E;  2YIU B;  5APX A;  4YXW H;  1T3U A;  1M7L A;  2FFD C;  2NPS D;  1W2E A;  1SQQ D;  1ZV8 A;  3P8C E;  5E79 E;  1BCC D;  2E43 A;  1PP9 D;  2ZYG A;  2OZ1 A;  1N90 A;  1LTA C;  5AVV B;  3WFE C;  1WMK A;  3AE2 C;  4RJT A;  3IN6 A;  4GDO A;  1FZC B;  5B66 V;  1J1E B;  2M5A B;  2JWD A;  1NVO A;  2E75 C;  3PP5 A;  2XDJ A;  3HQ6 A;  4H13 C;  1KV9 A;  3E1I A;  1JY2 N;  1L4A A;  2V08 A;  2H88 C;  5AW3 B;  5KLV E;  1FS0 E;  4PD4 H;  2JR8 A;  1CRC A;  3DP5 A;  3G9R A;  3A3Y B;  2V4H A;  3L35 A;  3HD7 A;  2K3R A;  1BE3 D;  4PJ0 V;  1LC2 A;  2V7Q H;  3KPE A;  2FYU K;  3AEG C;  4FAV A;  2R3S A;  1CHH A;  5B66 H;  3JBT B;  4OH8 B;  4ZKP A;  3A0B E;  1BDC A;  4ZKU A;  1M1J B; 
#chains in the Genus database with same CATH homology
 4PWA A;  4L3G A;  1YFC A;  1NMI A;  1KYO W;  1GDV A;  3WUI A;  1CIF A;  1CXC A;  2QJY B;  1HZU A;  1CIG A;  3L70 D;  3CXH W;  1ETP A;  1EB7 A;  2FYU D;  3WFC C;  3ITK A;  3ZBM A;  1GU2 A;  1MZ4 A;  3PTZ A;  1L9J C;  2PCB B;  4O1Q A;  3HQ9 A;  3PHL A;  5CIH B;  1C6O A;  1I54 A;  4WQ8 A;  2EXV A;  1H33 B;  1DW3 A;  1RZ6 A;  3C2C A;  2ZZS 1;  2IBZ D;  1IO3 A;  1WEJ F;  1AYG A;  1AKK A;  1HZV A;  2V07 A;  1H32 B;  1GKS A;  1KYO D;  1COT A;  4WQB A;  5GTH V;  5GTI V;  1CCR A;  4FB1 A;  2JQR A;  4FA1 A;  1YTC A;  1QN2 A;  2Y0D A;  1KX2 A;  3SLE A;  3CYT I;  3PXT A;  3A0B V;  1K3G A;  1KB0 A;  1N9C A;  1RAQ A;  1FI3 A;  2C8S A;  2BCC D;  4J20 A;  1CTY A;  1COR A;  1NIR A;  1WVE C;  3WC8 A;  4AAM A;  1SQP D;  3CX5 D;  1C6S A;  2YK3 A;  1LC1 A;  2RN0 A;  155C A;  3CXH D;  1MG3 D;  3VYM A;  1C52 A;  3H1I D;  1EZV D;  1HRC A;  1N15 A;  3TDK A;  2CA4 B;  1CHI A;  2B4Z A;  3X39 A;  1CSU A;  1CYC A;  1L0N D;  3SWS A;  1CSV A;  1I6E A;  4DY9 A;  4U3F D;  4KMG A;  1QYZ A;  4EIC A;  4WQE A;  1NML A;  4XYD B;  3O0R C;  2FWL A;  3OCD B;  4Q5P A;  5DJQ B;  4A7P A;  2GIW A;  4JCG A;  3PXS A;  2A06 D;  1DIQ C;  3DR0 A;  2BGV X;  5KAI V;  4EID A;  3NWV A;  1LFM A;  3O20 A;  1CRJ A;  1HH7 A;  3WFB C;  2ORL A;  1I6D A;  3PXW A;  5KLV D;  1NU1 D;  5CIF B;  3TGU D;  2C1U A;  2HV4 A;  3MK7 B;  1CIH A;  3A0H V;  1DW0 A;  4WQ7 A;  2ZOO A;  1PPJ D;  3PLN A;  1K3H A;  1HJ3 A;  1AOF A;  2C1D B;  2Y0E A;  4D6T D;  1J3S A;  2MTA C;  4EDF A;  4H0K A;  1C75 A;  4UB8 V;  5C9M A;  2C2C A;  1ZRT D;  3O5C A;  4P4Q B;  3TYI A;  3NBT A;  2L91 A;  3FWL A;  3M97 X;  3OCD A;  3ZOO A;  1N50 A;  4WQD A;  451C A;  1DVV A;  2XTS B;  1NTK D;  4YE1 A;  4FA4 A;  2JWA A;  4WQ9 A;  1CNO A;  4QAO A;  1I8P A;  1QL4 A;  3SJL A;  1OCD A;  1L9B C;  3HQ7 A;  1FOC A;  4N0K A;  1I8O A;  1FI9 A;  1DVH A;  1E29 A;  1M6Z A;  5EXQ A;  5TIS