5KLVD

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5klvD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5klvD02
2B12B 1YTCA 4A7PA 2JQRA 3L4MA 1A8CA 5CIHB 1HH7A 2B4ZA 5C9MA 1DW2A 3WU2V 3ZOWA 1LS9A 1FI3A 1H32B 5CYTR 3ZOOA 4L1QA 5B6QA 1C7MA 1CCHA 3VRDA 1U74B 1CRGA 1KYOW 1L0LD 1CRJA 2ZOOA 2JTIB 3O0RC 3HQ9A 2PCBB 1CSWA 3OA8A 2C1DA 2DGEA 5CIDB 3L73D 3SXTA 5B5EV 2MTAC 2YK3A 4V2KA 3VYMA 4D6TD 1I5TA 1MG3D 4WQ8A 5CIBB 2B0ZB 1KYOD 1SQPD 1I6EA 1E8EA 3DR0A 1FI9A 1SQBD 1CRHA 1H33A 4FAVA 3H1JD 5KLVD 3H1ID 1NTZD 1CIEA 1L9BC 2CE0A 2YQBA 1GIWA 5EXQA 3PTZA 1N15A 1BCCD 4WQAA 4Y5RA 4EICA 3HQ6A 1NIRA 4AX3A 155CA 5E79V 4FA4A 1HRCA 5GTHV 3CXHW 4UB8V 2V08A 2L4DA 5AURA 3GG2A 2N18B 4AANA 1VYDA 1BGYD 1LMSA 5CIFB 3CWBD 3ZIYA 2C2CA 1NNOA 1S5LV 1L9JC 4AALA 3PHLA 1YICA 5DJQB 2N3YA 4YE1A 1RZ6A 1CORA 2L91A 3A9FA 5KKZB 1OCDA 3O20A 4EIFA 4FANA 1CEDA 2ZONG 3TYIA 2N3BA 1IQCA 5KAIV 1HZUA 3PXSA 3DP5A 1CSVA 3L75D 1U75B 4WQCA 1CXAA 3NBSA 4N0KA 3RMZA 1FCDC 1C75A 2CXBA 5H2FV 1H1OA 2DVHA 1F1FA 2N9IA 4WQ9A 4K3IA 1FJ0A 2C8SA 1L0ND 4EIDA 4WQDA 3OA8B 1N50A 2C1DB 2C9XB 1C2NA 3MK7C 2AXTV 5TISV 3WFEC 4P4QB 2C1UA 4L3HA 5IY51 1ZZHA 4XXLA 4GEDB 1CRYA 2QJKB 1DIIC 2PCCB 2EXVA 4O1WA 1C6RA 1WVEC 1CCRA 4H0JA 4AAMA 1HCMA 4PJ0V 1CIFA 3VMAA 1JDLA 1MG2D 1KX2A 2OZ1A 2CE1A 1CSUA 1CNOA 1ETPA 3TF5A 1HJ3A 4RSZA 1SQXD 1RZ5A 1M70A 1K3HA 1B7VA 3CX5W 2YCCA 2HV4A 1J3SA 1RAQA 4EDFA 1NMLA 1CHIA 1DW0A 2KNCB 1LC1A 1K3GA 4UB6V 1KB9D 3SLEA 3GW6A 1CYCA 3WFCC 3RN1A 1EB7A 5KAFV 1DT1A 3PXWA 3CX5D 3NBTA 3RLMA 1IRVA 3FWLA 4MU8A 1AOQA 3ITKA 3PH2B 4PW9B 1RAPA 2N9JA 1A56A 3C2CA 1QL4A 3RN0A 1NTMD 3SJLA 3L4OA 2ORLA 3WFBC 1I6DA 2KS1A 1GDVA 3WC8A 3ZOYA 3ZOXA 3ORVA 2JWAA 2N18C 3PRJA 2MHMA 3NWVA 1N9CA 1I8PA 2GB8B 4QAOA 4Q5PA 2GC4D 4FA9A 1GU2A 1HJ5A 1QKSA 4L3GA 2Y0DA 4JCGA 1DIQC 3JBTB 3TDKA 1C6SA 3KHUA 4IL6V 1CRCA 1QN2A 5CICB 1CC5A 5DJQC 2GIWA 1P84D 1AYGA 1CYJA 4PWAA 1NMIA 3H1LD 1KB0A 1NU1D 1IZL0 2Y0EA 4LJIA 2K9JB 2FYUD 3L74D 2PACA 5TJHA 1BL9A 4GYDA 3SWSA 3PXTA 1LFMA 1I8OA 5GTIV 4U3FD 2VHDA 4WQBA 4WQEA 1S6VB 3L72D 1CYIA 1FOCA 1H31A 2C1VA 1YIQA 1CXCA 3OCDA 1YFCA 3DMIA 1C52A 1YEBA 2B11B 1H33B 2B10B 1CHJA 3HQ7A 2BGVX 1W5CT 2BH5X 2XTSB 1H9YA 4KMGA 1E2RA 2BPBB 2GC7D 1E29A 2BH4X 2Q3EA 1CTJA 2ZXYA 1ZRTD 1I54A 1OAEA 1QYZA 2FWLA 2QG4A 1HZVA 1GQ1A 1AOFA 3TGUD 3A0HV 3L70D 2V07A 1HROA 2FYNB 3KZIV 2AIUA 1R0QA 3CP5A 1F1CA 1C2RA 1H32A 4J20A 4FA5A 3H1KD 1DW3A 3WFDC 1CIHA 1SQQD 5CIGB 1IRWA 2QJYB 1QL3A 1GKSA 1KX7A 2D0SA 1CHHA 1YEAA 4PD4D 1C6OA 1M60A 1CTYA 2A06D 2D0WA 3L71D 5C0ZA 2BLFB 4XYDB 4WQ7A 3ZCFA 3SVWA 1CTZA 1DW1A 1YNRA 4NFGB 3HQ8A 2I8FA 3H1HD 2RMZA 1I55A 4DY9A 1PP9D 1CRIA 2LIRA 2ZZS1 3BCCD 5B66V 1CO6A 2LITA 5DF5A 1EZVD 2FRCA 451CA 1CIGA 1CSXA 1PPJD 1SQVD 2RN0A 2IBZD 1FI7A 3X39A 2N9YB 2BCCD 4FA1A 4H0KA 2Y0CA 3CXHD 1H31B 5KLIB 1M6ZA 2CA3B 3OCDB 2O3JA 1BE3D 5CIEB 1H9XA 1LC2A 4EIEA 1FHBA 2BCNB 1W2LA 1DVVA 2YIUB 1NTKD 1KIBA 3MK7B 1A2SA 4FB1A 3VNWA 1MZ4A 1IO3A 2AI5A 1YCCA 3PLNA 5DFSA 1N90A 3CU4A 1GJQA 3CYTI 2OZ1B 3ZBMA 3M97X 3O5CA 1DVHA 2QJPB 351CA 3O1YA 4RJTA 4AAOA 3WUIA 1KV9A 2CA4B 1COTA 4O1QA 2ZBOA 1WEJF 1AKKA 1HJ4A 3A0BV
chains in the Genus database with same CATH superfamily
4PV1D 2K88A 3FXDA 4A7PA 4IL6X 4XA4A 1A8CA 1JB0J 1FI3A 5CYTR 3WMM0 4R4LA 4B86A 1C7MA 1NTMJ 1CCHA 4N3YB 3VRDA 1QL2A 1VQLP 2ZOOA 3B8EB 1GMJA 2PCBB 1CSWA 4EYYQ 1Y8AA 4WY4B 1N2DC 5B5EV 2YK3A 4NPEA 4D6TD 1NOHA 3WU2E 4DT0A 1AA0A 5DJUB 1LT9A 1SQBG 3RK2D 1JCCA 4LGDE 1WMKA 1NTZG 2KS1B 2Y9ZA 1FI9A 2P10A 2WITA 1KYOI 3A7OA 1GL2A 1JY2N 1IFIA 3H1JD 4U7JA 5KLVD 3CCRP 3H1JE 2FYNC 1CIEA 4PD4E 1L9BC 5KLVE 4K35A 2WSCJ 2JEEA 1DEEG 4AYCA 3B71A 3L71E 4WQAA 4Y5RA 1DEBA 1URQD 2I8DA 1LTAC 1OW6A 1RF1C 3HQ6A 4ASVA 1GZLA 2KP8A 2FKWB 3QWOC 1FZCC 3CXHW 2V08A 1EZVG 3JCUH 2Q9IA 1L0NK 4AANA 2OQQA 1BGYD 3M9HA 1BGYE 2BCCG 1FJKA 1HJ0A 4GT1A 1X22A 1YICA 1FBMA 1SQVE 2L91A 4EIFA 1NKNA 4FANA 5AVWB 2IFMA 3TYIA 1USDA 2N3BA 1KILC 2IBZI 3Q5RA 3EFGA 2WPSA 4H44D 1NTKE 4WQCA 1FCDC 2I1KA 1F1FA 2N9IA 2XKMA 3HUSA 2OYOA 2W83C 3M91A 3BVHA 4EIDA 1FDOA 2OYHB 4WQDA 3OA8B 3SWFA 1N50A 1OX3A 5BU8B 2E76D 1GL2D 1C2NA 4WVZA 3RBXA 5TISV 3WFEC 4L3HA 2OTKE 5IY51 1ZZHA 4XXLA 1L4AD 2O01H 5H2FE 2QJKB 1FZFA 1IFPA 4O1WA 1LP1A 3R2PA 1WVEC 2OTLP 2KLVA 3WUUA 3F5HA 4C7NB 3AE8C 1EDKA 1HCMA 5BU5A 1N8RQ 3GMAA 4W7YA 3HD7B 1AFOA 2M3BA 2AXTE 1H0TA 1X79B 1ETPA 1HJ3A 1NTMK 4C46A 4RSZA 1SQXD 1M70A 1EDJA 2JP3A 1JM0A 5AW6B 5APQA 4WY4C 1KC8Q 2YCCA 1VDFA 1J3SA 1RAQA 1OXZA 1H88A 4UB6V 1FS0E 1ZXGA 3SLEA 3M0DC 3CWBG 3RN1A 2BEZF 3CX5D 3NBTA 5CHXA 1IRVA 1KB9I 3CX5E 1NU1K 2O01J 2KIKA 1GK6A 2N1TB 1VQ5P 3RN0A 1H89A 2HLOA 4OGQD 3D6ZA 2KZJA 3RBZA 3OAKA 3WFBC 1I6DA 3HTKB 2WT7B 2IFNA 3ZOYA 1QL1A 2XU6A 3FX0A 1X8YA 2KOGA 1PGPA 4Q5PA 3KXDA 1RF0C 1QKSA 1KMIZ 4IOIH 3KHUA 3D70A 2PP6A 1QN2A 2FYUG 2GIWA 1Y9BA 1CYJA 1YJ9P 4OVNF 1S5LX 4LLHA 4AUWA 1SQBJ 5TJHA 1LFMA 4IFFA 4I2LC 1NTZJ 1S9KD 1S6VB 3L72D 1CYIA 3L72E 1PGJA 4IL6E 1H31A 3OCDA 1YFCA 1YJWP 2NRGA 2QVAA 4IL6H 2B10B 2OYHC 2D2CD 1S1CX 4XFJA 3I5CA 2BGVX 1CSBA 1RE4A 3QH9A 1JUNA 1H9YA 1E2RA 3L70G 2GC7D 2QJKC 3AECC 1E29A 1Q90D 2BCCJ 1DIPA 5TISH 1OAEA 1QYZA 1HZVA 1AOFA 3TGUD 1NHLA 2UWJE 1JY2O 2QRXA 1LTJA 1EQ7A 1NKZB 1JOCA 2KYVA 4J20A 1FE6A 4HJGH 5AVRB 3HD7C 3MGNA 3V4WA 4N6JA 1CIHA 1SQQD 1SQVK 1IRWA 1YTZT 1FAVA 1Y47A 2PFXA 2ZVOB 