1SQPD

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1sqpD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1sqpD02
4RJTA 4UB8V 3NBTA 2GIWA 4FAVA 3SWSA 1MG2D 1DIQC 2FRCA 3RMZA 3L70D 2LIRA 1U74B 1RAQA 3HQ8A 4WQDA 1QL4A 1CXCA 4AAMA 1I5TA 1QN2A 5KAIV 1CTJA 5DJQC 4GYDA 3H1HD 4JCGA 1YEBA 1FI7A 1R0QA 4Y5RA 1CTZA 1NNOA 2ZONG 2PACA 1W5CT 1KIBA 3TGUD 2C1DB 1L0ND 3ZOWA 2Y0EA 1RZ6A 3ZIYA 1C6SA 1CIFA 1HZVA 2B0ZB 1CRYA 1HJ4A 5KLIB 2OZ1B 3CU4A 1CRIA 3WFDC 5DFSA 1N9CA 1I6EA 1W2LA 1LC1A 5TISV 2GB8B 2ZBOA 1LC2A 4D6TD 1KV9A 1H31A 1YFCA 1NMIA 2B4ZA 2N9YB 3ZOYA 3A9FA 3RN1A 1DW3A 1RZ5A 4O1QA 1GQ1A 1HROA 4K3IA 1U75B 1CNOA 3CX5D 2B10B 4AALA 3L75D 2Q3EA 1I8OA 3JBTB 1C7MA 5DF5A 1H9YA 4WQBA 1H33A 3ORVA 1VYDA 4DY9A 2BCCD 2RMZA 1DVHA 1I55A 4N0KA 1YNRA 2QJYB 2PCBB 3M97X 5CIHB 3OCDA 4FB1A 2O3JA 2MTAC 3CX5W 4V2KA 2N18B 3H1KD 1CIHA 5CIGB 1ZZHA 2RN0A 3O20A 1GJQA 1IQCA 1C75A 1C6OA 1A2SA 3WU2V 155CA 2QG4A 1AOFA 1I54A 351CA 2I8FA 3CWBD 2L91A 1EB7A 1N15A 2AIUA 2BGVX 5CIEB 1IO3A 1CSWA 1LMSA 1K3HA 1F1FA 4NFGB 4EIFA 4AAOA 1L9BC 2N3BA 1CSXA 3WC8A 2C9XB 1E29A 1HCMA 2B12B 2ORLA 1CHIA 1CSVA 1C6RA 1BGYD 1H32A 1H9XA 3NWVA 1NTKD 4AANA 2C1VA 1J3SA 1I6DA 1HH7A 1YEAA 5AURA 4WQ7A 2ZXYA 1PPJD 1HJ3A 2PCCB 1CYIA 4PW9B 2Y0CA 3PXSA 4J20A 2N9JA 1DW2A 3A0BV 3TF5A 3KZIV 1C2NA 2BLFB 2D0WA 3H1JD 1KYOD 3ZBMA 1GU2A 1C52A 1M70A 3HQ9A 4AX3A 1S5LV 1YTCA 2ZOOA 2B11B 4O1WA 5EXQA 3C2CA 5KKZB 1AOQA 3KHUA 3DMIA 1QKSA 2JQRA 1CHJA 2D0SA 451CA 3OA8A 1ETPA 1ZRTD 1WEJF 1CCHA 1C2RA 2C2CA 5CIDB 1KYOW 4EDFA 2C1UA 1SQXD 4MU8A 1YICA 1IRWA 4RSZA 4IL6V 1L0LD 1CYCA 5DJQB 4EIDA 3RN0A 4WQCA 4FA1A 5CYTR 1FI3A 3NBSA 3L4OA 2MHMA 3CXHD 3PTZA 1N50A 1JDLA 3L74D 2C1DA 1BCCD 1FCDC 2DGEA 3PH2B 5CIFB 2OZ1A 5E79V 1HJ5A 3PLNA 3DR0A 3PHLA 2Y0DA 1FHBA 4PJ0V 1B7VA 1SQQD 2QJPB 2HV4A 3CYTI 4L1QA 1COTA 3GW6A 2C8SA 4KMGA 3L73D 3DP5A 1A8CA 2JTIB 3CXHW 4WQ8A 4FA5A 4LJIA 3WFBC 3ITKA 3PXWA 1CYJA 4GEDB 1CTYA 1KX2A 2A06D 2V07A 1SQBD 1HZUA 3TDKA 1F1CA 1N90A 3FWLA 3TYIA 5GTHV 1H1OA 2BPBB 4QAOA 3A0HV 4H0JA 1AKKA 1CIEA 1H31B 1L9JC 2VHDA 1CO6A 1GDVA 4L3GA 1DIIC 2EXVA 4EIEA 1NMLA 1OAEA 3PRJA 1M60A 2XTSB 5KAFV 4PD4D 3HQ7A 3WFCC 1RAPA 3O1YA 1S6VB 3L71D 2LITA 4UB6V 1LFMA 1H33B 2CE1A 2YK3A 3X39A 3VMAA 1FI9A 2CE0A 1K3GA 1LS9A 1KX7A 3MK7C 4PWAA 2BH4X 3ZCFA 1IZL0 1I8PA 5TJHA 3SLEA 3SXTA 1NTZD 3OCDB 2BH5X 5B6QA 4XYDB 2CXBA 4WQ9A 3VRDA 3VYMA 1P84D 2N9IA 4FA4A 3PXTA 2N18C 1MG3D 3BCCD 3VNWA 1CRHA 5GTIV 1FJ0A 1CHHA 1KB9D 1NTMD 1PP9D 1CORA 3WFEC 2GC4D 5H2FV 2N3YA 2KS1A 4EICA 4FANA 5B66V 1KB0A 2YIUB 2FYUD 3H1ID 3WUIA 2AI5A 5CIBB 1BL9A 1SQPD 3O5CA 2L4DA 1FOCA 3L72D 1NU1D 4P4QB 1CXAA 1DW0A 3MK7B 2CA3B 4H0KA 1IRVA 2DVHA 2FYNB 1AYGA 2AXTV 1H32B 1A56A 5KLVD 1CRCA 3H1LD 4U3FD 4A7PA 1E8EA 1GKSA 3HQ6A 1HRCA 3O0RC 1QL3A 1CC5A 1WVEC 2K9JB 2CA4B 3CP5A 2IBZD 5B5EV 1CRGA 2JWAA 1YCCA 4WQAA 5C0ZA 2FWLA 2BCNB 4FA9A 3GG2A 1SQVD 1YIQA 4Q5PA 4L3HA 1M6ZA 1DT1A 3ZOXA 1QYZA 3ZOOA 2YCCA 1EZVD 2YQBA 5C9MA 1CCRA 1MZ4A 1CRJA 2V08A 5IY51 3L4MA 1DVVA 4XXLA 1CEDA 2QJKB 1CIGA 3SJLA 5CICB 1OCDA 1CSUA 3RLMA 1DW1A 1E2RA 2KNCB 4YE1A 1BE3D 3OA8B 1GIWA 4WQEA 2ZZS1 3SVWA 2GC7D 1NIRA
chains in the Genus database with same CATH superfamily
4RJTA 4ASWA 1H89A 2GIWA 3HD7A 3E1IA 3SWSA 3CXHE 3CXHH 2KLVA 2C0XA 3L70D 3P7KA 1JCDA 1N7SB 2HPCA 3Q3DA 2ZT9C 2WSFH 1LP1A 3L37A 5AW0B 4AQRD 1U57A 4L74A 4I1LA 1ZR4A 1KILE 3L35A 3GLMA 5AW5B 1T3JA 3BCCJ 3CCVP 2PACA 1W5CT 1KIBA 3BCCG 2O1KA 1C6SA 1CIFA 2B0ZB 1CRYA 2QIWA 3I55P 1DX7A 1CRIA 2N1TB 4PV1D 1JM0A 1HJBA 2FYUJ 5TISV 4JF7A 4KJMA 3BATA 1KV9A 5AVYB 3L72J 2B4ZA 3L72G 3ZOYA 2KB7P 1AQTA 1ZLLA 4YXDC 1GQ1A 1HROA 1KORA 3QH9A 1HGZA 3H1LJ 4N3YB 4U3FJ 2YMYA 4AALA 3H1LG 4U3FG 3JBTB 2ZAEB 4EYYQ 5DF5A 3N7NA 4PD4E 4PD4H 3SFDC 2ZJSE 1NWQA 2NPSD 1PPJE 3CXHI 3IN6A 3L71E 2E75D 2LR2A 2BCCD 4WY4D 3S4RA 4N0KA 2IBZG 3AE1C 1YNRA 2UWJE 3BRVB 2YMKA 1YYCA 2O01H 2PCBB 3M97X 3OCDA 1KYOE 2MTAC 1J2JB 4H13D 4H13C 4HYTB 1K05A 2Z4EA 3D70A 5CIGB 3I5CA 2Q1KA 2HPCB 2K1AA 1YJ9P 3MZWB 3M0DA 2IZ1A 3CMEP 1LTJA 1ZOYC 1A2SA 1QVGO 3VP8A 5KAFE 5KAFH 2VRSA 1AV1A 1QEXA 2L91A 1N15A 5KKZC 2AIUA 2IPPA 3H25A 5CCHD 3C9IA 1KFMA 1NO4A 1NTZK 2NPSB 1CSWA 1LMSA 1K3HA 1IC2A 4AAOA 1FDOA 2W6JH 4MN4C 2E75B 3D6YA 2C9XB 5AVQB 1SQPE 1E29A 2J5UA 1CHIA 1CSVA 3AE6C 4PD4I 2KOGA 4C46A 1H9XA 3M9BA 3VMZA 1BCCE 3GF3A 1I6DA 3U1AA 1EC5A 1HH7A 1YEAA 4H13B 1SQXK 1KYOI 3D0WA 3G3ZA 4PW9B 1FDMA 3MHVA 2WT7B 3M9HA 1W2EA 3A0BV 1C2NA 3FWNA 1T2KD 2D0WA 3H1JD 3ZBMA 1GL2A 1JY2P 5EXQA 3CPWO 3C2CA 5KKZB 3M9QA 2GUVA 2HLOA 1RF0A 3DMIA 2M0BA 2JQRA 2BEZF 1GW3A 451CA 1SQQK 1ZRTD 2AXTE 1WEJF 2AXTH 1YI2P 3AE5C 5KLVJ 5KLVG 1YQ3C 1KYOW 4IFDK 4GOFA 2C1UA 3B5NC 1GMJA 1JOCA 2FXOA 3HE5B 1IRWA 1XTGB 4IL6V 1L0LD 1LTBC 2AEJA 5DJQB 5B5EH 5B5EE 3R2PA 1GZLA 1M1JA 1FI3A 3G9RA 2E5TA 3L4OA 1FU1A 3MD0A 1SQVG 1ZXGA 1T6AA 1JDLA 1EZVG 1SVFA 3OAKA 1M8OB 4K3AA 2E42A 1FOSE 1FZCA 4U7JA 2OZ1A 5E79V 1HJ5A 4H44D 1T3UA 2A45G 3PLNA 1FDIA 1M56D 1L4AC 3CCLP 1T8ZA 2XV5A 1COTA 2K3RA 3MP7B 2JJLA 3FX0A 3HRNA 2N9BA 1M1JC 1PFIA 4FA5A 2KSEA 1URQA 3GHGC 4UB6E 1NHLA 3B5NB 4ZNCA 2FYUE 3TDKA 1VQMP 1AVOA 2YKPA 1H1OA 2BPBB 1NU1E 1AJYA 1GD2E 2AXCA 4I2LC 3V4QA 1CIEA 1JNMA 1L9JC 4NPEA 4L3GA 4EIEA 2GA1A 1NMLA 3D6ZA 1H88A 3T97B 1L0NJ 3PRJA 2XTSB 1L0NG 3WFCC 3KYQA 1BDCA 2LITA 1FI9A 4R4MA 1L4AB 1JB0J 4PWAA 2P1JA 