1SQPD

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 47
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqpD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqpD02
4L3HA 1CSUA 5C0ZA 4AANA 4Y5RA 4EIFA 2C9XB 3DMIA 2XTSB 1E8EA 1BE3D 1HZUA 1H31A 3SJLA 3CWBD 4H0KA 1KB0A 5B5EV 2N18B 1HJ4A 4WQ7A 1HJ5A 1CXCA 3TYIA 5CIGB 1BCCD 1QN2A 3PH2B 1IQCA 1PP9D 5DJQB 1J3SA 1FCDC 1FOCA 4PWAA 2Y0DA 4UB6V 1H9YA 2C8SA 5GTHV 3ZIYA 4FA9A 1NMLA 3VRDA 3NWVA 1FJ0A 1LFMA 5KLIB 1B7VA 2B0ZB 1F1CA 1H32A 1C2NA 2QJKB 2N3BA 1CCHA 2ZONG 3O20A 1NTMD 5EXQA 1YFCA 1AKKA 5B6QA 4WQ9A 1NTKD 1GJQA 1DW1A 351CA 2QG4A 5KAIV 2RN0A 1U74B 4UB8V 2GC7D 4RSZA 2FYUD 1YIQA 3ZOXA 4FANA 2N9YB 2ZOOA 1DW0A 1KB9D 1LMSA 1SQBD 2C1VA 2CE0A 1EB7A 1W2LA 1N15A 1CCRA 3FWLA 1CYJA 2O3JA 3L71D 1F1FA 2YQBA 1YTCA 3NBSA 1CRCA 1L9JC 1DIIC 4EICA 4QAOA 2BPBB 1QL4A 1I54A 2ZXYA 1NNOA 3RN0A 2ZBOA 2D0WA 3OA8B 1YICA 2CA3B 2KS1A 4P4QB 1CORA 1QKSA 1C2RA 1M70A 3A0HV 5H2FV 3RMZA 1QL3A 1DIQC 1GIWA 3CYTI 1COTA 4O1QA 2YCCA 1NMIA 1FHBA 3C2CA 4WQCA 3H1LD 5TISV 1MZ4A 3H1HD 2B4ZA 2LITA 1FI3A 3L4OA 3ZCFA 4L3GA 3TF5A 1IZL0 1KYOW 5IY51 5CIBB 3DP5A 2B12B 1E29A 2BLFB 2C1UA 4H0JA 2Q3EA 1K3HA 5KAFV 1YEAA 4KMGA 5C9MA 155CA 2ZZS1 1CYCA 4AAMA 3WU2V 2Y0CA 5TJHA 3HQ7A 1I8OA 1KX2A 3H1ID 4WQEA 1SQXD 1DVVA 3NBTA 4EIEA 3H1JD 1L9BC 1M60A 4N0KA 3TDKA 2DGEA 3OA8A 4JCGA 4AX3A 5AURA 4AAOA 2AIUA 1CYIA 1MG3D 2V07A 2HV4A 1OCDA 4EIDA 1H33A 3ZOWA 3DR0A 2GB8B 1CHHA 1BL9A 4RJTA 1AOQA 1OAEA 1PPJD 1WVEC 3KHUA 3PRJA 1I6EA 3MK7C 1K3GA 1CRYA 2IBZD 1HJ3A 3WUIA 3L4MA 4GEDB 1IRWA 1KYOD 3H1KD 2VHDA 1GQ1A 3RN1A 1LC2A 3ZOYA 1HCMA 3JBTB 2CA4B 2K9JB 2FWLA 451CA 3OCDA 1CIEA 1FI9A 2C1DB 3CU4A 2BCNB 3CXHW 2MHMA 4LJIA 5CIEB 1DT1A 5KLVD 3GW6A 5CYTR 1C6SA 1HROA 1KV9A 2FYNB 2L4DA 1E2RA 1WEJF 1CHJA 1A56A 2QJYB 2N9JA 4FA4A 3O0RC 2N3YA 1CIFA 1IRVA 4V2KA 1GU2A 3L72D 3ZOOA 5B66V 1H33B 3PXTA 4WQDA 4K3IA 2PCCB 1I8PA 3BCCD 1C6OA 5CIDB 4WQBA 4NFGB 4GYDA 1S6VB 3CX5W 4FB1A 3TGUD 1AYGA 3A9FA 1CNOA 2PCBB 1S5LV 1CRGA 2PACA 3PXSA 3CP5A 3MK7B 1CRHA 3L73D 1ETPA 3L70D 3SWSA 5CIHB 2ORLA 3KZIV 1SQVD 4FA1A 3SVWA 2C1DA 3CXHD 2CE1A 4XYDB 3VYMA 1IO3A 5E79V 1L0LD 3OCDB 4Q5PA 1CXAA 2RMZA 2D0SA 2CXBA 3M97X 2YIUB 4IL6V 4YE1A 1LC1A 1LS9A 1C6RA 3WFEC 1RZ6A 1C52A 4AALA 1CC5A 1CTJA 5DF5A 1CHIA 3L75D 4FA5A 3WFCC 2GC4D 1C7MA 1ZZHA 3HQ8A 5DFSA 5KKZB 2LIRA 1KIBA 1I6DA 3VMAA 4PW9B 2OZ1B 1NIRA 3ZBMA 1CSWA 3CX5D 1JDLA 1EZVD 1SQPD 2FRCA 4PD4D 1YNRA 1MG2D 4U3FD 1DVHA 2KNCB 1ZRTD 1KX7A 3SXTA 1H1OA 3ORVA 1R0QA 5GTIV 1HRCA 3WFBC 1M6ZA 3X39A 3L74D 1N50A 3GG2A 1CRJA 2B10B 1CO6A 3SLEA 4O1WA 4DY9A 5CIFB 2MTAC 3HQ6A 1CIGA 1AOFA 1L0ND 1HZVA 2JTIB 1CSVA 2N9IA 1GDVA 1CEDA 1GKSA 1N9CA 1P84D 4A7PA 4MU8A 2N18C 2BCCD 2QJPB 2AXTV 1N90A 1VYDA 1I55A 3O1YA 2B11B 1CRIA 1H9XA 5DJQC 1DW3A 2L91A 1RZ5A 1DW2A 4L1QA 1H31B 3HQ9A 4J20A 2OZ1A 4XXLA 1BGYD 4PJ0V 2BH5X 1RAPA 1YCCA 1FI7A 2AI5A 1C75A 3VNWA 2A06D 2BH4X 3O5CA 4EDFA 2JWAA 1CIHA 1CTYA 2GIWA 2I8FA 1U75B 2EXVA 3PLNA 3PTZA 1CSXA 3ITKA 4WQAA 2V08A 5CICB 1A2SA 2Y0EA 3WC8A 3RLMA 1H32B 1RAQA 1A8CA 2JQRA 3A0BV 4WQ8A 2C2CA 1NTZD 3PXWA 2DVHA 1CTZA 1SQQD 4FAVA 1I5TA 1W5CT 2BGVX 1QYZA 4D6TD 2YK3A 3PHLA 1YEBA 3WFDC 1NU1D 1HH7A
chains in the Genus database with same CATH superfamily
1LTSC 4L3HA 3I5CA 4Y5RA 3CD6P 2C9XB 3K5BA 1GK6A 1SQVG 4TT3H 5APQA 1CI6A 2E75C 5AW8B 3CX5H 2JEEA 5AVUB 3SJLA 3CWBD 1FAVA 2N18B 2C0WA 1HJ4A 3HE5B 3TYIA 5CIGB 1HBWA 1OMIA 2RKLA 1FE6A 3H1LJ 4I7ZC 2R5DA 3NWVA 1FJ0A 3PJSK 1B7VA 2B0ZB 1NTZK 2YXRB 3LW5H 3D70A 1SS1A 3HTKA 1OVRA 3CWBG 1DEBA 1CCHA 1N7SA 3TNUA 4W7YA 1Y8AA 1PGQA 3KZIE 2B87B 3AEFC 1VPCA 351CA 3EQ2A 1IFPA 1U74B 4D6TE 3B5NB 2P67A 2XV5A 1YIQA 2CK3H 1GZLA 1OXZA 2E43A 4FANA 1S4XA 4NPEA 1XTCC 2E74C 4W7ZA 1CCRA 1CYJA 2O3JA 3L71D 4DCKA 1F1FA 4K3AA 2YQBA 3NBSA 1E79H 3CCQP 2Q3IA 1AV1A 3RK2D 1VQNP 3V4QA 1BCCE 1I54A 2FXOA 3RN0A 3HRNA 3P8CD 2CA3B 2E75B 4AUWA 2KS1A 2KLVA 3L71G 2FY8A 2YKPA 1DIQC 4ZMDA 1NTME 1X0TA 1IFJA 3A0BH 3C2CA 4I7ZB 4WQCA 1KV4A 1KFMA 3H1HD 2B4ZA 3MTUE 3PH0A 2FYUE 1FI3A 1VQLP 2K1AA 3KYQA 4ZKUA 1GD2E 2OARA 2JP3A 3JCUH 2B12B 2HG5D 2Z5HA 1E29A 3C9IA 4H0JA 5C9MA 1MFZA 155CA 2IPPA 3AE2C 1CYCA 4AAMA 1U7JA 4N78E 1FZEA 1FZCC 5AW6B 2Z5IA 1RHZB 3M9QA 2BCCJ 2XU6A 3H1HG 1LT9A 4EIEA 5APSA 1IZNB 2E74B 3HUSC 1KZUB 1EZVI 4JCGA 1NU1G 3HE4B 5GTHH 1FU1A 1LJ2A 2HPCA 3BCCJ 1VQPP 2OTLP 2AIUA 3ABVC 2V07A 2M8RA 1FJKA 4H13B 1OCDA 1H33A 3ZOWA 3DR0A 2GB8B 3KPEA 4MN4C 1AFOA 1CHHA 3O6QA 5KAIH 3RBXA 4RJTA 1OFCX 1PPJD 3L73J 4UB8H 2WPQA 3I56P 2R32A 2IBZD 1HJ3A 1SQVJ 3V2NA 4GODA 3WUIA 2QSIA 1A02J 1L0LJ 2VHDA 3L35A 1G2CB 1RQVA 2YMYA 1TU3F 1R5SA 3JBTB 2W90A 2FWLA 3H1IE 2VRSA 1CZQA 1PPJG 2C1DB 1SQXE 3CU4A 3CXHW 1IFMA 2WSSH 2IBZG 3H1JE 4LJIA 1DT1A 2PAJA 4YXDC 5AW5B 3RK2C 1HROA 1KV9A 1FZCB 2L4DA 1E2RA 3CCEP 2OGUA 4FA4A 3O0RC 4UB6E 1SQPJ 3HUSB 1IRVA 1J1EC 4U3FJ 1OW8A 3H32B 4OVNF 3L72D 2OTKE 2A45H 3A2AA 4ASWA 1PZQA 2ZT9D 3NTNA 1L4AC 1DH3A 1H88A 4H0LC 4NFGB 3P32A 2O01N 1KYOE 1FJPA 4FB1A 1S5LH 3CXHH 1JY2O 3CC4P 2OYHC 1CRHA 4L73A 3CLQA 2LXBA 3L72G 1RE3A 1Q81Q 1L0NJ 5AW3B 4JYCA 2HODB 3RK3D 3CCSP 5KLVE 3MHVA 1U7MA 1VQ4P 2KB7P 1UIXA 3FXEA 2WPRA 1Y9BA 1RY3A 4IL6V 1LC1A 2QRXA 2K88A 2QM7A 3MD0A 2YNYA 5AW4B 3RK2B 1HH0A 3L75D 3MUDA 1LGHB 4PD4H 1YQ4C 3HQ8A 3T97A 4WY4D 3GF3A 2OZ1B 2N1TD 2Q6QA 1J1EB 3TGUE 2FRCA 1YNRA 