3L35A 2NPSB 2E75D 2Y9YA 2D0SA 1CHHA 1JY2P 1GTWA 3AE5C 4EI2A 3KZIE 2BASA 2A06D 2E5YA 3LW5H 3ZCFA 1VQPP 1CTZA 3RL0B 4NFGB 4DJGA 2HODA 2RMZA 1KORA 2LITA 1LT1A 5DF5A 2FRCA 2KNCA 1AVOA 2KXPB 1D7MA 1BE3G 2P58A 3M9BA 2N1TC 2IBZD 1FI7A 3X39A 1NU1G 2R5DA 2M3EA 1M6ZA 2CA3B 1AV1A 1H9XA 1LC2A 2VRSA 3H32B 3H1LE 3CCLP 3B5NA 2OYIA 1P84I 1A2SA 2AI5A 1R5SA 1YCCA 1WRGA 3CU4A 1GJQA 2OZ1B 4U3FE 3M97X 2KSEA 2L5GB 4I6MC 3D0WA 1COTA 1YITP 3HE4A 1SFCA 2B12B 4LC1A 2JQRA 1SQBK 2B4ZA 2JJLA 1K04A 3WU2V 3CWBJ 1LS9A 1NTZK 1FC2C 3ZOOA 4L1QA 1K8AQ 5B6QA 2FXOA 3V2PA 5AW8B 3GHGA 3V6IA 1KYOW 1L0LD 1YHQP 1BSHA 1L0LE 3O0RC 2A45G 1JMBA 1ZRTE 4PV1B 1LWUB 2DGEA 3L73D 1RE3C 2B88A 4N78E 3MIWA 1MG3D 4WQ8A 2B0ZB 1PGQA 3OW2O 1IK9A 3AE3C 3H1JG 1CI6A 1ZMEC 5KLVG 3MUDC 1I6EA 1FZBA 1RH5B 3L71G 1H33A 3H1ID 5CCGC 2ZYGA 3B5ND 3CL3D 3H1IE 4GIFA 2FYUJ 1HBWA 1JEKA 4KT0J 2YQBA 1GIWA 2Q7CA 2PAJA 1Q2NA 1BCCD 2E43A 1N7LA 1BCCE 1BGYG 155CA 1NWQA 1N73A 1J1EB 5AURA 2HFED 1VYDA 2NPSC 3A5TA 1PP9E 3FXEA 1SQVG 3TNUA 2WSSH 2JKVA 2J59M 3U1AA 4L74A 1RF1A 1RY3A 2AEJA 1URQB 1NNOA 1L9JC 3O6QA 1PPJE 5DJQB 1OZHA 1E5WA 2N3YA 5AVYB 1YQ3C 4YE1A 1EZVI 3RL0C 1VQOP 1NTKG 5KKZB 1OCDA 3CXHE 1MKMA 5APXA 4W7ZA 2HYNA 2H8PD 1HZUA 4WWIA 3DP5A 1CSVA 3L75D 1R8EA 3MP7B 3OA7A 3L70J 3L75E 2Q6QA 1M1JB 4N0KA 1C75A 1T8ZA 5H2FV 5L8RJ 4WQ9A 3M0AA 1M57D 1S5LH 3Q1MA 5KAIE 4H44B 2AXTV 4P4QB 2C1UA 1NJIQ 1YJNP 4GEDB 1HVVA 1KD1Q 1HGZA 2PCCB 4TT3H 2E76B 1GL2B 1U7JA 5C39A 2K9JA 1CIFA 3RK3D 1HWTC 2YNYA 3RK3E 2XZRA 1MG2D 1K05A 1L4AB 1CSUA 3LIDA 3MHVA 1RQVA 3CC4P 4D6TE 5EFWB 1NGMB 1T3UA 3N4XA 3G4SP 1OW7A 4O9BA 2DW3A 2A45H 2W27A 1K3HA 3WU2H 1BE3J 3CCSP 3MD0A 4PV1C 2P67A 2HV4A 1LWUC 3CMAP 1NU1J 4EDFA 1T3JA 2HR3A 1DW0A 3TK1A 1QX8A 1KQFB 2B87B 1K3GA 1T6AA 3GW6A 4PD4H 1DT1A 5AW1B 2GA1A 1PL5A 3AEDC 4WY4A 2E42A 3FWLA 2M8RA 4RO0A 1AOQA 3ITKA 3PH2B 2LXBA 2R3CA 2FYUK 1PIXA 1KQLA 1ZR4A 1HGVA 1ZN5A 3T97B 2KS1A 1EDLA 5AW3B 5KAFE 3V2QA 1J1EC 5CMZA 2IYPA 3PRJA 3NWVA 1LGHB 1PFIA 1I8PA 2GB8B 1JTHA 2P2UA 5KAFH 5M1BA 2G8YA 4L3GA 4OGQB 2Y0DA 2YMKA 1DIQC 3JBTB 3TDKA 1URQC 4Y99B 1QEXA 4IL6V 5CICB 1CC5A 5DJQC 3IR9A 1P84D 4PWAA 2NZ2A 5KKZC 1LP1B 1VQ6P 1NMIA 4L73A 1KB0A 1IZL0 2C0XA 2Y0EA 3L72G 3IAOA 3L74D 2PACA 3SWSA 3L74E 3PXTA 2K9YA 3H1JJ 5KLVJ 2WTYA 1T2KD 1M1JC 1H0TB 2VHDA 4WQEA 3L71J 1X0TA 3F89A 1FOCA 2IX7C 2C1VA 1CXCA 1VQ8P 3DMIA 1FZEA 5H2FH 4WY4D 4JYBA 1YEBA 1VL2A 1NH4A 2GUVA 2YKQA 3HQ7A 1VQMP 1BGYJ 4H44C 1JO5A 1SS1A 2IZ0A 3CCQP 2V4HA 4KMGA 2H89C 3M06A 4GOFA 5AVVB 1SQVJ 2BH4X 3SWYA 2Q3EA 2ZXYA 1SQXE 2AXTH 3BATA 2YXRB 3LIEA 2FWLA 1GQ1A 1RHZB 2D2CB 3KZIV 2E76C 1GL2C 1NYHA 1R0QA 2J5UA 1N7SB 4HYTB 1C2RA 2WVRA 1NTKJ 1H32A 4FA5A 1IC2A 3H1KD 1L4AC 2W6BA 3H1KE 1XTCC 3IN6A 2QM8A 3WFDC 5CIGB 2C0WA 3BASA 1BSNA 1LTIC 1MFZA 1IFJA 1N86A 4ZMDA 1C6OA 1IZNB 3HD7A 3CX5H 2BLFB 4WQ7A 3SVWA 3CPWO 1DW1A 1VF5D 1QLED 1S4XA 2JO1A 4TLFA 3H1HD 1IJDB 3H1HE 2B89A 4DY9A 2E75B 2I1JA 2LIRA 1KN7A 3BCCD 2O01N 3BCCE 2R32A 3AEAC 1EZVD 451CA 1IK7A 2RH0A 2QA4P 2QE7H 3H1LG 3GF3A 1VQ7P 2WMMA 1Q82Q 2BCCD 2Y0CA 2XNXA 1LTGC 1H31B 3OJAB 3RGUA 2POHA 3H6PA 4NPFX 3OCDB 1HJBA 5CIEB 3U59A 4EIEA 5AW2B 4U3FG 2YXQB 2M5AB 2HG5D 3JC22 3MTUE 2QM7A 3VNWA 5B66E 2V7QH 3ABVC 1MZ4A 4DZOA 4OGQC 3ZBMA 1S9KE 3O5CA 1DVHA 4NPDA 3O1YA 4RJTA 4AAOA 4Y99C 1R5LA 3HTKA 1KV9A 4MN4C 4ASWA 4H0LD 1XTGB 1HJ4A 4RKUJ 3CCMP 1L0LG 1HH0A 5KLVK 2FXMA 1JCDA 3HD7D 3SSUA 3W68A 1FOSF 1U74B 4BRYA 4C7RA 2YKOA 2MKVA 3HQ9A 2E74D 3VP9A 5AW7B 5KTBA 3C9IA 3EFFK 2C1DA 4H13D 3TGUE 4AQRD 4V2KA 1NVOA 2Q1KA 3B4SA 1PZQA 4HKZH 5CIBB 1KYOD 2A45I 2OARA 3RL0g 1SQPD 1KYOE 3H1IG 1SQQE 1SQPE 2V7QJ 1CRHA 4ZKUA 2K1AA 4FAVA 1BCCG 1OWAA 2D2CC 1DD4A 2FBWC 3SWKA 1K9MQ 3V5BA 1QVFO 2HPCB 3Q5SA 1NTKK 1N7SC 1N15A 2A06E 2FFDB 4EICA 1PP9G 2R5BA 4PD4I 1NIRA 4AX3A 3KZIH 2LR2A 3L72J 2KUBA 2L4DA 3S4RA 1S3JA 2N18B 5APUA 2ITAA 1PPJG 3HE5A 5CCGA 1LMSA 5CIFB 2ZT9D 3CWBD 3B5NB 1QVGO 1G2CB 1M8OB 1S5LV 4AALA 4IFMA 2IBZE 1RZ6A 1CORA 3L75G 5E79E 2PRRA 3E1RA 1CEDA 5GTHE 2ZONG 3AE6C 4UB8E 5DJTB 3HE4B 3H25A 1IQCA 5KAIV 2E75C 1BDDA 3P32A 5E79H 1Q86Q 4GDOA 4Y28J 1JY3N 5GTHH 3NBSA 3A2AA 2ZXEB 2Z5IA 1H1OA 2DVHA 1ZLLA 2G3AA 1GU4A 1NAFA 4KJMA 2CPSA 2C8SA 3GHGB 1QGKB 1L0ND 2KB7P 1L0NE 1FDIA 5APYA 1GDTA 3IF4A 1BDCA 1VQ4P 5AW9B 3LW5J 2WSEH 1Q81Q 4JQ0D 2GUSA 3UIAA 1RE4C 5CCHA 1DIIC 1CI6B 5APWA 1C6RA 1CCRA 4H0JA 4AAMA 1W5CE 4D6TG 4GOEA 3AE7C 3NTNA 2OTJP 5CCGD 2M0BA 3VMAA 2YMYA 3L73E 4JPZB 1KX2A 2OZ1A 2CE1A 5AVZB 3VTPC 1CW5A 1CNOA 2LKMA 3D6YA 3VMZA 3TF5A 1RZ5A 1N73B 3V4QA 5CJ4A 2IZ1A 3RK3B 3TNUB 3H1LJ 3Q5PA 4PJ0E 3CCUP 1NMLA 3CC7P 3RK2B 3O6QB 1KB9D 5AVTB 2QSIA 4U3FJ 1KB9E 4PJ0H 1YI2P 1X9VA 1EB7A 5KAFV 3PXWA 1KV4A 1CZQA 3VP8A 1TU3F 4MU8A 2WSEJ 4K3AA 3C8VA 4PW9B 1SFCD 1RAPA 2N9JA 4OWFA 1A56A 1DX7A 1ZP0C 1NTMD 1NTME 3SJLA 1FZCA 2FFDC 4EOTA 2ORLA 4YTPC 5CCHD 3WC8A 1IFDA 1IFNA 3CLQA 1L0LJ 3ZOXA 3ORVA 4IFDK 1NAYA 4W80A 2JWAA 2N18C 1N9CA 2O1KA 4ZKPA 4FA9A 3B5NC 3CXHH 1GU2A 1HJ5A 2N9BA 2AEFA 1CRCA 5KJ7C 5AVSB 3L74G 3PH0A 1KILA 4XE5B 2ZYAA 2K37A 2OGUA 1NU1D 3PP5A 4LJIA 2K9JB 1BL9A 4GYDA 3BRTB 1KTMA 4QMAA 2FYZA 3H1IJ 2W8ZA 4GODA 4WQBA 5KAIH 1LT9B 3AE9C 1BCCJ 1GD2E 2WSFH 1LTTC 3GHGC 1SQQK 3AE1C 3GLMA 1C52A 4WB4A 2H7HA 2B11B 1CHJA 1PP9J 4WBAA 3AEEC 3USSA 1M1JA 1YIJP 1SQXG 1RQUA 1PV3A 3HRNA 5GTIE 4R4MA 1W5CT 2BH5X 2XTSB 3II6A 1G1IA 