1SQPD

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqpD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqpD02
2V07A 3NBTA 1FI3A 1NU1D 1I8PA 1HROA 3SVWA 2BGVX 2RN0A 1H33B 3ZOOA 1N50A 1CO6A 1I8OA 4Q5PA 1CRJA 2LIRA 1H31B 5DF5A 5TJHA 4EIEA 1H33A 1AOFA 3PXTA 3ZOXA 1C75A 1H31A 1CYIA 1A2SA 1OAEA 4UB6V 1KIBA 1WEJF 2BCNB 4WQAA 4FB1A 2MHMA 1RZ5A 1BL9A 3H1ID 3A0BV 1YTCA 2Q3EA 3PXWA 1DW0A 2FWLA 1SQXD 1YEAA 2QJPB 4FANA 5H2FV 3NWVA 2K9JB 1CTZA 1K3GA 2IBZD 5DJQB 2N3BA 1IZL0 1GIWA 1N90A 5B6QA 4RJTA 4AX3A 3L70D 3M97X 2CA3B 1AYGA 1YEBA 3X39A 3A9FA 1YCCA 4A7PA 1H1OA 1CTYA 4WQEA 3WUIA 5AURA 1U75B 1EZVD 4UB8V 4FA9A 3NBSA 1DVVA 3VMAA 3HQ6A 1DW2A 3L72D 2OZ1B 1DW3A 5B5EV 3O20A 1YICA 2A06D 1CCHA 1COTA 3RN0A 1CYCA 1QYZA 3OA8B 2OZ1A 1C6OA 5KAFV 1E29A 1CIHA 1SQVD 3WFDC 3HQ8A 155CA 1CSUA 2JQRA 2N3YA 2PACA 2ZOOA 2B11B 5DFSA 1KYOW 3RLMA 2YQBA 4PJ0V 1NTZD 1C7MA 4L3GA 1ETPA 2PCBB 2CXBA 1P84D 3TYIA 3ITKA 2GIWA 5KLVD 1K3HA 3DMIA 2Y0CA 2FYUD 1GDVA 1FHBA 4H0KA 2KNCB 1H9YA 4PD4D 5CIBB 2V08A 1QL4A 3CP5A 1U74B 4PWAA 5GTHV 1CEDA 2QJYB 4WQDA 4AANA 1CRYA 4FA1A 1DT1A 1CRCA 1NTKD 1FI9A 1HJ3A 4O1QA 3WFEC 4O1WA 4U3FD 3CWBD 5CIFB 1L0LD 1A56A 2GC4D 1C6SA 1BCCD 2ZBOA 3CX5W 1CRGA 1HH7A 2EXVA 1H9XA 2C1DA 4RSZA 2ORLA 1C52A 2JTIB 1MG3D 1C2RA 1KYOD 3PXSA 1J3SA 3H1HD 2CE1A 1VYDA 1GJQA 4EICA 2C2CA 3CYTI 4PW9B 2YK3A 3H1JD 1DIQC 4FA4A 1IQCA 3VYMA 1S6VB 3H1LD 3GG2A 1NNOA 3ZBMA 3SJLA 3C2CA 2BLFB 1E8EA 3TDKA 1JDLA 4L3HA 1I54A 4WQBA 3A0HV 1M60A 2FRCA 1DIIC 3PLNA 2JWAA 4J20A 4QAOA 3JBTB 3L75D 1CYJA 1W2LA 3SXTA 1YIQA 2N9IA 1FJ0A 2AI5A 5KKZB 2N18C 1GU2A 3WC8A 3OCDA 3CX5D 1CHJA 1L9BC 2ZZS1 4WQ8A 3O5CA 1B7VA 1CC5A 4L1QA 4EIDA 1I6DA 1BGYD 1EB7A 1MG2D 2N9JA 1ZZHA 2BH4X 2N18B 2B12B 1CXCA 2CA4B 5C0ZA 4WQCA 2L91A 3O0RC 1N15A 5IY51 1SQPD 1CRIA 4XXLA 1NTMD 2XTSB 4YE1A 3VRDA 2O3JA 4H0JA 4GYDA 1SQBD 1QKSA 1CXAA 1QN2A 1HJ5A 1LFMA 1CIFA 5KLIB 1CTJA 351CA 5EXQA 2LITA 1KV9A 3L4MA 2C1UA 3KZIV 2B4ZA 3BCCD 2DVHA 1OCDA 4JCGA 3VNWA 5TISV 2C1DB 1CSVA 3PTZA 1R0QA 4GEDB 3TGUD 1YNRA 1GKSA 1SQQD 3L73D 2DGEA 1F1FA 1DVHA 4V2KA 1NMLA 5CYTR 5CICB 4P4QB 4AALA 3H1KD 1IRVA 1F1CA 3ZIYA 1I5TA 1C6RA 5CIDB 2Y0EA 1PP9D 3ZOWA 1S5LV 4D6TD 2B10B 5KAIV 1HCMA 2Y0DA 4WQ9A 1AKKA 2QJKB 3O1YA 1CHHA 1M6ZA 2VHDA 3ZOYA 1IO3A 451CA 4EDFA 1GQ1A 5DJQC 1CRHA 1PPJD 2GB8B 3DP5A 2GC7D 2ZXYA 1FCDC 1FOCA 1C2NA 3HQ7A 3TF5A 2BCCD 3PRJA 1DW1A 3MK7C 3WFBC 4FA5A 1BE3D 4DY9A 1CNOA 1HZUA 1N9CA 3WU2V 3CXHD 4N0KA 1I55A 5CIHB 2KS1A 2D0WA 1YFCA 3GW6A 4IL6V 2I8FA 4K3IA 3PH2B 5B66V 2MTAC 3DR0A 2QG4A 1LS9A 1W5CT 1CHIA 1L9JC 1RAQA 3MK7B 4AAOA 1A8CA 2HV4A 2CE0A 1HJ4A 2L4DA 3KHUA 3SLEA 1CIEA 3OCDB 2C8SA 1E2RA 2FYNB 1RAPA 2RMZA 4AAMA 1QL3A 3WFCC 1LC2A 1LMSA 2PCCB 3FWLA 5E79V 1NMIA 2YIUB 1HZVA 2BH5X 1ZRTD 3ZCFA 1M70A 1I6EA 2B0ZB 1FI7A 1KB9D 1NIRA 1IRWA 1KX2A 3ORVA 3L74D 5CIEB 4WQ7A 2BPBB 3OA8A 3CU4A 1RZ6A 1LC1A 4Y5RA 4NFGB 1CSWA 4KMGA 3CXHW 1CSXA 1CCRA 1CIGA 3HQ9A 3L4OA 1HRCA 1CORA 2ZONG 3PHLA 4XYDB 3SWSA 2AIUA 1H32B 3RN1A 2C9XB 5C9MA 2N9YB 2YCCA 1KB0A 3RMZA 4EIFA 1KX7A 1WVEC 1H32A 1L0ND 4LJIA 2D0SA 2AXTV 1MZ4A 5CIGB 2C1VA 1AOQA 4FAVA 3L71D 5GTIV 4MU8A
chains in the Genus database with same CATH superfamily
1FI3A 3SVWA 2XDJA 2JKVA 3FXEA 3ZOOA 2FYZA 1N50A 1I8OA 2B87B 2LIRA 3M0DC 3H1JJ 1KTMA 2O1KA 2V7QH 1H33A 3USSA 2QJPC 3WU2E 1NTZE 5CCHA 2N1TA 1WEJF 5B66E 4FB1A 1KILA 1RZ5A 1BL9A 1P84E 2C0WA 3PXWA 4PD4I 1AJYA 4WVZA 5H2FV 2AEMA 2CPBA 4PV1C 3KDPB 3NXSA 2J58A 3NMDA 3B5NA 2N3BA 4KHXA 1N90A 3RK2B 3D6YA 1VL2A 1K04A 3X39A 3A9FA 2WPRA 4ASVA 1NH4A 3WUIA 1DEBA 1NO4A 2B9BA 3Q5RA 3A7OA 1JCDA 1PFIA 1NTKE 2OYIC 5B5EV 1HWTC 1N7SA 3HUSC 2QE7H 5AVXB 1QYZA 2W27A 1GD2E 3CWBE 1BCCE 1LTAC 3WMM0 1D7MA 1CIHA 3MD0A 1KN7A 155CA 1KYOE 5K5GB 2N3YA 2HFED 1SQBJ 5DFSA 1GW3A 1KYOW 1YTZI 2YQBA 1C7MA 1N73B 1ZN5A 5AW5B 1A02F 4JPZB 2XZRA 1QX8A 3ITKA 3CL3D 3AEGC 1K3HA 2AXTE 3ZDMA 1LWUA 1RE3A 2Y0CA 1K73Q 1FZBA 3G9RA 2J5UA 2KZIA 3BCCJ 1EZVG 1FHBA 3LW5H 1T3JA 1PIXA 3OAKA 1PGQA 1URQC 2KXPB 1GW4A 1PP9J 1EDIA 1IFMA 1SQVG 1QGKB 1VQ5P 1NYHA 2JEEA 2M3BA 3N4XA 3A0BE 1CSBA 1JY3P 3M91A 1IO4A 2N1TB 1SFCC 3HD7C 4O1WA 1PZQA 5CIFB 1L0LD 2JJLA 2OQQA 2FYUG 2QJKC 1BGYE 2ORLA 1C52A 2JTIB 4HKZH 3PXSA 2W6AA 3GF3A 1GJQA 2O1JA 1ZP0C 1L0NG 2WSSH 1MUUA 1GL2D 1R5LA 1CW5A 1NTME 4XFJA 3NFQA 3L36A 3V2PA 1BDCA 2Z5IA 1GU4A 1LTBC 1T8ZA 1E8EA 1I54A 4WQBA 3V5BA 2P1JA 2WPSA 1IFNA 4U3FG 3PLNA 2WPVB 1VQPP 1RQVA 4J20A 3CXHH 4PJ0E 5APYA 5CHXA 2YIUC 3TGUE 2E76C 1YIQA 1SQXG 2QA4P 2HPCB 4IL6X 4D6TE 5KKZB 1GU2A 2PRRA 2OTLP 3CX5D 1BDDA 1CC5A 4EIDA 2AXCA 1OX3A 2E5TA 2ZT9C 2Q7CA 2B12B 5KJ7A 1PPJE 4LC1A 4CPGA 1Y8AA 4WQCA 3O0RC 1N15A 1XTCC 1SQPD 3KQGA 1T6AA 1CRIA 5DJTB 1KILE 2WSEH 3VRDA 2A45H 3MZWB 4HH2A 1CXAA 3L73J 1LTGC 3L35A 3CPWO 2E5YA 3H1KJ 4RESB 3TK1A 3V2NA 1LP1A 3AEFC 4W7YA 1YI2P 2Q6QA 1W2BO 3L75E 2C9LY 4C7NA 4H13D 1OFCX 1EXIA 2DVHA 3VNWA 5TISV 1AQ5A 3RBXA 1M1JA 2R5BA 4GEDB 1GKSA 3L73D 5E79H 2BCCJ 2WZ7A 4HYTB 1DVHA 1PL5A 1NMLA 1GL2B 5CICB 4P4QB 2LXCB 3H1KD 1F1CA 1I5TA 5CIDB 3ZOWA 1X0TA 2B10B 3D6ZA 3CCJP 2XNDH 1JTHB 4Y99B 1LT9A 2BEZF 2PP6A 4C7RA 1LNQA 4L75A 1FZCA 1NAYA 1VQ9P 451CA 2VHDA 1UIIA 2KP8A 3TNUA 4EDFA 3GHGC 1SQBK 4K3AA 1LT1A 3RK2C 1FCDC 1C2NA 1JY2O 1RF0A 4ZKPA 2H43A 2BCCD 2YNYA 1FZAA 3MK7C 3WFBC 4L74A 5AW6B 1BE3D 4DY9A 1HZUA 1N9CA 2GUSA 2KOGA 3FGAD 