V;  1IRV A;  1DII C;  1KIB A;  3GW6 A;  1H9Y A;  2AXT V;  4AAO A;  2KS1 A;  4GED B;  2QJP B;  3H1K D;  2GB8 B;  2YCC A;  2Q3E A;  1QKS A;  2N3B A;  4IL6 V;  2I8F A;  1GIW A;  4L3H A;  1CTZ A;  1CIE A;  3RN1 A;  2GC4 D;  5IY5 1;  1CYI A;  4EIF A;  3VNW A;  1OAE A;  3RMZ A;  2FYN B;  2O3J A;  5TJH A;  2CA3 B;  3PRJ A;  5DF5 A;  1E2R A;  1YIC A;  3ZIY A;  2PCC B;  3ZOY A;  2ZXY A;  1DW1 A;  2N9I A;  1E8E A;  1H32 A;  2BCN B;  2C1D A;  1CRG A;  1B7V A;  2B11 B;  1FHB A;  2BH5 X;  1U75 B;  5KKZ B;  1U74 B;  4RSZ A;  1KX7 A;  2VHD A;  1YNR A;  1LMS A;  1RAP A;  3H1L D;  3L74 D;  2GC7 D;  2BH4 X;  4XXL A;  1HJ4 A;  2L4D A;  2YQB A;  1F1C A;  1CC5 A;  1NNO A;  3L72 D;  1CXA A;  4WQC A;  3HQ8 A;  2N3Y A;  3CP5 A;  3ORV A;  1YEA A;  1M60 A;  2MHM A;  3CU4 A;  1CSX A;  1AOQ A;  1L0L D;  3TF5 A;  4NFG B;  1LS9 A;  1S5L V;  1ZZH A;  2CXB A;  3MK7 C;  1BGY D;  2N18 B;  3GG2 A;  2AIU A;  4LJI A;  5CYT R;  2QJK B;  3L73 D;  4AAN A;  1CED A;  2B0Z B;  1GQ1 A;  4V2K A;  1QL3 A;  3NBS A;  1NTZ D;  1DW2 A;  5KLI B;  1H9X A;  5C0Z A;  1HRO A;  1H33 A;  4WQA A;  1CRY A;  1RZ5 A;  2LIT A;  2D0W A;  4GYD A;  3OA8 A;  4EIE A;  1CSW A;  5KAF V;  1H1O A;  2KNC B;  351C A;  5E79 V;  4AAL A;  5H2F V;  2PAC A;  4FA9 A;  2AI5 A;  4FA5 A;  4O1W A;  3O1Y A;  2C1V A;  1A56 A;  3KZI V;  1YEB A;  3L71 D;  2OZ1 B;  5DJQ C;  2JTI B;  1I55 A;  3H1J D;  2DGE A;  1A2S A;  1C6R A;  5B6Q A;  2LIR A;  1C2N A;  1SQV D;  1H31 A;  2B12 B;  3ZOW A;  2D0S A;  1FCD C;  3PH2 B;  3RN0 A;  1DT1 A;  1P84 D;  2RMZ A;  3CX5 W;  3VRD A;  1BL9 A;  2C9X B;  1HJ5 A;  5CIG B;  1W5C T;  1CTJ A;  1F1F A;  3RLM A;  1I5T A;  1CCH A;  4Y5R A;  2Y0C A;  1R0Q A;  4MU8 A;  2ZBO A;  5DFS A;  3ZCF A;  1VYD A;  2YIU B;  3CWB D;  2CE1 A;  3H1H D;  1CYJ A;  2CE0 A;  1C2R A;  1NTM D;  2N9J A;  4AX3 A;  1SQQ D;  2BPB B;  3WFD C;  1IZL 0;  1FJ0 A;  1JDL A;  5AUR A;  1BCC D;  1MG2 D;  1M70 A;  3WU2 V;  1CRH A;  1IRW A;  1PP9 D;  4H0J A;  5CIE B;  1YIQ A;  2FRC A;  2OZ1 A;  1N90 A;  1W2L A;  3WFE C;  4PD4 D;  4RJT A;  1SQB D;  3KHU A;  2ZON G;  1FI7 A;  1A8C A;  5B66 V;  1CO6 A;  3SVW A;  4FAN A;  1C7M A;  1HCM A;  5CID B;  3L4O A;  3DMI A;  3SXT A;  3HQ6 A;  1KV9 A;  2DVH A;  2V08 A;  3OA8 B;  5CIB B;  1CRC A;  3VMA A;  3BCC D;  3DP5 A;  1GJQ A;  3L4M A;  2N18 C;  1BE3 D;  4PJ0 V;  1CRI A;  2K9J B;  2B10 B;  1S6V B;  4PW9 B;  1LC2 A;  1KB9 D;  4K3I A;  5CIC B;  2QG4 A;  1YCC A;  4FAV A;  1CHH A;  1IQC A;  4UB6 V;  3L75 D;  2N9Y B;  3JBT B;  5B5E V;  2BLF B;  1H31 B;  1CHJ A;  3A9F A;  1SQX D;  4L1Q A;  3ZOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...