5KLVD

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 63
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5klvD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5klvD02
1CRGA 4FA9A 4J20A 1EB7A 1SQXD 1AOQA 4PWAA 2GC4D 2MHMA 2RN0A 3CWBD 1KV9A 3ZCFA 1CCHA 5KLVD 1GIWA 1JDLA 2JWAA 1B7VA 1HCMA 1YEBA 3MK7B 1ZRTD 3L4MA 4AAMA 1RAPA 2N18C 1M6ZA 3WFDC 1I55A 1H33A 1E8EA 4IL6V 2ZONG 1CHIA 2N9IA 3ZOYA 2CA4B 2C1VA 1W5CT 1CTJA 1CHHA 1C2RA 1N9CA 3WFBC 2PCBB 1IZL0 1AOFA 3HQ7A 5AURA 2KS1A 3CYTI 3A0HV 4FA5A 1YEAA 3SWSA 1CNOA 1IRVA 4L3GA 3MK7C 1FI3A 4WQAA 4WQ8A 1H9YA 1SQBD 1CEDA 5CIBB 155CA 2BCNB 3RN1A 2B4ZA 1HZVA 1A8CA 1H9XA 3O0RC 5KAFV 2FYUD 3OCDA 1QL3A 1N90A 1CIFA 1DW2A 1RZ6A 2LITA 1P84D 1L0LD 5B5EV 1HJ5A 4WQBA 1ZZHA 1AKKA 1BL9A 1U74B 1K3GA 1FI9A 1E2RA 1C6SA 3A0BV 2AI5A 1YICA 3SJLA 3PXWA 1FHBA 2N3BA 4EICA 5KLIB 2CE0A 1LC2A 3OA8A 1BCCD 1L0ND 2GC7D 4PD4D 1SQPD 5CIDB 1C2NA 4EDFA 3RN0A 1PP9D 4A7PA 1R0QA 1DW3A 1K3HA 1LMSA 5GTIV 3WUIA 1IO3A 1YTCA 3CXHW 1F1CA 3ZOWA 3CXHD 2B0ZB 4XYDB 3WU2V 1SQQD 4Y5RA 1QN2A 2DVHA 1KX2A 5C0ZA 4AANA 3L75D 3H1HD 1H31B 2PACA 3L71D 3NWVA 2C1DB 1S5LV 1U75B 1CRYA 2YCCA 1KYOD 2CE1A 3HQ8A 1HJ4A 4RJTA 3L74D 1NU1D 1F1FA 4UB6V 2HV4A 1CRHA 1H1OA 1GJQA 3SXTA 4WQ9A 3DMIA 3WFEC 1CCRA 1H32B 3H1ID 1IQCA 2AXTV 2V07A 3VRDA 3PTZA 1L9JC 5CIGB 1HRCA 1CC5A 4O1QA 1CO6A 1CSXA 2ZXYA 1NTZD 3RLMA 2OZ1B 1I5TA 3KZIV 1CRCA 3O5CA 5CICB 1FOCA 3VNWA 2B12B 1CIHA 1PPJD 3ZBMA 2MTAC 2Y0DA 3SVWA 2FRCA 4RSZA 1ETPA 4PJ0V 1YFCA 3WC8A 3L70D 4FANA 2BPBB 3JBTB 3GG2A 1CYJA 4JCGA 5H2FV 1N50A 4UB8V 3O20A 4EIFA 2C9XB 3DP5A 2N9JA 2N9YB 3ZOOA 3L73D 2BCCD 4FA4A 3C2CA 3FWLA 1QKSA 2Q3EA 4N0KA 2JTIB 1MG3D 2QG4A 1I8OA 1NMLA 2B11B 4GYDA 2CA3B 5EXQA 3TGUD 1YIQA 2BGVX 1W2LA 2ZOOA 2ORLA 4H0JA 2GIWA 2FWLA 2BH4X 3VYMA 3DR0A 3TDKA 4FB1A 1CSWA 1NIRA 1MZ4A 3NBSA 4Q5PA 1RAQA 1BGYD 1IRWA 2Y0EA 1CTZA 1H31A 2RMZA 5DF5A 1CXAA 1GU2A 1CORA 3CX5W 4O1WA 2K9JB 