4W7ZA 1Y8AA 5AW9B 4EOTA 3HE4B 2R3SA 3ZCFA 1EDLA 1RE4A 3GHGB 3SXTA 3ZDMA 4BXLA 1HTLC 2ZYAA 2B87A 3QWOC 1KC8Q 3VRDA 4O9BA 5AW6B 1OW8A 1IO4A 1QL1A 4IL6H 3IF4A 1K9MQ 3H32A 5GTIV 1CHHA 2WSEH 4N78E 2QVAA 1KQLA 3A2AA 1NTMD 2QRXA 3RK3D 1USEA 2KS1A 4EICA 4FANA 5B66V 1NAYA 1S4XA 4CPGA 1S3JA 4RESB 3WUIA 1NTKE 4ZKPA 2WSFJ 2L4DA 4W80A 2JO1A 3II6A 4P4QB 2WPSA 1DW0A 2YXQB 4H0KA 3FGAD 2ZVOB 3H1HE 2WPRA 2WPQA 1H32B 1A56A 5KLVD 3B71A 5AVUB 1EDIA 2KI7B 1VQKP 3AE8C 3PH0A 3HTKA 2RKLA 1RH5B 3B8EB 4IOIH 1VQLP 4KT0J 2PFXA 1CRGA 5C0ZA 3Q5RA 2FWLA 4Z1MH 1SQVD 1ZR2A 3ZOOA 2SPZA 1EZVD 2JWDA 3G4SP 1U7JA 1CRJA 1VQ8P 4OH8B 1DVVA 3NTNA 4XXLA 1CEDA 3L75E 4C7RA 3SJLA 1OMIA 2P58A 4TLFA 2H8PD 3L71J 1PPJG 2KNCB 3L71G 1BE3D 1VQ9P 4WQEA 3KZIE 3SVWA 3KZIH 4UB8V 3NBTA 2O01J 1EXJA 1EDKA 2Q3IA 2FRCA 4BRYA 1S5LE 4XE5B 1S9KD 1U74B 4WQDA 1UIIA 2M3EA 1LTSC 5APWA 1VL2A 2D2CC 4GYDA 4JCGA 1FI7A 1ZW0A 2QSIA 1RF1A 2C1DB 1L0ND 3ZOWA 2Y0EA 1IK7A 1HZVA 5KLIB 2QEXP 1OVUA 2W6BA 4LC1A 5DFSA 5CCGC 1BDDA 1PIXA 3TK1A 1LC1A 3KXDA 1JO5A 4D6TD 1VF5D 1LT9C 1SQPJ 1SQPG 1MKMA 2N9YB 3A9FA 2I8DA 3RN1A 2K88A 1BCCJ 1RZ5A 1DIPA 1BCCG 3F5HA 2B10B 1IFDA 4PJ0E 4PJ0H 1Q2NA 5APTA 1H33A 2H89C 1YJNP 2ZVNB 4ZKUA 3PJSK 2D2CB 2RMZA 1DVHA 1LGHB 4IFMA 3CMAP 5CIHB 1N7SD 4OGQC 2M3BA 1M90Q 2YNYA 3CX5W 3JCUE 3JCUH 2N18B 1NTZE 3H1KD 1CIHA 3VN0A 5GTHE 5GTHH 1FZAA 1ZZHA 1SFCA 2WZ7A 1R5LA 1GJQA 4H0LC 1CW5A 1LWUA 1N73A 5KJ7A 1LT9B 4QMAA 1KILC 1VF5B 1C6OA 1JTHB 1YQ4C 2NRGA 3AEAC 1KN7A 3AE7C 3WU2V 1IJDB 2N1TD 155CA 4RKUJ 1KQSO 1AOFA 3CCUP 1KB9E 1KB9H 1SQXE 351CA 2KK7A 2C9NY 1IO3A 1FZGA 1K73Q 1MFTA 4EIFA 1N7LA 1L9BC 3D71A 1DD4A 1BGYD 1LWUC 1PGJA 2OYIA 3O6QB 4AANA 2AEFA 2ZT9D 1KFNA 2YO3A 1Q7YQ 2FBWC 5AURA 1N8RQ 3GF7A 1UIXA 2K9JA 2ZXYA 3Q1MA 1PPJD 1NTMK 1SQQE 1HJ3A 1CYIA 1DH3A 4H0LB 4XFJA 2Q7CA 1KQFB 5APUA 1KILB 3L73E 2OTKE 3HD7C 1H0TB 2IFNA 1KYOD 2FYNC 1G2CA 2M5AB 2OYIC 2PP6A 2B11B 2XNXA 2BASA 2R3CA 2FYUG 1AOQA 3KHUA 5AVZB 1NU1J 3SWFA 1CHJA 1KB9I 1RHZB 1NU1G 4JBZA 2I1KA 1FZEA 1ETPA 2FYZA 1CCHA 1Q81Q 5EFWB 5C39A 4L73A 5CIDB 4WY4A 3R4YA 4C7NB 2ZT9B 1YICA 4HKZH 4RSZA 2V7QH 1CYCA 4EIDA 3IFMA 2QM7A 1OW7A 3B4SA 1JY3N 3HD7B 3L74D 3KQGA 1BCCD 2DGEA 1JMMA 3PH2B 2IZ0A 5CIFB 3PHLA 1FZBA 1LP1B 2POHA 2Z5HA 2OTJP 3CXHW 2YXRB 4WQ8A 4LJIA 3WFBC 3RBXA 3CLQA 5BU8B 2AEMA 1PP9E 3SWYA 1CYJA 4GEDB 1IFNA 1CTYA 1FBMA 5APVA 3W67A 2A06D 3HUSA 2V07A 1NTKJ 3H1IE 1SQBD 1HZUA 1N90A 1NTKG 3TYIA 3A0HV 4DJGA 1ZV8A 2QE7H 3G6EP 4L76A 3P8CE 3H1HJ 3M0DC 1LTJC 3H1HG 2OGUA 1OZHA 2BCCE 3CC4P 2B9BA 3HQ7A 1IK9A 1RAPA 3O1YA 3C8VA 4UB6V 1HH0A 2MKVA 2CE1A 3X39A 1X9VA 2CE0A 1K3GA 5TISE 5TISH 4NPDA 1LS9A 3MIWA 1FOSF 5APXA 2PRRA 1IZL0 3WUVA 1JCCA 3OCDB 1Z56A 2IYOA 2W8ZA 3UIAA 3L75J 4JYCA 3VYMA 3EQ2A 3L75G 1P84D 4HB1A 1MZ9A 2N9IA 3RBZA 5AVRB 1S5LX 1NGMB 3BCCD 3RL0g 2GM4A 2P67A 1LTJB 2G3AA 3B5ND 2GC4D 5H2FV 2E43A 2N3YA 1GL2C 2WSCH 2V4HA 2FYUD 2AI5A 4M3LA 4WWIA 1RF0C 3V2QA 1J1EC 1YBKA 3L72D 1LTIC 3CCQP 1NU1D 3H6PA 2CA3B 1AYGA 2BEQD 1CRCA 3H1LD 4U3FD 2WQYC 4A7PA 3TGUE 2OTLP 1GKSA 2QM8A 3HQ6A 1L4AD 3MTUE 1PGPA 2WVRA 1VQ6P 3O0RC 3H1JE 1QL3A 2XKMA 2CA4B 3CP5A 2IBZD 2FFDA 3SSUA 2JWAA 1YCCA 1GK4A 1K8AQ 3M0AA 1YIQA 3P32A 4Q5PA 4L3HA 5AW8B 1M6ZA 2Q5UA 1QYZA 2YCCA 2YQBA 5C9MA 1KMIZ 1GL2B 2PAJA 1FZCC 1JEKA 1AA0A 3L4MA 3A5TA 5AVVB 1VQOP 1A02J 3NXSA 1YIJP 4EIJA 1OCDA 1J1EB 2ITAA 1CSUA 1E2RA 4YE1A 1L0LE 1AFOA 3LIEA 2ZZS1 3A0BH 1NAFA 1URQD 1URQC 1OXZA 2XU6A 2HG5D 1XTCC 3MUDA 1NYHA 4GKGA 3EFGA 3RMZA 2ZFCA 5CMZA 1NTZJ 1NTZG 3A7OA 1H8AA 3CL3D 1QL4A 1CXCA 5AW2B 3S9OA 2QA4P 4AAMA 1M1JB 1QN2A 5KAIV 2RH0A 5AVXB 3H1HD 2J59M 1R0QA 4Y5RA 1NNOA 1CI6A 1JY3O 4L75A 3VP9A 1M7LA 1R8EA 1OWAA 3O8ZA 1FZCB 1SQXJ 3MUDC 1HJ4A 2OZ1B 1SQXG 4IL6E 2IFMA 3CWBE 3CU4A 3WFDC 1QL2A 1OIPA 1I6EA 1OFCX 1W2LA 2GB8B 5K5GB 5DJTB 1H31A 1CZQA 1VPCA 1YTZI 2HODA 1URQB 2CPBA 1RE4C 1EDJA 2KP8A 4O1QA 4K3IA 1CNOA 3CX5D 5E79H 5E79E 3L75D 2Q3EA 2Y9YA 1C7MA 2E74C 1N2DC 2KLUA 3V2PA 2R44A 1H9YA 4WQBA 1GK6A 1SQQJ 1KD1Q 3C1LA 1SQQG 3CCRP 1NOHA 1VYDA 3WMM0 1Y47A 3L73J 1I55A 1J1DC 1HUCA 3L73G 1SQBK 3OJAB 4OWFA 5BU5A 3FXEA 2H88C 3P8MC 3LW5H 1IFMA 1LTGC 2W83C 1IQCA 1MFZA 4AYCA 1GU5A 1AVYA 1C75A 3WUTA 2FXPA 2P2UA 2FKWB 2QG4A 3N4XA 1CI6B 5AVWB 2B87B 2I8FA 1NTME 3TSIA 2E74B 3RK3E 4OVNF 1PGOA 4NFGB 1CSXA 3WC8A 3SWKA 3H32B 4LLHA 1OVVA 3EFFK 1HWTC 4W7YA 1HCMA 2B12B 1J1DB 4WBAA 3USSA 1A02F 3W68A 3NWVA 1FE6A 2LXCB 2PGDA 1OVRA 2C1VA 2KS1B 2KUBA 1RQVA 1SS1A 1LNQA 4BWNA 3BVHA 2ZYGA 2D2CD 4WQ7A 3CCMP 2PCCB 1L0LK 5GTIE 5GTIH 1DW2A 1U7MA 3F89A 1RE3A 4HH2A 1SQVE 2BLFB 1PP9J 3HTKB 4I7ZC 1GU2A 1PP9G 5B66H 1IFIA 3HQ9A 3NFQA 1VQ7P 2G8YA 1LJ2A 4AX3A 2B88A 5CCGD 3Q5PA 4WB4A 1YTCA 2ZOOA 3H1IJ 1NVOA 3TNUA 3H1IG 1BSNA 4K35A 2A45H 3U59A 2D0SA 3OA8A 2P10A 3U1CA 1RF1C 4EI2A 2BCCJ 1BE3E 2C2CA 2BCCG 3BASA 2B89A 1SQXD 4MU8A 3CD6P 2J58A 1EQ7A 1FZFA 3RN0A 4WQCA 1DEEG 3NBSA 2R5DA 5APSA 3CXHD 4OGQD 3AEGC 4AUWA 4I7ZB 5AW3B 4BRYB 4ZMDA 4N6JA 3KPEA 4H0LD 1VQ5P 1FHBA 2N1TA 1KILD 1B7VA 1SQQD 4DT0A 4RO0A 3GW6A 2C8SA 3L73D 3DP5A 2ZYDA 3M06A 4UB8E 4UB8H 1RF1B 2XNDH 2A45I 4D6TE 1JMBA 2WSCJ 3I56P 1KX2A 1Q82Q 4NPFX 1F1CA 5CJ0A 1SFCC 1USDA 4QAOA 5KJ7D 1N73C 5KJ7C 3L4FA 2K37A 4OGQB 2WTYA 5CBNA 1CSBA 3TGUJ 1FC2C 5KAFV 3KDPB 3RL0C 3TGUG 1LTAC 4PD4D 2YIUC 3H1JJ 3L71D 4GT1A 3H1JG 1H33B 2LXBA 2YK3A 1GU4A 3H1KE 1KX7A 