2Q5UA 1H89A 1ZRTD 3L75G 1L4AB 3L70E 4GT1A 3WFBC 3VP8A 1M6ZA 4H0LB 2C9LY 4D6TJ 3CCVP 1JUNA 3RL0D 1N50A 1NU1J 1CO6A 3BRTB 4L76A 3SLEA 2NPSA 1P84H 2OYHB 4OGQD 1CIGA 1LWUA 1QX8A 2WT7A 1N8RQ 1CSVA 2UWJE 5CJ0A 1W5CE 2B9BA 4I1LA 4A7PA 2JDIH 1JY2P 3M0DA 1QGKB 1T3JA 1N90A 1BCCJ 3O1YA 2IZ1A 3MIWA 2L91A 1RZ5A 1H31B 3AEBC 3SSUA 4TLFA 2YXQB 5AVZB 4XXLA 5KLIC 3CX5E 1ZP0C 1EXJA 1VL2A 1C75A 3VNWA 1FBMA 1NTMJ 2A06D 2BH4X 1YJNP 4EDFA 2GIWA 1KC8Q 3RGUA 2I8FA 1NTKK 3ITKA 1LTBC 3L74E 2Y0EA 2FYUJ 5KJ7D 1JY3O 1XTGB 1A8CA 1FS0E 3A0BV 2JKVA 2B89A 3RK3C 3PXWA 3VOPA 1M1KQ 2A06G 1SQQD 2R3SA 4FAVA 1I5TA 3NFQA 2YK3A 3PHLA 2GM4A 2FXMA 2BCCE 1Y47A 2H88C 5C0ZA 4AANA 4C46A 3TYYA 4RKUJ 3DMIA 1JOCA 2XTSB 1BSNA 1LTTC 3V2QA 5CCHA 1DD4A 2W6JH 1SQQG 5B5EV 1G1JA 2W6BA 4WQ7A 1CXCA 2ZYAA 2N1TC 4LLHA 1EXIA 3R4YA 3Q2YA 1QL1A 1PP9D 1J3SA 1FOCA 4PWAA 1KYOI 1GL2A 5GTHV 2IYOA 1NMLA 3VRDA 5KLIB 1WMKA 1F1CA 1PGOA 1SQVE 4GKGA 1RE4C 3O20A 1FZFA 1KILE 2PP6A 3CCUP 2E42A 4WQ9A 1KB9H 3II6A 2QG4A 5KAIV 2G8YA 4UB8V 4IFMA 4OGQC 1PP9G 3D6ZA 1WRGA 2KSEA 2N9YB 2ZOOA 2P7JA 3H1IJ 1SQXJ 2C1VA 1M1JC 2RH0A 2AXTH 3H1JJ 3RK3B 1W2LA 2K37A 1JY3P 4JYBA 2POHA 3CWBE 1DIIC 1HTLC 4QAOA 5AW2B 1K8AQ 3F5HA 5B5EE 3G9RA 2ZXYA 1NNOA 3HE4A 5AVTB 5BU5A 2D0WA 3OA8B 1YICA 2GA1A 3MZWB 1ZV8A 3GF7A 3KXDA 3M9BA 2HYNA 1C2RA 1M70A 5H2FV 2M5AB 2N1TB 1VQ7P 3FX0A 5GTIE 4O1QA 2YCCA 5KJ7C 1BDDA 2AXCA 3FXDA 2IYPA 3S9OA 4OWFA 2LITA 2ZYGA 5KAIE 1CW5A 2ZXXA 2MJZA 2FXPA 4BRYA 5KLVJ 1HGVA 1Q82Q 3L71E 2Q3EA 4OGQB 1R5LA 3MGNA 1I8OA 1NTZG 3D6YA 1AA0A 1M1JB 5AW7B 1DVVA 2CPBA 3NBTA 2QJYC 5CMZA 1FDMA 1HVVA 2KIKA 1L9BC 1M60A 3P8CE 5CJ4A 2DGEA 3CX5I 1GU5A 4PJ0E 2OTJP 1MKMA 2YO2A 3HUSA 3G3ZA 5H2FE 3TGUJ 4EOTA 1IJDB 1Z56A 2YMKA 1IO4A 2Q1KA 4U7JA 2JJLA 1BL9A 1JTHB 3H1HE 3AECC 3KHUA 2W27A 3MK7C 1K3GA 1CRYA 3L70J 1Q2NA 2K3RA 2I8DA 3L4MA 4GEDB 1N7SD 2D2CD 1IRWA 1NU1E 2ZFCA 2Q9IA 3H1KD 5AVVB 2N9BA 2QA4P 1GQ1A 1AVYA 1HCMA 3ZDMA 2K9JB 3E1RA 2HODA 451CA 2YIUC 1CIEA 4N6JA 1JM0A 1EDLA 2BCNB 1ZLLA 3AE3C 1VQ8P 3AE4C 1CSBA 3EWKA 3A3YB 5CYTR 2PRRA 3CMAP 1LP1A 3H1KG 3TK1A 5APUA 2FYZA 4GOEA 1WEJF 3A0HH 3EFGA 5KKZC 1OIPA 3M06A 1A56A 2QJYB 2JO1A 2B88A 4V2KA 3GMAA 1SQPK 3VN0A 1NWQA 5B66H 1M8OB 1J1DC 1PPJE 1H0TB 2IBZE 2ZAEB 5DJUB 1JO5A 1I8PA 4WQBA 3L74J 1KILC 4GYDA 2Y9ZA 3G4SP 3LW5J 3A9FA 1LTJC 1W2EA 3O8ZA 3MK7B 5KAFH 3BRVB 3WU2H 4H44D 1YI2P 4AYCA 5E79H 4GOFA 4FA1A 1L0NK 1J2JB 3CXHD 2CE1A 4XYDB 3OJAB 1IO3A 1N2DC 1OW6A 3OCDB 3S4RA 1CXAA 2RMZA 4IFFA 2A45G 2Y9YA 2YIUB 3A5TA 1LS9A 1IC2A 1C6RA 1RZ6A 2KZIA 3CMEP 2H8PD 3L72E 1CTJA 1ZR2A 1GW4A 1U57A 1ZZHA 2AEMA 1SFCA 5DFSA 5KKZB 1T6AA 3HD7A 1KIBA 2OYIC 3ZBMA 2QE7H 2WWWA 1GW3A 1NAFA 5AVSB 4PD4D 2P1JA 1DVHA 2KNCB 1N7SC 2SPZA 1J1DB 1JEKA 1NTZJ 2D2CC 1T3UA 2GUSA 3TSIA 3ORVA 1HRCA 1MUUA 2KXPB 3SWFA 1KILB 1OVVA 2W83C 4IL6X 3RK3E 3GG2A 1CRJA 2XNXA 2B10B 1LTJB 4Y99C 1FOSF 2ZYDA 3AE7C 4DY9A 1AOFA 1GDVA 2LKMA 4KHXA 3CWBJ 1GMJA 1P84D 5APWA 2KSJA 3AEEC 3L75E 2AXTV 1I55A 2HFED 2B11B 1H9XA 5DJQC 1DW3A 1CI6B 4L1QA 4R4LA 1KORA 3USSA 1EQ7A 1BGYD 1GK4A 1AQTA 2E5TA 2IDBA 1SP4A 2FBWC 3H6PA 2WQYC 4ZKPA 3G6EP 1ZRTE 1CIHA 1NTMK 4HB1A 3CCRP 2EXVA 1M90Q 2NZ2A 2OYIB 1ZN5A 3KZIH 3WC8A 3GHGC 4H44C 3TNUB 1N7SB 2D2CB 1BGYG 4JQ0D 2C2CA 3AE5C 2M3EA 2P58A 2DVHA 2AEJA 2C0XA 1WT6A 3L71J 1W5CT 1NYHA 1YQ3C 3Q5SA 2J58A 1N7LA 2XZRA 1YEBA 3WFDC 3U1AA 4Y99B 2ZXEB 3C1LA 4XFJA 3S1KA 2JWDA 2KLUA 1CSUA 1K05A 2NRGA 1VQMP 1IK7A 3FWNA 1BE3D 3NMDA 4H0KA 1KB0A 1OWAA 2A06E 2IBZI 4YXWH 1QN2A 3PH2B 5DJQB 2W6AA 1FCDC 3BASA 2HR3A 2Y0DA 5CCGA 3ZIYA 4FA9A 3H1HJ 1URQA 1LFMA 1ZW0A 1H8AA 1NAYA 1BE3G 1H32A 3FGAD 3SWKA 4JF7A 2FFDA 2N3BA 5EXQA 2O01J 3VMYA 3Q3DA 1FZGA 1NTKD 3C8VA 1NKZB 1SQQE 4XA4A 2RN0A 2AEFA 2XNDH 1YTZT 3MP7B 2GC7D 1Q90D 3VTPC 3GHGB 5CBNA 3IF4A 4H44B 1DW0A 1KB9D 1P84I 2ZVNB 2R44A 2NPSD 4XE5B 1LMSA 1SQBD 2YO3A 5L8RJ 1SQXK 1YHQP 4IL6E 1EB7A 3RL0g 4EYYQ 1N15A 1RF0C 1EC5A 1FZAA 1NTKG 1M1JA 3V6IA 3CC7P 1X22A 3L37A 1CRCA 1QEXA 2WSCJ 3W68A 3HE5A 5C39A 2ZT9C 1X9VA 1R8EA 1PP9E 1AQ5A 1SQBG 1QKSA 4ZNCA 3A0HV 3RMZA 5AW0B 3JC22 1QL3A 3CPWO 1JMMA 1E5WA 1IFIA 1GIWA 1NMIA 2B87A 3H1LD 3O6QB 1MZ4A 1SQBK 2WSEJ 3B5NA 1RE3C 2E76D 4JPZB 2JR8A 2KK7A 3L4OA 1IZL0 1KYOW 1AVOA 5CIBB 3U1CA 2BLFB 2K9JA 5KLVK 5KAFV 4KMGA 3WU2V 2Y0CA 1ZR4A 5TJHA 2I1JA 1KX2A 4LGDE 4WQEA 3G71P 1Q86Q 1KFNA 3L72J 1IK9A 3TDKA 3CC2P 4WY4C 3MUDC 1YITP 4UB6H 5CCHD 4PV1D 3IFMA 5AURA 3LIDA 2ZT9B 2E75D 3A0HE 1FOSE 3UIAA 2HV4A 2C9NY 1GL2D 1KYOH 3BATA 2IZ0A 1NTZE 3AEGC 1T2KD 3R2PA 1AOQA 1OAEA 3RL0C 3PRJA 1I6EA 3A0BE 2KOGA 1JMBA 3B71A 5KTBA 5AVQB 1NVOA 1VQ6P 2J59M 4DZOA 3M0AA 1KQGB 3RN1A 1LC2A 3OA7A 3ZOYA 5CHXA 1LWUC 5APYA 3JCUE 3OCDA 2M3BA 1FI9A 4O9BA 2WZ7A 1OVUA 2R3CA 3M0DC 3L75J 3GW6A 4RO0A 4Z1MH 4WWIA 2H89C 5AVXB 2E74D 3AEDC 5GTHE 2N3YA 4WVZA 4WY4B 1GU2A 5APVA 3CCJP 3ZOOA 5TISH 4WBAA 3PXTA 4WQDA 4K3IA 2PCCB 1IFDA 3T97B 4H13D 3BCCD 5AVRB 5CIDB 5BU8B 1S9KD 2V7QJ 3VMZA 2ITAA 1S6VB 3V2RA 3CX5W 3H1KE 4HYTB 1YIJP 4UB8E 2E76C 1KMIZ 1G1IA 2PCBB 1S5LV 5AVWB 1CRGA 1G2CA 5APXA 2PACA 3RL0B 3CP5A 1KILA 2J5UA 3L73D 1N73C 1ETPA 5CIHB 2ORLA 3KZIV 1LTJA 1SQVD 3P7KA 2C1DA 2BEZF 1OW7A 3BCCG 1DIPA 1L0LD 2CXBA 1FC2C 1HF9A 1LWUB 4EIJA 3IR9A 2K9YA 1FZCA 2WT7B 2GUVA 4YE1A 2P2UA 3L73G 5CCHC 1C52A 4PV1C 4C7NB 1DX7A 5EFWB 2KI7B 1CC5A 5DF5A 3H32A 2WSFJ 2GC4D 1L0LG 1C7MA 1IFNA 