3PLNA 3WFCC 1E29A 3M97X 1CRIA 4AALA 1N15A 1WEJF 3L4OA 1A2SA 1DVVA 5CIHB 4XXLA 4QAOA 3SLEA 1J3SA 1KX7A 1C75A 451CA 1CSUA 4WQEA 5TISV 3HQ9A 1BE3D 4YE1A 3X39A 1CRJA 2QJKB 3PRJA 1H32A 2AIUA 2LIRA 1DT1A 1YCCA 351CA 2QJPB 4LJIA 1DIIC 1L9BC 3TF5A 2YQBA 3HQ6A 4P4QB 5CIEB 2BH5X 4AX3A 1C6OA 1QYZA 1HZUA 2PCCB 4EIEA 2O3JA 3O1YA 4PW9B 2D0WA 5DJQB 4GEDB 2D0SA 4MU8A 3ORVA 5KKZB 1CSVA 1CIGA 1C7MA 1I6EA 4KMGA 1SQVD 3A9FA 3PHLA 1COTA 1LS9A 4FAVA 1GDVA 1DVHA 1KB0A 3NBTA 4H0KA 2KNCB 1VYDA 3KHUA 1I54A 4L1QA 1CIEA 2A06D 3H1JD 3ITKA 1M70A 5KAIV 2V08A 1C52A 2YIUB 5DJQC 3ZOXA 1A56A 3RMZA 4EIDA 2FYNB 2I8FA 1CXCA 3CU4A 3H1KD 1DW1A 2B10B 1RZ5A 5C9MA 1H33B 4L3HA 2VHDA 2C1UA 1FJ0A 2YK3A 2C8SA 5DFSA 1I6DA 3H1LD 1AYGA 1DW0A 4FA1A 2DGEA 3TYIA 4WQDA 5CYTR 1S6VB 4U3FD 1OAEA 5CIFB 2Y0CA 2QJYB 1C6RA 1QL4A 1HH7A 3BCCD 3PH2B 5E79V 1CTYA 2BLFB 1CYIA 2GB8B 3OCDB 1NTMD 1YNRA 4NFGB 1NMIA 4AAOA 4DY9A 1CHJA 2C1DA 4V2KA 1KB9D 2ZZS1 3CP5A 3CX5D 5TJHA 2CXBA 2N3YA 4WQCA 4WQ7A 2L91A 1GKSA 1MG2D 1NNOA 2XTSB 2JQRA 1CYCA 1LFMA 1LC1A 3GW6A 3L72D 5GTHV 1FI7A 1I8PA 1DIQC 1OCDA 3PXTA 5B66V 4K3IA 3OA8B 1EZVD 2L4DA 3VMAA 2C2CA 1FCDC 1M60A 2EXVA 5B6QA 1NTKD 2IBZD 1GQ1A 2N18B 1KIBA 1HJ3A 1KYOW 1WVEC 2OZ1A 1HROA 2ZBOA 5IY51 3PXSA 3ZIYA 4D6TD
chains in the Genus database with same CATH superfamily
5TISH 1EB7A 1LTJB 4PWAA 2JJLA 3CWBD 1GL2A 1LWUC 3V2PA 5KLVD 1VDFA 1YQ4C 1NTMJ 3L70E 1JDLA 2ZAEB 3SWKA 1GZLA 1VQ6P 3IF4A 1RAPA 1LT9B 3I5CA 3WFDC 1AV1A 1I55A 2YKPA 3MUDC 1H33A 2A45I 1KB9H 4YPCA 2O01N 1FC2C 2N9IA 3L73E 1W5CT 1CTJA 3H25A 1RY3A 3QWOC 1C2RA 3L72J 1N7SA 5KKZC 4XA4A 2FFDB 1N7LA 1VPCA 3A0HV 1K05A 1A02F 3RK2D 4GT1A 3TNUB 3B71A 2WPSA 1S5LE 4U3FE 1H9YA 1KFNA 3AE5C 1JY3N 3USSA 3CCJP 1SQVK 4W7ZA 3SFEC 2BCNB 3M06A 5KTBA 3BCCE 1H9XA 2FYUD 3OCDA 2ZYGA 2D2CD 3KYQA 1NGMB 1QL3A 1BGYE 1RZ6A 4D6TJ 1IZNB 2M3EA 1FAVA 3CX5E 2BCCG 3CCVP 2XZRA 5B5EV 1HJ5A 1QLED 4DJGA 1BL9A 1LTTC 3EWKA 3CXHI 