1YHQP 1JY3P 3HD7D 2OYHA 3V4WA 5TJHA 3SLEA 1G1JA 2BH5X 5KLVK 5B6QA 4XYDB 2CXBA 4WQ9A 2Q9IA 5BVZA 2YO2A 1SFCB 3ABVC 2NPSA 1LTTC 1L0LJ 1LWUB 4PV1C 1N73B 2JP3A 1L0LG 3VNWA 5M1BA 3MGNA 1VQ4P 2JEEA 1SQVK 2OYHC 1Q90D 1KZUB 1PP9D 1CORA 3SFEC 1FAVA 3GMAA 2IX7C 3RL0B 2ZXEB 1SP4A 1BGYE 2YIUB 2OQQA 1X22A 3H1ID 3L70E 5CIBB 1BL9A 1SQPD 2JKVA 3O5CA 1FOCA 1Q86Q 1CXAA 1PGQA 4IL6X 2WT7A 3P8CD 2NPSC 2FYNB 3TYYA 2AXTV 3CC7P 2E75C 2OYIB 3WU2E 3WU2H 4WY4C 1YITP 5APQA 1QVFO 1HRCA 1BSHA 3CWBJ 3V2NA 1KTMA 1KYOH 3CWBG 1CC5A 2K9JB 3V2RA 5B5EV 2YKQA 5CCHA 4WQAA 2WSEJ 4FA9A 3G71P 4PV1B 1OX3A 2OYHB 2ZXXA 1CCRA 3IR9A 2IYPA 1MZ4A 1G2CB 3CCEP 1TU3F 1L0NK 3IAOA 1HF9A 3HE5A 1GW4A 1CIGA 1G1IA 2XDJA 1IFJA 1N86A 3CCSP 1GIWA 4YXWH 5CCHC 2KZIA 3AE3C 1NIRA 3CC2P 1HBWA 4FAVA 2E5YA 4WY4B 1MG2D 1X79B 1DIQC 2CK3H 4DCKA 3HUSC 1DD3A 3L74E 3LW5J 2LIRA 1RAQA 3HQ8A 4WVZA 4GODA 1ZP0C 3E7KA 1I5TA 3RGUA 2C9LY 1CTJA 5DJQC 2R32A 3VMYA 3E1RA 1S72P 1YEBA 4YTPC 3AECC 2QJYC 1CTZA 2ZONG 3TGUD 1RZ6A 3ZIYA 1PV3A 3B5NA 1NTMJ 1T2KC 1NTMG 3AEFC 4TT3H 2W27A 1N9CA 2A06E 1AQ5A 2ZBOA 1LC2A 1SQBE 3AEDC 1YFCA 1NMIA 1GL2D 3T97A 2E76D 2E76C 1DW3A 2O1JA 2P7JA 4KHXA 1U75B 2JR8A 5L8RJ 3OA7A 3HUSB 2OARA 1I8OA 3ORVA 1L4AA 1IFPA 4DY9A 2YKOA 1FJPA 1MV8A 3AEBC 3HE4A 2QJYB 4LGDE 1SQVJ 2MJZA 3GHGA 1M1KQ 2L5GB 4FB1A 2O3JA 3V6IA 4V2KA 5DJUB 3L36A 2DW3A 2KSJA 1JY2N 2RN0A 3O20A 4H44C 3A0HE 3A0HH 2R5BA 3Q5SA 1P84E 1P84H 2C0WA 1ZRTE 4JYBA 2Q6QA 3EWKA 2KXPB 1BE3J 1RY3A 3BCCE 1BE3G 3K5BA 2E76B 1I54A 3CCJP 3CWBD 4UB6H 1EB7A 2JDIH 3V5BA 3CI9A 2BGVX 5CIEB 3A0BE 2FFDC 1F1FA 2N3BA 4N78D 1ZN5A 2ORLA 3L72E 1C6RA 1H32A 3OW2O 1NTKD 1KV4A 1J3SA 2O01N 3H1LE 4U3FE 2KIKA 1QGKB 1VQPP 4DZOA 3M91A 4H44B 3VTPC 2Y0CA 3PXSA 1NH4A 4J20A 2N9JA 1R5SA 2IBZE 3TF5A 3KZIV 2HFED 1HVVA 2LKMA 3FXDA 4D6TJ 1SQPK 5H2FE 5H2FH 3AE9C 4D6TG 1M70A 1C52A 3LIDA 1P84I 1S5LV 4GOEA 4O1WA 1S2EA 4Y28J 1HJ0A 1QX8A 2FFDB 2QJPC 1QKSA 2KNCA 1C2RA 2H43A 3WUUA 1E79H 2E74D 2Y9ZA 3BRTB 4EDFA 2I1JA 1QLED 3RK3C 1ZMEC 1PZQA 2FY8A 3NMDA 4FA1A 5CYTR 3H1KJ 1WRGA 3H1KG 2WITA 2MHMA 3PTZA 1RQUA 4GDOA 1W5CE 4I6MC 1N50A 1EXIA 2C1DA 2W90A 1FCDC 2WWWA 5CHXA 2IBZI 1Y9BA 2WPVB 3DR0A 2Y0DA 4PJ0V 4R4LA 2HYNA 1W2BO 2QJPB 3S1KA 2HV4A 3CYTI 2WSSH 4L1QA 3VOPA 1NKNA 3A3YB 4KMGA 1YJWP 1A8CA 2JTIB 1LT1A 1DEBA 1OW6A 3ITKA 3PXWA 1MUUA 2V7QJ 4HJGH 1BGYJ 1SLQA 3VMXA 1KQGB 1BGYG 3L70J 3RK3B 3L70G 2IDBA 3FWLA 5KLIC 5AW1B 3CX5E 3CX5H 1GDTA 5GTHV 2GUSA 5KAIE 5KAIH 1M57D 4H0JA 2KYVA 1AKKA 1H31B 2VHDA 1CO6A 5AW4B 1GDVA 1FJKA 1WT6A 2HODB 1DIIC 2EXVA 5KLVE 1OAEA 2KZJA 1M60A 5AVTB 2Z5IA 1HGVA 1S6VB 4JPZB 4XA4A 1LFMA 1S5LH 3VMAA 5CCGA 2FYUK 1GTWA 3MK7C 1IZNB 2BH4X 2K9YA 1LT9A 1NU1K 5B66E 1I8PA 1JTHA 2CPSA 1EZVE 1NTZD 1E5WA 2M8RA 4JQ0D 4IFFA 2XZRA 1K04A 4FA4A 1JY2O 3PXTA 2N18C 1MG3D 4Y99C 4B86A 2H7HA 3AE4C 3Q2YA 1CRHA 1L2PA 1FJ0A 1RE3C 1KB9D 3CX5I 4ASVA 1X0TA 1VF5C 3O6QA 3WFEC 1N7SA 1YTZT 3PP5A 1KB0A 3L74J 1S9KE 2QJKC 3L74G 3AE2C 1VDFA 2NZ2A 3RK2D 5KTBA 3RK2C 3JC22 3MK7B 1FS0E 1WMKA 1IRVA 1KILA 2DVHA 1NKZB 1NJIQ 1H0TA 1E8EA 1L0NE 1VQNP 2M5AA 4YPCA 3JSVC 5CBOA 1N7SC 3AEEC 1WVEC 1EZVI 1X8YA 1NTKK 4Y99B 2FXMA 2A06G 1SQBJ 2BCNB 3GG2A 1SQBG 4DOJA 1DT1A 3ZOXA 5APYA 1S1CX 5CJ4A 5AVSB 2OYOA 4C7NA 1SFCD 2V08A 2W6AA 1PL5A 2WMMA 5IY51 2QJKB 3TNUB 2N1TC 1JUNA 5AW7B 5CICB 3RLMA 1DW1A 3RK2B 2HR3A 3OA8B 1D7MA 4GIFA 3RL0D 3VYIA 2GC7D
chains in the Genus database with same CATH topology
4RJTA 4UB8V 3NBTA 2GIWA 4FAVA 3SWSA 1MG2D 1DIQC 2FRCA 3RMZA 3L70D 2LIRA 1U74B 1RAQA 3HQ8A 4WQDA 1QL4A 1CXCA 4AAMA 1I5TA 1QN2A 5KAIV 1CTJA 5DJQC 4GYDA 3H1HD 4JCGA 1YEBA 1FI7A 1R0QA 4Y5RA 1CTZA 1NNOA 2ZONG 2PACA 1W5CT 1KIBA 3TGUD 2C1DB 1L0ND 3ZOWA 2Y0EA 1RZ6A 3ZIYA 1C6SA 1CIFA 1HZVA 2B0ZB 1CRYA 1HJ4A 5KLIB 2OZ1B 3CU4A 1CRIA 3WFDC 5DFSA 1N9CA 1I6EA 1W2LA 1LC1A 5TISV 2GB8B 2ZBOA 1LC2A 4D6TD 1KV9A 1H31A 1YFCA 1NMIA 2B4ZA 2N9YB 3ZOYA 3A9FA 3RN1A 1DW3A 1RZ5A 4O1QA 1GQ1A 1HROA 4K3IA 1U75B 1CNOA 3CX5D 2B10B 4AALA 3L75D 2Q3EA 1I8OA 3JBTB 1C7MA 5DF5A 1H9YA 4WQBA 1H33A 3ORVA 1VYDA 4DY9A 2BCCD 2RMZA 1DVHA 1I55A 4N0KA 1YNRA 2QJYB 2PCBB 3M97X 5CIHB 3OCDA 4FB1A 2O3JA 2MTAC 3CX5W 4V2KA 2N18B 3H1KD 1CIHA 5CIGB 1ZZHA 2RN0A 3O20A 1GJQA 1IQCA 1C75A 1C6OA 1A2SA 3WU2V 155CA 2QG4A 1AOFA 1I54A 351CA 2I8FA 3CWBD 2L91A 1EB7A 1N15A 2AIUA 2BGVX 5CIEB 1IO3A 1CSWA 1LMSA 1K3HA 1F1FA 4NFGB 4EIFA 4AAOA 1L9BC 2N3BA 1CSXA 3WC8A 2C9XB 1E29A 1HCMA 2B12B 2ORLA 1CHIA 1CSVA 1C6RA 1BGYD 1H32A 1H9XA 3NWVA 1NTKD 4AANA 2C1VA 1J3SA 1I6DA 1HH7A 1YEAA 5AURA 4WQ7A 2ZXYA 1PPJD 1HJ3A 2PCCB 1CYIA 4PW9B 2Y0CA 3PXSA 4J20A 2N9JA 1DW2A 3A0BV 3TF5A 3KZIV 1C2NA 2BLFB 2D0WA 3H1JD 1KYOD 3ZBMA 1GU2A 1C52A 1M70A 3HQ9A 4AX3A 1S5LV 1YTCA 2ZOOA 2B11B 4O1WA 5EXQA 3C2CA 5KKZB 1AOQA 3KHUA 3DMIA 1QKSA 2JQRA 1CHJA 2D0SA 451CA 3OA8A 1ETPA 1ZRTD 1WEJF 1CCHA 1C2RA 2C2CA 5CIDB 1KYOW 4EDFA 2C1UA 1SQXD 4MU8A 1YICA 1IRWA 4RSZA 4IL6V 1L0LD 1CYCA 5DJQB 4EIDA 3RN0A 4WQCA 4FA1A 5CYTR 1FI3A 3NBSA 3L4OA 2MHMA 3CXHD 3PTZA 1N50A 1JDLA 3L74D 2C1DA 1BCCD 1FCDC 2DGEA 3PH2B 5CIFB 2OZ1A 5E79V 1HJ5A 3PLNA 3DR0A 3PHLA 2Y0DA 1FHBA 4PJ0V 1B7VA 1SQQD 2QJPB 2HV4A 3CYTI 4L1QA 1COTA 3GW6A 2C8SA 4KMGA 3L73D 3DP5A 1A8CA 2JTIB 3CXHW 4WQ8A 4FA5A 4LJIA 3WFBC 3ITKA 3PXWA 1CYJA 4GEDB 1CTYA 1KX2A 2A06D 2V07A 1SQBD 1HZUA 3TDKA 1F1CA 1N90A 3FWLA 3TYIA 5GTHV 1H1OA 