2O1KA 2QVAA 1PGJA 1GL2C 2LIRA 3VMAA 4PW9B 2FKWB 1T2KC 4KT0J 1NIRA 1GU4A 1CSWA 1AJYA 1JDLA 1EZVD 1SQPD 4U3FD 1MG2D 4BXLA 1SQVK 4YPCA 2OYIA 1KX7A 3SXTA 2PFXA 1R0QA 1S5LE 1SQQJ 3AE1C 1L0LK 1YTZI 1DD3A 1PV3A 3CXHE 1DEEG 1JCCA 2E76B 4L74A 3QH9A 4O1WA 4IOIH 1K9MQ 3CCLP 1EZVG 1SQPG 3HQ6A 4U3FG 1N73B 2I1KA 2E5YA 1NGMB 1L0ND 2N9IA 1CEDA 5M1BA 1VYDA 1CRIA 1PP9J 5AW9B 3OW2O 1DW2A 3HQ9A 3Q5RA 2OZ1A 4PV1B 1OX3A 3WUVA 1L0NG 1RAPA 1YCCA 4PD4E 1KQFB 4H13C 2QJKC 3O5CA 2JWAA 3VMXA 1RF1C 1CTYA 1GL2B 1CSXA 2G3AA 1L4AA 4R4MA 2R5BA 3V4WA 2V08A 5CICB 4M3LA 4LC1A 3SFEC 1A2SA 3RLMA 4AQRD 3WUUA 1L4AD 1L2PA 3E7KA 2DW3A 4H0LD 4WQ8A 1HGZA 2OYHA 5K5GB 3GHGA 4KJMA 1HJBA 1CTZA 1EDJA 1QYZA 4D6TD 1P84E 1MZ9A 1NU1D 1HH7A 1HJ0A 3P8MC 3B8EB 4EIFA 1LTAC 1EDKA 1E8EA 1HZUA 1QLED 5B5EH 1H31A 1BGYE 4D6TG 4QMAA 2KYVA 1HJ5A 1BCCD 3WUTA 1LNQA 1IQCA 1SFCD 3HD7D 4UB6V 1H9YA 2C8SA 1M7LA 1VQ9P 1N86A 5GTIH 2XDJA 2O1JA 3KQGA 1C2NA 2ZJSE 2QJKB 2QIWA 2ZONG 1NTMD 1YFCA 1RF1B 1ZXGA 1AKKA 3OAKA 5B6QA 1GJQA 1SVFA 1NU1K 1SLQA 1DW1A 3AE6C 2M0BA 1BCCG 1NH4A 2LR2A 1GDTA 4RSZA 2FYUD 3ZOXA 1OZHA 4BRYB 3L4FA 3A7OA 1VF5D 2CE0A 1BE3E 1NTMG 1QVFO 4HJGH 3B4SA 3FWLA 1USDA 1YTCA 4N78D 2XKMA 1PL5A 1L9JC 4PJ0H 3AE8C 4EICA 2Z4EA 2BPBB 3CCMP 1RF0A 1QL4A 2FYUG 3Q1MA 1A02F 2ZBOA 4DT0A 2WPVB 1M56D 5APTA 2A45I 1GTWA 5H2FH 1K73Q 2QM8A 4P4QB 1YYCA 1CORA 2WPSA 2ZVOB 3CYTI 1COTA 1D7MA 2BASA 4GIFA 5CBOA 1NTKE 2FYUK 2YKQA 1FHBA 3H1KJ 3CXHI 2WVRA 3HTKB 3M9HA 2O01H 5TISV 1KD1Q 1LTGC 1LT1A 3EFFK 4RESB 1KB9E 3ZCFA 1RH5B 4L3GA 1SQBE 3TF5A 2PGDA 4L75A 3IAOA 3JSVC 1ZMEC 5IY51 2WITA 3DP5A 3H25A 1PGPA 4NPFX 1LT9C 2C1UA 1K3HA 1YEAA 2ZZS1 1PIXA 2FYNC 3HQ7A 2AXTE 3H1ID 2H43A 1SQXD 2QEXP 2IFMA 3H1JD 2KP8A 2WSCH 4N0KA 3OA8A 1S2EA 3V5BA 1LP1B 1S72P 4PD4I 4AX3A 1SFCC 2M5AA 3HD7C 4AAOA 2KS1B 4WY4A 1HWTC 3M91A 4K35A 2N1TA 1CYIA 3Q5PA 1MG3D 3H1IG 1YJWP 4EIDA 1MV8A 3H1LE 5CCGD 3SWYA 1SQXG 2YKOA 1URQD 3H1JG 1WVEC 1NO4A 2H7HA 5TISE 4B86A 1KQLA 2P10A 3L36A 5AW1B 1RE4A 2WSEH 1KYOD 1PFIA 3D0WA 3BVHA 3GLMA 2KZJA 2WMMA 2L5GB 2LXCB 1VF5C 4C7RA 2CA4B 3IN6A 3E1IA 1JNMA 2WTYA 1YBKA 2MHMA 2CPSA 5CIEB 1LT9B 5KLVD 3VYIA 3KDPB 1C6SA 3W67A 2FYNB 1USEA 4GDOA 1VQ5P 4C7NA 2W8ZA 4I2LC 4OH8B 2IFNA 1CHJA 4EI2A 1Q7YQ 3V2PA 2N9JA 1T8ZA 1CIFA 2HPCB 4HKZH 1UIIA 1LTIC 1W2BO 1JTHA 5B66V 1SFCB 5KLVG 1H33B 3HD7B 1YJ9P 1MFTA 1C6OA 4N3YB 5KJ7A 1RQUA 3TGUD 1AYGA 1CNOA 3PXSA 5AVYB 3B5ND 1JY2N 3L70D 3SWSA 1JCDA 3SVWA 1FDOA 3VYMA 3H1LG 5E79V 1N73A 4Q5PA 1FZBA 2D0SA 2QJPC 3TGUG 1VF5B 3M97X 1S3JA 3WFEC 3RBZA 1BGYJ 1QVGO 3L70G 4ASVA 4AALA 1CHIA 4BWNA 3SFDC 4FA5A 3WFCC 4W80A 3VP9A 4NPDA 1NHLA 1NJIQ 1H0TA 1X8YA 4IFDK 1S5LX 1VQOP 1HUCA 3BCCE 5CCGC 1I6DA 1KTMA 1S9KE 5B66E 1URQC 3N4XA 3CX5D 3NXSA 1NKNA 4I6MC 2FFDC 2V7QH 3U59A 4CPGA 1X79B 1KB9I 3WMM0 3L73E 1H1OA 4DOJA 5GTIV 3X39A 1SQQK 2NPSC 3L74D 1FDIA 1L0LE 5KAFE 2Q7CA 1S1CX 3WU2E 5BVZA 5E79E 1BDCA 5CIFB 2MTAC 1BE3J 3F89A 1HZVA 2JTIB 1GKSA 2IX7C 4YTPC 3PP5A 1N9CA 1KQSO 1M57D 4MU8A 1EDIA 2N18C 2BCCD 3L74G 2QJPB 3D71A 2OQQA 2KUBA 1K04A 2WSFH 2OYOA 3QWOC 3AE9C 4J20A 4PJ0V 2BH5X 1EZVE 1SQPE 1NOHA 4U3FE 1FI7A 1VDFA 2AI5A 4DJGA 3AEAC 3N7NA 2KNCA 1QL2A 1NTKJ 2BCCG 3CL3D 1U75B 2V4HA 3CI9A 3PLNA 3PTZA 2BEQD 4WQAA 1ZOYC 1URQB 4HH2A 4JBZA 1VQKP 3LIEA 2HLOA 3B5NC 1RF1A 1H32B 1RAQA 2FFDB 3I55P 2JQRA 1JY3N 1SQBJ 1KILD 1NTZD 2MKVA 5DJTB 1L0NE 2NPSB 2BGVX 4IL6H 4WB4A 4Y28J 1BSHA 1KN7A 1JB0J
chains in the Genus database with same CATH topology
4L3HA 1CSUA 5C0ZA 4AANA 4Y5RA 4EIFA 2C9XB 3DMIA 2XTSB 1E8EA 1BE3D 1HZUA 1H31A 3SJLA 3CWBD 4H0KA 1KB0A 5B5EV 2N18B 1HJ4A 4WQ7A 1HJ5A 1CXCA 3TYIA 5CIGB 1BCCD 1QN2A 3PH2B 1IQCA 1PP9D 5DJQB 1J3SA 1FCDC 1FOCA 4PWAA 2Y0DA 4UB6V 1H9YA 2C8SA 5GTHV 3ZIYA 4FA9A 1NMLA 3VRDA 3NWVA 1FJ0A 1LFMA 5KLIB 1B7VA 2B0ZB 1F1CA 1H32A 1C2NA 2QJKB 2N3BA 1CCHA 2ZONG 3O20A 1NTMD 5EXQA 1YFCA 1AKKA 5B6QA 4WQ9A 1NTKD 1GJQA 1DW1A 351CA 2QG4A 5KAIV 2RN0A 1U74B 4UB8V 2GC7D 4RSZA 2FYUD 1YIQA 3ZOXA 4FANA 2N9YB 2ZOOA 1DW0A 1KB9D 1LMSA 1SQBD 2C1VA 2CE0A 1EB7A 1W2LA 1N15A 1CCRA 3FWLA 1CYJA 2O3JA 3L71D 1F1FA 2YQBA 1YTCA 3NBSA 1CRCA 1L9JC 1DIIC 4EICA 4QAOA 2BPBB 1QL4A 1I54A 2ZXYA 1NNOA 3RN0A 2ZBOA 2D0WA 3OA8B 1YICA 2CA3B 2KS1A 4P4QB 1CORA 1QKSA 1C2RA 1M70A 3A0HV 5H2FV 3RMZA 1QL3A 1DIQC 1GIWA 3CYTI 1COTA 4O1QA 2YCCA 1NMIA 1FHBA 3C2CA 4WQCA 3H1LD 5TISV 1MZ4A 3H1HD 2B4ZA 2LITA 1FI3A 3L4OA 3ZCFA 4L3GA 3TF5A 1IZL0 1KYOW 5IY51 5CIBB 3DP5A 2B12B 1E29A 2BLFB 2C1UA 4H0JA 2Q3EA 1K3HA 5KAFV 1YEAA 4KMGA 5C9MA 155CA 2ZZS1 1CYCA 4AAMA 3WU2V 2Y0CA 5TJHA 3HQ7A 1I8OA 1KX2A 3H1ID 4WQEA 1SQXD 1DVVA 3NBTA 4EIEA 3H1JD 1L9BC 1M60A 4N0KA 3TDKA 2DGEA 3OA8A 4JCGA 4AX3A 5AURA 4AAOA 2AIUA 1CYIA 1MG3D 2V07A 2HV4A 1OCDA 4EIDA 1H33A 3ZOWA 3DR0A 2GB8B 1CHHA 1BL9A 4RJTA 1AOQA 1OAEA 1PPJD 1WVEC 3KHUA 3PRJA 1I6EA 3MK7C 1K3GA 1CRYA 2IBZD 1HJ3A 3WUIA 3L4MA 4GEDB 1IRWA 1KYOD 3H1KD 2VHDA 1GQ1A 3RN1A 1LC2A 3ZOYA 1HCMA 3JBTB 2CA4B 2K9JB 2FWLA 451CA 3OCDA 1CIEA 1FI9A 2C1DB 3CU4A 2BCNB 3CXHW 2MHMA 4LJIA 5CIEB 1DT1A 5KLVD 3GW6A 5CYTR 1C6SA 1HROA 1KV9A 2FYNB 2L4DA 1E2RA 1WEJF 1CHJA 1A56A 2QJYB 2N9JA 4FA4A 3O0RC 2N3YA 1CIFA 1IRVA 4V2KA 1GU2A 3L72D 3ZOOA 5B66V 1H33B 3PXTA 4WQDA 4K3IA 2PCCB 1I8PA 3BCCD 1C6OA 5CIDB 4WQBA 4NFGB 4GYDA 1S6VB 3CX5W 4FB1A 3TGUD 1AYGA 3A9FA 1CNOA 2PCBB 1S5LV 1CRGA 2PACA 3PXSA 3CP5A 3MK7B 