1E2RA 1C6SA 3A0BV 2YKOA 2XDJA 3H1JJ 2AEJA 5CCGD 1FHBA 3D70A 1IFDA 2CE0A 1LC2A 3OA8A 4MN4C 1A02J 1SQPD 5BVZA 1YHQP 2K3RA 1KYOI 3AE9C 1LMSA 3RK2C 3B8EB 5E79H 2WWWA 1IO3A 5M1BA 3GHGC 1Q2NA 2B0ZB 5H2FE 4XYDB 1WT6A 4C7NB 1KILB 1RF0A 4Y5RA 1VQ7P 1SQBJ 3Q5RA 3WMM0 3E7KA 1NTMK 3M91A 1IK7A 2C1DB 2Z5HA 1BE3G 3HQ8A 1SQVE 1PZQA 1R5SA 2OQQA 5KJ7C 3FX0A 4UB6V 5C39A 1CRHA 2ITAA 1N73B 1U7JA 1L0LJ 4N78E 2WSCH 1HWTC 5B66H 1P84H 4R4MA 1IO4A 3WFEC 2XU6A 3VMYA 1CCRA 2G8YA 1DIPA 1MZ9A 2KSJA 2YO3A 1QGKB 2WSEH 3R2PA 5AW9B 2WSSH 3M9HA 3H1KE 1S3JA 3VRDA 3Q1MA 1L9JC 1BCCJ 3LIEA 3JCUH 3RLMA 2OZ1B 4C7RA 5KLVG 3H1LE 3VNWA 2B12B 2KOGA 3IFMA 2ZVNB 1PPJD 3ZBMA 1HJ0A 4H44B 2Y0DA 1MV8A 5GTHE 1YTZT 1ETPA 4FANA 3HE5B 1JNMA 2BPBB 3JBTB 1N2DC 4JCGA 3O8ZA 3KDPB 1H8AA 4H13B 2OTLP 1NTME 3DP5A 3L74J 1IFJA 1X8YA 4YXWH 1Q90D 1JCDA 2OYIB 1PIXA 1RE4A 1YJ9P 3FWLA 1GU5A 2FKWB 2PRRA 4B86A 1XTCC 2JTIB 3CC7P 2QG4A 3H32A 2O01J 1VQ4P 3TGUD 2FYUG 3M0DA 4QMAA 2W6BA 1YIQA 1VQ9P 3Q5PA 4C46A 1Y8AA 2HODB 2BH4X 2ZFCA 3BCCG 1AQ5A 4Q5PA 3N7NA 1IRWA 2WSFJ 1CXAA 1AJYA 2B87A 2AEMA 4DOJA 3M97X 5L8RJ 1WEJF 4D6TE 1EDIA 1L0LK 4QAOA 3SLEA 1LTIC 3A0HE 2W8ZA 1C75A 451CA 2W6JH 1FZBA 4EI2A 3X39A 3PJSK 1T3UA 1YITP 2QJKB 4LLHA 3RBZA 4IL6X 1LWUB 4KHXA 2BCCJ 3AEFC 2QJPB 1NVOA 3SWFA 1HGZA 5AW7B 2W6AA 3TF5A 3VOPA 2IBZG 3CCLP 5CIEB 3WU2H 1L4AB 1C6OA 1KC8Q 2PP6A 2HPCA 3WUVA 4YTPC 5DJQB 1SQQK 1G1IA 5KKZB 1CIGA 3A0BE 1FBMA 5CCHA 4KMGA 1PP9J 2IYPA 1COTA 1SLQA 3NBTA 3CLQA 2LR2A 3RL0C 4H0LD 1Q86Q 3P7KA 2A06D 4I1LA 3H1JD 4K35A 1S9KE 2ZT9D 3ITKA 1GL2B 2E74C 4JF7A 5KAIV 2V08A 2VRSA 1YJNP 3L75J 1RH5B 1L0LE 3VMZA 1PL5A 1BE3J 2R3CA 1DEEG 2I8FA 3CU4A 3P8CE 2B10B 1RZ5A 3U1CA 1H33B 1NU1J 2VHDA 2IFNA 2OARA 1FJ0A 1M90Q 3NMDA 2YK3A 1T2KD 3GF3A 1N86A 4JBZA 1I6DA 3H6PA 1JB0J 2NPSD 1BCCE 4UB6E 4Y99C 3MHVA 3CX5I 3TYIA 2QE7H 5CYTR 5CCHC 2KP8A 3CCSP 3G4SP 1KN7A 3M9QA 3P32A 4DCKA 1QL4A 4BXLA 1SFCC 3PH2B 1SQQE 1CYIA 