2BPBB 3P8CD 2E5TA 3CCVP 5AW0B 2YO2A 3P8CE 1CTJA 4JBZA 5GTIH 3Q2YA 2QG4A 3M9QA 1G1JA 3H1KG 3WUTA 2YKPA 1HROA 2AIUA 3TSIA 1L2PA 1MFTA 3L75J 5CBOA 3I55P 3CCJP 1GW3A 3Q3DA 1DW3A 3KYQA 2QJYB 1QL3A 1YBKA 2W90A 3L4FA 1N73C 1KILD 1KX7A 1KILE 4PD4D 3A0HE 3CC2P 4YPCA 3RK3C 1M60A 1JTHB 4L76A 4M3LA 3PJSK 1L4AA 1DD3A 3H1HG 3L71D 2WSFJ 3JCUE 5AVXB 4BWNA 3A0HH 4XYDB 2AEMA 3RK2C 1SVFA 3M0DA 3BCCG 3HUSB 1ZW0A 5AW5B 2CPBA 2O1JA 1I55A 1PGOA 4I7ZB 1Z56A 2J58A 1CRIA 1WT6A 3NMDA 5B66V 1CO6A 1JY3O 1CIGA 2WQYC 1CSXA 2B87A 3G71P 1SQVD 2KLUA 1VF5B 4FA1A 4D6TJ 4H0KA 5KLIB 2O3JA 1L0LK 1P84E 2BCNB 3E1IA 1W2LA 1DVVA 1M1KQ 2YIUB 1KQGB 1NTKD 1LTSC 1KIBA 3MK7B 1RF0A 1IO3A 1P84H 1JY3P 3PLNA 1N90A 1M7LA 2ZFCA 2H88C 2QJPB 351CA 4GKGA 3T97A 3WUIA 1AVYA 4O1QA 4ZNCA 1WEJF 3NFQA 3GF7A 2IPPA 1OMIA 3AEBC 2QIWA 1YTCA 3L4MA 2WWWA 5CIHB 1HH7A 1KQSO 5C9MA 1DW2A 3ZOWA 1H32B 4L75A 3TGUG 3KPEA 1VQKP 1LT9C 2ZYDA 1CRGA 4H0LB 1CRJA 3G6EP 2JTIB 2FY8A 1IO4A 3EQ2A 2OYHA 3OA8A 3A0BE 5AVUB 5CIDB 3SXTA 4CPGA 2MTAC 1SQQG 2KZIA 1SQPG 3VYMA 1T2KC 3A0BH 1I5TA 3CCEP 2E74B 2CK3H 1E8EA 3DR0A 2A06G 1SQBD 1KFNA 4H13B 4C7NA 1SQBE 1NTZD 1LNQA 2CE0A 5B5EE 1NTZE 3L74J 1AQTA 1GW4A 5EXQA 3PTZA 2SPZA 2KI7B 2P1JA 5E79V 5B5EH 4FA4A 1HRCA 5GTHV 1ZR2A 4UB8V 2QJYC 1Q7YQ 2WPRA 3GG2A 1MZ9A 3L36A 1DH3A 2IBZG 2Q3IA 3ZIYA 1LJ2A 2Z4EA 1N7SA 1VQ9P 1KZUB 2MJZA 1EZVE 2C2CA 3PHLA 1U7MA 4DOJA 3A9FA 2BCCE 3HUSC 3V2RA 3O20A 2XDJA 1SQXJ 2ZT9B 4I7ZC 1GU5A 1S72P 3PXSA 3CXHI 1OIPA 1U75B 1CXAA 1L0NG 2N1TA 3BRVB 3RMZA 2CXBA 1HUCA 1U57A 1VF5C 3H1KJ 4K3IA 1FJ0A 5B66H 3VMYA 2WT7A 4BRYB 3KDPB 5KLIC 3FGAD 1SP4A 2C1DB 2YIUC 2C9XB 3N7NA 1USEA 1LTJB 3MK7C 3G9RA 2ZVNB 3NXSA 1CRYA 3C1LA 5K5GB 2QJPC 3L73G 1MV8A 2EXVA 3G3ZA 1EC5A 3H1HJ 2M5AA 2JWDA 4PJ0V 4HB1A 4BXLA 2R3SA 3BCCJ 1JDLA 1N7SD 2KK7A 5TISE 1ZOYC 1SLQA 2WPVB 3AE2C 1GK4A 3P8MC 4EIJA 4H0LC 1OW8A 1B7VA 1W2EA 2HODB 3CX5W 3CMEP 1RE3A 3HE5B 1KYOH 1KFMA 2C9NY 1S2EA 3VMXA 3AEGC 1CHIA 5APSA 2KNCB 1K73Q 2N1TD 1LC1A 2WPQA 3FWNA 2XV5A 2LXCB 3MUDA 1CYCA 3WFCC 3RLMA 2E74C 1HTLC 2JDIH 1FJPA 1NTMG 4KHXA 4H13C 3SFEC 2OYIB 1EXJA 4HH2A 3CWBE 3C2CA 3A3YB 1QL4A 2H43A 3L4OA 4UB6E 1OVRA 2R44A 4DCKA 1GDVA 2Q5UA 2NPSA 1J1DB 1FOSE 4UB6H 2MHMA 1SFCB 1FZGA 2W6AA 4QAOA 3TGUJ 2GC4D 1OFCX 2HPCA 3I56P 4UB8H 2FFDA 4JCGA 1C6SA 2FXPA 3IFMA 1NO4A 3S1KA 2K3RA 3E7KA 1AYGA 2QEXP 1SQQJ 1ZV8A 1SQPJ 1OVVA 3H1LD 1M90Q 1SQXK 2YO3A 1UIIA 1VPCA 2ZT9C 5APTA 2FYUD 1G2CA 2FYUE 1I8OA 3KQGA 5GTIV 1A02F 4U3FD 5BVZA 5KJ7A 1UIXA 1OVUA 4I1LA 3MZWB 1JMMA 1HF9A 1YIQA 1H8AA 3VYIA 2IDBA 5CBNA 3EWKA 3TYYA 3H32A 1H33B 3S9OA 1FZAA 5AVQB 1LTJC 4Z1MH 1IFMA 1ZRTD 1I54A 3A0HV 3L70D 2NPSD 3W67A 4JYCA 2V07A 3L70E 2FYNB 4N78D 1W2BO 3CP5A 1F1CA 2XNDH 3ZDMA 1RF1B 2RKLA 1YTZI 1FZCB 5CJ0A 4OH8B 4JF7A 3RL0D 2WZ7A 1GKSA 1AQ5A 3O8ZA 1L0NJ 1JNMA 1LWUA 1KB9H 1EXIA 1YEAA 2C9LY 2KSJA 3L37A 3AE4C 2ZAEB 1CTYA 2PGDA 3CX5I 1M56D 2D0WA 2Z5HA 5C0ZA 1FDMA 3D71A 3WUVA 3SFDC 2B9BA 5KJ7D 1YNRA 3HQ8A 2I8FA 1KILB 4YXDC 1E79H 1PP9D 2ZZS1 2P7JA 3R4YA 5AW4B 5APVA 1MUUA 2ZJSE 1YQ4C 4YXWH 3V2NA 1VQNP 1EDIA 2OYIC 3L73J 1PPJD 2GM4A 2RN0A 2JR8A 2N9YB 2AXCA 3CXHD 3CD6P 1LTBC 1BE3D 1YYCA 1BE3E 1FHBA 3AEFC 1J1DC 1NU1E 1SFCC 4RESB 3VN0A 4FB1A 3JSVC 3VOPA 5DFSA 2BEQD 2W6JH 3CYTI 1URQA 2ZXXA 1FU1A 1S5LE 1AJYA 3U1CA 2WSCH 1J2JB 5CCHC 3K5BA 2CA4B 3P7KA 2ZBOA 1A02J 2IYOA 1AKKA 1SQPK 3CI9A 3A0BV
chains in the Genus database with same CATH topology
2B12B 1YTCA 4A7PA 2JQRA 3L4MA 1A8CA 5CIHB 1HH7A 2B4ZA 5C9MA 1DW2A 3WU2V 3ZOWA 1LS9A 1FI3A 1H32B 5CYTR 3ZOOA 4L1QA 5B6QA 1C7MA 1CCHA 3VRDA 1U74B 1CRGA 1KYOW 1L0LD 1CRJA 2ZOOA 2JTIB 3O0RC 3HQ9A 2PCBB 1CSWA 3OA8A 2C1DA 2DGEA 5CIDB 3L73D 3SXTA 5B5EV 2MTAC 2YK3A 4V2KA 3VYMA 4D6TD 1I5TA 1MG3D 4WQ8A 5CIBB 2B0ZB 1KYOD 1SQPD 1I6EA 1E8EA 3DR0A 1FI9A 1SQBD 1CRHA 1H33A 4FAVA 3H1JD 5KLVD 3H1ID 1NTZD 1CIEA 1L9BC 2CE0A 2YQBA 1GIWA 5EXQA 3PTZA 1N15A 1BCCD 4WQAA 4Y5RA 4EICA 3HQ6A 1NIRA 4AX3A 155CA 5E79V 4FA4A 1HRCA 5GTHV 3CXHW 4UB8V 2V08A 2L4DA 5AURA 3GG2A 2N18B 4AANA 1VYDA 1BGYD 1LMSA 5CIFB 3CWBD 3ZIYA 2C2CA 1NNOA 1S5LV 1L9JC 4AALA 3PHLA 1YICA 5DJQB 2N3YA 4YE1A 1RZ6A 1CORA 2L91A 3A9FA 5KKZB 1OCDA 3O20A 4EIFA 4FANA 1CEDA 2ZONG 3TYIA 2N3BA 1IQCA 5KAIV 1HZUA 3PXSA 3DP5A 1CSVA 3L75D 1U75B 4WQCA 1CXAA 3NBSA 4N0KA 3RMZA 1FCDC 1C75A 2CXBA 5H2FV 1H1OA 2DVHA 1F1FA 2N9IA 4WQ9A 4K3IA 1FJ0A 2C8SA 1L0ND 4EIDA 4WQDA 3OA8B 1N50A 2C1DB 2C9XB 1C2NA 3MK7C 2AXTV 5TISV 3WFEC 4P4QB 2C1UA 4L3HA 5IY51 1ZZHA 4XXLA 4GEDB 1CRYA 2QJKB 1DIIC 2PCCB 2EXVA 4O1WA 1C6RA 1WVEC 1CCRA 4H0JA 4AAMA 1HCMA 4PJ0V 1CIFA 3VMAA 1JDLA 1MG2D 1KX2A 2OZ1A 2CE1A 1CSUA 1CNOA 1ETPA 3TF5A 1HJ3A 4RSZA 1SQXD 1RZ5A 1M70A 1K3HA 1B7VA 3CX5W 2YCCA 2HV4A 1J3SA 1RAQA 4EDFA 1NMLA 1CHIA 1DW0A 2KNCB 1LC1A 1K3GA 4UB6V 1KB9D 3SLEA 3GW6A 1CYCA 3WFCC 3RN1A 1EB7A 5KAFV 1DT1A 3PXWA 3CX5D 3NBTA 3RLMA 1IRVA 3FWLA 4MU8A 1AOQA 3ITKA 3PH2B 4PW9B 1RAPA 2N9JA 1A56A 3C2CA 1QL4A 3RN0A 1NTMD 3SJLA 3L4OA 2ORLA 3WFBC 1I6DA 2KS1A 1GDVA 3WC8A 3ZOYA 3ZOXA 3ORVA 2JWAA 2N18C 3PRJA 2MHMA 3NWVA 1N9CA 1I8PA 2GB8B 4QAOA 4Q5PA 2GC4D 4FA9A 1GU2A 1HJ5A 1QKSA 4L3GA 2Y0DA 4JCGA 1DIQC 3JBTB 3TDKA 1C6SA 3KHUA 4IL6V 1CRCA 1QN2A 5CICB 1CC5A 5DJQC 2GIWA 1P84D 1AYGA 1CYJA 4PWAA 1NMIA 3H1LD 1KB0A 1NU1D 1IZL0 2Y0EA 4LJIA 2K9JB 2FYUD 3L74D 2PACA 5TJHA 1BL9A 4GYDA 3SWSA 3PXTA 1LFMA 