1CRHA 3L73D 1ETPA 3L70D 3SWSA 5CIHB 2ORLA 3KZIV 1SQVD 4FA1A 3SVWA 2C1DA 3CXHD 2CE1A 4XYDB 3VYMA 1IO3A 5E79V 1L0LD 3OCDB 4Q5PA 1CXAA 2RMZA 2D0SA 2CXBA 3M97X 2YIUB 4IL6V 4YE1A 1LC1A 1LS9A 1C6RA 3WFEC 1RZ6A 1C52A 4AALA 1CC5A 1CTJA 5DF5A 1CHIA 3L75D 4FA5A 3WFCC 2GC4D 1C7MA 1ZZHA 3HQ8A 5DFSA 5KKZB 2LIRA 1KIBA 1I6DA 3VMAA 4PW9B 2OZ1B 1NIRA 3ZBMA 1CSWA 3CX5D 1JDLA 1EZVD 1SQPD 2FRCA 4PD4D 1YNRA 1MG2D 4U3FD 1DVHA 2KNCB 1ZRTD 1KX7A 3SXTA 1H1OA 3ORVA 1R0QA 5GTIV 1HRCA 3WFBC 1M6ZA 3X39A 3L74D 1N50A 3GG2A 1CRJA 2B10B 1CO6A 3SLEA 4O1WA 4DY9A 5CIFB 2MTAC 3HQ6A 1CIGA 1AOFA 1L0ND 1HZVA 2JTIB 1CSVA 2N9IA 1GDVA 1CEDA 1GKSA 1N9CA 1P84D 4A7PA 4MU8A 2N18C 2BCCD 2QJPB 2AXTV 1N90A 1VYDA 1I55A 3O1YA 2B11B 1CRIA 1H9XA 5DJQC 1DW3A 2L91A 1RZ5A 1DW2A 4L1QA 1H31B 3HQ9A 4J20A 2OZ1A 4XXLA 1BGYD 4PJ0V 2BH5X 1RAPA 1YCCA 1FI7A 2AI5A 1C75A 3VNWA 2A06D 2BH4X 3O5CA 4EDFA 2JWAA 1CIHA 1CTYA 2GIWA 2I8FA 1U75B 2EXVA 3PLNA 3PTZA 1CSXA 3ITKA 4WQAA 2V08A 5CICB 1A2SA 2Y0EA 3WC8A 3RLMA 1H32B 1RAQA 1A8CA 2JQRA 3A0BV 4WQ8A 2C2CA 1NTZD 3PXWA 2DVHA 1CTZA 1SQQD 4FAVA 1I5TA 1W5CT 2BGVX 1QYZA 4D6TD 2YK3A 3PHLA 1YEBA 3WFDC 1NU1D 1HH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3H A;  1CSU A;  5C0Z A;  4AAN A;  4Y5R A;  4EIF A;  2C9X B;  3DMI A;  2XTS B;  1E8E A;  1BE3 D;  1HZU A;  1H31 A;  3SJL A;  3CWB D;  4H0K A;  1KB0 A;  5B5E V;  2N18 B;  1HJ4 A;  4WQ7 A;  1HJ5 A;  1CXC A;  3TYI A;  5CIG B;  1BCC D;  1QN2 A;  3PH2 B;  1IQC A;  1PP9 D;  5DJQ B;  1J3S A;  1FCD C;  1FOC A;  4PWA A;  2Y0D A;  4UB6 V;  1H9Y A;  2C8S A;  5GTH V;  3ZIY A;  4FA9 A;  1NML A;  3VRD A;  3NWV A;  1FJ0 A;  1LFM A;  5KLI B;  1B7V A;  2B0Z B;  1F1C A;  1H32 A;  1C2N A;  2QJK B;  2N3B A;  1CCH A;  2ZON G;  3O20 A;  1NTM D;  5EXQ A;  1YFC A;  1AKK A;  5B6Q A;  4WQ9 A;  1NTK D;  1GJQ A;  1DW1 A;  351C A;  2QG4 A;  5KAI V;  2RN0 A;  1U74 B;  4UB8 V;  2GC7 D;  4RSZ A;  2FYU D;  1YIQ A;  3ZOX A;  4FAN A;  2N9Y B;  2ZOO A;  1DW0 A;  1KB9 D;  1LMS A;  1SQB D;  2C1V A;  2CE0 A;  1EB7 A;  1W2L A;  1N15 A;  1CCR A;  3FWL A;  1CYJ A;  2O3J A;  3L71 D;  1F1F A;  2YQB A;  1YTC A;  3NBS A;  1CRC A;  1L9J C;  1DII C;  4EIC A;  4QAO A;  2BPB B;  1QL4 A;  1I54 A;  2ZXY A;  1NNO A;  3RN0 A;  2ZBO A;  2D0W A;  3OA8 B;  1YIC A;  2CA3 B;  2KS1 A;  4P4Q B;  1COR A;  1QKS A;  1C2R A;  1M70 A;  3A0H V;  5H2F V;  3RMZ A;  1QL3 A;  1DIQ C;  1GIW A;  3CYT I;  1COT A;  4O1Q A;  2YCC A;  1NMI A;  1FHB A;  3C2C A;  4WQC A;  3H1L D;  5TIS V;  1MZ4 A;  3H1H D;  2B4Z A;  2LIT A;  1FI3 A;  3L4O A;  3ZCF A;  4L3G A;  3TF5 A;  1IZL 0;  1KYO W;  5IY5 1;  5CIB B;  3DP5 A;  2B12 B;  1E29 A;  2BLF B;  2C1U A;  4H0J A;  2Q3E A;  1K3H A;  5KAF V;  1YEA A;  4KMG A;  5C9M A;  155C A;  2ZZS 1;  1CYC A;  4AAM A;  3WU2 V;  2Y0C A;  5TJH A;  3HQ7 A;  1I8O A;  1KX2 A;  3H1I D;  4WQE A;  1SQX D;  1DVV A;  3NBT A;  4EIE A;  3H1J D;  1L9B C;  1M60 A;  4N0K A;  3TDK A;  2DGE A;  3OA8 A;  4JCG A;  4AX3 A;  5AUR A;  4AAO A;  2AIU A;  1CYI A;  1MG3 D;  2V07 A;  2HV4 A;  1OCD A;  4EID A;  1H33 A;  3ZOW A;  3DR0 A;  2GB8 B;  1CHH A;  1BL9 A;  4RJT A;  1AOQ A;  1OAE A;  1PPJ D;  1WVE C;  3KHU A;  3PRJ A;  1I6E A;  3MK7 C;  1K3G A;  1CRY A;  2IBZ D;  1HJ3 A;  3WUI A;  3L4M A;  4GED B;  1IRW A;  1KYO D;  3H1K D;  2VHD A;  1GQ1 A;  3RN1 A;  1LC2 A;  3ZOY A;  1HCM A;  3JBT B;  2CA4 B;  2K9J B;  2FWL A;  451C A;  3OCD A;  1CIE A;  1FI9 A;  2C1D B;  3CU4 A;  2BCN B;  3CXH W;  2MHM A;  4LJI A;  5CIE B;  1DT1 A;  5KLV D;  3GW6 A;  5CYT R;  1C6S A;  1HRO A;  1KV9 A;  2FYN B;  2L4D A;  1E2R A;  1WEJ F;  1CHJ A;  1A56 A;  2QJY B;  2N9J A;  4FA4 A;  3O0R C;  2N3Y A;  1CIF A;  1IRV A;  4V2K A;  1GU2 A;  3L72 D;  3ZOO A;  5B66 V;  1H33 B;  3PXT A;  4WQD A;  4K3I A;  2PCC B;  1I8P A;  3BCC D;  1C6O A;  5CID B;  4WQB A;  4NFG B;  4GYD A;  1S6V B;  3CX5 W;  4FB1 A;  3TGU D;  1AYG A;  3A9F A;  1CNO A;  2PCB B;  1S5L V;  1CRG A;  2PAC A;  3PXS A;  3CP5 A;  3MK7 B;  1CRH A;  3L73 D;  1ETP A;  3L70 D;  3SWS A;  5CIH B;  2ORL A;  3KZI V;  1SQV D;  4FA1 A;  3SVW A;  2C1D A;  3CXH D;  2CE1 A;  4XYD B;  3VYM A;  1IO3 A;  5E79 V;  1L0L D;  3OCD B;  4Q5P A;  1CXA A;  2RMZ A;  2D0S A;  2CXB A;  3M97 X;  2YIU B;  4IL6 V;  4YE1 A;  1LC1 A;  1LS9 A;  1C6R A;  3WFE C;  1RZ6 A;  1C52 A;  4AAL A;  1CC5 A;  1CTJ A;  5DF5 A;  1CHI A;  3L75 D;  4FA5 A;  3WFC C;  2GC4 D;  1C7M A;  1ZZH A;  3HQ8 A;  5DFS A;  5KKZ B;  2LIR A;  1KIB A;  1I6D A;  3VMA A;  4PW9 B;  2OZ1 B;  1NIR A;  3ZBM A;  1CSW A;  3CX5 D;  1JDL A;  1EZV D;  1SQP D;  2FRC A;  4PD4 D;  1YNR A;  1MG2 D;  4U3F D;  1DVH A;  2KNC B;  1ZRT D;  1KX7 A;  3SXT A;  1H1O A;  3ORV A;  1R0Q A;  5GTI V;  1HRC A;  3WFB C;  1M6Z A;  3X39 A;  3L74 D;  1N50 A;  3GG2 A;  1CRJ A;  2B10 B;  1CO6 A;  3SLE A;  4O1W A;  4DY9 A;  5CIF B;  2MTA C;  3HQ6 A;  1CIG A;  1AOF A;  1L0N D;  1HZV A;  2JTI B;  1CSV A;  2N9I A;  1GDV A;  1CED A;  1GKS A;  1N9C A;  1P84 D;  4A7P A;  4MU8 A;  2N18 C;  2BCC D;  2QJP B;  2AXT V;  1N90 A;  1VYD A;  1I55 A;  3O1Y A;  2B11 B;  1CRI A;  1H9X A;  5DJQ C;  1DW3 A;  2L91 A;  1RZ5 A;  1DW2 A;  4L1Q A;  1H31 B;  3HQ9 A;  4J20 A;  2OZ1 A;  4XXL A;  1BGY D;  4PJ0 V;  2BH5 X;  1RAP A;  1YCC A;  1FI7 A;  2AI5 A;  1C75 A;  3VNW A;  2A06 D;  2BH4 X;  3O5C A;  4EDF A;  2JWA A;  1CIH A;  1CTY A;  2GIW A;  2I8F A;  1U75 B;  2EXV A;  3PLN A;  3PTZ A;  1CSX A;  3ITK A;  4WQA A;  2V08 A;  5CIC B;  1A2S A;  2Y0E A;  3WC8 A;  3RLM A;  1H32 B;  1RAQ A;  1A8C A;  2JQR A;  3A0B V;  4WQ8 A;  2C2C A;  1NTZ D;  3PXW A;  2DVH A;  1CTZ A;  1SQQ D;  4FAV A;  1I5T A;  1W5C T;  2BGV X;  1QYZ A;  4D6T D;  2YK3 A;  3PHL A;  1YEB A;  3WFD C;  1NU1 D;  1HH7 A; 