2BPBB 4QAOA 3A0HV 4H0JA 1AKKA 1CIEA 1H31B 1L9JC 2VHDA 1CO6A 1GDVA 4L3GA 1DIIC 2EXVA 4EIEA 1NMLA 1OAEA 3PRJA 1M60A 2XTSB 5KAFV 4PD4D 3HQ7A 3WFCC 1RAPA 3O1YA 1S6VB 3L71D 2LITA 4UB6V 1LFMA 1H33B 2CE1A 2YK3A 3X39A 3VMAA 1FI9A 2CE0A 1K3GA 1LS9A 1KX7A 3MK7C 4PWAA 2BH4X 3ZCFA 1IZL0 1I8PA 5TJHA 3SLEA 3SXTA 1NTZD 3OCDB 2BH5X 5B6QA 4XYDB 2CXBA 4WQ9A 3VRDA 3VYMA 1P84D 2N9IA 4FA4A 3PXTA 2N18C 1MG3D 3BCCD 3VNWA 1CRHA 5GTIV 1FJ0A 1CHHA 1KB9D 1NTMD 1PP9D 1CORA 3WFEC 2GC4D 5H2FV 2N3YA 2KS1A 4EICA 4FANA 5B66V 1KB0A 2YIUB 2FYUD 3H1ID 3WUIA 2AI5A 5CIBB 1BL9A 1SQPD 3O5CA 2L4DA 1FOCA 3L72D 1NU1D 4P4QB 1CXAA 1DW0A 3MK7B 2CA3B 4H0KA 1IRVA 2DVHA 2FYNB 1AYGA 2AXTV 1H32B 1A56A 5KLVD 1CRCA 3H1LD 4U3FD 4A7PA 1E8EA 1GKSA 3HQ6A 1HRCA 3O0RC 1QL3A 1CC5A 1WVEC 2K9JB 2CA4B 3CP5A 2IBZD 5B5EV 1CRGA 2JWAA 1YCCA 4WQAA 5C0ZA 2FWLA 2BCNB 4FA9A 3GG2A 1SQVD 1YIQA 4Q5PA 4L3HA 1M6ZA 1DT1A 3ZOXA 1QYZA 3ZOOA 2YCCA 1EZVD 2YQBA 5C9MA 1CCRA 1MZ4A 1CRJA 2V08A 5IY51 3L4MA 1DVVA 4XXLA 1CEDA 2QJKB 1CIGA 3SJLA 5CICB 1OCDA 1CSUA 3RLMA 1DW1A 1E2RA 2KNCB 4YE1A 1BE3D 3OA8B 1GIWA 4WQEA 2ZZS1 3SVWA 2GC7D 1NIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJT A;  4UB8 V;  3NBT A;  2GIW A;  4FAV A;  3SWS A;  1MG2 D;  1DIQ C;  2FRC A;  3RMZ A;  3L70 D;  2LIR A;  1U74 B;  1RAQ A;  3HQ8 A;  4WQD A;  1QL4 A;  1CXC A;  4AAM A;  1I5T A;  1QN2 A;  5KAI V;  1CTJ A;  5DJQ C;  4GYD A;  3H1H D;  4JCG A;  1YEB A;  1FI7 A;  1R0Q A;  4Y5R A;  1CTZ A;  1NNO A;  2ZON G;  2PAC A;  1W5C T;  1KIB A;  3TGU D;  2C1D B;  1L0N D;  3ZOW A;  2Y0E A;  1RZ6 A;  3ZIY A;  1C6S A;  1CIF A;  1HZV A;  2B0Z B;  1CRY A;  1HJ4 A;  5KLI B;  2OZ1 B;  3CU4 A;  1CRI A;  3WFD C;  5DFS A;  1N9C A;  1I6E A;  1W2L A;  1LC1 A;  5TIS V;  2GB8 B;  2ZBO A;  1LC2 A;  4D6T D;  1KV9 A;  1H31 A;  1YFC A;  1NMI A;  2B4Z A;  2N9Y B;  3ZOY A;  3A9F A;  3RN1 A;  1DW3 A;  1RZ5 A;  4O1Q A;  1GQ1 A;  1HRO A;  4K3I A;  1U75 B;  1CNO A;  3CX5 D;  2B10 B;  4AAL A;  3L75 D;  2Q3E A;  1I8O A;  3JBT B;  1C7M A;  5DF5 A;  1H9Y A;  4WQB A;  1H33 A;  3ORV A;  1VYD A;  4DY9 A;  2BCC D;  2RMZ A;  1DVH A;  1I55 A;  4N0K A;  1YNR A;  2QJY B;  2PCB B;  3M97 X;  5CIH B;  3OCD A;  4FB1 A;  2O3J A;  2MTA C;  3CX5 W;  4V2K A;  2N18 B;  3H1K D;  1CIH A;  5CIG B;  1ZZH A;  2RN0 A;  3O20 A;  1GJQ A;  1IQC A;  1C75 A;  1C6O A;  1A2S A;  3WU2 V;  155C A;  2QG4 A;  1AOF A;  1I54 A;  351C A;  2I8F A;  3CWB D;  2L91 A;  1EB7 A;  1N15 A;  2AIU A;  2BGV X;  5CIE B;  1IO3 A;  1CSW A;  1LMS A;  1K3H A;  1F1F A;  4NFG B;  4EIF A;  4AAO A;  1L9B C;  2N3B A;  1CSX A;  3WC8 A;  2C9X B;  1E29 A;  1HCM A;  2B12 B;  2ORL A;  1CHI A;  1CSV A;  1C6R A;  1BGY D;  1H32 A;  1H9X A;  3NWV A;  1NTK D;  4AAN A;  2C1V A;  1J3S A;  1I6D A;  1HH7 A;  1YEA A;  5AUR A;  4WQ7 A;  2ZXY A;  1PPJ D;  1HJ3 A;  2PCC B;  1CYI A;  4PW9 B;  2Y0C A;  3PXS A;  4J20 A;  2N9J A;  1DW2 A;  3A0B V;  3TF5 A;  3KZI V;  1C2N A;  2BLF B;  2D0W A;  3H1J D;  1KYO D;  3ZBM A;  1GU2 A;  1C52 A;  1M70 A;  3HQ9 A;  4AX3 A;  1S5L V;  1YTC A;  2ZOO A;  2B11 B;  4O1W A;  5EXQ A;  3C2C A;  5KKZ B;  1AOQ A;  3KHU A;  3DMI A;  1QKS A;  2JQR A;  1CHJ A;  2D0S A;  451C A;  3OA8 A;  1ETP A;  1ZRT D;  1WEJ F;  1CCH A;  1C2R A;  2C2C A;  5CID B;  1KYO W;  4EDF A;  2C1U A;  1SQX D;  4MU8 A;  1YIC A;  1IRW A;  4RSZ A;  4IL6 V;  1L0L D;  1CYC A;  5DJQ B;  4EID A;  3RN0 A;  4WQC A;  4FA1 A;  5CYT R;  1FI3 A;  3NBS A;  3L4O A;  2MHM A;  3CXH D;  3PTZ A;  1N50 A;  1JDL A;  3L74 D;  2C1D A;  1BCC D;  1FCD C;  2DGE A;  3PH2 B;  5CIF B;  2OZ1 A;  5E79 V;  1HJ5 A;  3PLN A;  3DR0 A;  3PHL A;  2Y0D A;  1FHB A;  4PJ0 V;  1B7V A;  1SQQ D;  2QJP B;  2HV4 A;  3CYT I;  4L1Q A;  1COT A;  3GW6 A;  2C8S A;  4KMG A;  3L73 D;  3DP5 A;  1A8C A;  2JTI B;  3CXH W;  4WQ8 A;  4FA5 A;  4LJI A;  3WFB C;  3ITK A;  3PXW A;  1CYJ A;  4GED B;  1CTY A;  1KX2 A;  2A06 D;  2V07 A;  1SQB D;  1HZU A;  3TDK A;  1F1C A;  1N90 A;  3FWL A;  3TYI A;  5GTH V;  1H1O A;  2BPB B;  4QAO A;  3A0H V;  4H0J A;  1AKK A;  1CIE A;  1H31 B;  1L9J C;  2VHD A;  1CO6 A;  1GDV A;  4L3G A;  1DII C;  2EXV A;  4EIE A;  1NML A;  1OAE A;  3PRJ A;  1M60 A;  2XTS B;  5KAF V;  4PD4 D;  3HQ7 A;  3WFC C;  1RAP A;  3O1Y A;  1S6V B;  3L71 D;  2LIT A;  4UB6 V;  1LFM A;  1H33 B;  2CE1 A;  2YK3 A;  3X39 A;  3VMA A;  1FI9 A;  2CE0 A;  1K3G A;  1LS9 A;  1KX7 A;  3MK7 C;  4PWA A;  2BH4 X;  3ZCF A;  1IZL 0;  1I8P A;  5TJH A;  3SLE A;  3SXT A;  1NTZ D;  3OCD B;  2BH5 X;  5B6Q A;  4XYD B;  2CXB A;  4WQ9 A;  3VRD A;  3VYM A;  1P84 D;  2N9I A;  4FA4 A;  3PXT A;  2N18 C;  1MG3 D;  3BCC D;  3VNW A;  1CRH A;  5GTI V;  1FJ0 A;  1CHH A;  1KB9 D;  1NTM D;  1PP9 D;  1COR A;  3WFE C;  2GC4 D;  5H2F V;  2N3Y A;  2KS1 A;  4EIC A;  4FAN A;  5B66 V;  1KB0 A;  2YIU B;  2FYU D;  3H1I D;  3WUI A;  2AI5 A;  5CIB B;  1BL9 A;  1SQP D;  3O5C A;  2L4D A;  1FOC A;  3L72 D;  1NU1 D;  4P4Q B;  1CXA A;  1DW0 A;  3MK7 B;  2CA3 B;  4H0K A;  1IRV A;  2DVH A;  2FYN B;  1AYG A;  2AXT V;  1H32 B;  1A56 A;  5KLV D;  1CRC A;  3H1L D;  4U3F D;  4A7P A;  1E8E A;  1GKS A;  3HQ6 A;  1HRC A;  3O0R C;  1QL3 A;  1CC5 A;  1WVE C;  2K9J B;  2CA4 B;  3CP5 A;  2IBZ D;  5B5E V;  1CRG A;  2JWA A;  1YCC A;  4WQA A;  5C0Z A;  2FWL A;  2BCN B;  4FA9 A;  3GG2 A;  1SQV D;  1YIQ A;  4Q5P A;  4L3H A;  1M6Z A;  1DT1 A;  3ZOX A;  1QYZ A;  3ZOO A;  2YCC A;  1EZV D;  2YQB A;  5C9M A;  1CCR A;  1MZ4 A;  1CRJ A;  2V08 A;  5IY5 1;  3L4M A;  1DVV A;  4XXL A;  1CED A;  2QJK B;  1CIG A;  3SJL A;  5CIC B;  1OCD A;  1CSU A;  3RLM A;  1DW1 A;  1E2R A;  2KNC B;  4YE1 A;  1BE3 D;  3OA8 B;  1GIW A;  4WQE A;  2ZZS 1;  3SVW A;  2GC7 D;  1NIR A; 