1I8OA 5GTIV 4U3FD 2VHDA 4WQBA 4WQEA 1S6VB 3L72D 1CYIA 1FOCA 1H31A 2C1VA 1YIQA 1CXCA 3OCDA 1YFCA 3DMIA 1C52A 1YEBA 2B11B 1H33B 2B10B 1CHJA 3HQ7A 2BGVX 1W5CT 2BH5X 2XTSB 1H9YA 4KMGA 1E2RA 2BPBB 2GC7D 1E29A 2BH4X 2Q3EA 1CTJA 2ZXYA 1ZRTD 1I54A 1OAEA 1QYZA 2FWLA 2QG4A 1HZVA 1GQ1A 1AOFA 3TGUD 3A0HV 3L70D 2V07A 1HROA 2FYNB 3KZIV 2AIUA 1R0QA 3CP5A 1F1CA 1C2RA 1H32A 4J20A 4FA5A 3H1KD 1DW3A 3WFDC 1CIHA 1SQQD 5CIGB 1IRWA 2QJYB 1QL3A 1GKSA 1KX7A 2D0SA 1CHHA 1YEAA 4PD4D 1C6OA 1M60A 1CTYA 2A06D 2D0WA 3L71D 5C0ZA 2BLFB 4XYDB 4WQ7A 3ZCFA 3SVWA 1CTZA 1DW1A 1YNRA 4NFGB 3HQ8A 2I8FA 3H1HD 2RMZA 1I55A 4DY9A 1PP9D 1CRIA 2LIRA 2ZZS1 3BCCD 5B66V 1CO6A 2LITA 5DF5A 1EZVD 2FRCA 451CA 1CIGA 1CSXA 1PPJD 1SQVD 2RN0A 2IBZD 1FI7A 3X39A 2N9YB 2BCCD 4FA1A 4H0KA 2Y0CA 3CXHD 1H31B 5KLIB 1M6ZA 2CA3B 3OCDB 2O3JA 1BE3D 5CIEB 1H9XA 1LC2A 4EIEA 1FHBA 2BCNB 1W2LA 1DVVA 2YIUB 1NTKD 1KIBA 3MK7B 1A2SA 4FB1A 3VNWA 1MZ4A 1IO3A 2AI5A 1YCCA 3PLNA 5DFSA 1N90A 3CU4A 1GJQA 3CYTI 2OZ1B 3ZBMA 3M97X 3O5CA 1DVHA 2QJPB 351CA 3O1YA 4RJTA 4AAOA 3WUIA 1KV9A 2CA4B 1COTA 4O1QA 2ZBOA 1WEJF 1AKKA 1HJ4A 3A0BV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B12 B;  1YTC A;  4A7P A;  2JQR A;  3L4M A;  1A8C A;  5CIH B;  1HH7 A;  2B4Z A;  5C9M A;  1DW2 A;  3WU2 V;  3ZOW A;  1LS9 A;  1FI3 A;  1H32 B;  5CYT R;  3ZOO A;  4L1Q A;  5B6Q A;  1C7M A;  1CCH A;  3VRD A;  1U74 B;  1CRG A;  1KYO W;  1L0L D;  1CRJ A;  2ZOO A;  2JTI B;  3O0R C;  3HQ9 A;  2PCB B;  1CSW A;  3OA8 A;  2C1D A;  2DGE A;  5CID B;  3L73 D;  3SXT A;  5B5E V;  2MTA C;  2YK3 A;  4V2K A;  3VYM A;  4D6T D;  1I5T A;  1MG3 D;  4WQ8 A;  5CIB B;  2B0Z B;  1KYO D;  1SQP D;  1I6E A;  1E8E A;  3DR0 A;  1FI9 A;  1SQB D;  1CRH A;  1H33 A;  4FAV A;  3H1J D;  5KLV D;  3H1I D;  1NTZ D;  1CIE A;  1L9B C;  2CE0 A;  2YQB A;  1GIW A;  5EXQ A;  3PTZ A;  1N15 A;  1BCC D;  4WQA A;  4Y5R A;  4EIC A;  3HQ6 A;  1NIR A;  4AX3 A;  155C A;  5E79 V;  4FA4 A;  1HRC A;  5GTH V;  3CXH W;  4UB8 V;  2V08 A;  2L4D A;  5AUR A;  3GG2 A;  2N18 B;  4AAN A;  1VYD A;  1BGY D;  1LMS A;  5CIF B;  3CWB D;  3ZIY A;  2C2C A;  1NNO A;  1S5L V;  1L9J C;  4AAL A;  3PHL A;  1YIC A;  5DJQ B;  2N3Y A;  4YE1 A;  1RZ6 A;  1COR A;  2L91 A;  3A9F A;  5KKZ B;  1OCD A;  3O20 A;  4EIF A;  4FAN A;  1CED A;  2ZON G;  3TYI A;  2N3B A;  1IQC A;  5KAI V;  1HZU A;  3PXS A;  3DP5 A;  1CSV A;  3L75 D;  1U75 B;  4WQC A;  1CXA A;  3NBS A;  4N0K A;  3RMZ A;  1FCD C;  1C75 A;  2CXB A;  5H2F V;  1H1O A;  2DVH A;  1F1F A;  2N9I A;  4WQ9 A;  4K3I A;  1FJ0 A;  2C8S A;  1L0N D;  4EID A;  4WQD A;  3OA8 B;  1N50 A;  2C1D B;  2C9X B;  1C2N A;  3MK7 C;  2AXT V;  5TIS V;  3WFE C;  4P4Q B;  2C1U A;  4L3H A;  5IY5 1;  1ZZH A;  4XXL A;  4GED B;  1CRY A;  2QJK B;  1DII C;  2PCC B;  2EXV A;  4O1W A;  1C6R A;  1WVE C;  1CCR A;  4H0J A;  4AAM A;  1HCM A;  4PJ0 V;  1CIF A;  3VMA A;  1JDL A;  1MG2 D;  1KX2 A;  2OZ1 A;  2CE1 A;  1CSU A;  1CNO A;  1ETP A;  3TF5 A;  1HJ3 A;  4RSZ A;  1SQX D;  1RZ5 A;  1M70 A;  1K3H A;  1B7V A;  3CX5 W;  2YCC A;  2HV4 A;  1J3S A;  1RAQ A;  4EDF A;  1NML A;  1CHI A;  1DW0 A;  2KNC B;  1LC1 A;  1K3G A;  4UB6 V;  1KB9 D;  3SLE A;  3GW6 A;  1CYC A;  3WFC C;  3RN1 A;  1EB7 A;  5KAF V;  1DT1 A;  3PXW A;  3CX5 D;  3NBT A;  3RLM A;  1IRV A;  3FWL A;  4MU8 A;  1AOQ A;  3ITK A;  3PH2 B;  4PW9 B;  1RAP A;  2N9J A;  1A56 A;  3C2C A;  1QL4 A;  3RN0 A;  1NTM D;  3SJL A;  3L4O A;  2ORL A;  3WFB C;  1I6D A;  2KS1 A;  1GDV A;  3WC8 A;  3ZOY A;  3ZOX A;  3ORV A;  2JWA A;  2N18 C;  3PRJ A;  2MHM A;  3NWV A;  1N9C A;  1I8P A;  2GB8 B;  4QAO A;  4Q5P A;  2GC4 D;  4FA9 A;  1GU2 A;  1HJ5 A;  1QKS A;  4L3G A;  2Y0D A;  4JCG A;  1DIQ C;  3JBT B;  3TDK A;  1C6S A;  3KHU A;  4IL6 V;  1CRC A;  1QN2 A;  5CIC B;  1CC5 A;  5DJQ C;  2GIW A;  1P84 D;  1AYG A;  1CYJ A;  4PWA A;  1NMI A;  3H1L D;  1KB0 A;  1NU1 D;  1IZL 0;  2Y0E A;  4LJI A;  2K9J B;  2FYU D;  3L74 D;  2PAC A;  5TJH A;  1BL9 A;  4GYD A;  3SWS A;  3PXT A;  1LFM A;  1I8O A;  5GTI V;  4U3F D;  2VHD A;  4WQB A;  4WQE A;  1S6V B;  3L72 D;  1CYI A;  1FOC A;  1H31 A;  2C1V A;  1YIQ A;  1CXC A;  3OCD A;  1YFC A;  3DMI A;  1C52 A;  1YEB A;  2B11 B;  1H33 B;  2B10 B;  1CHJ A;  3HQ7 A;  2BGV X;  1W5C T;  2BH5 X;  2XTS B;  1H9Y A;  4KMG A;  1E2R A;  2BPB B;  2GC7 D;  1E29 A;  2BH4 X;  2Q3E A;  1CTJ A;  2ZXY A;  1ZRT D;  1I54 A;  1OAE A;  1QYZ A;  2FWL A;  2QG4 A;  1HZV A;  1GQ1 A;  1AOF A;  3TGU D;  3A0H V;  3L70 D;  2V07 A;  1HRO A;  2FYN B;  3KZI V;  2AIU A;  1R0Q A;  3CP5 A;  1F1C A;  1C2R A;  1H32 A;  4J20 A;  4FA5 A;  3H1K D;  1DW3 A;  3WFD C;  1CIH A;  1SQQ D;  5CIG B;  1IRW A;  2QJY B;  1QL3 A;  1GKS A;  1KX7 A;  2D0S A;  1CHH A;  1YEA A;  4PD4 D;  1C6O A;  1M60 A;  1CTY A;  2A06 D;  2D0W A;  3L71 D;  5C0Z A;  2BLF B;  4XYD B;  4WQ7 A;  3ZCF A;  3SVW A;  1CTZ A;  1DW1 A;  1YNR A;  4NFG B;  3HQ8 A;  2I8F A;  3H1H D;  2RMZ A;  1I55 A;  4DY9 A;  1PP9 D;  1CRI A;  2LIR A;  2ZZS 1;  3BCC D;  5B66 V;  1CO6 A;  2LIT A;  5DF5 A;  1EZV D;  2FRC A;  451C A;  1CIG A;  1CSX A;  1PPJ D;  1SQV D;  2RN0 A;  2IBZ D;  1FI7 A;  3X39 A;  2N9Y B;  2BCC D;  4FA1 A;  4H0K A;  2Y0C A;  3CXH D;  1H31 B;  5KLI B;  1M6Z A;  2CA3 B;  3OCD B;  2O3J A;  1BE3 D;  5CIE B;  1H9X A;  1LC2 A;  4EIE A;  1FHB A;  2BCN B;  1W2L A;  1DVV A;  2YIU B;  1NTK D;  1KIB A;  3MK7 B;  1A2S A;  4FB1 A;  3VNW A;  1MZ4 A;  1IO3 A;  2AI5 A;  1YCC A;  3PLN A;  5DFS A;  1N90 A;  3CU4 A;  1GJQ A;  3CYT I;  2OZ1 B;  3ZBM A;  3M97 X;  3O5C A;  1DVH A;  2QJP B;  351C A;  3O1Y A;  4RJT A;  4AAO A;  3WUI A;  1KV9 A;  2CA4 B;  1COT A;  4O1Q A;  2ZBO A;  1WEJ F;  1AKK A;  1HJ4 A;  3A0B V; 