#chains in the Genus database with same CATH topology
 1LTS C;  4L3H A;  3I5C A;  4Y5R A;  3CD6 P;  2C9X B;  3K5B A;  1GK6 A;  1SQV G;  4TT3 H;  5APQ A;  1CI6 A;  2E75 C;  5AW8 B;  3CX5 H;  2JEE A;  5AVU B;  3SJL A;  3CWB D;  1FAV A;  2N18 B;  2C0W A;  1HJ4 A;  3HE5 B;  3TYI A;  5CIG B;  1HBW A;  1OMI A;  2RKL A;  1FE6 A;  3H1L J;  4I7Z C;  2R5D A;  3NWV A;  1FJ0 A;  3PJS K;  1B7V A;  2B0Z B;  1NTZ K;  2YXR B;  3LW5 H;  3D70 A;  1SS1 A;  3HTK A;  1OVR A;  3CWB G;  1DEB A;  1CCH A;  1N7S A;  3TNU A;  4W7Y A;  1Y8A A;  1PGQ A;  3KZI E;  2B87 B;  3AEF C;  1VPC A;  351C A;  3EQ2 A;  1IFP A;  1U74 B;  4D6T E;  3B5N B;  2P67 A;  2XV5 A;  1YIQ A;  2CK3 H;  1GZL A;  1OXZ A;  2E43 A;  4FAN A;  1S4X A;  4NPE A;  1XTC C;  2E74 C;  4W7Z A;  1CCR A;  1CYJ A;  2O3J A;  3L71 D;  4DCK A;  1F1F A;  4K3A A;  2YQB A;  3NBS A;  1E79 H;  3CCQ P;  2Q3I A;  1AV1 A;  3RK2 D;  1VQN P;  3V4Q A;  1BCC E;  1I54 A;  2FXO A;  3RN0 A;  3HRN A;  3P8C D;  2CA3 B;  2E75 B;  4AUW A;  2KS1 A;  2KLV A;  3L71 G;  2FY8 A;  2YKP A;  1DIQ C;  4ZMD A;  1NTM E;  1X0T A;  1IFJ A;  3A0B H;  3C2C A;  4I7Z B;  4WQC A;  1KV4 A;  1KFM A;  3H1H D;  2B4Z A;  3MTU E;  3PH0 A;  2FYU E;  1FI3 A;  1VQL P;  2K1A A;  3KYQ A;  4ZKU A;  1GD2 E;  2OAR A;  2JP3 A;  3JCU H;  2B12 B;  2HG5 D;  2Z5H A;  1E29 A;  3C9I A;  4H0J A;  5C9M A;  1MFZ A;  155C A;  2IPP A;  3AE2 C;  1CYC A;  4AAM A;  1U7J A;  4N78 E;  1FZE A;  1FZC C;  5AW6 B;  2Z5I A;  1RHZ B;  3M9Q A;  2BCC J;  2XU6 A;  3H1H G;  1LT9 A;  4EIE A;  5APS A;  1IZN B;  2E74 B;  3HUS C;  1KZU B;  1EZV I;  4JCG A;  1NU1 G;  3HE4 B;  5GTH H;  1FU1 A;  1LJ2 A;  2HPC A;  3BCC J;  1VQP P;  2OTL P;  2AIU A;  3ABV C;  2V07 A;  2M8R A;  1FJK A;  4H13 B;  1OCD A;  1H33 A;  3ZOW A;  3DR0 A;  2GB8 B;  3KPE A;  4MN4 C;  1AFO A;  1CHH A;  3O6Q A;  5KAI H;  3RBX A;  4RJT A;  1OFC X;  1PPJ D;  3L73 J;  4UB8 H;  2WPQ A;  3I56 P;  2R32 A;  2IBZ D;  1HJ3 A;  1SQV J;  3V2N A;  4GOD A;  3WUI A;  2QSI A;  1A02 J;  1L0L J;  2VHD A;  3L35 A;  1G2C B;  1RQV A;  2YMY A;  1TU3 F;  1R5S A;  3JBT B;  2W90 A;  2FWL A;  3H1I E;  2VRS A;  1CZQ A;  1PPJ G;  2C1D B;  1SQX E;  3CU4 A;  3CXH W;  1IFM A;  2WSS H;  2IBZ G;  3H1J E;  4LJI A;  1DT1 A;  2PAJ A;  4YXD C;  5AW5 B;  3RK2 C;  1HRO A;  1KV9 A;  1FZC B;  2L4D A;  1E2R A;  3CCE P;  2OGU A;  4FA4 A;  3O0R C;  4UB6 E;  1SQP J;  3HUS B;  1IRV A;  1J1E C;  4U3F J;  1OW8 A;  3H32 B;  4OVN F;  3L72 D;  2OTK E;  2A45 H;  3A2A A;  4ASW A;  1PZQ A;  2ZT9 D;  3NTN A;  1L4A C;  1DH3 A;  1H88 A;  4H0L C;  4NFG B;  3P32 A;  2O01 N;  1KYO E;  1FJP A;  4FB1 A;  1S5L H;  3CXH H;  1JY2 O;  3CC4 P;  2OYH C;  1CRH A;  4L73 A;  3CLQ A;  2LXB A;  3L72 G;  1RE3 A;  1Q81 Q;  1L0N J;  5AW3 B;  4JYC A;  2HOD B;  3RK3 D;  3CCS P;  5KLV E;  3MHV A;  1U7M A;  1VQ4 P;  2KB7 P;  1UIX A;  3FXE A;  2WPR A;  1Y9B A;  1RY3 A;  4IL6 V;  1LC1 A;  2QRX A;  2K88 A;  2QM7 A;  3MD0 A;  2YNY A;  5AW4 B;  3RK2 B;  1HH0 A;  3L75 D;  3MUD A;  1LGH B;  4PD4 H;  1YQ4 C;  3HQ8 A;  3T97 A;  4WY4 D;  3GF3 A;  2OZ1 B;  2N1T D;  2Q6Q A;  1J1E B;  3TGU E;  2FRC A;  1YNR A;  2Q5U A;  1H89 A;  1ZRT D;  3L75 G;  1L4A B;  3L70 E;  4GT1 A;  3WFB C;  3VP8 A;  1M6Z A;  4H0L B;  2C9L Y;  4D6T J;  3CCV P;  1JUN A;  3RL0 D;  1N50 A;  1NU1 J;  1CO6 A;  3BRT B;  4L76 A;  3SLE A;  2NPS A;  1P84 H;  2OYH B;  4OGQ D;  1CIG A;  1LWU A;  1QX8 A;  2WT7 A;  1N8R Q;  1CSV A;  2UWJ E;  5CJ0 A;  1W5C E;  2B9B A;  4I1L A;  4A7P A;  2JDI H;  1JY2 P;  3M0D A;  1QGK B;  1T3J A;  1N90 A;  1BCC J;  3O1Y A;  2IZ1 A;  3MIW A;  2L91 A;  1RZ5 A;  1H31 B;  3AEB C;  3SSU A;  4TLF A;  2YXQ B;  5AVZ B;  4XXL A;  5KLI C;  3CX5 E;  1ZP0 C;  1EXJ A;  1VL2 A;  1C75 A;  3VNW A;  1FBM A;  1NTM J;  2A06 D;  2BH4 X;  1YJN P;  4EDF A;  2GIW A;  1KC8 Q;  3RGU A;  2I8F A;  1NTK K;  3ITK A;  1LTB C;  3L74 E;  2Y0E A;  2FYU J;  5KJ7 D;  1JY3 O;  1XTG B;  1A8C A;  1FS0 E;  3A0B V;  2JKV A;  2B89 A;  3RK3 C;  3PXW A;  3VOP A;  1M1K Q;  2A06 G;  1SQQ D;  2R3S A;  4FAV A;  1I5T A;  3NFQ A;  2YK3 A;  3PHL A;  2GM4 A;  2FXM A;  2BCC E;  1Y47 A;  2H88 C;  5C0Z A;  4AAN A;  4C46 A;  3TYY A;  4RKU J;  3DMI A;  1JOC A;  2XTS B;  1BSN A;  1LTT C;  3V2Q A;  5CCH A;  1DD4 A;  2W6J H;  1SQQ G;  5B5E V;  1G1J A;  2W6B A;  4WQ7 A;  1CXC A;  2ZYA A;  2N1T C;  4LLH A;  1EXI A;  3R4Y A;  3Q2Y A;  1QL1 A;  1PP9 D;  1J3S A;  1FOC A;  4PWA A;  1KYO I;  1GL2 A;  5GTH V;  2IYO A;  1NML A;  3VRD A;  5KLI B;  1WMK A;  1F1C A;  1PGO A;  1SQV E;  4GKG A;  1RE4 C;  3O20 A;  1FZF A;  1KIL E;  2PP6 A;  3CCU P;  2E42 A;  4WQ9 A;  1KB9 H;  3II6 A;  2QG4 A;  5KAI V;  2G8Y A;  4UB8 V;  4IFM A;  4OGQ C;  1PP9 G;  3D6Z A;  1WRG A;  2KSE A;  2N9Y B;  2ZOO A;  2P7J A;  3H1I J;  1SQX J;  2C1V A;  1M1J C;  2RH0 A;  2AXT H;  3H1J J;  3RK3 B;  1W2L A;  2K37 A;  1JY3 P;  4JYB A;  2POH A;  3CWB E;  1DII C;  1HTL