#chains in the Genus database with same CATH topology
 4RJT A;  4ASW A;  1H89 A;  2GIW A;  3HD7 A;  3E1I A;  3SWS A;  3CXH E;  3CXH H;  2KLV A;  2C0X A;  3L70 D;  3P7K A;  1JCD A;  1N7S B;  2HPC A;  3Q3D A;  2ZT9 C;  2WSF H;  1LP1 A;  3L37 A;  5AW0 B;  4AQR D;  1U57 A;  4L74 A;  4I1L A;  1ZR4 A;  1KIL E;  3L35 A;  3GLM A;  5AW5 B;  1T3J A;  3BCC J;  3CCV P;  2PAC A;  1W5C T;  1KIB A;  3BCC G;  2O1K A;  1C6S A;  1CIF A;  2B0Z B;  1CRY A;  2QIW A;  3I55 P;  1DX7 A;  1CRI A;  2N1T B;  4PV1 D;  1JM0 A;  1HJB A;  2FYU J;  5TIS V;  4JF7 A;  4KJM A;  3BAT A;  1KV9 A;  5AVY B;  3L72 J;  2B4Z A;  3L72 G;  3ZOY A;  2KB7 P;  1AQT A;  1ZLL A;  4YXD C;  1GQ1 A;  1HRO A;  1KOR A;  3QH9 A;  1HGZ A;  3H1L J;  4N3Y B;  4U3F J;  2YMY A;  4AAL A;  3H1L G;  4U3F G;  3JBT B;  2ZAE B;  4EYY Q;  5DF5 A;  3N7N A;  4PD4 E;  4PD4 H;  3SFD C;  2ZJS E;  1NWQ A;  2NPS D;  1PPJ E;  3CXH I;  3IN6 A;  3L71 E;  2E75 D;  2LR2 A;  2BCC D;  4WY4 D;  3S4R A;  4N0K A;  2IBZ G;  3AE1 C;  1YNR A;  2UWJ E;  3BRV B;  2YMK A;  1YYC A;  2O01 H;  2PCB B;  3M97 X;  3OCD A;  1KYO E;  2MTA C;  1J2J B;  4H13 D;  4H13 C;  4HYT B;  1K05 A;  2Z4E A;  3D70 A;  5CIG B;  3I5C A;  2Q1K A;  2HPC B;  2K1A A;  1YJ9 P;  3MZW B;  3M0D A;  2IZ1 A;  3CME P;  1LTJ A;  1ZOY C;  1A2S A;  1QVG O;  3VP8 A;  5KAF E;  5KAF H;  2VRS A;  1AV1 A;  1QEX A;  2L91 A;  1N15 A;  5KKZ C;  2AIU A;  2IPP A;  3H25 A;  5CCH D;  3C9I A;  1KFM A;  1NO4 A;  1NTZ K;  2NPS B;  1CSW A;  1LMS A;  1K3H A;  1IC2 A;  4AAO A;  1FDO A;  2W6J H;  4MN4 C;  2E75 B;  3D6Y A;  2C9X B;  5AVQ B;  1SQP E;  1E29 A;  2J5U A;  1CHI A;  1CSV A;  3AE6 C;  4PD4 I;  2KOG A;  4C46 A;  1H9X A;  3M9B A;  3VMZ A;  1BCC E;  3GF3 A;  1I6D A;  3U1A A;  1EC5 A;  1HH7 A;  1YEA A;  4H13 B;  1SQX K;  1KYO I;  3D0W A;  3G3Z A;  4PW9 B;  1FDM A;  3MHV A;  2WT7 B;  3M9H A;  1W2E A;  3A0B V;  1C2N A;  3FWN A;  1T2K D;  2D0W A;  3H1J D;  3ZBM A;  1GL2 A;  1JY2 P;  5EXQ A;  3CPW O;  3C2C A;  5KKZ B;  3M9Q A;  2GUV A;  2HLO A;  1RF0 A;  3DMI A;  2M0B A;  2JQR A;  2BEZ F;  1GW3 A;  451C A;  1SQQ K;  1ZRT D;  2AXT E;  1WEJ F;  2AXT H;  1YI2 P;  3AE5 C;  5KLV J;  5KLV G;  1YQ3 C;  1KYO W;  4IFD K;  4GOF A;  2C1U A;  3B5N C;  1GMJ A;  1JOC A;  2FXO A;  3HE5 B;  1IRW A;  1XTG B;  4IL6 V;  1L0L D;  1LTB C;  2AEJ A;  5DJQ B;  5B5E H;  5B5E E;  3R2P A;  1GZL A;  1M1J A;  1FI3 A;  3G9R A;  2E5T A;  3L4O A;  1FU1 A;  3MD0 A;  1SQV G;  1ZXG A;  1T6A A;  1JDL A;  1EZV G;  1SVF A;  3OAK A;  1M8O B;  4K3A A;  2E42 A;  1FOS E;  1FZC A;  4U7J A;  2OZ1 A;  5E79 V;  1HJ5 A;  4H44 D;  1T3U A;  2A45 G;  3PLN A;  1FDI A;  1M56 D;  1L4A C;  3CCL P;  1T8Z A;  2XV5 A;  1COT A;  2K3R A;  3MP7 B;  2JJL A;  3FX0 A;  3HRN A;  2N9B A;  1M1J C;  1PFI A;  4FA5 A;  2KSE A;  1URQ A;  3GHG C;  4UB6 E;  1NHL A;  3B5N B;  4ZNC A;  2FYU E;  3TDK A;  1VQM P;  1AVO A;  2YKP A;  1H1O A;  2BPB B;  1NU1 E;  1AJY A;  1GD2 E;  2AXC A;  4I2L C;  3V4Q A;  1CIE A;  1JNM A;  1L9J C;  4NPE A;  4L3G A;  4EIE A;  2GA1 A;  1NML A;  3D6Z A;  1H88 A;  3T97 B;  1L0N J;  3PRJ A;  2XTS B;  1L0N G;  3WFC C;  3KYQ A;  1BDC A;  2LIT A;  1FI9 A;  4R4M A;  1L4A B;  1JB0 J;  4PWA A;  2P1J A;  4W7Z A;  1Y8A A;  5AW9 B;  4EOT A;  3HE4 B;  2R3S A;  3ZCF A;  1EDL A;  1RE4 A;  3GHG B;  3SXT A;  3ZDM A;  4BXL A;  1HTL C;  2ZYA A;  2B87 A;  3QWO C;  1KC8 Q;  3VRD A;  4O9B A;  5AW6 B;  1OW8 A;  1IO4 A;  1QL1 A;  4IL6 H;  3IF4 A;  1K9M Q;  3H32 A;  5GTI V;  1CHH A;  2WSE H;  4N78 E;  2QVA A;  1KQL A;  3A2A A;  1NTM D;  2QRX A;  3RK3 D;  1USE A;  2KS1 A;  4EIC A;  4FAN A;  5B66 V;  1NAY A;  1S4X A;  4CPG A;  1S3J A;  4RES B;  3WUI A;  1NTK E;  4ZKP A;  2WSF J;  2L4D A;  4W80 A;  2JO1 A;  3II6 A;  4P4Q B;  2WPS A;  1DW0 A;  2YXQ B;  4H0K A;  3FGA D;  2ZVO B;  3H1H E;  2WPR A;  2WPQ A;  1H32 B;  1A56 A;  5KLV D;  3B71 A;  5AVU B;  1EDI A;  2KI7 B;  1VQK P;  3AE8 C;  3PH0 A;  3HTK A;  2RKL A;  1RH5 B;  3B8E B;  4IOI H;  1VQL P;  4KT0 J;  2PFX A;  1CRG A;  5C0Z A;  3Q5R A;  2FWL A;  4Z1M H;  1SQV D;  1ZR2 A;  3ZOO A;  2SPZ A;  1EZV D;  2JWD A;  3G4S P;  1U7J A;  1CRJ A;  1VQ8 P;  4OH8 B;  1DVV A;  3NTN A;  4XXL A;  1CED A;  3L75 E;  4C7R A;  3SJL A;  1OMI A;  2P58 A;  4TLF A;  2H8P D;  3L71 J;  1PPJ G;  2KNC B;  3L71 G;  1BE3 D;  1VQ9 P;  4WQE A;  3KZI E;  3SVW A;  3KZI H;  4UB8 V;  3NBT A;  2O01 J;  1EXJ A;  1EDK A;  2Q3I A;  2FRC A;  4BRY A;  1S5L E;  4XE5 B;  1S9K D;  1U74 B;  4WQD A;  1UII A;  2M3E A;  1LTS C;  5APW A;  1VL2 A;  2D2C C;  4GYD A;  4JCG A;  1FI7 A;  1ZW0 A;  2QSI A;  1RF1 A;  2C1D B;  1L0N D;  3ZOW A;  2Y0E A;  1IK7 A;  1HZV A;  5KLI B;  2QEX P;  1OVU A;  2W6B A;  4LC1 A;  5DFS A;  5CCG C;  1BDD A;  1PIX A;  3TK1 A;  1LC1 A;  3KXD A;  1JO5 A;  4D6T D;  1VF5 D;  1LT9 C;  1SQP J;  1SQP G;  1MKM A;  2N9Y B;  3A9F A;  2I8D A;  3RN1 A;  2K88 A;  1BCC J;  1RZ5 A;  1DIP A;  1BCC G;  3F5H