#chains in the Genus database with same CATH topology
 4PV1 D;  2K88 A;  3FXD A;  4A7P A;  4IL6 X;  4XA4 A;  1A8C A;  1JB0 J;  1FI3 A;  5CYT R;  3WMM 0;  4R4L A;  4B86 A;  1C7M A;  1NTM J;  1CCH A;  4N3Y B;  3VRD A;  1QL2 A;  1VQL P;  2ZOO A;  3B8E B;  1GMJ A;  2PCB B;  1CSW A;  4EYY Q;  1Y8A A;  4WY4 B;  1N2D C;  5B5E V;  2YK3 A;  4NPE A;  4D6T D;  1NOH A;  3WU2 E;  4DT0 A;  1AA0 A;  5DJU B;  1LT9 A;  1SQB G;  3RK2 D;  1JCC A;  4LGD E;  1WMK A;  1NTZ G;  2KS1 B;  2Y9Z A;  1FI9 A;  2P10 A;  2WIT A;  1KYO I;  3A7O A;  1GL2 A;  1JY2 N;  1IFI A;  3H1J D;  4U7J A;  5KLV D;  3CCR P;  3H1J E;  2FYN C;  1CIE A;  4PD4 E;  1L9B C;  5KLV E;  4K35 A;  2WSC J;  2JEE A;  1DEE G;  4AYC A;  3B71 A;  3L71 E;  4WQA A;  4Y5R A;  1DEB A;  1URQ D;  2I8D A;  1LTA C;  1OW6 A;  1RF1 C;  3HQ6 A;  4ASV A;  1GZL A;  2KP8 A;  2FKW B;  3QWO C;  1FZC C;  3CXH W;  2V08 A;  1EZV G;  3JCU H;  2Q9I A;  1L0N K;  4AAN A;  2OQQ A;  1BGY D;  3M9H A;  1BGY E;  2BCC G;  1FJK A;  1HJ0 A;  4GT1 A;  1X22 A;  1YIC A;  1FBM A;  1SQV E;  2L91 A;  4EIF A;  1NKN A;  4FAN A;  5AVW B;  2IFM A;  3TYI A;  1USD A;  2N3B A;  1KIL C;  2IBZ I;  3Q5R A;  3EFG A;  2WPS A;  4H44 D;  1NTK E;  4WQC A;  1FCD C;  2I1K A;  1F1F A;  2N9I A;  2XKM A;  3HUS A;  2OYO A;  2W83 C;  3M91 A;  3BVH A;  4EID A;  1FDO A;  2OYH B;  4WQD A;  3OA8 B;  3SWF A;  1N50 A;  1OX3 A;  5BU8 B;  2E76 D;  1GL2 D;  1C2N A;  4WVZ A;  3RBX A;  5TIS V;  3WFE C;  4L3H A;  2OTK E;  5IY5 1;  1ZZH A;  4XXL A;  1L4A D;  2O01 H;  5H2F E;  2QJK B;  1FZF A;  1IFP A;  4O1W A;  1LP1 A;  3R2P A;  1WVE C;  2OTL P;  2KLV A;  3WUU A;  3F5H A;  4C7N B;  3AE8 C;  1EDK A;  1HCM A;  5BU5 A;  1N8R Q;  3GMA A;  4W7Y A;  3HD7 B;  1AFO A;  2M3B A;  2AXT E;  1H0T A;  1X79 B;  1ETP A;  1HJ3 A;  1NTM K;  4C46 A;  4RSZ A;  1SQX D;  1M70 A;  1EDJ A;  2JP3 A;  1JM0 A;  5AW6 B;  5APQ A;  4WY4 C;  1KC8 Q;  2YCC A;  1VDF A;  1J3S A;  1RAQ A;  1OXZ A;  1H88 A;  4UB6 V;  1FS0 E;  1ZXG A;  3SLE A;  3M0D C;  3CWB G;  3RN1 A;  2BEZ F;  3CX5 D;  3NBT A;  5CHX A;  1IRV A;  1KB9 I;  3CX5 E;  1NU1 K;  2O01 J;  2KIK A;  1GK6 A;  2N1T B;  1VQ5 P;  3RN0 A;  1H89 A;  2HLO A;  4OGQ D;  3D6Z A;  2KZJ A;  3RBZ A;  3OAK A;  3WFB C;  1I6D A;  3HTK B;  2WT7 B;  2IFN A;  3ZOY A;  1QL1 A;  2XU6 A;  3FX0 A;  1X8Y A;  2KOG A;  1PGP A;  4Q5P A;  3KXD A;  1RF0 C;  1QKS A;  1KMI Z;  4IOI H;  3KHU A;  3D70 A;  2PP6 A;  1QN2 A;  2FYU G;  2GIW A;  1Y9B A;  1CYJ A;  1YJ9 P;  4OVN F;  1S5L X;  4LLH A;  4AUW A;  1SQB J;  5TJH A;  1LFM A;  4IFF A;  4I2L C;  1NTZ J;  1S9K D;  1S6V B;  3L72 D;  1CYI A;  3L72 E;  1PGJ A;  4IL6 E;  1H31 A;  3OCD A;  1YFC A;  1YJW P;  2NRG A;  2QVA A;  4IL6 H;  2B10 B;  2OYH C;  2D2C D;  1S1C X;  4XFJ A;  3I5C A;  2BGV X;  1CSB A;  1RE4 A;  3QH9 A;  1JUN A;  1H9Y A;  1E2R A;  3L70 G;  2GC7 D;  2QJK C;  3AEC C;  1E29 A;  1Q90 D;  2BCC J;  1DIP A;  5TIS H;  1OAE A;  1QYZ A;  1HZV A;  1AOF A;  3TGU D;  1NHL A;  2UWJ E;  1JY2 O;  2QRX A;  1LTJ A;  1EQ7 A;  1NKZ B;  1JOC A;  2KYV A;  4J20 A;  1FE6 A;  4HJG H;  5AVR B;  3HD7 C;  3MGN A;  3V4W A;  4N6J A;  1CIH A;  1SQQ D;  1SQV K;  1IRW A;  1YTZ T;  1FAV A;  1Y47 A;  2PFX A;  2ZVO B;  3L35 A;  2NPS B;  2E75 D;  2Y9Y A;  2D0S A;  1CHH A;  1JY2 P;  1GTW A;  3AE5 C;  4EI2 A;  3KZI E;  2BAS A;  2A06 D;  2E5Y A;  3LW5 H;  3ZCF A;  1VQP P;  1CTZ A;  3RL0 B;  4NFG B;  4DJG A;  2HOD A;  2RMZ A;  1KOR A;  2LIT A;  1LT1 A;  5DF5 A;  2FRC A;  2KNC A;  1AVO A;  2KXP B;  1D7M A;  1BE3 G;  2P58 A;  3M9B A;  2N1T C;  2IBZ D;  1FI7 A;  3X39 A;  1NU1 G;  2R5D A;  2M3E A;  1M6Z A;  2CA3 B;  1AV1 A;  1H9X A;  1LC2 A;  2VRS A;  3H32 B;  3H1L E;  3CCL P;  3B5N A;  2OYI A;  1P84 I;  1A2S A;  2AI5 A;  1R5S A;  1YCC A;  1WRG A;  3CU4 A;  1GJQ A;  2OZ1 B;  4U3F E;  3M97 X;  2KSE A;  2L5G B;  4I6M C;  3D0W A;  1COT A;  1YIT P;  3HE4 A;  1SFC A;  2B12 B;  4LC1 A;  2JQR A;  1SQB K;  2B4Z A;  2JJL A;  1K04 A;  3WU2 V;  3CWB J;  1LS9 A;  1NTZ K;  1FC2 C;  3ZOO A;  4L1Q A;  1K8A Q;  5B6Q A;  2FXO A;  3V2P A;  5AW8 B;  3GHG A;  3V6I A;  1KYO W;  1L0L D;  1YHQ P;  1BSH A;  1L0L E;  3O0R C;  2A45 G;  1JMB A;  1ZRT E;  4PV1 B;  1LWU B;  2DGE A;  3L73 D;  1RE3 C;  2B88 A;  4N78 E;  3MIW A;  1MG3 D;  4WQ8 A;  2B0Z B;  1PGQ A;  3OW2 O;  1IK9 A;  3AE3 C;  3H1J G;  1CI6 A;  1ZME C;  5KLV G;  3MUD C;  1I6E A;  1FZB A;  1RH5 B;  3L71 G;  1H33 A;  3H1I D;  5CCG C;  2ZYG A;  3B5N D;  3CL3 D;  3H1I E;  4GIF A;  2FYU J;  1HBW A;  1JEK A;  4KT0 J;  2YQB A;  1GIW A;  2Q7C A;  2PAJ A;  1Q2N A;  1BCC D;  2E43 A;  1N7L A;  1BCC E;  1BGY G;  155C A;  1NWQ A;  1N73 A;  1J1E B;  5AUR A;  2HFE D;  1VYD A;  2NPS C;  3A5T A;  1PP9 E;  3FXE A;  1SQV G;  3TNU A;  2WSS H;  2JKV A;  2J59 M;  3U1A A;  4L74 A;  1RF1 A;  1RY3 A;  2AEJ A;  1URQ B;  1NNO A;  1L9J C;  3O6Q A;  1PPJ E;  5DJQ B;  1OZH A;  1E5W A;  2N3Y A;  5AVY B;  1YQ3 C;  4YE1 A;  