C;  4QAO A;  5AW2 B;  1K8A Q;  3F5H A;  5B5E E;  3G9R A;  2ZXY A;  1NNO A;  3HE4 A;  5AVT B;  5BU5 A;  2D0W A;  3OA8 B;  1YIC A;  2GA1 A;  3MZW B;  1ZV8 A;  3GF7 A;  3KXD A;  3M9B A;  2HYN A;  1C2R A;  1M70 A;  5H2F V;  2M5A B;  2N1T B;  1VQ7 P;  3FX0 A;  5GTI E;  4O1Q A;  2YCC A;  5KJ7 C;  1BDD A;  2AXC A;  3FXD A;  2IYP A;  3S9O A;  4OWF A;  2LIT A;  2ZYG A;  5KAI E;  1CW5 A;  2ZXX A;  2MJZ A;  2FXP A;  4BRY A;  5KLV J;  1HGV A;  1Q82 Q;  3L71 E;  2Q3E A;  4OGQ B;  1R5L A;  3MGN A;  1I8O A;  1NTZ G;  3D6Y A;  1AA0 A;  1M1J B;  5AW7 B;  1DVV A;  2CPB A;  3NBT A;  2QJY C;  5CMZ A;  1FDM A;  1HVV A;  2KIK A;  1L9B C;  1M60 A;  3P8C E;  5CJ4 A;  2DGE A;  3CX5 I;  1GU5 A;  4PJ0 E;  2OTJ P;  1MKM A;  2YO2 A;  3HUS A;  3G3Z A;  5H2F E;  3TGU J;  4EOT A;  1IJD B;  1Z56 A;  2YMK A;  1IO4 A;  2Q1K A;  4U7J A;  2JJL A;  1BL9 A;  1JTH B;  3H1H E;  3AEC C;  3KHU A;  2W27 A;  3MK7 C;  1K3G A;  1CRY A;  3L70 J;  1Q2N A;  2K3R A;  2I8D A;  3L4M A;  4GED B;  1N7S D;  2D2C D;  1IRW A;  1NU1 E;  2ZFC A;  2Q9I A;  3H1K D;  5AVV B;  2N9B A;  2QA4 P;  1GQ1 A;  1AVY A;  1HCM A;  3ZDM A;  2K9J B;  3E1R A;  2HOD A;  451C A;  2YIU C;  1CIE A;  4N6J A;  1JM0 A;  1EDL A;  2BCN B;  1ZLL A;  3AE3 C;  1VQ8 P;  3AE4 C;  1CSB A;  3EWK A;  3A3Y B;  5CYT R;  2PRR A;  3CMA P;  1LP1 A;  3H1K G;  3TK1 A;  5APU A;  2FYZ A;  4GOE A;  1WEJ F;  3A0H H;  3EFG A;  5KKZ C;  1OIP A;  3M06 A;  1A56 A;  2QJY B;  2JO1 A;  2B88 A;  4V2K A;  3GMA A;  1SQP K;  3VN0 A;  1NWQ A;  5B66 H;  1M8O B;  1J1D C;  1PPJ E;  1H0T B;  2IBZ E;  2ZAE B;  5DJU B;  1JO5 A;  1I8P A;  4WQB A;  3L74 J;  1KIL C;  4GYD A;  2Y9Z A;  3G4S P;  3LW5 J;  3A9F A;  1LTJ C;  1W2E A;  3O8Z A;  3MK7 B;  5KAF H;  3BRV B;  3WU2 H;  4H44 D;  1YI2 P;  4AYC A;  5E79 H;  4GOF A;  4FA1 A;  1L0N K;  1J2J B;  3CXH D;  2CE1 A;  4XYD B;  3OJA B;  1IO3 A;  1N2D C;  1OW6 A;  3OCD B;  3S4R A;  1CXA A;  2RMZ A;  4IFF A;  2A45 G;  2Y9Y A;  2YIU B;  3A5T A;  1LS9 A;  1IC2 A;  1C6R A;  1RZ6 A;  2KZI A;  3CME P;  2H8P D;  3L72 E;  1CTJ A;  1ZR2 A;  1GW4 A;  1U57 A;  1ZZH A;  2AEM A;  1SFC A;  5DFS A;  5KKZ B;  1T6A A;  3HD7 A;  1KIB A;  2OYI C;  3ZBM A;  2QE7 H;  2WWW A;  1GW3 A;  1NAF A;  5AVS B;  4PD4 D;  2P1J A;  1DVH A;  2KNC B;  1N7S C;  2SPZ A;  1J1D B;  1JEK A;  1NTZ J;  2D2C C;  1T3U A;  2GUS A;  3TSI A;  3ORV A;  1HRC A;  1MUU A;  2KXP B;  3SWF A;  1KIL B;  1OVV A;  2W83 C;  4IL6 X;  3RK3 E;  3GG2 A;  1CRJ A;  2XNX A;  2B10 B;  1LTJ B;  4Y99 C;  1FOS F;  2ZYD A;  3AE7 C;  4DY9 A;  1AOF A;  1GDV A;  2LKM A;  4KHX A;  3CWB J;  1GMJ A;  1P84 D;  5APW A;  2KSJ A;  3AEE C;  3L75 E;  2AXT V;  1I55 A;  2HFE D;  2B11 B;  1H9X A;  5DJQ C;  1DW3 A;  1CI6 B;  4L1Q A;  4R4L A;  1KOR A;  3USS A;  1EQ7 A;  1BGY D;  1GK4 A;  1AQT A;  2E5T A;  2IDB A;  1SP4 A;  2FBW C;  3H6P A;  2WQY C;  4ZKP A;  3G6E P;  1ZRT E;  1CIH A;  1NTM K;  4HB1 A;  3CCR P;  2EXV A;  1M90 Q;  2NZ2 A;  2OYI B;  1ZN5 A;  3KZI H;  3WC8 A;  3GHG C;  4H44 C;  3TNU B;  1N7S B;  2D2C B;  1BGY G;  4JQ0 D;  2C2C A;  3AE5 C;  2M3E A;  2P58 A;  2DVH A;  2AEJ A;  2C0X A;  1WT6 A;  3L71 J;  1W5C T;  1NYH A;  1YQ3 C;  3Q5S A;  2J58 A;  1N7L A;  2XZR A;  1YEB A;  3WFD C;  3U1A A;  4Y99 B;  2ZXE B;  3C1L A;  4XFJ A;  3S1K A;  2JWD A;  2KLU A;  1CSU A;  1K05 A;  2NRG A;  1VQM P;  1IK7 A;  3FWN A;  1BE3 D;  3NMD A;  4H0K A;  1KB0 A;  1OWA A;  2A06 E;  2IBZ I;  4YXW H;  1QN2 A;  3PH2 B;  5DJQ B;  2W6A A;  1FCD C;  3BAS A;  2HR3 A;  2Y0D A;  5CCG A;  3ZIY A;  4FA9 A;  3H1H J;  1URQ A;  1LFM A;  1ZW0 A;  1H8A A;  1NAY A;  1BE3 G;  1H32 A;  3FGA D;  3SWK A;  4JF7 A;  2FFD A;  2N3B A;  5EXQ A;  2O01 J;  3VMY A;  3Q3D A;  1FZG A;  1NTK D;  3C8V A;  1NKZ B;  1SQQ E;  4XA4 A;  2RN0 A;  2AEF A;  2XND H;  1YTZ T;  3MP7 B;  2GC7 D;  1Q90 D;  3VTP C;  3GHG B;  5CBN A;  3IF4 A;  4H44 B;  1DW0 A;  1KB9 D;  1P84 I;  2ZVN B;  2R44 A;  2NPS D;  4XE5 B;  1LMS A;  1SQB D;  2YO3 A;  5L8R J;  1SQX K;  1YHQ P;  4IL6 E;  1EB7 A;  3RL0 g;  4EYY Q;  1N15 A;  1RF0 C;  1EC5 A;  1FZA A;  1NTK G;  1M1J A;  3V6I A;  3CC7 P;  1X22 A;  3L37 A;  1CRC A;  1QEX A;  2WSC J;  3W68 A;  3HE5 A;  5C39 A;  2ZT9 C;  1X9V A;  1R8E A;  1PP9 E;  1AQ5 A;  1SQB G;  1QKS A;  4ZNC A;  3A0H V;  3RMZ A;  5AW0 B;  3JC2 2;  1QL3 A;  3CPW O;  1JMM A;  1E5W A;  1IFI A;  1GIW A;  1NMI A;  2B87 A;  3H1L D;  3O6Q B;  1MZ4 A;  1SQB K;  2WSE J;  3B5N A;  1RE3 C;  2E76 D;  4JPZ B;  2JR8 A;  2KK7 A;  3L4O A;  1IZL 0;  1KYO W;  1AVO A;  5CIB B;  3U1C A;  2BLF B;  2K9J A;  5KLV K;  5KAF V;  4KMG A;  3WU2 V;  2Y0C A;  1ZR4 A;  5TJH A;  2I1J A;  1KX2 A;  4LGD E;  4WQE A;  3G71 P;  1Q86 Q;  1KFN A;  3L72 J;  1IK9 A;  3TDK A;  3CC2 P;  4WY4 C;  3MUD C;  1YIT P;  4UB6 H;  5CCH D;  4PV1 D;  3IFM A;  5AUR A;  3LID A;  2ZT9 B;  2E75 D;  3A0H E;  1FOS E;  3UIA A;  2HV4 A;  2C9N Y;  1GL2 D;  1KYO H;  3BAT A;  2IZ0 A;  1NTZ E;  3AEG C;  1T2K D;  3R2P A;  1AOQ A;  1OAE A;  3RL0 C;  3PRJ A;  1I6E A;  3A0B E;  2KOG A;  1JMB A;  3B71 A;  5KTB A;  5AVQ B;  1NVO A;  1VQ6 P;  2J59 M;  4DZO A;  3M0A A;  1KQG B;  3RN1 A;  1LC2 A;  3OA7 A;  3ZOY A;  5CHX A;  1LWU C;  5APY A;  3JCU E;  3OCD A;  2M3B A;  1FI9 A;  4O9B A;  2WZ7 A;  1OVU A;  2R3C A;  3M0D C;  3L75 J;  3GW6 A;  4RO0 A;  4Z1M