2GB8B 3OCDB 1ZW0A 3G71P 3GHGB 4AYCA 4AAOA 4RO0A 1CHJA 2C1DA 2ZT9C 1ZN5A 3PH0A 3TGUG 1HH0A 1KB9D 2ZZS1 3CP5A 1JTHB 3G9RA 4IFMA 1NAFA 2XNDH 4GIFA 4WQ7A 2IBZI 1G2CA 3L74E 1MG2D 1NYHA 3GMAA 2JQRA 1N73A 2C0WA 3AEEC 1DX7A 1QL2A 1FI7A 5AVRB 1M1JC 3CMAP 1T2KC 4TLFA 4I7ZC 3L73J 3OA8B 3JC22 2L4DA 5KAFE 2NPSC 4LC1A 1FCDC 1M60A 2EXVA 1NTKD 2N18B 1FU1A 3L71G 3W68A 4KT0J 1KYOW 1JY2N 5APQA 1WVEC 2OZ1A 2E42A 2ZBOA 4U3FJ 1YJWP 2M8RA 1SQXD 1JEKA 3N4XA 4XE5B 3BCCJ 1KV9A 3HE5A 2BASA 4XFJA 2KZJA 1BGYJ 2Z5IA 2JWAA 2K9YA 3MK7B 1ZRTD 4AAMA 3A5TA 2KLVA 5AW3B 5GTIE 2JKVA 4IL6V 3ZOYA 2CA4B 2BCCE 1RE3A 2N1TA 1CHHA 2OYOA 1N9CA 2PCBB 1IZL0 5AVWB 1DEBA 1ZLLA 1HUCA 3AEDC 1YEAA 1CNOA 1YQ3C 4WQAA 4WQ8A 3MP7B 3HD7A 1CEDA 1HBWA 1H0TA 1M57D 1UIIA 3NXSA 1NOHA 3G3ZA 4LGDE 1A8CA 4PJ0H 2WITA 1IK9A 1KV4A 3AE1C 1N90A 1CW5A 1URQA 1BDDA 2LITA 5DJUB 2Y9ZA 4PD4I 4UB8H 2E43A 1P84D 3O6QA 1FOSE 5APYA 2E76C 1ZZHA 4GKGA 3BVHA 1SQVJ 2H89C 2KSEA 1FJPA 3HTKB 1ZR4A 1BE3E 1OFCX 4IOIH 1PGPA 3MIWA 4EICA 3D0WA 3BRVB 1L0ND 5CIDB 4GDOA 3H32B 4EDFA 2LXBA 1PP9D 1PGJA 4A7PA 2FYUK 3F5HA 2IX7C 5KAIE 2Q7CA 3WUIA 3MUDA 3Q3DA 1F1CA 1T8ZA 2E75D 3GLMA 4OGQD 1URQC 2H8PD 1KX2A 3L75D 3H1HD 1U7MA 3I56P 3NWVA 4EOTA 3CWBE 2B87B 1DH3A 3SWYA 5KLVE 3SFDC 3I55P 1NWQA 1NU1D 1OVVA 1HVVA 4AQRD 3IR9A 3RL0g 2HV4A 4JYBA 1JY2P 1GJQA 5CJ4A 1HGVA 1UIXA 3L4FA 3SXTA 3RL0B 2IZ1A 3C9IA 3A3YB 2ZXEB 3CD6P 3H1ID 2E74B 2BEQD 1OW6A 4HB1A 1BSNA 3PTZA 3M9BA 1SQXG 1FS0E 1NHLA 1GDTA 2R3SA 1NTZD 2J5UA 2E75C 3O5CA 2HPCB 1FOCA 1R8EA 1M8OB 2Q3IA 2MTAC 2FYUE 3SVWA 1RF1C 4RSZA 2Q6QA 1N7SD 3CXHH 4PJ0V 1JY3O 3L70D 1OW8A 2YMYA 3E1IA 5APSA 4I6MC 3GG2A 3HRNA 1N50A 4UB8V 3O20A 4EIFA 3GHGA 2GA1A 2PAJA 2C9XB 2YKQA 2N9JA 1SFCB 1EDKA 1KYOH 1JTHA 3L73D 1GTWA 4N0KA 1M1KQ 1USEA 1SQPE 1NMLA 1XTGB 2B11B 5KJ7A 2QM7A 2O01H 3V6IA 2ORLA 3WUUA 1SP4A 2P67A 1VF5B 1DD4A 2M0BA 1FZEA 2ZVOB 3M0AA 1CSWA 3AE3C 3NBSA 1RAQA 1BGYD 2IBZE 5DF5A 2KIKA 