A;  2B10 B;  1IFD A;  4PJ0 E;  4PJ0 H;  1Q2N A;  5APT A;  1H33 A;  2H89 C;  1YJN P;  2ZVN B;  4ZKU A;  3PJS K;  2D2C B;  2RMZ A;  1DVH A;  1LGH B;  4IFM A;  3CMA P;  5CIH B;  1N7S D;  4OGQ C;  2M3B A;  1M90 Q;  2YNY A;  3CX5 W;  3JCU E;  3JCU H;  2N18 B;  1NTZ E;  3H1K D;  1CIH A;  3VN0 A;  5GTH E;  5GTH H;  1FZA A;  1ZZH A;  1SFC A;  2WZ7 A;  1R5L A;  1GJQ A;  4H0L C;  1CW5 A;  1LWU A;  1N73 A;  5KJ7 A;  1LT9 B;  4QMA A;  1KIL C;  1VF5 B;  1C6O A;  1JTH B;  1YQ4 C;  2NRG A;  3AEA C;  1KN7 A;  3AE7 C;  3WU2 V;  1IJD B;  2N1T D;  155C A;  4RKU J;  1KQS O;  1AOF A;  3CCU P;  1KB9 E;  1KB9 H;  1SQX E;  351C A;  2KK7 A;  2C9N Y;  1IO3 A;  1FZG A;  1K73 Q;  1MFT A;  4EIF A;  1N7L A;  1L9B C;  3D71 A;  1DD4 A;  1BGY D;  1LWU C;  1PGJ A;  2OYI A;  3O6Q B;  4AAN A;  2AEF A;  2ZT9 D;  1KFN A;  2YO3 A;  1Q7Y Q;  2FBW C;  5AUR A;  1N8R Q;  3GF7 A;  1UIX A;  2K9J A;  2ZXY A;  3Q1M A;  1PPJ D;  1NTM K;  1SQQ E;  1HJ3 A;  1CYI A;  1DH3 A;  4H0L B;  4XFJ A;  2Q7C A;  1KQF B;  5APU A;  1KIL B;  3L73 E;  2OTK E;  3HD7 C;  1H0T B;  2IFN A;  1KYO D;  2FYN C;  1G2C A;  2M5A B;  2OYI C;  2PP6 A;  2B11 B;  2XNX A;  2BAS A;  2R3C A;  2FYU G;  1AOQ A;  3KHU A;  5AVZ B;  1NU1 J;  3SWF A;  1CHJ A;  1KB9 I;  1RHZ B;  1NU1 G;  4JBZ A;  2I1K A;  1FZE A;  1ETP A;  2FYZ A;  1CCH A;  1Q81 Q;  5EFW B;  5C39 A;  4L73 A;  5CID B;  4WY4 A;  3R4Y A;  4C7N B;  2ZT9 B;  1YIC A;  4HKZ H;  4RSZ A;  2V7Q H;  1CYC A;  4EID A;  3IFM A;  2QM7 A;  1OW7 A;  3B4S A;  1JY3 N;  3HD7 B;  3L74 D;  3KQG A;  1BCC D;  2DGE A;  1JMM A;  3PH2 B;  2IZ0 A;  5CIF B;  3PHL A;  1FZB A;  1LP1 B;  2POH A;  2Z5H A;  2OTJ P;  3CXH W;  2YXR B;  4WQ8 A;  4LJI A;  3WFB C;  3RBX A;  3CLQ A;  5BU8 B;  2AEM A;  1PP9 E;  3SWY A;  1CYJ A;  4GED B;  1IFN A;  1CTY A;  1FBM A;  5APV A;  3W67 A;  2A06 D;  3HUS A;  2V07 A;  1NTK J;  3H1I E;  1SQB D;  1HZU A;  1N90 A;  1NTK G;  3TYI A;  3A0H V;  4DJG A;  1ZV8 A;  2QE7 H;  3G6E P;  4L76 A;  3P8C E;  3H1H J;  3M0D C;  1LTJ C;  3H1H G;  2OGU A;  1OZH A;  2BCC E;  3CC4 P;  2B9B A;  3HQ7 A;  1IK9 A;  1RAP A;  3O1Y A;  3C8V A;  4UB6 V;  1HH0 A;  2MKV A;  2CE1 A;  3X39 A;  1X9V A;  2CE0 A;  1K3G A;  5TIS E;  5TIS H;  4NPD A;  1LS9 A;  3MIW A;  1FOS F;  5APX A;  2PRR A;  1IZL 0;  3WUV A;  1JCC A;  3OCD B;  1Z56 A;  2IYO A;  2W8Z A;  3UIA A;  3L75 J;  4JYC A;  3VYM A;  3EQ2 A;  3L75 G;  1P84 D;  4HB1 A;  1MZ9 A;  2N9I A;  3RBZ A;  5AVR B;  1S5L X;  1NGM B;  3BCC D;  3RL0 g;  2GM4 A;  2P67 A;  1LTJ B;  2G3A A;  3B5N D;  2GC4 D;  5H2F V;  2E43 A;  2N3Y A;  1GL2 C;  2WSC H;  2V4H A;  2FYU D;  2AI5 A;  4M3L A;  4WWI A;  1RF0 C;  3V2Q A;  1J1E C;  1YBK A;  3L72 D;  1LTI C;  3CCQ P;  1NU1 D;  3H6P A;  2CA3 B;  1AYG A;  2BEQ D;  1CRC A;  3H1L D;  4U3F D;  2WQY C;  4A7P A;  3TGU E;  2OTL P;  1GKS A;  2QM8 A;  3HQ6 A;  1L4A D;  3MTU E;  1PGP A;  2WVR A;  1VQ6 P;  3O0R C;  3H1J E;  1QL3 A;  2XKM A;  2CA4 B;  3CP5 A;  2IBZ D;  2FFD A;  3SSU A;  2JWA A;  1YCC A;  1GK4 A;  1K8A Q;  3M0A A;  1YIQ A;  3P32 A;  4Q5P A;  4L3H A;  5AW8 B;  1M6Z A;  2Q5U A;  1QYZ A;  2YCC A;  2YQB A;  5C9M A;  1KMI Z;  1GL2 B;  2PAJ A;  1FZC C;  1JEK A;  1AA0 A;  3L4M A;  3A5T A;  5AVV B;  1VQO P;  1A02 J;  3NXS A;  1YIJ P;  4EIJ A;  1OCD A;  1J1E B;  2ITA A;  1CSU A;  1E2R A;  4YE1 A;  1L0L E;  1AFO A;  3LIE A;  2ZZS 1;  3A0B H;  1NAF A;  1URQ D;  1URQ C;  1OXZ A;  2XU6 A;  2HG5 D;  1XTC C;  3MUD A;  1NYH A;  4GKG A;  3EFG A;  3RMZ A;  2ZFC A;  5CMZ A;  1NTZ J;  1NTZ G;  3A7O A;  1H8A A;  3CL3 D;  1QL4 A;  1CXC A;  5AW2 B;  3S9O A;  2QA4 P;  4AAM A;  1M1J B;  1QN2 A;  5KAI V;  2RH0 A;  5AVX B;  3H1H D;  2J59 M;  1R0Q A;  4Y5R A;  1NNO A;  1CI6 A;  1JY3 O;  4L75 A;  3VP9 A;  1M7L A;  1R8E A;  1OWA A;  3O8Z A;  1FZC B;  1SQX J;  3MUD C;  1HJ4 A;  2OZ1 B;  1SQX G;  4IL6 E;  2IFM A;  3CWB E;  3CU4 A;  3WFD C;  1QL2 A;  1OIP A;  1I6E A;  1OFC X;  1W2L A;  2GB8 B;  5K5G B;  5DJT B;  1H31 A;  1CZQ A;  1VPC A;  1YTZ I;  2HOD A;  1URQ B;  2CPB A;  1RE4 C;  1EDJ A;  2KP8 A;  4O1Q A;  4K3I A;  1CNO A;  3CX5 D;  5E79 H;  5E79 E;  3L75 D;  2Q3E A;  2Y9Y A;  1C7M A;  2E74 C;  1N2D C;  2KLU A;  3V2P A;  2R44 A;  1H9Y A;  4WQB A;  1GK6 A;  1SQQ J;  1KD1 Q;  3C1L A;  1SQQ G;  3CCR P;  1NOH A;  1VYD A;  3WMM 0;  1Y47 A;  3L73 J;  1I55 A;  1J1D C;  1HUC A;  3L73 G;  1SQB K;  3OJA B;  4OWF A;  5BU5 A;  3FXE A;  2H88 C;  3P8M C;  3LW5 H;  1IFM A;  1LTG C;  2W83 C;  1IQC A;  1MFZ A;  4AYC A;  1GU5 A;  1AVY A;  1C75 A;  3WUT A;  2FXP A;  2P2U A;  2FKW B;  2QG4 A;  3N4X A;  1CI6 B;  5AVW B;  2B87 B;  2I8F A;  1NTM E;  3TSI A;  2E74 B;  3RK3 E;  4OVN F;  1PGO A;  4NFG B;  1CSX A;  3WC8 A;  3SWK A;  3H32 B;  4LLH A;  1OVV A;  3EFF K;  1HWT C;  4W7Y A;  1HCM A;  2B12 B;  1J1D B;  4WBA A;  3USS A;  1A02 F;  3W68 A;  3NWV A;  1FE6 A;  2LXC B;  2PGD A;  1OVR A;  2C1V A;  2KS1 B;  2KUB A;  1RQV A;  1SS1 A;  1LNQ A;  4BWN A;  3BVH A;  2ZYG A;  2D2C D;  4WQ7 A;  3CCM P;  2PCC B;  1L0L K;  5GTI E;  5GTI H;  1DW2 A;  1U7M A;  3F89 A;  1RE3 A;  4HH2 A;  1SQV E;  2BLF B;  1PP9 J;  3HTK B;  4I7Z C;  1GU2 A;  1PP9 G;  5B66 H;  1IFI A;  3HQ9 A;  3NFQ A;  1VQ7 P;  2G8Y A;  1LJ2 A;  4AX3 A;  2B88 A;  5CCG D;  3Q5P A;  4WB4 A;  1YTC A;  2ZOO A;  3H1I J;  1NVO A;  