2KS1A 2RH0A 2MTAC 1SQQG 2H88C 2N9BA 2R32A 1RAQA 4AAOA 2CPSA 5TISH 4WY4A 1L0LK 3PP5A 4RKUJ 1NTZJ 1NU1E 2LR2A 3WFCC 1RQUA 2BH5X 1ZXGA 2K3RA 3JCUH 1RY3A 3D70A 2H89C 3L74D 2IBZI 1GTWA 4WQ7A 2BPBB 5AVZB 3OA8A 3CU4A 2Y9ZA 4Z1MH 3KZIE 5CCGD 2FY8A 5APTA 3SFDC 2GM4A 3L4OA 1BSHA 2ZONG 2IZ0A 4C7NB 1NTKJ 2O01J 2P58A 1LTJA 5C9MA 2YCCA 4YTPC 1Q82Q 1KX7A 1JNMA 1H32A 3CWBJ 4LJIA 1EZVE 1BCCJ 4KJMA 5BVZA 4GOFA 1CI6A 4UB8H 1IFDA 1RF1A 3R4YA 4W80A 1AOQA 2R3CA 1GMJA 5CCHC 4FAVA 2N1TC 1KILC 1LT9B 1E79H 2YKQA 1I8PA 1HROA 1IFJA 2BGVX 3IF4A 2IPPA 1FZCB 3BRTB 3H32A 1NTMG 1SQVE 1H31B 5KAFH 3TNUB 1J1DC 1EDLA 1SQPK 4EIEA 3B5NC 3BASA 1AOFA 3PXTA 3B71A 3ZOXA 2B87A 1VF5D 1CYIA 4IL6E 4UB6V 1HJBA 3MTUE 1KQFB 1H8AA 2MHMA 2XU6A 4C46A 5KLVE 1DW0A 2FYUE 1YEAA 4FANA 3VP9A 2HR3A 3P32A 1IZL0 5B6QA 1L0NE 3L71G 1N7SC 3L70D 3M97X 4MN4C 2CA3B 4A7PA 1N86A 1OW6A 1IFPA 1H1OA 5AVVB 1CTYA 3VYIA 5AURA 3FX0A 4FA9A 4N3YB 3NBSA 1BGYJ 1G1JA 4YPCA 1VDFA 3U1CA 5KKZC 4GIFA 1GZLA 1COTA 3RN0A 1J1EB 4U3FE 3M9BA 1K8AQ 3OA8B 1LWUC 1RE3C 2Q3IA 1HVVA 4OGQD 4JYCA 1USEA 1JMBA 4UB6H 4H44D 3VMYA 2ZOOA 3RLMA 1SQXE 4DZOA 2M8RA 1T3UA 2PCBB 3TYIA 2GIWA 1LTJB 1N73A 2KLVA 3DMIA 1YHQP 1KB9H 1HH0A 5APUA 2C9NY 1GDVA 4H0KA 1X9VA 2QJYC 1NOHA 1H9YA 2IYOA 5AVWB 4PD4D 3TGUJ 1FC2C 1ZR2A 1U74B 4PWAA 4D6TJ 5AW2B 3H1HJ 3CLQA 3H32B 1VF5B 1AVOA 2E75D 1PV3A 1CRCA 1ZR4A 5AW1B 2P7JA 2CK3H 5CBNA 4Y99C 5H2FE 3U59A 1NTZK 3H1LJ 1S1CX 1JB0J 2ZBOA 1YITP 4HJGH 2EXVA 1H9XA 1XTGB 3K5BA 3H1HD 1M7LA 1FDIA 1IJDB 3CYTI 3AE3C 2YK3A 3H1JD 4FA4A 1USDA 3L75J 3H1LD 1AFOA 1NU1G 1KZUB 5B5EE 2W8ZA 1PGOA 4HB1A 2O01N 1KQGB 3HE5A 4OGQB 1NTKK 1L0LG 1RH5B 4N78E 4H44B 2OTJP 3RL0C 2IFNA 1JY2P 1YQ4C 1EC5A 1SQQE 3L75D 3MUDA 5KJ7C 2WSCJ 4NPDA 2N18C 3WC8A 3OCDA 3I5CA 2E74B 1OZHA 2ZZS1 1L4AD 3O5CA 4ZNCA 1B7VA 2HPCA 4L1QA 1I6DA 3S4RA 2ZVOB 1UIXA 1FDMA 2BH4X 3AEBC 2D2CD 2L91A 5IY51 4L76A 4H0LC 5GTIE 1JMMA 3L72G 2E75B 1DD3A 1SQBD 3CXHE 1QKSA 1M1JC 4TT3H 3WU2H 3RK3D 3H25A 5EXQA 5B66H 1WRGA 2LITA 1P84H 5AW0B 1Y47A 1MFZA 1JM0A 2B4ZA 3VTPC 1LT9C 4ASWA 1IK9A 3BCCD 1OCDA 3PTZA 2I1KA 1VQLP 1ZRTE 5KLVG 4LGDE 2WPQA 1VQ7P 1NGMB 2IFMA 1RF0C 4AALA 3LIEA 1KD1Q 1PP9D 1S5LV 1SQPG 2KIKA 5CBOA 5M1BA 1RE4A 1GL2A 4WQ9A 1IZNB 1YQ3C 1U57A 3O1YA 1JTHA 2O01H 1FZGA 2ZFCA 4DCKA 3EFGA 3DP5A 2GB8B 5DJUB 1Q81Q 3HE5B 4WY4C 1OVUA 2QSIA 1DW1A 1CNOA 2FXPA 1IFIA 1KYOH 1I55A 4I1LA 2I8FA 3RBZA 1CZQA 4LLHA 3L73G 2OGUA 1A8CA 2SPZA 3GLMA 1SQVJ 3P8CE 1L4AB 1Q2NA 2AXTH 1WMKA 2WTYA 1M90Q 3SLEA 3OCDB 2C8SA 1E2RA 2FYNB 3L71E 1N2DC 2W6JH 1Y9BA 1YJNP 2RMZA 4AAMA 1OWAA 1EXJA 2D2CB 5E79V 2H8PD 3S9OA 1S5LH 4PV1D 3V2RA 1VQNP 1M70A 1I6EA 1KB9D 2FYUJ 3V2QA 1U7JA 2YMYA 1KX2A 1SS1A 3ORVA 1DIPA 1BE3G 3CC2P 3RK3B 3W68A 1L0NJ 4I7ZB 3A0BH 2KLUA 4NFGB 2JO1A 1TU3F 2C0XA 4KMGA 5AW9B 1CSXA 1S9KE 1CCRA 1GU5A 1CIGA 1RF1C 2LXBA 1AQTA 1EZVI 3F89A 2QVAA 4WWIA 2N9YB 1FZFA 2FBWC 1FJKA 4OVNF 3IN6A 4U3FJ 5KTBA 2GUVA 1S3JA 2ZJSE 1L0ND 5L8RJ 1S4XA 2Z5HA 1FZEA 3IFMA 3AECC 2NPSA 3H1IJ 2HODA 4PD4H 3AE7C 3L74G 2WSFJ 2YXQB 3NBTA 1SQXJ 2K37A 2NPSD 3CX5I 3C1LA 2JWDA 3L4FA 1CO6A 3BATA 4NPFX 1CRJA 2KB7P 5TJHA 5CMZA 1H31A 1KIBA 4PJ0H 3TYYA 2BCNB 2W90A 4WQAA 1QLED 1NJIQ 3H1ID 1YTCA 1ZOYC 2H7HA 1SQXD 2QJPB 3NWVA 2K9JB 1CTZA 3MGNA 1PGJA 2IBZD 5DJQB 4EOTA 1DH3A 1GIWA 3I56P 4O9BA 2POHA 4RJTA 1N8RQ 4AX3A 1SFCD 3M9QA 4DOJA 4H44C 4PV1B 1Q90D 3JSVC 3V4WA 4WQEA 4AQRD 4GDOA 2WVRA 1U75B 4RO0A 4UB8V 4AYCA 1DW2A 1X22A 2OZ1B 1YICA 1HTLC 2A06D 2E74C 1CYCA 3AE6C 5APQA 1L0LE 1N73C 1C6OA 5KAFV 1E29A 2QEXP 3HQ8A 1YJWP 2JQRA 2B11B 3U1AA 5CCGA 3Q2YA 3HUSB 3F5HA 1NTZD 4L3GA 2G8YA 1ETPA 3L70G 2YO3A 1KORA 3VOPA 1P84D 1N7LA 1OXZA 4H13B 4IOIH 1VQ4P 5BU8B 3AE9C 5APSA 1Q86Q 2R5DA 5CIBB 2NPSB 2HODB 2V08A 1SQQJ 1H0TB 2WSCH 1RHZB 5AVUB 3L72E 5GTHV 3A3YB 1CEDA 1VQOP 1Z56A 2ZT9D 4UB6E 2A45G 2OYHA 1NTKD 3AE4C 5APWA 4N78D 1SQVK 3OW2O 1QEXA 3C8VA 4O1QA 3WFEC 3EQ2A 3CWBD 2GC4D 2MJZA 3CX5E 3G4SP 1FS0E 3HRNA 1BCCD 3CX5W 1CRGA 1HH7A 2C1DA 3G3ZA 4RSZA 2QRXA 2BEQD 1C2RA 1KYOD 3SWKA 1J3SA 1VQKP 1FJPA 1SFCB 2CE1A 2FYUK 3G71P 2KI7B 2OTKE 1EDJA 4EICA 1S72P 1SQPE 3R2PA 1DIQC 4NPEA 5AVSB 1L0NK 1IQCA 2B89A 2Z4EA 3CCVP 1S5LX 4JQ0D 2PFXA 2Q1KA 1QVGO 3MUDC 3Q1MA 3CCUP 2AEJA 1JDLA 4L3HA 5GTHH 2B88A 3A0HV 3AE5C 2FRCA 1DIIC 4IFMA 2FYNC 1T2KD 2JWAA 4L73A 2WITA 1GDTA 3L73E 3RK2D 3VP8A 1NTMJ 2AI5A 1H88A 1A02J 1FE6A 1SQXK 3H1JG 3AE1C 1L9BC 3G6EP 3RK3C 5BU5A 1EDKA 1BGYD 1EB7A 2AEFA 1MG2D 3NTNA 3O8ZA 2ZYDA 1ZZHA 2P67A 1MZ9A 1JY3N 3CXHI 2W83C 2BCCE 3VMXA 2ZT9B 2WT7A 1NTMD 1BE3E 4Y28J 4H0JA 4GYDA 3Q5PA 3L71J 2R44A 2M5AB 3A0HH 4U7JA 5KLIB 3FXDA 2OYHB 2Q9IA 4IL6H 2P2UA 1FU1A 3FWNA 1KV9A 3L4MA 2C1UA 2IDBA 1RE4C 1GL2C 4AUWA 5AW8B 4I2LC 3V6IA 5AW3B 3WUVA 1NKZB 1K9MQ 2C1DB 1AVYA 1CSVA 3W67A 3P8CD 3TGUD 3H6PA 1YNRA 1KQSO 4R4MA 2A45I 2DW3A 1YBKA 1LTIC 2Y0EA 2YMKA 4D6TD 2OARA 1VQ8P 3L74E 1K05A 5KAIV 1HCMA 2Y0DA 1SQBG 3HTKA 2KYVA 1IO3A 2Y9YA 2FXMA 4QMAA 5DJQC 3MIWA 1PPJD 2GC7D 2ZXYA 2UWJE 3HQ7A 1L2PA 5APVA 5CCHD 2N1TD 2NRGA 1KILD 4ZMDA 3BCCG 3WU2V 3GHGB 3CMAP 4N0KA 3CCMP 5CIHB 2WSFH 1YFCA 1S9KD 2LKMA 5B66V 2QG4A 1LS9A 1W5CT 1CHIA 3B5ND 3MK7B 2ITAA 5AW7B 1PP9G 2CE0A 3CI9A 4W7ZA 2YKOA 1HJ4A 2L4DA 1SQQK 2VRSA 4XE5B 2K88A 1RAPA 1QL3A 1L4AA 3FWLA 4IFFA 3RGUA 2QM7A 2ZYGA 1NMIA 1HZVA 3T97B 1KFNA 2KUBA 4EYYQ 2B0ZB 1FI7A 1NIRA 5KAIH 