4IL6E 3CX5W 2WSFH 3PLNA 3VYIA 1CI6A 1KZUB 1E29A 4AALA 2WTYA 1AA0A 2WT7A 1DVVA 5CIHB 4XXLA 1L0NG 2D2CC 4WQEA 5TISV 3HQ9A 2R5BA 3QH9A 2AIUA 1G2CB 3D6YA 1MFTA 1EZVG 5AVXB 3W67A 3OJAB 4P4QB 4AX3A 3H1HG 3CCQP 3AE4C 1T3JA 2PCCB 5CCGC 4PW9B 2D0WA 3RK3D 4L76A 2D0SA 4MU8A 3ORVA 1C7MA 3CWBG 1SQVD 4ZKPA 3B5ND 1LS9A 1YIJP 1DVHA 2JDIH 4H0KA 4YXDC 4L1QA 1OWAA 5AW6B 2GUSA 1SQQJ 1KMIZ 1C52A 2YIUB 2AXTH 1RHZB 1U57A 1A56A 1HF9A 2FYNB 3H1KD 1CXCA 1KD1Q 1JY3P 3L36A 1J1EB 2C1UA 2E76B 3HTKA 4WY4D 3KZIH 3TGUE 5BU5A 2C8SA 3D6ZA 2N1TB 3H1LD 1J1DC 1AYGA 3LW5H 4PD4E 3V2RA 4EIJA 3OW2O 3RK3C 2Q1KA 3L37A 1S6VB 1LP1A 2UWJE 2Y0CA 2QJYB 2LKMA 1C6RA 3HD7B 3HE4A 1H0TB 1GU4A 3CCUP 2OYHA 5E79V 1S5LX 1CTYA 4PV1B 1NTMD 1ZV8A 4NFGB 3L71E 4V2KA 1URQB 1EZVI 3VTPC 5TJHA 1LTAC 1D7MA 2CXBA 1NJIQ 4W80A 1OZHA 3O6QB 2QM8A 2QSIA 2ZXXA 2XTSB 3IN6A 1YI2P 1CYCA 2IDBA 2KZIA 2R44A 1SQPG 3GW6A 3L72D 1GW3A 4ZKUA 2MKVA 3AE8C 2RKLA 2KLUA 2O1KA 5B66V 4IFDK 1ZP0C 2FY8A 1PGOA 1S2EA 3F89A 2LXCB 4L75A 4ASWA 2V4HA 3CCRP 1FZGA 2H7HA 1GQ1A 2OYHC 2L5GB 1HJ3A 2CPBA 1S4XA 1HROA 5AVSB 1K04A 5B5EE 4D6TD 1IFMA 2KNCA 2WVRA 4OVNF 2I1JA 4FA9A 1Y9BA 1S5LH 1AOQA 2MHMA 3ZCFA 1GIWA 2P1JA 4EYYQ 1B7VA 1HCMA 1USDA 2WSEJ 3Q2YA 1K9MQ 1FZCC 3D71A 1Q81Q 1KQSO 2E5TA 1SFCA 1AQTA 2JR8A 3CX5H 3CCEP 2ZONG 1CHIA 2C1VA 1HJBA 1LTJC 1E79H 4CPGA 1VQPP 3HQ7A 2G3AA 5AURA 2KS1A 3CYTI 3SWSA 1PPJG 4M3LA 1IRVA 1SQXK 5TISE 1VL2A 1SQBD 1LT9C 1KQFB 3OAKA 1M1JA 3RN1A 1EC5A 3ZDMA 1S9KD 3AE2C 1CIFA 1DW2A 2NPSA 5H2FH 1HTLC 1KB9E 2FBWC 3RK2B 1W2BO 1L0LD 3CWBJ 4WQBA 5KLVJ 2K1AA 1AKKA 4H0LC 1ZR2A 1U74B 3CMEP 4BRYB 1AVYA 3L35A 2AI5A 1KILD 5DJTB 3SJLA 2D2CB 3FWNA 3S4RA 1OVUA 2N3BA 1BCCD 5AVQB 1C2NA 3RN0A 2V7QJ 4WWIA 1DW3A 1K3HA 1WMKA 3R4YA 2P7JA 1NTKE 2QVAA 1PV3A 3CXHW 1YTCA 1SS1A 3RGUA 2HR3A 3CXHD 3WU2V 1SQQD 4Y28J 1QN2A 2DVHA 4AANA 1SQXE 2C9NY 2PACA 3T97B 1JY2O 4KJMA 1S5LV 2FYUJ 3L72G 1CRYA 1CI6B 2YCCA 1KYOD 2CE1A 2I1KA 