3TNU A;  3H1I G;  1BSN A;  4K35 A;  2A45 H;  3U59 A;  2D0S A;  3OA8 A;  2P10 A;  3U1C A;  1RF1 C;  4EI2 A;  2BCC J;  1BE3 E;  2C2C A;  2BCC G;  3BAS A;  2B89 A;  1SQX D;  4MU8 A;  3CD6 P;  2J58 A;  1EQ7 A;  1FZF A;  3RN0 A;  4WQC A;  1DEE G;  3NBS A;  2R5D A;  5APS A;  3CXH D;  4OGQ D;  3AEG C;  4AUW A;  4I7Z B;  5AW3 B;  4BRY B;  4ZMD A;  4N6J A;  3KPE A;  4H0L D;  1VQ5 P;  1FHB A;  2N1T A;  1KIL D;  1B7V A;  1SQQ D;  4DT0 A;  4RO0 A;  3GW6 A;  2C8S A;  3L73 D;  3DP5 A;  2ZYD A;  3M06 A;  4UB8 E;  4UB8 H;  1RF1 B;  2XND H;  2A45 I;  4D6T E;  1JMB A;  2WSC J;  3I56 P;  1KX2 A;  1Q82 Q;  4NPF X;  1F1C A;  5CJ0 A;  1SFC C;  1USD A;  4QAO A;  5KJ7 D;  1N73 C;  5KJ7 C;  3L4F A;  2K37 A;  4OGQ B;  2WTY A;  5CBN A;  1CSB A;  3TGU J;  1FC2 C;  5KAF V;  3KDP B;  3RL0 C;  3TGU G;  1LTA C;  4PD4 D;  2YIU C;  3H1J J;  3L71 D;  4GT1 A;  3H1J G;  1H33 B;  2LXB A;  2YK3 A;  1GU4 A;  3H1K E;  1KX7 A;  1YHQ P;  1JY3 P;  3HD7 D;  2OYH A;  3V4W A;  5TJH A;  3SLE A;  1G1J A;  2BH5 X;  5KLV K;  5B6Q A;  4XYD B;  2CXB A;  4WQ9 A;  2Q9I A;  5BVZ A;  2YO2 A;  1SFC B;  3ABV C;  2NPS A;  1LTT C;  1L0L J;  1LWU B;  4PV1 C;  1N73 B;  2JP3 A;  1L0L G;  3VNW A;  5M1B A;  3MGN A;  1VQ4 P;  2JEE A;  1SQV K;  2OYH C;  1Q90 D;  1KZU B;  1PP9 D;  1COR A;  3SFE C;  1FAV A;  3GMA A;  2IX7 C;  3RL0 B;  2ZXE B;  1SP4 A;  1BGY E;  2YIU B;  2OQQ A;  1X22 A;  3H1I D;  3L70 E;  5CIB B;  1BL9 A;  1SQP D;  2JKV A;  3O5C A;  1FOC A;  1Q86 Q;  1CXA A;  1PGQ A;  4IL6 X;  2WT7 A;  3P8C D;  2NPS C;  2FYN B;  3TYY A;  2AXT V;  3CC7 P;  2E75 C;  2OYI B;  3WU2 E;  3WU2 H;  4WY4 C;  1YIT P;  5APQ A;  1QVF O;  1HRC A;  1BSH A;  3CWB J;  3V2N A;  1KTM A;  1KYO H;  3CWB G;  1CC5 A;  2K9J B;  3V2R A;  5B5E V;  2YKQ A;  5CCH A;  4WQA A;  2WSE J;  4FA9 A;  3G71 P;  4PV1 B;  1OX3 A;  2OYH B;  2ZXX A;  1CCR A;  3IR9 A;  2IYP A;  1MZ4 A;  1G2C B;  3CCE P;  1TU3 F;  1L0N K;  3IAO A;  1HF9 A;  3HE5 A;  1GW4 A;  1CIG A;  1G1I A;  2XDJ A;  1IFJ A;  1N86 A;  3CCS P;  1GIW A;  4YXW H;  5CCH C;  2KZI A;  3AE3 C;  1NIR A;  3CC2 P;  1HBW A;  4FAV A;  2E5Y A;  4WY4 B;  1MG2 D;  1X79 B;  1DIQ C;  2CK3 H;  4DCK A;  3HUS C;  1DD3 A;  3L74 E;  3LW5 J;  2LIR A;  1RAQ A;  3HQ8 A;  4WVZ A;  4GOD A;  1ZP0 C;  3E7K A;  1I5T A;  3RGU A;  2C9L Y;  1CTJ A;  5DJQ C;  2R32 A;  3VMY A;  3E1R A;  1S72 P;  1YEB A;  4YTP C;  3AEC C;  2QJY C;  1CTZ A;  2ZON G;  3TGU D;  1RZ6 A;  3ZIY A;  1PV3 A;  3B5N A;  1NTM J;  1T2K C;  1NTM G;  3AEF C;  4TT3 H;  2W27 A;  1N9C A;  2A06 E;  1AQ5 A;  2ZBO A;  1LC2 A;  1SQB E;  3AED C;  1YFC A;  1NMI A;  1GL2 D;  3T97 A;  2E76 D;  2E76 C;  1DW3 A;  2O1J A;  2P7J A;  4KHX A;  1U75 B;  2JR8 A;  5L8R J;  3OA7 A;  3HUS B;  2OAR A;  1I8O A;  3ORV A;  1L4A A;  1IFP A;  4DY9 A;  2YKO A;  1FJP A;  1MV8 A;  3AEB C;  3HE4 A;  2QJY B;  4LGD E;  1SQV J;  2MJZ A;  3GHG A;  1M1K Q;  2L5G B;  4FB1 A;  2O3J A;  3V6I A;  4V2K A;  5DJU B;  3L36 A;  2DW3 A;  2KSJ A;  1JY2 N;  2RN0 A;  3O20 A;  4H44 C;  3A0H E;  3A0H H;  2R5B A;  3Q5S A;  1P84 E;  1P84 H;  2C0W A;  1ZRT E;  4JYB A;  2Q6Q A;  3EWK A;  2KXP B;  1BE3 J;  1RY3 A;  3BCC E;  1BE3 G;  3K5B A;  2E76 B;  1I54 A;  3CCJ P;  3CWB D;  4UB6 H;  1EB7 A;  2JDI H;  3V5B A;  3CI9 A;  2BGV X;  5CIE B;  3A0B E;  2FFD C;  1F1F A;  2N3B A;  4N78 D;  1ZN5 A;  2ORL A;  3L72 E;  1C6R A;  1H32 A;  3OW2 O;  1NTK D;  1KV4 A;  1J3S A;  2O01 N;  3H1L E;  4U3F E;  2KIK A;  1QGK B;  1VQP P;  4DZO A;  3M91 A;  4H44 B;  3VTP C;  2Y0C A;  3PXS A;  1NH4 A;  4J20 A;  2N9J A;  1R5S A;  2IBZ E;  3TF5 A;  3KZI V;  2HFE D;  1HVV A;  2LKM A;  3FXD A;  4D6T J;  1SQP K;  5H2F E;  5H2F H;  3AE9 C;  4D6T G;  1M70 A;  1C52 A;  3LID A;  1P84 I;  1S5L V;  4GOE A;  4O1W A;  1S2E A;  4Y28 J;  1HJ0 A;  1QX8 A;  2FFD B;  2QJP C;  1QKS A;  2KNC A;  1C2R A;  2H43 A;  3WUU A;  1E79 H;  2E74 D;  2Y9Z A;  3BRT B;  4EDF A;  2I1J A;  1QLE D;  3RK3 C;  1ZME C;  1PZQ A;  2FY8 A;  3NMD A;  4FA1 A;  5CYT R;  3H1K J;  1WRG A;  3H1K G;  2WIT A;  2MHM A;  3PTZ A;  1RQU A;  4GDO A;  1W5C E;  4I6M C;  1N50 A;  1EXI A;  2C1D A;  2W90 A;  1FCD C;  2WWW A;  5CHX A;  2IBZ I;  1Y9B A;  2WPV B;  3DR0 A;  2Y0D A;  4PJ0 V;  4R4L A;  2HYN A;  1W2B O;  2QJP B;  3S1K A;  2HV4 A;  3CYT I;  2WSS H;  4L1Q A;  3VOP A;  1NKN A;  3A3Y B;  4KMG A;  1YJW P;  1A8C A;  2JTI B;  1LT1 A;  1DEB A;  1OW6 A;  3ITK A;  3PXW A;  1MUU A;  2V7Q J;  4HJG H;  1BGY J;  1SLQ A;  3VMX A;  1KQG B;  1BGY G;  3L70 J;  3RK3 B;  3L70 G;  2IDB A;  3FWL A;  5KLI C;  5AW1 B;  3CX5 E;  3CX5 H;  1GDT A;  5GTH V;  2GUS A;  5KAI E;  5KAI H;  1M57 D;  4H0J A;  2KYV A;  1AKK A;  1H31 B;  2VHD A;  1CO6 A;  5AW4 B;  1GDV A;  1FJK A;  1WT6 A;  2HOD B;  1DII C;  2EXV A;  5KLV E;  1OAE A;  2KZJ A;  1M60 A;  5AVT B;  2Z5I A;  1HGV A;  1S6V B;  4JPZ B;  4XA4 A;  1LFM A;  1S5L H;  3VMA A;  5CCG A;  2FYU K;  1GTW A;  3MK7 C;  1IZN B;  2BH4 X;  2K9Y A;  1LT9 A;  1NU1 K;  5B66 E;  1I8P A;  1JTH A;  2CPS A;  1EZV E;  1NTZ D;  1E5W A;  2M8R A;  4JQ0 D;  4IFF A;  2XZR A;  1K04 A;  4FA4 A;  1JY2 O;  3PXT A;  2N18 C;  1MG3 D;  4Y99 C;  4B86 A;  2H7H A;  3AE4 C;  3Q2Y A;  1CRH A;  1L2P A;  1FJ0 A;  1RE3 C;  1KB9 D;  3CX5 I;  4ASV A;  1X0T A;  1VF5 C;  3O6Q A;  3WFE C;  1N7S A;  1YTZ T;  3PP5 A;  1KB0 A;  3L74 J;  1S9K E;  2QJK C;  3L74 G;  3AE2 C;  1VDF A;  2NZ2 A;  3RK2 D;  5KTB A;  3RK2 C;  3JC2 2;  3MK7 B;  1FS0 E;  1WMK A;  1IRV A;  1KIL A;  2DVH A;  1NKZ B;  1NJI Q;  1H0T A;  1E8E A;  1L0N E;  1VQN P;  2M5A A;  4YPC A;  3JSV C;  5CBO A;  1N7S C;  3AEE C;  1WVE C;  1EZV I;  1X8Y A;  1NTK K;  4Y99 B;  2FXM A;  2A06 G;  1SQB J;  2BCN B;  3GG2 A;  1SQB G;  4DOJ A;  1DT1 A;  3ZOX A;  5APY A;  1S1C X;  5CJ4 A;  5AVS B;  2OYO A;  4C7N A;  1SFC D;  2V08 A;  2W6A A;  1PL5 A;  2WMM A;  5IY5 1;  2QJK B;  3TNU B;  2N1T C;  1JUN A;  5AW7 B;  5CIC B;  3RLM A;  1DW1 A;  3RK2 B;  2HR3 A;  3OA8 B;  1D7M A;  4GIF A;  3RL0 D;  3VYI A;  2GC7 D; 