1IRWA 1DEEG 2FFDA 1M57D 1N7SD 3CCQP 5CIEB 2WT7B 4H13C 2E42A 4JF7A 3GF7A 3SWFA 3CCSP 3CCEP 1LC1A 3TSIA 4WB4A 5H2FH 3CXHW 3A2AA 4R4LA 2NPSC 1NU1J 2M0BA 1NHLA 1HRCA 2WMMA 2ZXEB 3L70E 3SWSA 2AIUA 5AVRB 2C9XB 4OH8B 3RMZA 1KB0A 1YYCA 1J2JB 1S5LE 3CC7P 1L0LJ 4M3LA 2D0SA 1FZCC 2AXTV 2KNCA 2C1VA 2WQYC 3I55P 1MKMA 5GTIV 4MU8A 2V07A 1NU1D 5B5EH 1HBWA 3HTKB 2RN0A 1H33B 4Q5PA 3MP7B 4DT0A 5DF5A 1KILB 3QH9A 1OVRA 1C75A 5C39A 1NTMK 4JYBA 1A2SA 1OAEA 4I6MC 2R3SA 4WBAA 5AVYB 4XA4A 3HE4A 2I1JA 1EQ7A 4IFDK 3RL0g 3A0BV 2WWWA 2Q3EA 1OIPA 1J1DB 2FWLA 3B5NB 2K1AA 3M0DA 3L72J 3OA7A 1K3GA 4KT0J 4PD4E 2K9JA 5E79E 1JUNA 1R8EA 1HUCA 3H1KG 1AYGA 1YEBA 1FBMA 2L5GB 1YCCA 1SP4A 1J1EC 1MFTA 1SLQA 1EZVD 1DVVA 5CCGC 1GK6A 1N7SB 5GTIH 1KV4A 3L37A 4GOEA 3VMAA 3Q3DA 3HQ6A 3E1RA 3L72D 2JP3A 2FFDB 1DW3A 3O20A 1YJ9P 1ZLLA 5KLVJ 1CCHA 2Q5UA 3H1IG 1X79B 2BCCG 2OZ1A 1NWQA 1M8OB 1G2CA 3VN0A 1SQPJ 3M0AA 2M3EA 2KK7A 1SQVD 1LGHB 2NZ2A 3WFDC 2HLOA 2JR8A 1CSUA 2IBZG 1LTJC 2PACA 1JCCA 3H1HE 3CCLP 4PJ0V 2OYIA 2V4HA 1LWUB 2KSEA 3HUSA 2CXBA 2HYNA 5TISE 5KLVD 3H1JE 3B8EB 3RL0D 1LJ2A 1PGPA 1X8YA 2FYUD 2V7QJ 1OW8A 3H1LE 4BXLA 4TLFA 5KLIC 2OYHC 2P10A 1DD4A 5KJ7D 2KNCB 3ABVC 1Q7YQ 1DX7A 2W6BA 1VF5C 2ZXXA 1U7MA 3JCUE 2A06G 1SVFA 3N7NA 1QL4A 3CP5A 2BASA 2OYOA 2YO2A 1H0TA 2QJYB 1H89A 4WQDA 4AANA 1CRYA 3IAOA 3KXDA 4FA1A 1DT1A 1OW7A 3P8MC 1NTZG 1KB9I 1FI9A 1HJ3A 1JEKA 2KSJA 4H0LD 1IC2A 4U3FD 1URQA 3HE4B 1A56A 1C6SA 3QWOC 3Q5SA 3AE8C 3AE2C 1URQD 3CC4P 1FAVA 2IX7C 1MG3D 1QL1A 1BE3J 1S2EA 2I8DA 5AVQB 1T2KC 1VYDA 5CJ0A 4YXWH 1NKNA 3OJAB 2C2CA 1KFMA 1SFCA 3HD7A 4PW9B 4UB8E 1IK7A 1FDOA 1SQBE 3M9HA 4OGQC 5EFWB 3VYMA 1S6VB 3GG2A 3CMEP 3HD7D 5AW4B 1NNOA 3V4QA 1AA0A 3ZBMA 3SJLA 3RK3E 3C2CA 1NTKG 3S1KA 1JO5A 2BLFB 3TDKA 3VMZA 2RKLA 1VQ6P 3E1IA 1W5CE 1NU1K 3PJSK 5KAFE 4EIJA 1M60A 3AEDC 3CWBG 4B86A 3BCCE 1BCCG 4QAOA 1KQLA 3LW5J 1G2CB 1ZMEC 3L74J 1QVFO 3JBTB 1W2EA 2ZAEB 4YXDC 1CYJA 1W2LA 3SXTA 2N9IA 3M06A 1FJ0A 2OYIB 4WY4D 1JOCA 3IR9A 2QM8A 1GK4A 1PP9E 3RL0B 2XNXA 2ZVNB 3JC22 3E7KA 1YIJP 1CHJA 1OVVA 2HG5D 4BRYA 4WQ8A 3GMAA 2N9JA 2GA1A 2XV5A 4K35A 2E75C 5APXA 2N18B 1CXCA 2CA4B 5C0ZA 5GTHE 1OMIA 2E76D 4XXLA 3O6QA 1HJ0A 2XTSB 4YE1A 2O3JA 1LTSC 2PAJA 5AVTB 1QN2A 1LP1B 4OWFA 1JY3O 3C9IA 1HJ5A 1LFMA 1CIFA 1CTJA 3B4SA 351CA 4H0LB 1R5SA 1HGZA 1NVOA 2G3AA 3CCRP 2M5AA 3KZIV 1M1JB 1QL2A 3BVHA 1URQB 3WUUA 4JCGA 3KYQA 1BGYG 1G1IA 1R0QA 3KPEA 3AEEC 3D0WA 1SQQD 2DGEA 1F1FA 3EFFK 4V2KA 4GT1A 2IZ1A 1KB9E 5CYTR 2IYPA 3EWKA 1IRVA 2FXOA 3ZIYA 1C6RA 5KLVK 1MV8A 1JY2N 3HD7B 1HF9A 2YKPA 3AEAC 1P84I 1AKKA 2QJKB 3L70J 1CHHA 1M6ZA 3ZOYA 3A0HE 3SFEC 1GQ1A 3P7KA 4ZKUA 1CRHA 1WT6A 1KMIZ 2QIWA 1FOCA 2K9YA 3TF5A 3PRJA 2KS1B 3CD6P 1AV1A 4FA5A 3D71A 3CXHD 1L4AC 2D0WA 3GW6A 4IL6V 4K3IA 3TGUG 3PH2B 2J59M 4WY4B 3DR0A 4GODA 2PGDA 3KZIH 3GHGA 1FOSF 2D2CC 1M1KQ 1L9JC 2WSEJ 2ZYAA 2HV4A 2FFDC 4D6TG 3KHUA 3H1HG 1CIEA 4GKGA 4N6JA 1LC2A 2FKWB 1LMSA 2PCCB 3H1KE 4BRYB 4BWNA 5CJ4A 2E43A 3WUTA 4JBZA 1HGVA 2YIUB 1ZRTD 1KC8Q 3ZCFA 1KYOI 1PPJG 2E76B 4I7ZC 3H1LG 3BRVB 1NAFA 3T97A 1M56D 1VQMP 4DJGA 3O6QB 3H1IE 1BSNA 3SWYA 1RZ6A 3MHVA 3SSUA 1YTZT 2XKMA 1E5WA 3A5TA 4Y5RA 3PH0A 1CSWA 2JDIH 1LTTC 2IBZE 3UIAA 3CX5H 3HQ9A 2YXRB 1CORA 3L75G 3PHLA 4XYDB 2E74D 4EI2A 1H32B 3RN1A 1ZW0A 2KZJA 2MKVA 1ZV8A 4EIFA 1WVEC 1CI6B 3II6A 1VPCA 1RF1B 3LIDA 5CIGB 1MZ4A 5KAIE 2A06E 3L71D 1FOSE
chains in the Genus database with same CATH topology
2V07A 3NBTA 1FI3A 1NU1D 1I8PA 1HROA 3SVWA 2BGVX 2RN0A 1H33B 3ZOOA 1N50A 1CO6A 1I8OA 4Q5PA 1CRJA 2LIRA 1H31B 5DF5A 5TJHA 4EIEA 1H33A 1AOFA 3PXTA 3ZOXA 1C75A 1H31A 1CYIA 1A2SA 1OAEA 4UB6V 1KIBA 1WEJF 2BCNB 4WQAA 4FB1A 2MHMA 1RZ5A 1BL9A 3H1ID 3A0BV 1YTCA 2Q3EA 3PXWA 1DW0A 2FWLA 1SQXD 1YEAA 2QJPB 4FANA 5H2FV 3NWVA 2K9JB 1CTZA 1K3GA 2IBZD 5DJQB 2N3BA 1IZL0 1GIWA 1N90A 5B6QA 4RJTA 4AX3A 3L70D 3M97X 2CA3B 1AYGA 1YEBA 3X39A 3A9FA 1YCCA 4A7PA 1H1OA 1CTYA 4WQEA 3WUIA 5AURA 1U75B 1EZVD 4UB8V 4FA9A 3NBSA 1DVVA 3VMAA 3HQ6A 1DW2A 3L72D 2OZ1B 1DW3A 5B5EV 3O20A 1YICA 2A06D 1CCHA 1COTA 3RN0A 1CYCA 1QYZA 3OA8B 2OZ1A 1C6OA 5KAFV 1E29A 1CIHA 1SQVD 3WFDC 3HQ8A 155CA 1CSUA 2JQRA 2N3YA 2PACA 2ZOOA 2B11B 5DFSA 1KYOW 3RLMA 2YQBA 4PJ0V 1NTZD 1C7MA 4L3GA 1ETPA 2PCBB 2CXBA 1P84D 3TYIA 3ITKA 2GIWA 5KLVD 1K3HA 3DMIA 2Y0CA 2FYUD 1GDVA 1FHBA 4H0KA 2KNCB 1H9YA 4PD4D 5CIBB 2V08A 1QL4A 3CP5A 1U74B 4PWAA 5GTHV 1CEDA 2QJYB 4WQDA 4AANA 1CRYA 4FA1A 1DT1A 1CRCA 1NTKD 1FI9A 1HJ3A 4O1QA 3WFEC 4O1WA 4U3FD 3CWBD 5CIFB 1L0LD 1A56A 2GC4D 1C6SA 1BCCD 2ZBOA 3CX5W 1CRGA 1HH7A 2EXVA 1H9XA 2C1DA 4RSZA 2ORLA 1C52A 2JTIB 1MG3D 1C2RA 1KYOD 3PXSA 1J3SA 3H1HD 2CE1A 1VYDA 1GJQA 4EICA 2C2CA 3CYTI 4PW9B 2YK3A 3H1JD 1DIQC 4FA4A 1IQCA 3VYMA 1S6VB 3H1LD 3GG2A 1NNOA 3ZBMA 3SJLA 3C2CA 2BLFB 1E8EA 3TDKA 1JDLA 4L3HA 1I54A 4WQBA 3A0HV 1M60A 2FRCA 1DIIC 3PLNA 2JWAA 4J20A 4QAOA 3JBTB 3L75D 1CYJA 1W2LA 3SXTA 1YIQA 2N9IA 1FJ0A 2AI5A 5KKZB 2N18C 1GU2A 3WC8A 3OCDA 3CX5D 1CHJA 1L9BC 2ZZS1 4WQ8A 3O5CA 1B7VA 1CC5A 4L1QA 4EIDA 1I6DA 1BGYD 1EB7A 1MG2D 2N9JA 1ZZHA 2BH4X 2N18B 2B12B 1CXCA 2CA4B 5C0ZA 4WQCA 2L91A 3O0RC 1N15A 5IY51 1SQPD 1CRIA 4XXLA 1NTMD 2XTSB 4YE1A 3VRDA 2O3JA 4H0JA 4GYDA 1SQBD 1QKSA 1CXAA 1QN2A 1HJ5A 1LFMA 1CIFA 5KLIB 1CTJA 351CA 5EXQA 2LITA 1KV9A 3L4MA 2C1UA 3KZIV 2B4ZA 3BCCD 2DVHA 1OCDA 4JCGA 3VNWA 5TISV 2C1DB 1CSVA 3PTZA 