3L74D 1NKZB 1EXIA 1F1FA 2WT7B 5GTHH 3II6A 1WRGA 1H1OA 1L0NK 1Y47A 1OIPA 1KILC 1JMMA 4H44D 5E79E 2IYOA 1IQCA 1OW7A 2KI7B 2R5DA 1OMIA 5CIGB 1R5LA 1SQPJ 1CC5A 1CSXA 4H13D 1MKMA 5CICB 2W27A 1CIHA 5AW5B 2FRCA 1ZXGA 2A06G 3H1JG 4I2LC 3AECC 1YFCA 3WC8A 2QRXA 2PGDA 5KLVK 3SSUA 3CCMP 5B66E 3CL3D 5H2FV 4JYCA 1E5WA 3VMXA 1IC2A 4WB4A 2N9YB 1X79B 3ZOOA 2BCCD 4FA4A 4ASVA 3B4SA 1VQNP 1KQLA 2WZ7A 3A0HH 1SQBG 3JCUE 1MG3D 1L0NE 1I8OA 1FJKA 4GYDA 3PP5A 2CA3B 5EXQA 1H89A 1LNQA 2ZOOA 2E5YA 4H0JA 1AFOA 5CMZA 2GIWA 4H13C 4RESB 3VYMA 2YXQB 5EFWB 3TDKA 2CK3H 1EZVE 4FB1A 1NIRA 2IPPA 1H31A 2OYIC 1LP1B 3H1HE 1CORA 4O1WA 2KUBA 2WPVB 3V5BA 1VQLP 3HE4B 3WFCC 4OWFA 2HFED 1N15A 2OYHB 3L4OA 3A0BH 1L4AD 1QVFO 1CSUA 5AVZB 2A45H 5KLIC 3KXDA 1BE3D 2KK7A 1RF1A 3MTUE 1H32A 4GOFA 4W7YA 1KTMA 1DT1A 1PGQA 3AEBC 2KYVA 1SQPK 1DIIC 1L9BC 4DZOA 1IFNA 1NTKG 2HYNA 3CPWO 1QYZA 2KB7P 4EIEA 3EFFK 3TGUJ 4N3YB 3O1YA 1GL2D 1BDCA 3MD0A 2XNXA 3G6EP 2QJKC 3VP8A 1CSVA 1JO5A 1JOCA 1I6EA 2QJPC 4UB6H 1GDVA 3AE7C 4OGQC 1KB0A 2KNCB 2SPZA 1I54A 3E1RA 3P8MC 1L4AC 2QA4P 4Y99B 5DJQC 3L71J 2MJZA 3ZOXA 3WU2E 2QEXP 2WMMA 1DW1A 2QIWA 5C9MA 4L3HA 1GW4A 4BRYA 4H0LB 2M5AA 1VQMP 3A2AA 3U59A 2ZT9B 2K88A 1DW0A 2DGEA 1GL2C 2OGUA 1KB9I 2KS1B 4U3FD 1OAEA 5CIFB 4RKUJ 2OTJP 1N8RQ 4GOEA 1MFZA 2K9JA 2B89A 1NKNA 5KAFH 1HH7A 5APVA 3BCCD 5KJ7D 1M1JB 4NPEA 3RBXA 5CCGA 4I7ZB 3T97A 4HKZH 1G1JA 4DY9A 2NPSB 2C9LY 1CSBA 1LT1A 1N7SC 3CX5D 2N3YA 1L2PA 4WQCA 3AE6C 1KORA 3JSVC 4ZMDA 2Q5UA 1QVGO 1LFMA 1LC1A 5AW2B 1T6AA 1PP9G 1EDLA 1I8PA 2K37A 1DIQC 3PXTA 1EQ7A 1M7LA 5AVYB 2O1JA 4K3IA 2OTKE 5GTIH 2YNYA 1W2EA 3VMAA 2C2CA 3RK3E 2IBZD 5AVUB 3NFQA 3L75G 4L73A 1KIBA 4K3AA 3PXSA 2I8DA 4NPFX 3V4WA 2RH0A 1NU1G 1CRGA 3S9OA 4J20A 1PPJE 1GK4A 2GC4D 3WUTA 2J59M 2RN0A 5CBNA 1CCHA 1YEBA 2FYZA 3BRTB 3L4MA 2B88A 2N18C 3H1IG 1M6ZA 3TYYA 3B5NA 4N78D 1E8EA 1RF0C 1NTZG 3WFBC 1NO4A 1AOFA 1IFIA 1FDOA 3TSIA 4FA5A 1QX8A 2POHA 