1EZV I;  3RL0 C;  1VQO P;  1NTK G;  5KKZ B;  1OCD A;  3CXH E;  1MKM A;  5APX A;  4W7Z A;  2HYN A;  2H8P D;  1HZU A;  4WWI A;  3DP5 A;  1CSV A;  3L75 D;  1R8E A;  3MP7 B;  3OA7 A;  3L70 J;  3L75 E;  2Q6Q A;  1M1J B;  4N0K A;  1C75 A;  1T8Z A;  5H2F V;  5L8R J;  4WQ9 A;  3M0A A;  1M57 D;  1S5L H;  3Q1M A;  5KAI E;  4H44 B;  2AXT V;  4P4Q B;  2C1U A;  1NJI Q;  1YJN P;  4GED B;  1HVV A;  1KD1 Q;  1HGZ A;  2PCC B;  4TT3 H;  2E76 B;  1GL2 B;  1U7J A;  5C39 A;  2K9J A;  1CIF A;  3RK3 D;  1HWT C;  2YNY A;  3RK3 E;  2XZR A;  1MG2 D;  1K05 A;  1L4A B;  1CSU A;  3LID A;  3MHV A;  1RQV A;  3CC4 P;  4D6T E;  5EFW B;  1NGM B;  1T3U A;  3N4X A;  3G4S P;  1OW7 A;  4O9B A;  2DW3 A;  2A45 H;  2W27 A;  1K3H A;  3WU2 H;  1BE3 J;  3CCS P;  3MD0 A;  4PV1 C;  2P67 A;  2HV4 A;  1LWU C;  3CMA P;  1NU1 J;  4EDF A;  1T3J A;  2HR3 A;  1DW0 A;  3TK1 A;  1QX8 A;  1KQF B;  2B87 B;  1K3G A;  1T6A A;  3GW6 A;  4PD4 H;  1DT1 A;  5AW1 B;  2GA1 A;  1PL5 A;  3AED C;  4WY4 A;  2E42 A;  3FWL A;  2M8R A;  4RO0 A;  1AOQ A;  3ITK A;  3PH2 B;  2LXB A;  2R3C A;  2FYU K;  1PIX A;  1KQL A;  1ZR4 A;  1HGV A;  1ZN5 A;  3T97 B;  2KS1 A;  1EDL A;  5AW3 B;  5KAF E;  3V2Q A;  1J1E C;  5CMZ A;  2IYP A;  3PRJ A;  3NWV A;  1LGH B;  1PFI A;  1I8P A;  2GB8 B;  1JTH A;  2P2U A;  5KAF H;  5M1B A;  2G8Y A;  4L3G A;  4OGQ B;  2Y0D A;  2YMK A;  1DIQ C;  3JBT B;  3TDK A;  1URQ C;  4Y99 B;  1QEX A;  4IL6 V;  5CIC B;  1CC5 A;  5DJQ C;  3IR9 A;  1P84 D;  4PWA A;  2NZ2 A;  5KKZ C;  1LP1 B;  1VQ6 P;  1NMI A;  4L73 A;  1KB0 A;  1IZL 0;  2C0X A;  2Y0E A;  3L72 G;  3IAO A;  3L74 D;  2PAC A;  3SWS A;  3L74 E;  3PXT A;  2K9Y A;  3H1J J;  5KLV J;  2WTY A;  1T2K D;  1M1J C;  1H0T B;  2VHD A;  4WQE A;  3L71 J;  1X0T A;  3F89 A;  1FOC A;  2IX7 C;  2C1V A;  1CXC A;  1VQ8 P;  3DMI A;  1FZE A;  5H2F H;  4WY4 D;  4JYB A;  1YEB A;  1VL2 A;  1NH4 A;  2GUV A;  2YKQ A;  3HQ7 A;  1VQM P;  1BGY J;  4H44 C;  1JO5 A;  1SS1 A;  2IZ0 A;  3CCQ P;  2V4H A;  4KMG A;  2H89 C;  3M06 A;  4GOF A;  5AVV B;  1SQV J;  2BH4 X;  3SWY A;  2Q3E A;  2ZXY A;  1SQX E;  2AXT H;  3BAT A;  2YXR B;  3LIE A;  2FWL A;  1GQ1 A;  1RHZ B;  2D2C B;  3KZI V;  2E76 C;  1GL2 C;  1NYH A;  1R0Q A;  2J5U A;  1N7S B;  4HYT B;  1C2R A;  2WVR A;  1NTK J;  1H32 A;  4FA5 A;  1IC2 A;  3H1K D;  1L4A C;  2W6B A;  3H1K E;  1XTC C;  3IN6 A;  2QM8 A;  3WFD C;  5CIG B;  2C0W A;  3BAS A;  1BSN A;  1LTI C;  1MFZ A;  1IFJ A;  1N86 A;  4ZMD A;  1C6O A;  1IZN B;  3HD7 A;  3CX5 H;  2BLF B;  4WQ7 A;  3SVW A;  3CPW O;  1DW1 A;  1VF5 D;  1QLE D;  1S4X A;  2JO1 A;  4TLF A;  3H1H D;  1IJD B;  3H1H E;  2B89 A;  4DY9 A;  2E75 B;  2I1J A;  2LIR A;  1KN7 A;  3BCC D;  2O01 N;  3BCC E;  2R32 A;  3AEA C;  1EZV D;  451C A;  1IK7 A;  2RH0 A;  2QA4 P;  2QE7 H;  3H1L G;  3GF3 A;  1VQ7 P;  2WMM A;  1Q82 Q;  2BCC D;  2Y0C A;  2XNX A;  1LTG C;  1H31 B;  3OJA B;  3RGU A;  2POH A;  3H6P A;  4NPF X;  3OCD B;  1HJB A;  5CIE B;  3U59 A;  4EIE A;  5AW2 B;  4U3F G;  2YXQ B;  2M5A B;  2HG5 D;  3JC2 2;  3MTU E;  2QM7 A;  3VNW A;  5B66 E;  2V7Q H;  3ABV C;  1MZ4 A;  4DZO A;  4OGQ C;  3ZBM A;  1S9K E;  3O5C A;  1DVH A;  4NPD A;  3O1Y A;  4RJT A;  4AAO A;  4Y99 C;  1R5L A;  3HTK A;  1KV9 A;  4MN4 C;  4ASW A;  4H0L D;  1XTG B;  1HJ4 A;  4RKU J;  3CCM P;  1L0L G;  1HH0 A;  5KLV K;  2FXM A;  1JCD A;  3HD7 D;  3SSU A;  3W68 A;  1FOS F;  1U74 B;  4BRY A;  4C7R A;  2YKO A;  2MKV A;  3HQ9 A;  2E74 D;  3VP9 A;  5AW7 B;  5KTB A;  3C9I A;  3EFF K;  2C1D A;  4H13 D;  3TGU E;  4AQR D;  4V2K A;  1NVO A;  2Q1K A;  3B4S A;  1PZQ A;  4HKZ H;  5CIB B;  1KYO D;  2A45 I;  2OAR A;  3RL0 g;  1SQP D;  1KYO E;  3H1I G;  1SQQ E;  1SQP E;  2V7Q J;  1CRH A;  4ZKU A;  2K1A A;  4FAV A;  1BCC G;  1OWA A;  2D2C C;  1DD4 A;  2FBW C;  3SWK A;  1K9M Q;  3V5B A;  1QVF O;  2HPC B;  3Q5S A;  1NTK K;  1N7S C;  1N15 A;  2A06 E;  2FFD B;  4EIC A;  1PP9 G;  2R5B A;  4PD4 I;  1NIR A;  4AX3 A;  3KZI H;  2LR2 A;  3L72 J;  2KUB A;  2L4D A;  3S4R A;  1S3J A;  2N18 B;  5APU A;  2ITA A;  1PPJ G;  3HE5 A;  5CCG A;  1LMS A;  5CIF B;  2ZT9 D;  3CWB D;  3B5N B;  1QVG O;  1G2C B;  1M8O B;  1S5L V;  4AAL A;  4IFM A;  2IBZ E;  1RZ6 A;  1COR A;  3L75 G;  5E79 E;  2PRR A;  3E1R A;  1CED A;  5GTH E;  2ZON G;  3AE6 C;  4UB8 E;  5DJT B;  3HE4 B;  3H25 A;  1IQC A;  5KAI V;  2E75 C;  1BDD A;  3P32 A;  5E79 H;  1Q86 Q;  4GDO A;  4Y28 J;  1JY3 N;  5GTH H;  3NBS A;  3A2A A;  2ZXE B;  2Z5I A;  1H1O A;  2DVH A;  1ZLL A;  2G3A A;  1GU4 A;  1NAF A;  4KJM A;  2CPS A;  2C8S A;  3GHG B;  1QGK B;  1L0N D;  2KB7 P;  1L0N E;  1FDI A;  5APY A;  1GDT A;  3IF4 A;  1BDC A;  1VQ4 P;  5AW9 B;  3LW5 J;  2WSE H;  1Q81 Q;  4JQ0 D;  2GUS A;  3UIA A;  1RE4 C;  5CCH A;  1DII C;  1CI6 B;  5APW A;  1C6R A;  1CCR A;  4H0J A;  4AAM A;  1W5C E;  4D6T G;  4GOE A;  3AE7 C;  3NTN A;  2OTJ P;  5CCG D;  2M0B A;  3VMA A;  2YMY A;  3L73 E;  4JPZ B;  1KX2 A;  2OZ1 A;  2CE1 A;  5AVZ B;  3VTP C;  1CW5 A;  1CNO A;  2LKM A;  3D6Y A;  3VMZ A;  3TF5 A;  1RZ5 A;  1N73 B;  3V4Q A;  5CJ4 A;  2IZ1 A;  3RK3 B;  3TNU B;  3H1L J;  3Q5P A;  4PJ0 E;  3CCU P;  1NML A;  3CC7 P;  3RK2 B;  3O6Q B;  1KB9 D;  5AVT B;  2QSI A;  4U3F J;  1KB9 E;  4PJ0 H;  1YI2 P;  1X9V A;  1EB7 A;  5KAF V;  3PXW A;  1KV4 A;  1CZQ A;  3VP8 A;  1TU3 F;  