1R0QA 4GEDB 3TGUD 1YNRA 1GKSA 1SQQD 3L73D 2DGEA 1F1FA 1DVHA 4V2KA 1NMLA 5CYTR 5CICB 4P4QB 4AALA 3H1KD 1IRVA 1F1CA 3ZIYA 1I5TA 1C6RA 5CIDB 2Y0EA 1PP9D 3ZOWA 1S5LV 4D6TD 2B10B 5KAIV 1HCMA 2Y0DA 4WQ9A 1AKKA 2QJKB 3O1YA 1CHHA 1M6ZA 2VHDA 3ZOYA 1IO3A 451CA 4EDFA 1GQ1A 5DJQC 1CRHA 1PPJD 2GB8B 3DP5A 2GC7D 2ZXYA 1FCDC 1FOCA 1C2NA 3HQ7A 3TF5A 2BCCD 3PRJA 1DW1A 3MK7C 3WFBC 4FA5A 1BE3D 4DY9A 1CNOA 1HZUA 1N9CA 3WU2V 3CXHD 4N0KA 1I55A 5CIHB 2KS1A 2D0WA 1YFCA 3GW6A 4IL6V 2I8FA 4K3IA 3PH2B 5B66V 2MTAC 3DR0A 2QG4A 1LS9A 1W5CT 1CHIA 1L9JC 1RAQA 3MK7B 4AAOA 1A8CA 2HV4A 2CE0A 1HJ4A 2L4DA 3KHUA 3SLEA 1CIEA 3OCDB 2C8SA 1E2RA 2FYNB 1RAPA 2RMZA 4AAMA 1QL3A 3WFCC 1LC2A 1LMSA 2PCCB 3FWLA 5E79V 1NMIA 2YIUB 1HZVA 2BH5X 1ZRTD 3ZCFA 1M70A 1I6EA 2B0ZB 1FI7A 1KB9D 1NIRA 1IRWA 1KX2A 3ORVA 3L74D 5CIEB 4WQ7A 2BPBB 3OA8A 3CU4A 1RZ6A 1LC1A 4Y5RA 4NFGB 1CSWA 4KMGA 3CXHW 1CSXA 1CCRA 1CIGA 3HQ9A 3L4OA 1HRCA 1CORA 2ZONG 3PHLA 4XYDB 3SWSA 2AIUA 1H32B 3RN1A 2C9XB 5C9MA 2N9YB 2YCCA 1KB0A 3RMZA 4EIFA 1KX7A 1WVEC 1H32A 1L0ND 4LJIA 2D0SA 2AXTV 1MZ4A 5CIGB 2C1VA 1AOQA 4FAVA 3L71D 5GTIV 4MU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V07 A;  3NBT A;  1FI3 A;  1NU1 D;  1I8P A;  1HRO A;  3SVW A;  2BGV X;  2RN0 A;  1H33 B;  3ZOO A;  1N50 A;  1CO6 A;  1I8O A;  4Q5P A;  1CRJ A;  2LIR A;  1H31 B;  5DF5 A;  5TJH A;  4EIE A;  1H33 A;  1AOF A;  3PXT A;  3ZOX A;  1C75 A;  1H31 A;  1CYI A;  1A2S A;  1OAE A;  4UB6 V;  1KIB A;  1WEJ F;  2BCN B;  4WQA A;  4FB1 A;  2MHM A;  1RZ5 A;  1BL9 A;  3H1I D;  3A0B V;  1YTC A;  2Q3E A;  3PXW A;  1DW0 A;  2FWL A;  1SQX D;  1YEA A;  2QJP B;  4FAN A;  5H2F V;  3NWV A;  2K9J B;  1CTZ A;  1K3G A;  2IBZ D;  5DJQ B;  2N3B A;  1IZL 0;  1GIW A;  1N90 A;  5B6Q A;  4RJT A;  4AX3 A;  3L70 D;  3M97 X;  2CA3 B;  1AYG A;  1YEB A;  3X39 A;  3A9F A;  1YCC A;  4A7P A;  1H1O A;  1CTY A;  4WQE A;  3WUI A;  5AUR A;  1U75 B;  1EZV D;  4UB8 V;  4FA9 A;  3NBS A;  1DVV A;  3VMA A;  3HQ6 A;  1DW2 A;  3L72 D;  2OZ1 B;  1DW3 A;  5B5E V;  3O20 A;  1YIC A;  2A06 D;  1CCH A;  1COT A;  3RN0 A;  1CYC A;  1QYZ A;  3OA8 B;  2OZ1 A;  1C6O A;  5KAF V;  1E29 A;  1CIH A;  1SQV D;  3WFD C;  3HQ8 A;  155C A;  1CSU A;  2JQR A;  2N3Y A;  2PAC A;  2ZOO A;  2B11 B;  5DFS A;  1KYO W;  3RLM A;  2YQB A;  4PJ0 V;  1NTZ D;  1C7M A;  4L3G A;  1ETP A;  2PCB B;  2CXB A;  1P84 D;  3TYI A;  3ITK A;  2GIW A;  5KLV D;  1K3H A;  3DMI A;  2Y0C A;  2FYU D;  1GDV A;  1FHB A;  4H0K A;  2KNC B;  1H9Y A;  4PD4 D;  5CIB B;  2V08 A;  1QL4 A;  3CP5 A;  1U74 B;  4PWA A;  5GTH V;  1CED A;  2QJY B;  4WQD A;  4AAN A;  1CRY A;  4FA1 A;  1DT1 A;  1CRC A;  1NTK D;  1FI9 A;  1HJ3 A;  4O1Q A;  3WFE C;  4O1W A;  4U3F D;  3CWB D;  5CIF B;  1L0L D;  1A56 A;  2GC4 D;  1C6S A;  1BCC D;  2ZBO A;  3CX5 W;  1CRG A;  1HH7 A;  2EXV A;  1H9X A;  2C1D A;  4RSZ A;  2ORL A;  1C52 A;  2JTI B;  1MG3 D;  1C2R A;  1KYO D;  3PXS A;  1J3S A;  3H1H D;  2CE1 A;  1VYD A;  1GJQ A;  4EIC A;  2C2C A;  3CYT I;  4PW9 B;  2YK3 A;  3H1J D;  1DIQ C;  4FA4 A;  1IQC A;  3VYM A;  1S6V B;  3H1L D;  3GG2 A;  1NNO A;  3ZBM A;  3SJL A;  3C2C A;  2BLF B;  1E8E A;  3TDK A;  1JDL A;  4L3H A;  1I54 A;  4WQB A;  3A0H V;  1M60 A;  2FRC A;  1DII C;  3PLN A;  2JWA A;  4J20 A;  4QAO A;  3JBT B;  3L75 D;  1CYJ A;  1W2L A;  3SXT A;  1YIQ A;  2N9I A;  1FJ0 A;  2AI5 A;  5KKZ B;  2N18 C;  1GU2 A;  3WC8 A;  3OCD A;  3CX5 D;  1CHJ A;  1L9B C;  2ZZS 1;  4WQ8 A;  3O5C A;  1B7V A;  1CC5 A;  4L1Q A;  4EID A;  1I6D A;  1BGY D;  1EB7 A;  1MG2 D;  2N9J A;  1ZZH A;  2BH4 X;  2N18 B;  2B12 B;  1CXC A;  2CA4 B;  5C0Z A;  4WQC A;  2L91 A;  3O0R C;  1N15 A;  5IY5 1;  1SQP D;  1CRI A;  4XXL A;  1NTM D;  2XTS B;  4YE1 A;  3VRD A;  2O3J A;  4H0J A;  4GYD A;  1SQB D;  1QKS A;  1CXA A;  1QN2 A;  1HJ5 A;  1LFM A;  1CIF A;  5KLI B;  1CTJ A;  351C A;  5EXQ A;  2LIT A;  1KV9 A;  3L4M A;  2C1U A;  3KZI V;  2B4Z A;  3BCC D;  2DVH A;  1OCD A;  4JCG A;  3VNW A;  5TIS V;  2C1D B;  1CSV A;  3PTZ A;  1R0Q A;  4GED B;  3TGU D;  1YNR A;  1GKS A;  1SQQ D;  3L73 D;  2DGE A;  1F1F A;  1DVH A;  4V2K A;  1NML A;  5CYT R;  5CIC B;  4P4Q B;  4AAL A;  3H1K D;  1IRV A;  1F1C A;  3ZIY A;  1I5T A;  1C6R A;  5CID B;  2Y0E A;  1PP9 D;  3ZOW A;  1S5L V;  4D6T D;  2B10 B;  5KAI V;  1HCM A;  2Y0D A;  4WQ9 A;  1AKK A;  2QJK B;  3O1Y A;  1CHH A;  1M6Z A;  2VHD A;  3ZOY A;  1IO3 A;  451C A;  4EDF A;  1GQ1 A;  5DJQ C;  1CRH A;  1PPJ D;  2GB8 B;  3DP5 A;  2GC7 D;  2ZXY A;  1FCD C;  1FOC A;  1C2N A;  3HQ7 A;  3TF5 A;  2BCC D;  3PRJ A;  1DW1 A;  3MK7 C;  3WFB C;  4FA5 A;  1BE3 D;  4DY9 A;  1CNO A;  1HZU A;  1N9C A;  3WU2 V;  3CXH D;  4N0K A;  1I55 A;  5CIH B;  2KS1 A;  2D0W A;  1YFC A;  3GW6 A;  4IL6 V;  2I8F A;  4K3I A;  3PH2 B;  5B66 V;  2MTA C;  3DR0 A;  2QG4 A;  1LS9 A;  1W5C T;  1CHI A;  1L9J C;  1RAQ A;  3MK7 B;  4AAO A;  1A8C A;  2HV4 A;  2CE0 A;  1HJ4 A;  2L4D A;  3KHU A;  3SLE A;  1CIE A;  3OCD B;  2C8S A;  1E2R A;  2FYN B;  1RAP A;  2RMZ A;  4AAM A;  1QL3 A;  3WFC C;  1LC2 A;  1LMS A;  2PCC B;  3FWL A;  5E79 V;  1NMI A;  2YIU B;  1HZV A;  2BH5 X;  1ZRT D;  3ZCF A;  1M70 A;  1I6E A;  2B0Z B;  1FI7 A;  1KB9 D;  1NIR A;  1IRW A;  1KX2 A;  3ORV A;  3L74 D;  5CIE B;  4WQ7 A;  2BPB B;  3OA8 A;  3CU4 A;  1RZ6 A;  1LC1 A;  4Y5R A;  4NFG B;  1CSW A;  4KMG A;  3CXH W;  1CSX A;  1CCR A;  1CIG A;  3HQ9 A;  3L4O A;  1HRC A;  1COR A;  2ZON G;  3PHL A;  4XYD B;  3SWS A;  2AIU A;  1H32 B;  3RN1 A;  2C9X B;  5C9M A;  2N9Y B;  2YCC A;  1KB0 A;  3RMZ A;  4EIF A;  1KX7 A;  1WVE C;  1H32 A;  1L0N D;  4LJI A;  2D0S A;  2AXT V;  1MZ4 A;  5CIG B;  2C1V A;  1AOQ A;  4FAV A;  3L71 D;  5GTI V;  4MU8 A; 