1P84I 4L3GA 3MK7C 1FI3A 2H43A 3K5BA 1YYCA 5CIBB 155CA 3L70G 1NTKJ 4WY4A 5CHXA 2B4ZA 1HZVA 1QL1A 3O0RC 5KAFV 5KAIH 1IJDB 3GF7A 2NRGA 1K8AQ 3L73G 1SQXJ 1MUUA 2YO2A 3B5NC 1K3GA 3EQ2A 1FI9A 3L72E 1YICA 4AUWA 3PXWA 4U3FG 2FXOA 1JCCA 5KLIB 1SQBK 3OA7A 2W90A 5CBOA 2GC7D 4PD4D 3AEGC 3FXEA 3V2NA 1R0QA 5K5GB 1FZCA 1JM0A 5GTIV 1BGYG 2P58A 3HUSA 4WY4C 4JPZB 2V7QH 4PJ0E 1IFPA 1FOSF 4R4LA 1LTGC 3ZOWA 4UB8E 3RL0D 5APUA 1LTJA 5C0ZA 1YTZI 2KXPB 1H31B 3L71D 1RE4C 2JEEA 2E74D 3FXDA 1U75B 1HJ4A 4RJTA 2J58A 3M0DC 1LT9A 3V4QA 2WSCJ 2E75B 3FGAD 2Z4EA 2A06E 3H1JE 4OGQB 4WQ9A 2YMKA 3DMIA 2P10A 5AVVB 1RF1B 1H32B 3HUSC 2AXTV 2FFDA 2N9BA 5CCHD 2V07A 1KFMA 1S1CX 1GMJA 3TNUA 2XKMA 1L0NJ 1NTKK 1HRCA 4O1QA 1CO6A 4L74A 2ZXYA 4ZNCA 4OH8B 1I5TA 1SQBE 3KZIV 1CRCA 1SQVG 1SFCD 1QEXA 2H88C 2Y9YA 4HH2A 1X0TA 3LIDA 2YXRB 3H1HJ 1CYJA 1M56D 1JMBA 4IFFA 4IL6H 1RQVA 3EFGA 3H1KG 2HLOA 1VF5D 2AEFA 3KQGA 1X22A 3CI9A 3C2CA 1KILE 3LW5J 2FFDC 5AW4B 1QKSA 2Q3EA 3H1LG 1N7SB 1RQUA 5AW1B 3P8CD 2M3BA 3C8VA 1DD3A 1YBKA 2R32A 3H1IJ 2JO1A 2BGVX 3CC2P 1W2LA 1K73Q 2M5AB 1LTSC 3NTNA 2FXMA 1Z56A 2FWLA 3CXHE 3DR0A 1NH4A 4TT3H 4C7NA 1KILA 1NTZJ 2AXCA 1MZ4A 4DT0A 1OVRA 1TU3F 2WQYC 2DW3A 2Y0EA 1CTZA 1NTMG 2RMZA 1GU2A 2ZJSE 2K9JB 5BU8B 3BASA 1FZFA 2C0XA 2CPSA 1KYOE 1CRIA 4N6JA 1W5CE 1A2SA 3L70J 2JP3A 3KPEA 4GODA 1J3SA 1KX7A 1JUNA 1FZAA 5AW8B 1VF5C 3CC4P 3C1LA 1VQ5P 3TK1A 4YE1A 1CRJA 1CZQA 3IAOA 3PRJA 1ZOYC 1LGHB 2LIRA 1GK6A 1ZRTE 4HJGH 1YCCA 351CA 1Q82Q 4WVZA 2HG5D 2GUVA 4LJIA 2P2UA 3A7OA 2YQBA 3HQ6A 1ZMEC 2ZYAA 2B9BA 2BH5X 1HZUA 2O3JA 3U1AA 2ZYDA 4O9BA 2BEZF 4D6TG 4GEDB 3MGNA 1BSHA 2WPQA 3A9FA 4PD4H 3PHLA 4FAVA 1N73C 2E76D 1VYDA 1NU1K 3KHUA 1CIEA 1J1DB 2N1TD 5CJ0A 3MZWB 1M70A 1FDMA 4BWNA 1PFIA 3RK3B 2OYIA 1P84E 1FDIA 3RMZA 3VN0A 4EIDA 3HD7D 1VQKP 3B5NB 1LTBC 3Q5SA 4PV1D 4H44C 4NPDA 5DFSA 2HODA 1NTZK 1J2JB 4WBAA 2A45G 1URQD 4FA1A 3ABVC 4JQ0D 5APWA 4WQDA 5AW0B 2YIUC 1PP9E 5APXA 