H;  4WWI A;  2H89 C;  5AVX B;  2E74 D;  3AED C;  5GTH E;  2N3Y A;  4WVZ A;  4WY4 B;  1GU2 A;  5APV A;  3CCJ P;  3ZOO A;  5TIS H;  4WBA A;  3PXT A;  4WQD A;  4K3I A;  2PCC B;  1IFD A;  3T97 B;  4H13 D;  3BCC D;  5AVR B;  5CID B;  5BU8 B;  1S9K D;  2V7Q J;  3VMZ A;  2ITA A;  1S6V B;  3V2R A;  3CX5 W;  3H1K E;  4HYT B;  1YIJ P;  4UB8 E;  2E76 C;  1KMI Z;  1G1I A;  2PCB B;  1S5L V;  5AVW B;  1CRG A;  1G2C A;  5APX A;  2PAC A;  3RL0 B;  3CP5 A;  1KIL A;  2J5U A;  3L73 D;  1N73 C;  1ETP A;  5CIH B;  2ORL A;  3KZI V;  1LTJ A;  1SQV D;  3P7K A;  2C1D A;  2BEZ F;  1OW7 A;  3BCC G;  1DIP A;  1L0L D;  2CXB A;  1FC2 C;  1HF9 A;  1LWU B;  4EIJ A;  3IR9 A;  2K9Y A;  1FZC A;  2WT7 B;  2GUV A;  4YE1 A;  2P2U A;  3L73 G;  5CCH C;  1C52 A;  4PV1 C;  4C7N B;  1DX7 A;  5EFW B;  2KI7 B;  1CC5 A;  5DF5 A;  3H32 A;  2WSF J;  2GC4 D;  1L0L G;  1C7M A;  1IFN A;  2O1K A;  2QVA A;  1PGJ A;  1GL2 C;  2LIR A;  3VMA A;  4PW9 B;  2FKW B;  1T2K C;  4KT0 J;  1NIR A;  1GU4 A;  1CSW A;  1AJY A;  1JDL A;  1EZV D;  1SQP D;  4U3F D;  1MG2 D;  4BXL A;  1SQV K;  4YPC A;  2OYI A;  1KX7 A;  3SXT A;  2PFX A;  1R0Q A;  1S5L E;  1SQQ J;  3AE1 C;  1L0L K;  1YTZ I;  1DD3 A;  1PV3 A;  3CXH E;  1DEE G;  1JCC A;  2E76 B;  4L74 A;  3QH9 A;  4O1W A;  4IOI H;  1K9M Q;  3CCL P;  1EZV G;  1SQP G;  3HQ6 A;  4U3F G;  1N73 B;  2I1K A;  2E5Y A;  1NGM B;  1L0N D;  2N9I A;  1CED A;  5M1B A;  1VYD A;  1CRI A;  1PP9 J;  5AW9 B;  3OW2 O;  1DW2 A;  3HQ9 A;  3Q5R A;  2OZ1 A;  4PV1 B;  1OX3 A;  3WUV A;  1L0N G;  1RAP A;  1YCC A;  4PD4 E;  1KQF B;  4H13 C;  2QJK C;  3O5C A;  2JWA A;  3VMX A;  1RF1 C;  1CTY A;  1GL2 B;  1CSX A;  2G3A A;  1L4A A;  4R4M A;  2R5B A;  3V4W A;  2V08 A;  5CIC B;  4M3L A;  4LC1 A;  3SFE C;  1A2S A;  3RLM A;  4AQR D;  3WUU A;  1L4A D;  1L2P A;  3E7K A;  2DW3 A;  4H0L D;  4WQ8 A;  1HGZ A;  2OYH A;  5K5G B;  3GHG A;  4KJM A;  1HJB A;  1CTZ A;  1EDJ A;  1QYZ A;  4D6T D;  1P84 E;  1MZ9 A;  1NU1 D;  1HH7 A;  1HJ0 A;  3P8M C;  3B8E B;  4EIF A;  1LTA C;  1EDK A;  1E8E A;  1HZU A;  1QLE D;  5B5E H;  1H31 A;  1BGY E;  4D6T G;  4QMA A;  2KYV A;  1HJ5 A;  1BCC D;  3WUT A;  1LNQ A;  1IQC A;  1SFC D;  3HD7 D;  4UB6 V;  1H9Y A;  2C8S A;  1M7L A;  1VQ9 P;  1N86 A;  5GTI H;  2XDJ A;  2O1J A;  3KQG A;  1C2N A;  2ZJS E;  2QJK B;  2QIW A;  2ZON G;  1NTM D;  1YFC A;  1RF1 B;  1ZXG A;  1AKK A;  3OAK A;  5B6Q A;  1GJQ A;  1SVF A;  1NU1 K;  1SLQ A;  1DW1 A;  3AE6 C;  2M0B A;  1BCC G;  1NH4 A;  2LR2 A;  1GDT A;  4RSZ A;  2FYU D;  3ZOX A;  1OZH A;  4BRY B;  3L4F A;  3A7O A;  1VF5 D;  2CE0 A;  1BE3 E;  1NTM G;  1QVF O;  4HJG H;  3B4S A;  3FWL A;  1USD A;  1YTC A;  4N78 D;  2XKM A;  1PL5 A;  1L9J C;  4PJ0 H;  3AE8 C;  4EIC A;  2Z4E A;  2BPB B;  3CCM P;  1RF0 A;  1QL4 A;  2FYU G;  3Q1M A;  1A02 F;  2ZBO A;  4DT0 A;  2WPV B;  1M56 D;  5APT A;  2A45 I;  1GTW A;  5H2F H;  1K73 Q;  2QM8 A;  4P4Q B;  1YYC A;  1COR A;  2WPS A;  2ZVO B;  3CYT I;  1COT A;  1D7M A;  2BAS A;  4GIF A;  5CBO A;  1NTK E;  2FYU K;  2YKQ A;  1FHB A;  3H1K J;  3CXH I;  2WVR A;  3HTK B;  3M9H A;  2O01 H;  5TIS V;  1KD1 Q;  1LTG C;  1LT1 A;  3EFF K;  4RES B;  1KB9 E;  3ZCF A;  1RH5 B;  4L3G A;  1SQB E;  3TF5 A;  2PGD A;  4L75 A;  3IAO A;  3JSV C;  1ZME C;  5IY5 1;  2WIT A;  3DP5 A;  3H25 A;  1PGP A;  4NPF X;  1LT9 C;  2C1U A;  1K3H A;  1YEA A;  2ZZS 1;  1PIX A;  2FYN C;  3HQ7 A;  2AXT E;  3H1I D;  2H43 A;  1SQX D;  2QEX P;  2IFM A;  3H1J D;  2KP8 A;  2WSC H;  4N0K A;  3OA8 A;  1S2E A;  3V5B A;  1LP1 B;  1S72 P;  4PD4 I;  4AX3 A;  1SFC C;  2M5A A;  3HD7 C;  4AAO A;  2KS1 B;  4WY4 A;  1HWT C;  3M91 A;  4K35 A;  2N1T A;  1CYI A;  3Q5P A;  1MG3 D;  3H1I G;  1YJW P;  4EID A;  1MV8 A;  3H1L E;  5CCG D;  3SWY A;  1SQX G;  2YKO A;  1URQ D;  3H1J G;  1WVE C;  1NO4 A;  2H7H A;  5TIS E;  4B86 A;  1KQL A;  2P10 A;  3L36 A;  5AW1 B;  1RE4 A;  2WSE H;  1KYO D;  1PFI A;  3D0W A;  3BVH A;  3GLM A;  2KZJ A;  2WMM A;  2L5G B;  2LXC B;  1VF5 C;  4C7R A;  2CA4 B;  3IN6 A;  3E1I A;  1JNM A;  2WTY A;  1YBK A;  2MHM A;  2CPS A;  5CIE B;  1LT9 B;  5KLV D;  3VYI A;  3KDP B;  1C6S A;  3W67 A;  2FYN B;  1USE A;  4GDO A;  1VQ5 P;  4C7N A;  2W8Z A;  4I2L C;  4OH8 B;  2IFN A;  1CHJ A;  4EI2 A;  1Q7Y Q;  3V2P A;  2N9J A;  1T8Z A;  1CIF A;  2HPC B;  4HKZ H;  1UII A;  1LTI C;  1W2B O;  1JTH A;  5B66 V;  1SFC B;  5KLV G;  1H33 B;  3HD7 B;  1YJ9 P;  1MFT A;  1C6O A;  4N3Y B;  5KJ7 A;  1RQU A;  3TGU D;  1AYG A;  1CNO A;  3PXS A;  5AVY B;  3B5N D;  1JY2 N;  3L70 D;  3SWS A;  1JCD A;  3SVW A;  1FDO A;  3VYM A;  3H1L G;  5E79 V;  1N73 A;  4Q5P A;  1FZB A;  2D0S A;  2QJP C;  3TGU G;  1VF5 B;  3M97 X;  1S3J A;  3WFE C;  3RBZ A;  1BGY J;  1QVG O;  3L70 G;  4ASV A;  4AAL A;  1CHI A;  4BWN A;  3SFD C;  4FA5 A;  3WFC C;  4W80 A;  3VP9 A;  4NPD A;  1NHL A;  1NJI Q;  1H0T A;  1X8Y A;  4IFD K;  1S5L X;  1VQO P;  1HUC A;  3BCC E;  5CCG C;  1I6D A;  1KTM A;  1S9K E;  5B66 E;  1URQ C;  3N4X A;  3CX5 D;  3NXS A;  1NKN A;  4I6M C;  2FFD C;  2V7Q H;  3U59 A;  4CPG A;  1X79 B;  1KB9 I;  3WMM 0;  3L73 E;  1H1O A;  4DOJ A;  5GTI V;  3X39 A;  1SQQ K;  2NPS C;  3L74 D;  1FDI A;  1L0L E;  5KAF E;  2Q7C A;  1S1C X;  3WU2 E;  5BVZ A;  5E79 E;  1BDC A;  5CIF B;  2MTA C;  1BE3 J;  3F89 A;  1HZV A;  2JTI B;  1GKS A;  2IX7 C;  4YTP C;  3PP5 A;  1N9C A;  1KQS O;  1M57 D;  4MU8 A;  1EDI A;  2N18 C;  2BCC D;  3L74 G;  2QJP B;  3D71 A;  2OQQ A;  2KUB A;  1K04 A;  2WSF H;  2OYO A;  3QWO C;  3AE9 C;  4J20 A;  4PJ0 V;  2BH5 X;  1EZV E;  1SQP E;  1NOH A;  4U3F E;  1FI7 A;  1VDF A;  2AI5 A;  4DJG A;  3AEA C;  3N7N A;  2KNC A;  1QL2 A;  1NTK J;  2BCC G;  3CL3 D;  1U75 B;  2V4H A;  3CI9 A;  3PLN A;  3PTZ A;  2BEQ D;  4WQA A;  1ZOY C;  1URQ B;  4HH2 A;  4JBZ A;  1VQK P;  3LIE A;  2HLO A;  3B5N C;  1RF1 A;  1H32 B;  1RAQ A;  2FFD B;  3I55 P;  2JQR A;  1JY3 N;  1SQB J;  1KIL D;  1NTZ D;  2MKV A;  5DJT B;  1L0N E;  2NPS B;  2BGV X;  4IL6 H;  4WB4 A;  4Y28 J;  1BSH A;  1KN7 A;  1JB0 J; 