4MU8 A;  2WSE J;  4K3A A;  3C8V A;  4PW9 B;  1SFC D;  1RAP A;  2N9J A;  4OWF A;  1A56 A;  1DX7 A;  1ZP0 C;  1NTM D;  1NTM E;  3SJL A;  1FZC A;  2FFD C;  4EOT A;  2ORL A;  4YTP C;  5CCH D;  3WC8 A;  1IFD A;  1IFN A;  3CLQ A;  1L0L J;  3ZOX A;  3ORV A;  4IFD K;  1NAY A;  4W80 A;  2JWA A;  2N18 C;  1N9C A;  2O1K A;  4ZKP A;  4FA9 A;  3B5N C;  3CXH H;  1GU2 A;  1HJ5 A;  2N9B A;  2AEF A;  1CRC A;  5KJ7 C;  5AVS B;  3L74 G;  3PH0 A;  1KIL A;  4XE5 B;  2ZYA A;  2K37 A;  2OGU A;  1NU1 D;  3PP5 A;  4LJI A;  2K9J B;  1BL9 A;  4GYD A;  3BRT B;  1KTM A;  4QMA A;  2FYZ A;  3H1I J;  2W8Z A;  4GOD A;  4WQB A;  5KAI H;  1LT9 B;  3AE9 C;  1BCC J;  1GD2 E;  2WSF H;  1LTT C;  3GHG C;  1SQQ K;  3AE1 C;  3GLM A;  1C52 A;  4WB4 A;  2H7H A;  2B11 B;  1CHJ A;  1PP9 J;  4WBA A;  3AEE C;  3USS A;  1M1J A;  1YIJ P;  1SQX G;  1RQU A;  1PV3 A;  3HRN A;  5GTI E;  4R4M A;  1W5C T;  2BH5 X;  2XTS B;  3II6 A;  1G1I A;  2BPB B;  3P8C D;  2E5T A;  3CCV P;  5AW0 B;  2YO2 A;  3P8C E;  1CTJ A;  4JBZ A;  5GTI H;  3Q2Y A;  2QG4 A;  3M9Q A;  1G1J A;  3H1K G;  3WUT A;  2YKP A;  1HRO A;  2AIU A;  3TSI A;  1L2P A;  1MFT A;  3L75 J;  5CBO A;  3I55 P;  3CCJ P;  1GW3 A;  3Q3D A;  1DW3 A;  3KYQ A;  2QJY B;  1QL3 A;  1YBK A;  2W90 A;  3L4F A;  1N73 C;  1KIL D;  1KX7 A;  1KIL E;  4PD4 D;  3A0H E;  3CC2 P;  4YPC A;  3RK3 C;  1M60 A;  1JTH B;  4L76 A;  4M3L A;  3PJS K;  1L4A A;  1DD3 A;  3H1H G;  3L71 D;  2WSF J;  3JCU E;  5AVX B;  4BWN A;  3A0H H;  4XYD B;  2AEM A;  3RK2 C;  1SVF A;  3M0D A;  3BCC G;  3HUS B;  1ZW0 A;  5AW5 B;  2CPB A;  2O1J A;  1I55 A;  1PGO A;  4I7Z B;  1Z56 A;  2J58 A;  1CRI A;  1WT6 A;  3NMD A;  5B66 V;  1CO6 A;  1JY3 O;  1CIG A;  2WQY C;  1CSX A;  2B87 A;  3G71 P;  1SQV D;  2KLU A;  1VF5 B;  4FA1 A;  4D6T J;  4H0K A;  5KLI B;  2O3J A;  1L0L K;  1P84 E;  2BCN B;  3E1I A;  1W2L A;  1DVV A;  1M1K Q;  2YIU B;  1KQG B;  1NTK D;  1LTS C;  1KIB A;  3MK7 B;  1RF0 A;  1IO3 A;  1P84 H;  1JY3 P;  3PLN A;  1N90 A;  1M7L A;  2ZFC A;  2H88 C;  2QJP B;  351C A;  4GKG A;  3T97 A;  3WUI A;  1AVY A;  4O1Q A;  4ZNC A;  1WEJ F;  3NFQ A;  3GF7 A;  2IPP A;  1OMI A;  3AEB C;  2QIW A;  1YTC A;  3L4M A;  2WWW A;  5CIH B;  1HH7 A;  1KQS O;  5C9M A;  1DW2 A;  3ZOW A;  1H32 B;  4L75 A;  3TGU G;  3KPE A;  1VQK P;  1LT9 C;  2ZYD A;  1CRG A;  4H0L B;  1CRJ A;  3G6E P;  2JTI B;  2FY8 A;  1IO4 A;  3EQ2 A;  2OYH A;  3OA8 A;  3A0B E;  5AVU B;  5CID B;  3SXT A;  4CPG A;  2MTA C;  1SQQ G;  2KZI A;  1SQP G;  3VYM A;  1T2K C;  3A0B H;  1I5T A;  3CCE P;  2E74 B;  2CK3 H;  1E8E A;  3DR0 A;  2A06 G;  1SQB D;  1KFN A;  4H13 B;  4C7N A;  1SQB E;  1NTZ D;  1LNQ A;  2CE0 A;  5B5E E;  1NTZ E;  3L74 J;  1AQT A;  1GW4 A;  5EXQ A;  3PTZ A;  2SPZ A;  2KI7 B;  2P1J A;  5E79 V;  5B5E H;  4FA4 A;  1HRC A;  5GTH V;  1ZR2 A;  4UB8 V;  2QJY C;  1Q7Y Q;  2WPR A;  3GG2 A;  1MZ9 A;  3L36 A;  1DH3 A;  2IBZ G;  2Q3I A;  3ZIY A;  1LJ2 A;  2Z4E A;  1N7S A;  1VQ9 P;  1KZU B;  2MJZ A;  1EZV E;  2C2C A;  3PHL A;  1U7M A;  4DOJ A;  3A9F A;  2BCC E;  3HUS C;  3V2R A;  3O20 A;  2XDJ A;  1SQX J;  2ZT9 B;  4I7Z C;  1GU5 A;  1S72 P;  3PXS A;  3CXH I;  1OIP A;  1U75 B;  1CXA A;  1L0N G;  2N1T A;  3BRV B;  3RMZ A;  2CXB A;  1HUC A;  1U57 A;  1VF5 C;  3H1K J;  4K3I A;  1FJ0 A;  5B66 H;  3VMY A;  2WT7 A;  4BRY B;  3KDP B;  5KLI C;  3FGA D;  1SP4 A;  2C1D B;  2YIU C;  2C9X B;  3N7N A;  1USE A;  1LTJ B;  3MK7 C;  3G9R A;  2ZVN B;  3NXS A;  1CRY A;  3C1L A;  5K5G B;  2QJP C;  3L73 G;  1MV8 A;  2EXV A;  3G3Z A;  1EC5 A;  3H1H J;  2M5A A;  2JWD A;  4PJ0 V;  4HB1 A;  4BXL A;  2R3S A;  3BCC J;  1JDL A;  1N7S D;  2KK7 A;  5TIS E;  1ZOY C;  1SLQ A;  2WPV B;  3AE2 C;  1GK4 A;  3P8M C;  4EIJ A;  4H0L C;  1OW8 A;  1B7V A;  1W2E A;  2HOD B;  3CX5 W;  3CME P;  1RE3 A;  3HE5 B;  1KYO H;  1KFM A;  2C9N Y;  1S2E A;  3VMX A;  3AEG C;  1CHI A;  5APS A;  2KNC B;  1K73 Q;  2N1T D;  1LC1 A;  2WPQ A;  3FWN A;  2XV5 A;  2LXC B;  3MUD A;  1CYC A;  3WFC C;  3RLM A;  2E74 C;  1HTL C;  2JDI H;  1FJP A;  1NTM G;  4KHX A;  4H13 C;  3SFE C;  2OYI B;  1EXJ A;  4HH2 A;  3CWB E;  3C2C A;  3A3Y B;  1QL4 A;  2H43 A;  3L4O A;  4UB6 E;  1OVR A;  2R44 A;  4DCK A;  1GDV A;  2Q5U A;  2NPS A;  1J1D B;  1FOS E;  4UB6 H;  2MHM A;  1SFC B;  1FZG A;  2W6A A;  4QAO A;  3TGU J;  2GC4 D;  1OFC X;  2HPC A;  3I56 P;  4UB8 H;  2FFD A;  4JCG A;  1C6S A;  2FXP A;  3IFM A;  1NO4 A;  3S1K A;  2K3R A;  3E7K A;  1AYG A;  2QEX P;  1SQQ J;  1ZV8 A;  1SQP J;  1OVV A;  3H1L D;  1M90 Q;  1SQX K;  2YO3 A;  1UII A;  1VPC A;  2ZT9 C;  5APT A;  2FYU D;  1G2C A;  2FYU E;  1I8O A;  3KQG A;  5GTI V;  1A02 F;  4U3F D;  5BVZ A;  5KJ7 A;  1UIX A;  1OVU A;  4I1L A;  3MZW B;  1JMM A;  1HF9 A;  1YIQ A;  1H8A A;  3VYI A;  2IDB A;  5CBN A;  3EWK A;  3TYY A;  3H32 A;  1H33 B;  3S9O A;  1FZA A;  5AVQ B;  1LTJ C;  4Z1M H;  1IFM A;  1ZRT D;  1I54 A;  3A0H V;  3L70 D;  2NPS D;  3W67 A;  4JYC A;  2V07 A;  3L70 E;  2FYN B;  4N78 D;  1W2B O;  3CP5 A;  1F1C A;  2XND H;  3ZDM A;  1RF1 B;  2RKL A;  1YTZ I;  1FZC B;  5CJ0 A;  4OH8 B;  4JF7 A;  3RL0 D;  2WZ7 A;  1GKS A;  1AQ5 A;  3O8Z A;  1L0N J;  1JNM A;  1LWU A;  1KB9 H;  1EXI A;  1YEA A;  2C9L Y;  2KSJ A;  3L37 A;  3AE4 C;  2ZAE B;  1CTY A;  2PGD A;  3CX5 I;  1M56 D;  2D0W A;  2Z5H A;  5C0Z A;  1FDM A;  3D71 A;  3WUV A;  3SFD C;  2B9B A;  5KJ7 D;  1YNR A;  3HQ8 A;  2I8F A;  1KIL B;  4YXD C;  1E79 H;  1PP9 D;  2ZZS 1;  2P7J A;  3R4Y A;  5AW4 B;  5APV A;  1MUU A;  2ZJS E;  1YQ4 C;  4YXW H;  3V2N A;  1VQN P;  1EDI A;  2OYI C;  3L73 J;  1PPJ D;  2GM4 A;  2RN0 A;  2JR8 A;  2N9Y B;  2AXC A;  3CXH D;  3CD6 P;  1LTB C;  1BE3 D;  1YYC A;  1BE3 E;  1FHB A;  3AEF C;  1J1D C;  1NU1 E;  1SFC C;  4RES B;  3VN0 A;  4FB1 A;  3JSV C;  3VOP A;  5DFS A;  2BEQ D;  2W6J H;  3CYT I;  1URQ A;  2ZXX A;  1FU1 A;  1S5L E;  1AJY A;  3U1C A;  2WSC H;  1J2J B;  5CCH C;  3K5B A;  2CA4 B;  3P7K A;  2ZBO A;  1A02 J;  2IYO A;  1AKK A;  1SQP K;  3CI9 A;  3A0B V; 