#chains in the Genus database with same CATH topology
 1FI3 A;  3SVW A;  2XDJ A;  2JKV A;  3FXE A;  3ZOO A;  2FYZ A;  1N50 A;  1I8O A;  2B87 B;  2LIR A;  3M0D C;  3H1J J;  1KTM A;  2O1K A;  2V7Q H;  1H33 A;  3USS A;  2QJP C;  3WU2 E;  1NTZ E;  5CCH A;  2N1T A;  1WEJ F;  5B66 E;  4FB1 A;  1KIL A;  1RZ5 A;  1BL9 A;  1P84 E;  2C0W A;  3PXW A;  4PD4 I;  1AJY A;  4WVZ A;  5H2F V;  2AEM A;  2CPB A;  4PV1 C;  3KDP B;  3NXS A;  2J58 A;  3NMD A;  3B5N A;  2N3B A;  4KHX A;  1N90 A;  3RK2 B;  3D6Y A;  1VL2 A;  1K04 A;  3X39 A;  3A9F A;  2WPR A;  4ASV A;  1NH4 A;  3WUI A;  1DEB A;  1NO4 A;  2B9B A;  3Q5R A;  3A7O A;  1JCD A;  1PFI A;  1NTK E;  2OYI C;  5B5E V;  1HWT C;  1N7S A;  3HUS C;  2QE7 H;  5AVX B;  1QYZ A;  2W27 A;  1GD2 E;  3CWB E;  1BCC E;  1LTA C;  3WMM 0;  1D7M A;  1CIH A;  3MD0 A;  1KN7 A;  155C A;  1KYO E;  5K5G B;  2N3Y A;  2HFE D;  1SQB J;  5DFS A;  1GW3 A;  1KYO W;  1YTZ I;  2YQB A;  1C7M A;  1N73 B;  1ZN5 A;  5AW5 B;  1A02 F;  4JPZ B;  2XZR A;  1QX8 A;  3ITK A;  3CL3 D;  3AEG C;  1K3H A;  2AXT E;  3ZDM A;  1LWU A;  1RE3 A;  2Y0C A;  1K73 Q;  1FZB A;  3G9R A;  2J5U A;  2KZI A;  3BCC J;  1EZV G;  1FHB A;  3LW5 H;  1T3J A;  1PIX A;  3OAK A;  1PGQ A;  1URQ C;  2KXP B;  1GW4 A;  1PP9 J;  1EDI A;  1IFM A;  1SQV G;  1QGK B;  1VQ5 P;  1NYH A;  2JEE A;  2M3B A;  3N4X A;  3A0B E;  1CSB A;  1JY3 P;  3M91 A;  1IO4 A;  2N1T B;  1SFC C;  3HD7 C;  4O1W A;  1PZQ A;  5CIF B;  1L0L D;  2JJL A;  2OQQ A;  2FYU G;  2QJK C;  1BGY E;  2ORL A;  1C52 A;  2JTI B;  4HKZ H;  3PXS A;  2W6A A;  3GF3 A;  1GJQ A;  2O1J A;  1ZP0 C;  1L0N G;  2WSS H;  1MUU A;  1GL2 D;  1R5L A;  1CW5 A;  1NTM E;  4XFJ A;  3NFQ A;  3L36 A;  3V2P A;  1BDC A;  2Z5I A;  1GU4 A;  1LTB C;  1T8Z A;  1E8E A;  1I54 A;  4WQB A;  3V5B A;  2P1J A;  2WPS A;  1IFN A;  4U3F G;  3PLN A;  2WPV B;  1VQP P;  1RQV A;  4J20 A;  3CXH H;  4PJ0 E;  5APY A;  5CHX A;  2YIU C;  3TGU E;  2E76 C;  1YIQ A;  1SQX G;  2QA4 P;  2HPC B;  4IL6 X;  4D6T E;  5KKZ B;  1GU2 A;  2PRR A;  2OTL P;  3CX5 D;  1BDD A;  1CC5 A;  4EID A;  2AXC A;  1OX3 A;  2E5T A;  2ZT9 C;  2Q7C A;  2B12 B;  5KJ7 A;  1PPJ E;  4LC1 A;  4CPG A;  1Y8A A;  4WQC A;  3O0R C;  1N15 A;  1XTC C;  1SQP D;  3KQG A;  1T6A A;  1CRI A;  5DJT B;  1KIL E;  2WSE H;  3VRD A;  2A45 H;  3MZW B;  4HH2 A;  1CXA A;  3L73 J;  1LTG C;  3L35 A;  3CPW O;  2E5Y A;  3H1K J;  4RES B;  3TK1 A;  3V2N A;  1LP1 A;  3AEF C;  4W7Y A;  1YI2 P;  2Q6Q A;  1W2B O;  3L75 E;  2C9L Y;  4C7N A;  4H13 D;  1OFC X;  1EXI A;  2DVH A;  3VNW A;  5TIS V;  1AQ5 A;  3RBX A;  1M1J A;  2R5B A;  4GED B;  1GKS A;  3L73 D;  5E79 H;  2BCC J;  2WZ7 A;  4HYT B;  1DVH A;  1PL5 A;  1NML A;  1GL2 B;  5CIC B;  4P4Q B;  2LXC B;  3H1K D;  1F1C A;  1I5T A;  5CID B;  3ZOW A;  1X0T A;  2B10 B;  3D6Z A;  3CCJ P;  2XND H;  1JTH B;  4Y99 B;  1LT9 A;  2BEZ F;  2PP6 A;  4C7R A;  1LNQ A;  4L75 A;  1FZC A;  1NAY A;  1VQ9 P;  451C A;  2VHD A;  1UII A;  2KP8 A;  3TNU A;  4EDF A;  3GHG C;  1SQB K;  4K3A A;  1LT1 A;  3RK2 C;  1FCD C;  1C2N A;  1JY2 O;  1RF0 A;  4ZKP A;  2H43 A;  2BCC D;  2YNY A;  1FZA A;  3MK7 C;  3WFB C;  4L74 A;  5AW6 B;  1BE3 D;  4DY9 A;  1HZU A;  1N9C A;  2GUS A;  2KOG A;  3FGA D;  2KS1 A;  2RH0 A;  2MTA C;  1SQQ G;  2H88 C;  2N9B A;  2R32 A;  1RAQ A;  4AAO A;  2CPS A;  5TIS H;  4WY4 A;  1L0L K;  3PP5 A;  4RKU J;  1NTZ J;  1NU1 E;  2LR2 A;  3WFC C;  1RQU A;  2BH5 X;  1ZXG A;  2K3R A;  3JCU H;  1RY3 A;  3D70 A;  2H89 C;  3L74 D;  2IBZ I;  1GTW A;  4WQ7 A;  2BPB B;  5AVZ B;  3OA8 A;  3CU4 A;  2Y9Z A;  4Z1M H;  3KZI E;  5CCG D;  2FY8 A;  5APT A;  3SFD C;  2GM4 A;  3L4O A;  1BSH A;  2ZON G;  2IZ0 A;  4C7N B;  1NTK J;  2O01 J;  2P58 A;  1LTJ A;  5C9M A;  2YCC A;  4YTP C;  1Q82 Q;  1KX7 A;  1JNM A;  1H32 A;  3CWB J;  4LJI A;  1EZV E;  1BCC J;  4KJM A;  5BVZ A;  4GOF A;  1CI6 A;  4UB8 H;  1IFD A;  1RF1 A;  3R4Y A;  4W80 A;  1AOQ A;  2R3C A;  1GMJ A;  5CCH C;  4FAV A;  2N1T C;  1KIL C;  1LT9 B;  1E79 H;  2YKQ A;  1I8P A;  1HRO A;  1IFJ A;  2BGV X;  3IF4 A;  2IPP A;  1FZC B;  3BRT B;  3H32 A;  1NTM G;  1SQV E;  1H31 B;  5KAF H;  3TNU B;  1J1D C;  1EDL A;  1SQP K;  4EIE A;  3B5N C;  3BAS A;  1AOF A;  3PXT A;  3B71 A;  3ZOX A;  2B87 A;  1VF5 D;  1CYI A;  4IL6 E;  4UB6 V;  1HJB A;  3MTU E;  1KQF B;  1H8A A;  2MHM A;  2XU6 A;  4C46 A;  5KLV E;  1DW0 A;  2FYU E;  1YEA A;  4FAN A;  3VP9 A;  2HR3 A;  3P32 A;  1IZL 0;  5B6Q A;  1L0N E;  3L71 G;  1N7S C;  3L70 D;  3M97 X;  4MN4 C;  2CA3 B;  4A7P A;  1N86 A;  1OW6 A;  1IFP A;  1H1O A;  5AVV B;  1CTY A;  3VYI A;  5AUR A;  3FX0 A;  4FA9 A;  4N3Y B;  3NBS A;  1BGY J;  1G1J A;  4YPC A;  1VDF A;  3U1C A;  5KKZ C;  4GIF A;  1GZL A;  1COT A;  3RN0 A;  1J1E B;  4U3F E;  3M9B A;  1K8A Q;  3OA8 B;  1LWU C;  1RE3 C;  2Q3I A;  1HVV A;  4OGQ D;  4JYC A;  1USE A;  1JMB A;  4UB6 H;  4H44 D;  3VMY A;  2ZOO A;  3RLM A;  1SQX E;  4DZO A;  2M8R A;  1T3U A;  