#chains in the Genus database with same CATH homology
 4RJT A;  4UB8 V;  3NBT A;  2GIW A;  4FAV A;  3SWS A;  1MG2 D;  1DIQ C;  2FRC A;  3RMZ A;  3L70 D;  2LIR A;  1U74 B;  1RAQ A;  3HQ8 A;  4WQD A;  1QL4 A;  1CXC A;  4AAM A;  1I5T A;  1QN2 A;  5KAI V;  1CTJ A;  5DJQ C;  4GYD A;  3H1H D;  4JCG A;  1YEB A;  1FI7 A;  1R0Q A;  4Y5R A;  1CTZ A;  1NNO A;  2ZON G;  2PAC A;  1W5C T;  1KIB A;  3TGU D;  2C1D B;  1L0N D;  3ZOW A;  2Y0E A;  1RZ6 A;  3ZIY A;  1C6S A;  1CIF A;  1HZV A;  2B0Z B;  1CRY A;  1HJ4 A;  5KLI B;  2OZ1 B;  3CU4 A;  1CRI A;  3WFD C;  5DFS A;  1N9C A;  1I6E A;  1W2L A;  1LC1 A;  5TIS V;  2GB8 B;  2ZBO A;  1LC2 A;  4D6T D;  1KV9 A;  1H31 A;  1YFC A;  1NMI A;  2B4Z A;  2N9Y B;  3ZOY A;  3A9F A;  3RN1 A;  1DW3 A;  1RZ5 A;  4O1Q A;  1GQ1 A;  1HRO A;  4K3I A;  1U75 B;  1CNO A;  3CX5 D;  2B10 B;  4AAL A;  3L75 D;  2Q3E A;  1I8O A;  3JBT B;  1C7M A;  5DF5 A;  1H9Y A;  4WQB A;  1H33 A;  3ORV A;  1VYD A;  4DY9 A;  2BCC D;  2RMZ A;  1DVH A;  1I55 A;  4N0K A;  1YNR A;  2QJY B;  2PCB B;  3M97 X;  5CIH B;  3OCD A;  4FB1 A;  2O3J A;  2MTA C;  3CX5 W;  4V2K A;  2N18 B;  3H1K D;  1CIH A;  5CIG B;  1ZZH A;  2RN0 A;  3O20 A;  1GJQ A;  1IQC A;  1C75 A;  1C6O A;  1A2S A;  3WU2 V;  155C A;  2QG4 A;  1AOF A;  1I54 A;  351C A;  2I8F A;  3CWB D;  2L91 A;  1EB7 A;  1N15 A;  2AIU A;  2BGV X;  5CIE B;  1IO3 A;  1CSW A;  1LMS A;  1K3H A;  1F1F A;  4NFG B;  4EIF A;  4AAO A;  1L9B C;  2N3B A;  1CSX A;  3WC8 A;  2C9X B;  1E29 A;  1HCM A;  2B12 B;  2ORL A;  1CHI A;  1CSV A;  1C6R A;  1BGY D;  1H32 A;  1H9X A;  3NWV A;  1NTK D;  4AAN A;  2C1V A;  1J3S A;  1I6D A;  1HH7 A;  1YEA A;  5AUR A;  4WQ7 A;  2ZXY A;  1PPJ D;  1HJ3 A;  2PCC B;  1CYI A;  4PW9 B;  2Y0C A;  3PXS A;  4J20 A;  2N9J A;  1DW2 A;  3A0B V;  3TF5 A;  3KZI V;  1C2N A;  2BLF B;  2D0W A;  3H1J D;  1KYO D;  3ZBM A;  1GU2 A;  1C52 A;  1M70 A;  3HQ9 A;  4AX3 A;  1S5L V;  1YTC A;  2ZOO A;  2B11 B;  4O1W A;  5EXQ A;  3C2C A;  5KKZ B;  1AOQ A;  3KHU A;  3DMI A;  1QKS A;  2JQR A;  1CHJ A;  2D0S A;  451C A;  3OA8 A;  1ETP A;  1ZRT D;  1WEJ F;  1CCH A;  1C2R A;  2C2C A;  5CID B;  1KYO W;  4EDF A;  2C1U A;  1SQX D;  4MU8 A;  1YIC A;  1IRW A;  4RSZ A;  4IL6 V;  1L0L D;  1CYC A;  5DJQ B;  4EID A;  3RN0 A;  4WQC A;  4FA1 A;  5CYT R;  1FI3 A;  3NBS A;  3L4O A;  2MHM A;  3CXH D;  3PTZ A;  1N50 A;  1JDL A;  3L74 D;  2C1D A;  1BCC D;  1FCD C;  2DGE A;  3PH2 B;  5CIF B;  2OZ1 A;  5E79 V;  1HJ5 A;  3PLN A;  3DR0 A;  3PHL A;  2Y0D A;  1FHB A;  4PJ0 V;  1B7V A;  1SQQ D;  2QJP B;  2HV4 A;  3CYT I;  4L1Q A;  1COT A;  3GW6 A;  2C8S A;  4KMG A;  3L73 D;  3DP5 A;  1A8C A;  2JTI B;  3CXH W;  4WQ8 A;  4FA5 A;  4LJI A;  3WFB C;  3ITK A;  3PXW A;  1CYJ A;  4GED B;  1CTY A;  1KX2 A;  2A06 D;  2V07 A;  1SQB D;  1HZU A;  3TDK A;  1F1C A;  1N90 A;  3FWL A;  3TYI A;  5GTH V;  1H1O A;  2BPB B;  4QAO A;  3A0H V;  4H0J A;  1AKK A;  1CIE A;  1H31 B;  1L9J C;  2VHD A;  1CO6 A;  1GDV A;  4L3G A;  1DII C;  2EXV A;  4EIE A;  1NML A;  1OAE A;  3PRJ A;  1M60 A;  2XTS B;  5KAF V;  4PD4 D;  3HQ7 A;  3WFC C;  1RAP A;  3O1Y A;  1S6V B;  3L71 D;  2LIT A;  4UB6 V;  1LFM A;  1H33 B;  2CE1 A;  2YK3 A;  3X39 A;  3VMA A;  1FI9 A;  2CE0 A;  1K3G A;  1LS9 A;  1KX7 A;  3MK7 C;  4PWA A;  2BH4 X;  3ZCF A;  1IZL 0;  1I8P A;  5TJH A;  3SLE A;  3SXT A;  1NTZ D;  3OCD B;  2BH5 X;  5B6Q A;  4XYD B;  2CXB A;  4WQ9 A;  3VRD A;  3VYM A;  1P84 D;  2N9I A;  4FA4 A;  3PXT A;  2N18 C;  1MG3 D;  3BCC D;  3VNW A;  1CRH A;  5GTI V;  1FJ0 A;  1CHH A;  1KB9 D;  1NTM D;  1PP9 D;  1COR A;  3WFE C;  2GC4 D;  5H2F V;  2N3Y A;  2KS1 A;  4EIC A;  4FAN A;  5B66 V;  1KB0 A;  2YIU B;  2FYU D;  3H1I D;  3WUI A;  2AI5 A;  5CIB B;  1BL9 A;  1SQP D;  3O5C A;  2L4D A;  1FOC A;  3L72 D;  1NU1 D;  4P4Q B;  1CXA A;  1DW0 A;  3MK7 B;  2CA3 B;  4H0K A;  1IRV A;  2DVH A;  2FYN B;  1AYG A;  2AXT V;  1H32 B;  1A56 A;  5KLV D;  1CRC A;  3H1L D;  4U3F D;  4A7P A;  1E8E A;  1GKS A;  3HQ6 A;  1HRC A;  3O0R C;  1QL3 A;  1CC5 A;  1WVE C;  2K9J B;  2CA4 B;  3CP5 A;  2IBZ D;  5B5E V;  1CRG A;  2JWA A;  1YCC A;  4WQA A;  5C0Z A;  2FWL A;  2BCN B;  4FA9 A;  3GG2 A;  1SQV D;  1YIQ A;  4Q5P A;  4L3H A;  1M6Z A;  1DT1 A;  3ZOX A;  1QYZ A;  3ZOO A;  2YCC A;  1EZV D;  2YQB A;  5C9M A;  1CCR A;  1MZ4 A;  1CRJ A;  2V08 A;  5IY5 1;  3L4M A;  1DVV A;  4XXL A;  1CED A;  2QJK B;  1CIG A;  3SJL A;  5CIC B;  1OCD A;  1CSU A;  3RLM A;  1DW1 A;  1E2R A;  2KNC B;  4YE1 A;  1BE3 D;  3OA8 B;  1GIW A;  4WQE A;  2ZZS 1;  3SVW A;  2GC7 D;  1NIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...