#chains in the Genus database with same CATH homology
 2B12 B;  1YTC A;  4A7P A;  2JQR A;  3L4M A;  1A8C A;  5CIH B;  1HH7 A;  2B4Z A;  5C9M A;  1DW2 A;  3WU2 V;  3ZOW A;  1LS9 A;  1FI3 A;  1H32 B;  5CYT R;  3ZOO A;  4L1Q A;  5B6Q A;  1C7M A;  1CCH A;  3VRD A;  1U74 B;  1CRG A;  1KYO W;  1L0L D;  1CRJ A;  2ZOO A;  2JTI B;  3O0R C;  3HQ9 A;  2PCB B;  1CSW A;  3OA8 A;  2C1D A;  2DGE A;  5CID B;  3L73 D;  3SXT A;  5B5E V;  2MTA C;  2YK3 A;  4V2K A;  3VYM A;  4D6T D;  1I5T A;  1MG3 D;  4WQ8 A;  5CIB B;  2B0Z B;  1KYO D;  1SQP D;  1I6E A;  1E8E A;  3DR0 A;  1FI9 A;  1SQB D;  1CRH A;  1H33 A;  4FAV A;  3H1J D;  5KLV D;  3H1I D;  1NTZ D;  1CIE A;  1L9B C;  2CE0 A;  2YQB A;  1GIW A;  5EXQ A;  3PTZ A;  1N15 A;  1BCC D;  4WQA A;  4Y5R A;  4EIC A;  3HQ6 A;  1NIR A;  4AX3 A;  155C A;  5E79 V;  4FA4 A;  1HRC A;  5GTH V;  3CXH W;  4UB8 V;  2V08 A;  2L4D A;  5AUR A;  3GG2 A;  2N18 B;  4AAN A;  1VYD A;  1BGY D;  1LMS A;  5CIF B;  3CWB D;  3ZIY A;  2C2C A;  1NNO A;  1S5L V;  1L9J C;  4AAL A;  3PHL A;  1YIC A;  5DJQ B;  2N3Y A;  4YE1 A;  1RZ6 A;  1COR A;  2L91 A;  3A9F A;  5KKZ B;  1OCD A;  3O20 A;  4EIF A;  4FAN A;  1CED A;  2ZON G;  3TYI A;  2N3B A;  1IQC A;  5KAI V;  1HZU A;  3PXS A;  3DP5 A;  1CSV A;  3L75 D;  1U75 B;  4WQC A;  1CXA A;  3NBS A;  4N0K A;  3RMZ A;  1FCD C;  1C75 A;  2CXB A;  5H2F V;  1H1O A;  2DVH A;  1F1F A;  2N9I A;  4WQ9 A;  4K3I A;  1FJ0 A;  2C8S A;  1L0N D;  4EID A;  4WQD A;  3OA8 B;  1N50 A;  2C1D B;  2C9X B;  1C2N A;  3MK7 C;  2AXT V;  5TIS V;  3WFE C;  4P4Q B;  2C1U A;  4L3H A;  5IY5 1;  1ZZH A;  4XXL A;  4GED B;  1CRY A;  2QJK B;  1DII C;  2PCC B;  2EXV A;  4O1W A;  1C6R A;  1WVE C;  1CCR A;  4H0J A;  4AAM A;  1HCM A;  4PJ0 V;  1CIF A;  3VMA A;  1JDL A;  1MG2 D;  1KX2 A;  2OZ1 A;  2CE1 A;  1CSU A;  1CNO A;  1ETP A;  3TF5 A;  1HJ3 A;  4RSZ A;  1SQX D;  1RZ5 A;  1M70 A;  1K3H A;  1B7V A;  3CX5 W;  2YCC A;  2HV4 A;  1J3S A;  1RAQ A;  4EDF A;  1NML A;  1CHI A;  1DW0 A;  2KNC B;  1LC1 A;  1K3G A;  4UB6 V;  1KB9 D;  3SLE A;  3GW6 A;  1CYC A;  3WFC C;  3RN1 A;  1EB7 A;  5KAF V;  1DT1 A;  3PXW A;  3CX5 D;  3NBT A;  3RLM A;  1IRV A;  3FWL A;  4MU8 A;  1AOQ A;  3ITK A;  3PH2 B;  4PW9 B;  1RAP A;  2N9J A;  1A56 A;  3C2C A;  1QL4 A;  3RN0 A;  1NTM D;  3SJL A;  3L4O A;  2ORL A;  3WFB C;  1I6D A;  2KS1 A;  1GDV A;  3WC8 A;  3ZOY A;  3ZOX A;  3ORV A;  2JWA A;  2N18 C;  3PRJ A;  2MHM A;  3NWV A;  1N9C A;  1I8P A;  2GB8 B;  4QAO A;  4Q5P A;  2GC4 D;  4FA9 A;  1GU2 A;  1HJ5 A;  1QKS A;  4L3G A;  2Y0D A;  4JCG A;  1DIQ C;  3JBT B;  3TDK A;  1C6S A;  3KHU A;  4IL6 V;  1CRC A;  1QN2 A;  5CIC B;  1CC5 A;  5DJQ C;  2GIW A;  1P84 D;  1AYG A;  1CYJ A;  4PWA A;  1NMI A;  3H1L D;  1KB0 A;  1NU1 D;  1IZL 0;  2Y0E A;  4LJI A;  2K9J B;  2FYU D;  3L74 D;  2PAC A;  5TJH A;  1BL9 A;  4GYD A;  3SWS A;  3PXT A;  1LFM A;  1I8O A;  5GTI V;  4U3F D;  2VHD A;  4WQB A;  4WQE A;  1S6V B;  3L72 D;  1CYI A;  1FOC A;  1H31 A;  2C1V A;  1YIQ A;  1CXC A;  3OCD A;  1YFC A;  3DMI A;  1C52 A;  1YEB A;  2B11 B;  1H33 B;  2B10 B;  1CHJ A;  3HQ7 A;  2BGV X;  1W5C T;  2BH5 X;  2XTS B;  1H9Y A;  4KMG A;  1E2R A;  2BPB B;  2GC7 D;  1E29 A;  2BH4 X;  2Q3E A;  1CTJ A;  2ZXY A;  1ZRT D;  1I54 A;  1OAE A;  1QYZ A;  2FWL A;  2QG4 A;  1HZV A;  1GQ1 A;  1AOF A;  3TGU D;  3A0H V;  3L70 D;  2V07 A;  1HRO A;  2FYN B;  3KZI V;  2AIU A;  1R0Q A;  3CP5 A;  1F1C A;  1C2R A;  1H32 A;  4J20 A;  4FA5 A;  3H1K D;  1DW3 A;  3WFD C;  1CIH A;  1SQQ D;  5CIG B;  1IRW A;  2QJY B;  1QL3 A;  1GKS A;  1KX7 A;  2D0S A;  1CHH A;  1YEA A;  4PD4 D;  1C6O A;  1M60 A;  1CTY A;  2A06 D;  2D0W A;  3L71 D;  5C0Z A;  2BLF B;  4XYD B;  4WQ7 A;  3ZCF A;  3SVW A;  1CTZ A;  1DW1 A;  1YNR A;  4NFG B;  3HQ8 A;  2I8F A;  3H1H D;  2RMZ A;  1I55 A;  4DY9 A;  1PP9 D;  1CRI A;  2LIR A;  2ZZS 1;  3BCC D;  5B66 V;  1CO6 A;  2LIT A;  5DF5 A;  1EZV D;  2FRC A;  451C A;  1CIG A;  1CSX A;  1PPJ D;  1SQV D;  2RN0 A;  2IBZ D;  1FI7 A;  3X39 A;  2N9Y B;  2BCC D;  4FA1 A;  4H0K A;  2Y0C A;  3CXH D;  1H31 B;  5KLI B;  1M6Z A;  2CA3 B;  3OCD B;  2O3J A;  1BE3 D;  5CIE B;  1H9X A;  1LC2 A;  4EIE A;  1FHB A;  2BCN B;  1W2L A;  1DVV A;  2YIU B;  1NTK D;  1KIB A;  3MK7 B;  1A2S A;  4FB1 A;  3VNW A;  1MZ4 A;  1IO3 A;  2AI5 A;  1YCC A;  3PLN A;  5DFS A;  1N90 A;  3CU4 A;  1GJQ A;  3CYT I;  2OZ1 B;  3ZBM A;  3M97 X;  3O5C A;  1DVH A;  2QJP B;  351C A;  3O1Y A;  4RJT A;  4AAO A;  3WUI A;  1KV9 A;  2CA4 B;  1COT A;  4O1Q A;  2ZBO A;  1WEJ F;  1AKK A;  1HJ4 A;  3A0B V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...