2PCB B;  3TYI A;  2GIW A;  1LTJ B;  1N73 A;  2KLV A;  3DMI A;  1YHQ P;  1KB9 H;  1HH0 A;  5APU A;  2C9N Y;  1GDV A;  4H0K A;  1X9V A;  2QJY C;  1NOH A;  1H9Y A;  2IYO A;  5AVW B;  4PD4 D;  3TGU J;  1FC2 C;  1ZR2 A;  1U74 B;  4PWA A;  4D6T J;  5AW2 B;  3H1H J;  3CLQ A;  3H32 B;  1VF5 B;  1AVO A;  2E75 D;  1PV3 A;  1CRC A;  1ZR4 A;  5AW1 B;  2P7J A;  2CK3 H;  5CBN A;  4Y99 C;  5H2F E;  3U59 A;  1NTZ K;  3H1L J;  1S1C X;  1JB0 J;  2ZBO A;  1YIT P;  4HJG H;  2EXV A;  1H9X A;  1XTG B;  3K5B A;  3H1H D;  1M7L A;  1FDI A;  1IJD B;  3CYT I;  3AE3 C;  2YK3 A;  3H1J D;  4FA4 A;  1USD A;  3L75 J;  3H1L D;  1AFO A;  1NU1 G;  1KZU B;  5B5E E;  2W8Z A;  1PGO A;  4HB1 A;  2O01 N;  1KQG B;  3HE5 A;  4OGQ B;  1NTK K;  1L0L G;  1RH5 B;  4N78 E;  4H44 B;  2OTJ P;  3RL0 C;  2IFN A;  1JY2 P;  1YQ4 C;  1EC5 A;  1SQQ E;  3L75 D;  3MUD A;  5KJ7 C;  2WSC J;  4NPD A;  2N18 C;  3WC8 A;  3OCD A;  3I5C A;  2E74 B;  1OZH A;  2ZZS 1;  1L4A D;  3O5C A;  4ZNC A;  1B7V A;  2HPC A;  4L1Q A;  1I6D A;  3S4R A;  2ZVO B;  1UIX A;  1FDM A;  2BH4 X;  3AEB C;  2D2C D;  2L91 A;  5IY5 1;  4L76 A;  4H0L C;  5GTI E;  1JMM A;  3L72 G;  2E75 B;  1DD3 A;  1SQB D;  3CXH E;  1QKS A;  1M1J C;  4TT3 H;  3WU2 H;  3RK3 D;  3H25 A;  5EXQ A;  5B66 H;  1WRG A;  2LIT A;  1P84 H;  5AW0 B;  1Y47 A;  1MFZ A;  1JM0 A;  2B4Z A;  3VTP C;  1LT9 C;  4ASW A;  1IK9 A;  3BCC D;  1OCD A;  3PTZ A;  2I1K A;  1VQL P;  1ZRT E;  5KLV G;  4LGD E;  2WPQ A;  1VQ7 P;  1NGM B;  2IFM A;  1RF0 C;  4AAL A;  3LIE A;  1KD1 Q;  1PP9 D;  1S5L V;  1SQP G;  2KIK A;  5CBO A;  5M1B A;  1RE4 A;  1GL2 A;  4WQ9 A;  1IZN B;  1YQ3 C;  1U57 A;  3O1Y A;  1JTH A;  2O01 H;  1FZG A;  2ZFC A;  4DCK A;  3EFG A;  3DP5 A;  2GB8 B;  5DJU B;  1Q81 Q;  3HE5 B;  4WY4 C;  1OVU A;  2QSI A;  1DW1 A;  1CNO A;  2FXP A;  1IFI A;  1KYO H;  1I55 A;  4I1L A;  2I8F A;  3RBZ A;  1CZQ A;  4LLH A;  3L73 G;  2OGU A;  1A8C A;  2SPZ A;  3GLM A;  1SQV J;  3P8C E;  1L4A B;  1Q2N A;  2AXT H;  1WMK A;  2WTY A;  1M90 Q;  3SLE A;  3OCD B;  2C8S A;  1E2R A;  2FYN B;  3L71 E;  1N2D C;  2W6J H;  1Y9B A;  1YJN P;  2RMZ A;  4AAM A;  1OWA A;  1EXJ A;  2D2C B;  5E79 V;  2H8P D;  3S9O A;  1S5L H;  4PV1 D;  3V2R A;  1VQN P;  1M70 A;  1I6E A;  1KB9 D;  2FYU J;  3V2Q A;  1U7J A;  2YMY A;  1KX2 A;  1SS1 A;  3ORV A;  1DIP A;  1BE3 G;  3CC2 P;  3RK3 B;  3W68 A;  1L0N J;  4I7Z B;  3A0B H;  2KLU A;  4NFG B;  2JO1 A;  1TU3 F;  2C0X A;  4KMG A;  5AW9 B;  1CSX A;  1S9K E;  1CCR A;  1GU5 A;  1CIG A;  1RF1 C;  2LXB A;  1AQT A;  1EZV I;  3F89 A;  2QVA A;  4WWI A;  2N9Y B;  1FZF A;  2FBW C;  1FJK A;  4OVN F;  3IN6 A;  4U3F J;  5KTB A;  2GUV A;  1S3J A;  2ZJS E;  1L0N D;  5L8R J;  1S4X A;  2Z5H A;  1FZE A;  3IFM A;  3AEC C;  2NPS A;  3H1I J;  2HOD A;  4PD4 H;  3AE7 C;  3L74 G;  2WSF J;  2YXQ B;  3NBT A;  1SQX J;  2K37 A;  2NPS D;  3CX5 I;  3C1L A;  2JWD A;  3L4F A;  1CO6 A;  3BAT A;  4NPF X;  1CRJ A;  2KB7 P;  5TJH A;  5CMZ A;  1H31 A;  1KIB A;  4PJ0 H;  3TYY A;  2BCN B;  2W90 A;  4WQA A;  1QLE D;  1NJI Q;  3H1I D;  1YTC A;  1ZOY C;  2H7H A;  1SQX D;  2QJP B;  3NWV A;  2K9J B;  1CTZ A;  3MGN A;  1PGJ A;  2IBZ D;  5DJQ B;  4EOT A;  1DH3 A;  1GIW A;  3I56 P;  4O9B A;  2POH A;  4RJT A;  1N8R Q;  4AX3 A;  1SFC D;  3M9Q A;  4DOJ A;  4H44 C;  4PV1 B;  1Q90 D;  3JSV C;  3V4W A;  4WQE A;  4AQR D;  4GDO A;  2WVR A;  1U75 B;  4RO0 A;  4UB8 V;  4AYC A;  1DW2 A;  1X22 A;  2OZ1 B;  1YIC A;  1HTL C;  2A06 D;  2E74 C;  1CYC A;  3AE6 C;  5APQ A;  1L0L E;  1N73 C;  1C6O A;  5KAF V;  1E29 A;  2QEX P;  3HQ8 A;  1YJW P;  2JQR A;  2B11 B;  3U1A A;  5CCG A;  3Q2Y A;  3HUS B;  3F5H A;  1NTZ D;  4L3G A;  2G8Y A;  1ETP A;  3L70 G;  2YO3 A;  1KOR A;  3VOP A;  1P84 D;  1N7L A;  1OXZ A;  4H13 B;  4IOI H;  1VQ4 P;  5BU8 B;  3AE9 C;  5APS A;  1Q86 Q;  2R5D A;  5CIB B;  2NPS B;  2HOD B;  2V08 A;  1SQQ J;  1H0T B;  2WSC H;  1RHZ B;  5AVU B;  3L72 E;  5GTH V;  3A3Y B;  1CED A;  1VQO P;  1Z56 A;  2ZT9 D;  4UB6 E;  2A45 G;  2OYH A;  1NTK D;  3AE4 C;  5APW A;  4N78 D;  1SQV K;  3OW2 O;  1QEX A;  3C8V A;  4O1Q A;  3WFE C;  3EQ2 A;  3CWB D;  2GC4 D;  2MJZ A;  3CX5 E;  3G4S P;  1FS0 E;  3HRN A;  1BCC D;  3CX5 W;  1CRG A;  1HH7 A;  2C1D A;  3G3Z A;  4RSZ A;  2QRX A;  2BEQ D;  1C2R A;  1KYO D;  3SWK A;  1J3S A;  1VQK P;  1FJP A;  1SFC B;  2CE1 A;  2FYU K;  3G71 P;  2KI7 B;  2OTK E;  1EDJ A;  4EIC A;  1S72 P;  1SQP E;  3R2P A;  1DIQ C;  4NPE A;  5AVS B;  1L0N K;  1IQC A;  2B89 A;  2Z4E A;  3CCV P;  1S5L X;  4JQ0 D;  2PFX A;  2Q1K A;  1QVG O;  3MUD C;  3Q1M A;  3CCU P;  2AEJ A;  1JDL A;  4L3H A;  5GTH H;  2B88 A;  3A0H V;  3AE5 C;  2FRC A;  1DII C;  4IFM A;  2FYN C;  1T2K D;  2JWA A;  4L73 A;  2WIT A;  1GDT A;  3L73 E;  3RK2 D;  3VP8 A;  1NTM J;  2AI5 A;  1H88 A;  1A02 J;  1FE6 A;  1SQX K;  3H1J G;  3AE1 C;  1L9B C;  3G6E P;  3RK3 C;  5BU5 A;  1EDK A;  1BGY D;  1EB7 A;  2AEF A;  1MG2 D;  3NTN A;  3O8Z A;  2ZYD A;  1ZZH A;  2P67 A;  1MZ9 A;  1JY3 N;  3CXH I;  2W83 C;  2BCC E;  3VMX A;  2ZT9 B;  2WT7 A;  1NTM D;  1BE3 E;  4Y28 J;  4H0J A;  4GYD A;  3Q5P A;  3L71 J;  2R44 A;  2M5A B;  3A0H H;  4U7J A;  5KLI B;  3FXD A;  2OYH B;  2Q9I A;  4IL6 H;  2P2U A;  1FU1 A;  3FWN A;  1KV9 A;  3L4M A;  2C1U A;  2IDB A;  1RE4 C;  1GL2 C;  4AUW A;  5AW8 B;  