#chains in the Genus database with same CATH homology
 4L3H A;  1CSU A;  5C0Z A;  4AAN A;  4Y5R A;  4EIF A;  2C9X B;  3DMI A;  2XTS B;  1E8E A;  1BE3 D;  1HZU A;  1H31 A;  3SJL A;  3CWB D;  4H0K A;  1KB0 A;  5B5E V;  2N18 B;  1HJ4 A;  4WQ7 A;  1HJ5 A;  1CXC A;  3TYI A;  5CIG B;  1BCC D;  1QN2 A;  3PH2 B;  1IQC A;  1PP9 D;  5DJQ B;  1J3S A;  1FCD C;  1FOC A;  4PWA A;  2Y0D A;  4UB6 V;  1H9Y A;  2C8S A;  5GTH V;  3ZIY A;  4FA9 A;  1NML A;  3VRD A;  3NWV A;  1FJ0 A;  1LFM A;  5KLI B;  1B7V A;  2B0Z B;  1F1C A;  1H32 A;  1C2N A;  2QJK B;  2N3B A;  1CCH A;  2ZON G;  3O20 A;  1NTM D;  5EXQ A;  1YFC A;  1AKK A;  5B6Q A;  4WQ9 A;  1NTK D;  1GJQ A;  1DW1 A;  351C A;  2QG4 A;  5KAI V;  2RN0 A;  1U74 B;  4UB8 V;  2GC7 D;  4RSZ A;  2FYU D;  1YIQ A;  3ZOX A;  4FAN A;  2N9Y B;  2ZOO A;  1DW0 A;  1KB9 D;  1LMS A;  1SQB D;  2C1V A;  2CE0 A;  1EB7 A;  1W2L A;  1N15 A;  1CCR A;  3FWL A;  1CYJ A;  2O3J A;  3L71 D;  1F1F A;  2YQB A;  1YTC A;  3NBS A;  1CRC A;  1L9J C;  1DII C;  4EIC A;  4QAO A;  2BPB B;  1QL4 A;  1I54 A;  2ZXY A;  1NNO A;  3RN0 A;  2ZBO A;  2D0W A;  3OA8 B;  1YIC A;  2CA3 B;  2KS1 A;  4P4Q B;  1COR A;  1QKS A;  1C2R A;  1M70 A;  3A0H V;  5H2F V;  3RMZ A;  1QL3 A;  1DIQ C;  1GIW A;  3CYT I;  1COT A;  4O1Q A;  2YCC A;  1NMI A;  1FHB A;  3C2C A;  4WQC A;  3H1L D;  5TIS V;  1MZ4 A;  3H1H D;  2B4Z A;  2LIT A;  1FI3 A;  3L4O A;  3ZCF A;  4L3G A;  3TF5 A;  1IZL 0;  1KYO W;  5IY5 1;  5CIB B;  3DP5 A;  2B12 B;  1E29 A;  2BLF B;  2C1U A;  4H0J A;  2Q3E A;  1K3H A;  5KAF V;  1YEA A;  4KMG A;  5C9M A;  155C A;  2ZZS 1;  1CYC A;  4AAM A;  3WU2 V;  2Y0C A;  5TJH A;  3HQ7 A;  1I8O A;  1KX2 A;  3H1I D;  4WQE A;  1SQX D;  1DVV A;  3NBT A;  4EIE A;  3H1J D;  1L9B C;  1M60 A;  4N0K A;  3TDK A;  2DGE A;  3OA8 A;  4JCG A;  4AX3 A;  5AUR A;  4AAO A;  2AIU A;  1CYI A;  1MG3 D;  2V07 A;  2HV4 A;  1OCD A;  4EID A;  1H33 A;  3ZOW A;  3DR0 A;  2GB8 B;  1CHH A;  1BL9 A;  4RJT A;  1AOQ A;  1OAE A;  1PPJ D;  1WVE C;  3KHU A;  3PRJ A;  1I6E A;  3MK7 C;  1K3G A;  1CRY A;  2IBZ D;  1HJ3 A;  3WUI A;  3L4M A;  4GED B;  1IRW A;  1KYO D;  3H1K D;  2VHD A;  1GQ1 A;  3RN1 A;  1LC2 A;  3ZOY A;  1HCM A;  3JBT B;  2CA4 B;  2K9J B;  2FWL A;  451C A;  3OCD A;  1CIE A;  1FI9 A;  2C1D B;  3CU4 A;  2BCN B;  3CXH W;  2MHM A;  4LJI A;  5CIE B;  1DT1 A;  5KLV D;  3GW6 A;  5CYT R;  1C6S A;  1HRO A;  1KV9 A;  2FYN B;  2L4D A;  1E2R A;  1WEJ F;  1CHJ A;  1A56 A;  2QJY B;  2N9J A;  4FA4 A;  3O0R C;  2N3Y A;  1CIF A;  1IRV A;  4V2K A;  1GU2 A;  3L72 D;  3ZOO A;  5B66 V;  1H33 B;  3PXT A;  4WQD A;  4K3I A;  2PCC B;  1I8P A;  3BCC D;  1C6O A;  5CID B;  4WQB A;  4NFG B;  4GYD A;  1S6V B;  3CX5 W;  4FB1 A;  3TGU D;  1AYG A;  3A9F A;  1CNO A;  2PCB B;  1S5L V;  1CRG A;  2PAC A;  3PXS A;  3CP5 A;  3MK7 B;  1CRH A;  3L73 D;  1ETP A;  3L70 D;  3SWS A;  5CIH B;  2ORL A;  3KZI V;  1SQV D;  4FA1 A;  3SVW A;  2C1D A;  3CXH D;  2CE1 A;  4XYD B;  3VYM A;  1IO3 A;  5E79 V;  1L0L D;  3OCD B;  4Q5P A;  1CXA A;  2RMZ A;  2D0S A;  2CXB A;  3M97 X;  2YIU B;  4IL6 V;  4YE1 A;  1LC1 A;  1LS9 A;  1C6R A;  3WFE C;  1RZ6 A;  1C52 A;  4AAL A;  1CC5 A;  1CTJ A;  5DF5 A;  1CHI A;  3L75 D;  4FA5 A;  3WFC C;  2GC4 D;  1C7M A;  1ZZH A;  3HQ8 A;  5DFS A;  5KKZ B;  2LIR A;  1KIB A;  1I6D A;  3VMA A;  4PW9 B;  2OZ1 B;  1NIR A;  3ZBM A;  1CSW A;  3CX5 D;  1JDL A;  1EZV D;  1SQP D;  2FRC A;  4PD4 D;  1YNR A;  1MG2 D;  4U3F D;  1DVH A;  2KNC B;  1ZRT D;  1KX7 A;  3SXT A;  1H1O A;  3ORV A;  1R0Q A;  5GTI V;  1HRC A;  3WFB C;  1M6Z A;  3X39 A;  3L74 D;  1N50 A;  3GG2 A;  1CRJ A;  2B10 B;  1CO6 A;  3SLE A;  4O1W A;  4DY9 A;  5CIF B;  2MTA C;  3HQ6 A;  1CIG A;  1AOF A;  1L0N D;  1HZV A;  2JTI B;  1CSV A;  2N9I A;  1GDV A;  1CED A;  1GKS A;  1N9C A;  1P84 D;  4A7P A;  4MU8 A;  2N18 C;  2BCC D;  2QJP B;  2AXT V;  1N90 A;  1VYD A;  1I55 A;  3O1Y A;  2B11 B;  1CRI A;  1H9X A;  5DJQ C;  1DW3 A;  2L91 A;  1RZ5 A;  1DW2 A;  4L1Q A;  1H31 B;  3HQ9 A;  4J20 A;  2OZ1 A;  4XXL A;  1BGY D;  4PJ0 V;  2BH5 X;  1RAP A;  1YCC A;  1FI7 A;  2AI5 A;  1C75 A;  3VNW A;  2A06 D;  2BH4 X;  3O5C A;  4EDF A;  2JWA A;  1CIH A;  1CTY A;  2GIW A;  2I8F A;  1U75 B;  2EXV A;  3PLN A;  3PTZ A;  1CSX A;  3ITK A;  4WQA A;  2V08 A;  5CIC B;  1A2S A;  2Y0E A;  3WC8 A;  3RLM A;  1H32 B;  1RAQ A;  1A8C A;  2JQR A;  3A0B V;  4WQ8 A;  2C2C A;  1NTZ D;  3PXW A;  2DVH A;  1CTZ A;  1SQQ D;  4FAV A;  1I5T A;  1W5C T;  2BGV X;  1QYZ A;  4D6T D;  2YK3 A;  3PHL A;  1YEB A;  3WFD C;  1NU1 D;  1HH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...