4I2L C;  3V6I A;  5AW3 B;  3WUV A;  1NKZ B;  1K9M Q;  2C1D B;  1AVY A;  1CSV A;  3W67 A;  3P8C D;  3TGU D;  3H6P A;  1YNR A;  1KQS O;  4R4M A;  2A45 I;  2DW3 A;  1YBK A;  1LTI C;  2Y0E A;  2YMK A;  4D6T D;  2OAR A;  1VQ8 P;  3L74 E;  1K05 A;  5KAI V;  1HCM A;  2Y0D A;  1SQB G;  3HTK A;  2KYV A;  1IO3 A;  2Y9Y A;  2FXM A;  4QMA A;  5DJQ C;  3MIW A;  1PPJ D;  2GC7 D;  2ZXY A;  2UWJ E;  3HQ7 A;  1L2P A;  5APV A;  5CCH D;  2N1T D;  2NRG A;  1KIL D;  4ZMD A;  3BCC G;  3WU2 V;  3GHG B;  3CMA P;  4N0K A;  3CCM P;  5CIH B;  2WSF H;  1YFC A;  1S9K D;  2LKM A;  5B66 V;  2QG4 A;  1LS9 A;  1W5C T;  1CHI A;  3B5N D;  3MK7 B;  2ITA A;  5AW7 B;  1PP9 G;  2CE0 A;  3CI9 A;  4W7Z A;  2YKO A;  1HJ4 A;  2L4D A;  1SQQ K;  2VRS A;  4XE5 B;  2K88 A;  1RAP A;  1QL3 A;  1L4A A;  3FWL A;  4IFF A;  3RGU A;  2QM7 A;  2ZYG A;  1NMI A;  1HZV A;  3T97 B;  1KFN A;  2KUB A;  4EYY Q;  2B0Z B;  1FI7 A;  1NIR A;  5KAI H;  1IRW A;  1DEE G;  2FFD A;  1M57 D;  1N7S D;  3CCQ P;  5CIE B;  2WT7 B;  4H13 C;  2E42 A;  4JF7 A;  3GF7 A;  3SWF A;  3CCS P;  3CCE P;  1LC1 A;  3TSI A;  4WB4 A;  5H2F H;  3CXH W;  3A2A A;  4R4L A;  2NPS C;  1NU1 J;  2M0B A;  1NHL A;  1HRC A;  2WMM A;  2ZXE B;  3L70 E;  3SWS A;  2AIU A;  5AVR B;  2C9X B;  4OH8 B;  3RMZ A;  1KB0 A;  1YYC A;  1J2J B;  1S5L E;  3CC7 P;  1L0L J;  4M3L A;  2D0S A;  1FZC C;  2AXT V;  2KNC A;  2C1V A;  2WQY C;  3I55 P;  1MKM A;  5GTI V;  4MU8 A;  2V07 A;  1NU1 D;  5B5E H;  1HBW A;  3HTK B;  2RN0 A;  1H33 B;  4Q5P A;  3MP7 B;  4DT0 A;  5DF5 A;  1KIL B;  3QH9 A;  1OVR A;  1C75 A;  5C39 A;  1NTM K;  4JYB A;  1A2S A;  1OAE A;  4I6M C;  2R3S A;  4WBA A;  5AVY B;  4XA4 A;  3HE4 A;  2I1J A;  1EQ7 A;  4IFD K;  3RL0 g;  3A0B V;  2WWW A;  2Q3E A;  1OIP A;  1J1D B;  2FWL A;  3B5N B;  2K1A A;  3M0D A;  3L72 J;  3OA7 A;  1K3G A;  4KT0 J;  4PD4 E;  2K9J A;  5E79 E;  1JUN A;  1R8E A;  1HUC A;  3H1K G;  1AYG A;  1YEB A;  1FBM A;  2L5G B;  1YCC A;  1SP4 A;  1J1E C;  1MFT A;  1SLQ A;  1EZV D;  1DVV A;  5CCG C;  1GK6 A;  1N7S B;  5GTI H;  1KV4 A;  3L37 A;  4GOE A;  3VMA A;  3Q3D A;  3HQ6 A;  3E1R A;  3L72 D;  2JP3 A;  2FFD B;  1DW3 A;  3O20 A;  1YJ9 P;  1ZLL A;  5KLV J;  1CCH A;  2Q5U A;  3H1I G;  1X79 B;  2BCC G;  2OZ1 A;  1NWQ A;  1M8O B;  1G2C A;  3VN0 A;  1SQP J;  3M0A A;  2M3E A;  2KK7 A;  1SQV D;  1LGH B;  2NZ2 A;  3WFD C;  2HLO A;  2JR8 A;  1CSU A;  2IBZ G;  1LTJ C;  2PAC A;  1JCC A;  3H1H E;  3CCL P;  4PJ0 V;  2OYI A;  2V4H A;  1LWU B;  2KSE A;  3HUS A;  2CXB A;  2HYN A;  5TIS E;  5KLV D;  3H1J E;  3B8E B;  3RL0 D;  1LJ2 A;  1PGP A;  1X8Y A;  2FYU D;  2V7Q J;  1OW8 A;  3H1L E;  4BXL A;  4TLF A;  5KLI C;  2OYH C;  2P10 A;  1DD4 A;  5KJ7 D;  2KNC B;  3ABV C;  1Q7Y Q;  1DX7 A;  2W6B A;  1VF5 C;  2ZXX A;  1U7M A;  3JCU E;  2A06 G;  1SVF A;  3N7N A;  1QL4 A;  3CP5 A;  2BAS A;  2OYO A;  2YO2 A;  1H0T A;  2QJY B;  1H89 A;  4WQD A;  4AAN A;  1CRY A;  3IAO A;  3KXD A;  4FA1 A;  1DT1 A;  1OW7 A;  3P8M C;  1NTZ G;  1KB9 I;  1FI9 A;  1HJ3 A;  1JEK A;  2KSJ A;  4H0L D;  1IC2 A;  4U3F D;  1URQ A;  3HE4 B;  1A56 A;  1C6S A;  3QWO C;  3Q5S A;  3AE8 C;  3AE2 C;  1URQ D;  3CC4 P;  1FAV A;  2IX7 C;  1MG3 D;  1QL1 A;  1BE3 J;  1S2E A;  2I8D A;  5AVQ B;  1T2K C;  1VYD A;  5CJ0 A;  4YXW H;  1NKN A;  3OJA B;  2C2C A;  1KFM A;  1SFC A;  3HD7 A;  4PW9 B;  4UB8 E;  1IK7 A;  1FDO A;  1SQB E;  3M9H A;  4OGQ C;  5EFW B;  3VYM A;  1S6V B;  3GG2 A;  3CME P;  3HD7 D;  5AW4 B;  1NNO A;  3V4Q A;  1AA0 A;  3ZBM A;  3SJL A;  3RK3 E;  3C2C A;  1NTK G;  3S1K A;  1JO5 A;  2BLF B;  3TDK A;  3VMZ A;  2RKL A;  1VQ6 P;  3E1I A;  1W5C E;  1NU1 K;  3PJS K;  5KAF E;  4EIJ A;  1M60 A;  3AED C;  3CWB G;  4B86 A;  3BCC E;  1BCC G;  4QAO A;  1KQL A;  3LW5 J;  1G2C B;  1ZME C;  3L74 J;  1QVF O;  3JBT B;  1W2E A;  2ZAE B;  4YXD C;  1CYJ A;  1W2L A;  3SXT A;  2N9I A;  3M06 A;  1FJ0 A;  2OYI B;  4WY4 D;  1JOC A;  3IR9 A;  2QM8 A;  1GK4 A;  1PP9 E;  3RL0 B;  2XNX A;  2ZVN B;  3JC2 2;  3E7K A;  1YIJ P;  1CHJ A;  1OVV A;  2HG5 D;  4BRY A;  4WQ8 A;  3GMA A;  2N9J A;  2GA1 A;  2XV5 A;  4K35 A;  2E75 C;  5APX A;  2N18 B;  1CXC A;  2CA4 B;  5C0Z A;  5GTH E;  1OMI A;  2E76 D;  4XXL A;  3O6Q A;  1HJ0 A;  2XTS B;  4YE1 A;  2O3J A;  1LTS C;  2PAJ A;  5AVT B;  1QN2 A;  1LP1 B;  4OWF A;  1JY3 O;  3C9I A;  1HJ5 A;  1LFM A;  1CIF A;  1CTJ A;  3B4S A;  351C A;  4H0L B;  1R5S A;  1HGZ A;  1NVO A;  2G3A A;  3CCR P;  2M5A A;  3KZI V;  1M1J B;  1QL2 A;  3BVH A;  1URQ B;  3WUU A;  4JCG A;  3KYQ A;  1BGY G;  1G1I A;  1R0Q A;  3KPE A;  3AEE C;  3D0W A;  1SQQ D;  2DGE A;  1F1F A;  3EFF K;  4V2K A;  4GT1 A;  2IZ1 A;  1KB9 E;  5CYT R;  2IYP A;  3EWK A;  1IRV A;  2FXO A;  3ZIY A;  1C6R A;  5KLV K;  1MV8 A;  1JY2 N;  3HD7 B;  1HF9 A;  2YKP A;  3AEA C;  1P84 I;  1AKK A;  2QJK B;  3L70 J;  1CHH A;  1M6Z A;  3ZOY A;  3A0H E;  3SFE C;  1GQ1 A;  3P7K A;  4ZKU A;  1CRH A;  1WT6 A;  1KMI Z;  2QIW A;  1FOC A;  2K9Y A;  3TF5 A;  3PRJ A;  2KS1 B;  3CD6 P;  1AV1 A;  4FA5 A;  3D71 A;  3CXH D;  1L4A C;  2D0W A;  3GW6 A;  4IL6 V;  4K3I A;  3TGU G;  3PH2 B;  2J59 M;  4WY4 B;  3DR0 A;  4GOD A;  2PGD A;  3KZI H;  3GHG A;  1FOS F;  2D2C C;  1M1K Q;  1L9J C;  2WSE J;  2ZYA A;  2HV4 A;  2FFD C;  4D6T G;  3KHU A;  3H1H G;  1CIE A;  4GKG A;  4N6J A;  1LC2 A;  2FKW B;  1LMS A;  2PCC B;  3H1K E;  4BRY B;  4BWN A;  5CJ4 A;  2E43 A;  3WUT A;  4JBZ A;  1HGV A;  2YIU B;  1ZRT D;  1KC8 Q;  3ZCF A;  1KYO I;  1PPJ G;  2E76 B;  4I7Z C;  3H1L G;  3BRV B;  1NAF A;  3T97 A;  1M56 D;  1VQM P;  4DJG A;  3O6Q B;  3H1I E;  1BSN A;  3SWY A;  1RZ6 A;  3MHV A;  3SSU A;  1YTZ T;  2XKM A;  1E5W A;  3A5T A;  4Y5R A;  3PH0 A;  1CSW A;  2JDI H;  1LTT C;  2IBZ E;  3UIA A;  3CX5 H;  3HQ9 A;  2YXR B;  1COR A;  3L75 G;  3PHL A;  4XYD B;  2E74 D;  4EI2 A;  1H32 B;  3RN1 A;  1ZW0 A;  2KZJ A;  2MKV A;  1ZV8 A;  4EIF A;  1WVE C;  1CI6 B;  3II6 A;  1VPC A;  1RF1 B;  3LID A;  5CIG B;  1MZ4 A;  5KAI E;  2A06 E;  3L71 D;  1FOS E; 
#chains in the Genus database with same CATH homology
 2V07 A;  3NBT A;  1FI3 A;  1NU1 D;  1I8P A;  1HRO A;  3SVW A;  2BGV X;  2RN0 A;  1H33 B;  3ZOO A;  1N50 A;  1CO6 A;  1I8O A;  4Q5P A;  1CRJ A;  2LIR A;  1H31 B;  5DF5 A;  5TJH A;  4EIE A;  1H33 A;  1AOF A;  3PXT A;  3ZOX A;  1C75 A;  1H31 A;  1CYI A;  1A2S A;  1OAE A;  4UB6 V;  1KIB A;  1WEJ F;  2BCN B;  4WQA A;  4FB1 A;  2MHM A;  1RZ5 A;  1BL9 A;  3H1I D;  3A0B V;  1YTC A;  2Q3E A;  3PXW A;  1DW0 A;  2FWL A;  1SQX D;  1YEA A;  2QJP B;  4FAN A;  5H2F V;  3NWV A;  2K9J B;  1CTZ A;  1K3G A;  2IBZ D;  5DJQ B;  2N3B A;  1IZL 0;  1GIW A;  1N90 A;  5B6Q A;  4RJT A;  4AX3 A;  3L70 D;  3M97 X;  2CA3 B;  1AYG A;  1YEB A;  3X39 A;  3A9F A;  1YCC A;  4A7P A;  1H1O A;  1CTY A;  4WQE A;  3WUI A;  5AUR A;  1U75 B;  1EZV D;  4UB8 V;  4FA9 A;  3NBS A;  1DVV A;  3VMA A;  3HQ6 A;  1DW2 A;  3L72 D;  2OZ1 B;  1DW3 A;  5B5E V;  3O20 A;  1YIC A;  2A06 D;  1CCH A;  1COT A;  3RN0 A;  1CYC A;  1QYZ A;  3OA8 B;  2OZ1 A;  1C6O A;  5KAF V;  1E29 A;  1CIH A;  1SQV D;  3WFD C;  3HQ8 A;  155C A;  1CSU A;  2JQR A;  2N3Y A;  2PAC A;  2ZOO A;  2B11 B;  5DFS A;  1KYO W;  3RLM A;  2YQB A;  4PJ0 V;  1NTZ D;  1C7M A;  4L3G A;  1ETP A;  2PCB B;  2CXB A;  1P84 D;  3TYI A;  3ITK A;  2GIW A;  5KLV D;  1K3H A;  3DMI A;  2Y0C A;  2FYU D;  1GDV A;  1FHB A;  4H0K A;  2KNC B;  1H9Y A;  4PD4 D;  5CIB B;  2V08 A;  1QL4 A;  3CP5 A;  1U74 B;  4PWA A;  5GTH V;  1CED A;  2QJY B;  4WQD A;  4AAN A;  1CRY A;  4FA1 A;  1DT1 A;  1CRC A;  1NTK D;  1FI9 A;  1HJ3 A;  4O1Q A;  3WFE C;  4O1W A;  4U3F D;  3CWB D;  5CIF B;  1L0L D;  1A56 A;  2GC4 D;  1C6S A;  1BCC D;  2ZBO A;  3CX5 W;  1CRG A;  1HH7 A;  2EXV A;  1H9X A;  2C1D A;  4RSZ A;  2ORL A;  1C52 A;  2JTI B;  1MG3 D;  1C2R A;  1KYO D;  3PXS A;  1J3S A;  3H1H D;  2CE1 A;  1VYD A;  1GJQ A;  4EIC A;  2C2C A;  3CYT I;  4PW9 B;  2YK3 A;  3H1J D;  1DIQ C;  4FA4 A;  1IQC A;  3VYM A;  1S6V B;  3H1L D;  3GG2 A;  1NNO A;  3ZBM A;  3SJL A;  3C2C A;  2BLF B;  1E8E A;  3TDK A;  1JDL A;  4L3H A;  1I54 A;  4WQB A;  3A0H V;  1M60 A;  2FRC A;  1DII C;  3PLN A;  2JWA A;  4J20 A;  4QAO A;  3JBT B;  3L75 D;  1CYJ A;  1W2L A;  3SXT A;  1YIQ A;  2N9I A;  1FJ0 A;  2AI5 A;  5KKZ B;  2N18 C;  1GU2 A;  3WC8 A;  3OCD A;  3CX5 D;  1CHJ A;  1L9B C;  2ZZS 1;  4WQ8 A;  3O5C A;  1B7V A;  1CC5 A;  4L1Q A;  4EID A;  1I6D A;  1BGY D;  1EB7 A;  1MG2 D;  2N9J A;  1ZZH A;  2BH4 X;  2N18 B;  2B12 B;  1CXC A;  2CA4 B;  5C0Z A;  4WQC A;  2L91 A;  3O0R C;  1N15 A;  5IY5 1;  1SQP D;  1CRI A;  4XXL A;  1NTM D;  2XTS B;  4YE1 A;  3VRD A;  2O3J A;  4H0J A;  4GYD A;  1SQB D;  1QKS A;  1CXA A;  1QN2 A;  1HJ5 A;  1LFM A;  1CIF A;  5KLI B;  1CTJ A;  351C A;  5EXQ A;  2LIT A;  1KV9 A;  3L4M A;  2C1U A;  3KZI V;  2B4Z A;  3BCC D;  2DVH A;  1OCD A;  4JCG A;  3VNW A;  5TIS V;  2C1D B;  1CSV A;  3PTZ A;  1R0Q A;  4GED B;  3TGU D;  1YNR A;  1GKS A;  1SQQ D;  3L73 D;  2DGE A;  1F1F A;  1DVH A;  4V2K A;  1NML A;  5CYT R;  5CIC B;  4P4Q B;  4AAL A;  3H1K D;  1IRV A;  1F1C A;  3ZIY A;  1I5T A;  1C6R A;  5CID B;  2Y0E A;  1PP9 D;  3ZOW A;  1S5L V;  4D6T D;  2B10 B;  5KAI V;  1HCM A;  2Y0D A;  4WQ9 A;  1AKK A;  2QJK B;  3O1Y A;  1CHH A;  1M6Z A;  2VHD A;  3ZOY A;  1IO3 A;  451C A;  4EDF A;  1GQ1 A;  5DJQ C;  1CRH A;  1PPJ D;  2GB8 B;  3DP5 A;  2GC7 D;  2ZXY A;  1FCD C;  1FOC A;  1C2N A;  3HQ7 A;  3TF5 A;  2BCC D;  3PRJ A;  1DW1 A;  3MK7 C;  3WFB C;  4FA5 A;  1BE3 D;  4DY9 A;  1CNO A;  1HZU A;  1N9C A;  3WU2 V;  3CXH D;  4N0K A;  1I55 A;  5CIH B;  2KS1 A;  2D0W A;  1YFC A;  3GW6 A;  4IL6 V;  2I8F A;  4K3I A;  3PH2 B;  5B66 V;  2MTA C;  3DR0 A;  2QG4 A;  1LS9 A;  1W5C T;  1CHI A;  1L9J C;  1RAQ A;  3MK7 B;  4AAO A;  1A8C A;  2HV4 A;  2CE0 A;  1HJ4 A;  2L4D A;  3KHU A;  3SLE A;  1CIE A;  3OCD B;  2C8S A;  1E2R A;  2FYN B;  1RAP A;  2RMZ A;  4AAM A;  1QL3 A;  3WFC C;  1LC2 A;  1LMS A;  2PCC B;  3FWL A;  5E79 V;  1NMI A;  2YIU B;  1HZV A;  2BH5 X;  1ZRT D;  3ZCF A;  1M70 A;  1I6E A;  2B0Z B;  1FI7 A;  1KB9 D;  1NIR A;  1IRW A;  1KX2 A;  3ORV A;  3L74 D;  5CIE B;  4WQ7 A;  2BPB B;  3OA8 A;  3CU4 A;  1RZ6 A;  1LC1 A;  4Y5R A;  4NFG B;  1CSW A;  4KMG A;  3CXH W;  1CSX A;  1CCR A;  1CIG A;  3HQ9 A;  3L4O A;  1HRC A;  1COR A;  2ZON G;  3PHL A;  4XYD B;  3SWS A;  2AIU A;  1H32 B;  3RN1 A;  2C9X B;  5C9M A;  2N9Y B;  2YCC A;  1KB0 A;  3RMZ A;  4EIF A;  1KX7 A;  1WVE C;  1H32 A;  1L0N D;  4LJI A;  2D0S A;  2AXT V;  1MZ4 A;  5CIG B;  2C1V A;  1AOQ A;  4FAV A;  3L71 D;  5GTI V;  4MU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...