3UIAA 1GD2E 2NZ2A 2Q9IA 2FYNC 1LJ2A 4WY4B 1Q7YQ 1J1EC 2BLFB 1L0LG 2AXTE 2IZ0A 1KQGB 1YNRA 1RE3C 5AVTB 1NMIA 2N1TC 3L75E 1NAYA 1FE6A 5B5EH 1AVOA 3KZIE 3V2QA 1H88A 1LWUA 2FXPA 2L91A 1GKSA 1NU1E 1EXJA 2GM4A 1NNOA 1EDJA 2QJYC 3BATA 1BCCG 3HD7C 1S72P 1OX3A 3S1KA 5GTHV 2WPRA 1L4AA 3H1KJ 4PV1C 1OCDA 1VQ8P 2IFMA 3VP9A 1SVFA 3H1IE 1EZVD 2JWDA 1X9VA 4U7JA 1SQQG 2XV5A 3H1LJ 5B6QA 1FZCB 2PFXA 2W83C 3HUSB 4Z1MH 1NTZE 4HYTB 5IY51 3ZIYA 3AEAC 1VQOP 3L74G 1OXZA 5APTA
chains in the Genus database with same CATH topology
1CRGA 4FA9A 4J20A 1EB7A 1SQXD 1AOQA 4PWAA 2GC4D 2MHMA 2RN0A 3CWBD 1KV9A 3ZCFA 1CCHA 5KLVD 1GIWA 1JDLA 2JWAA 1B7VA 1HCMA 1YEBA 3MK7B 1ZRTD 3L4MA 4AAMA 1RAPA 2N18C 1M6ZA 3WFDC 1I55A 1H33A 1E8EA 4IL6V 2ZONG 1CHIA 2N9IA 3ZOYA 2CA4B 2C1VA 1W5CT 1CTJA 1CHHA 1C2RA 1N9CA 3WFBC 2PCBB 1IZL0 1AOFA 3HQ7A 5AURA 2KS1A 3CYTI 3A0HV 4FA5A 1YEAA 3SWSA 1CNOA 1IRVA 4L3GA 3MK7C 1FI3A 4WQAA 4WQ8A 1H9YA 1SQBD 1CEDA 5CIBB 155CA 2BCNB 3RN1A 2B4ZA 1HZVA 1A8CA 1H9XA 3O0RC 5KAFV 2FYUD 3OCDA 1QL3A 1N90A 1CIFA 1DW2A 1RZ6A 2LITA 1P84D 1L0LD 5B5EV 1HJ5A 4WQBA 1ZZHA 1AKKA 1BL9A 1U74B 1K3GA 1FI9A 1E2RA 1C6SA 3A0BV 2AI5A 1YICA 3SJLA 3PXWA 1FHBA 2N3BA 4EICA 5KLIB 2CE0A 1LC2A 3OA8A 1BCCD 1L0ND 2GC7D 4PD4D 1SQPD 5CIDB 1C2NA 4EDFA 3RN0A 1PP9D 4A7PA 1R0QA 1DW3A 1K3HA 1LMSA 5GTIV 3WUIA 1IO3A 1YTCA 3CXHW 1F1CA 3ZOWA 3CXHD 2B0ZB 4XYDB 3WU2V 1SQQD 4Y5RA 1QN2A 2DVHA 1KX2A 5C0ZA 4AANA 3L75D 3H1HD 1H31B 2PACA 3L71D 3NWVA 2C1DB 1S5LV 1U75B 1CRYA 2YCCA 1KYOD 2CE1A 3HQ8A 1HJ4A 4RJTA 3L74D 1NU1D 1F1FA 4UB6V 2HV4A 1CRHA 1H1OA 1GJQA 3SXTA 4WQ9A 3DMIA 3WFEC 1CCRA 1H32B 3H1ID 1IQCA 2AXTV 2V07A 3VRDA 3PTZA 1L9JC 5CIGB 1HRCA 1CC5A 4O1QA 1CO6A 1CSXA 2ZXYA 1NTZD 3RLMA 2OZ1B 1I5TA 3KZIV 1CRCA 3O5CA 5CICB 1FOCA 3VNWA 2B12B 1CIHA 1PPJD 3ZBMA 2MTAC 2Y0DA 3SVWA 2FRCA 4RSZA 1ETPA 4PJ0V 1YFCA 3WC8A 3L70D 4FANA 2BPBB 3JBTB 3GG2A 1CYJA 4JCGA 5H2FV 1N50A 4UB8V 3O20A 4EIFA 2C9XB 3DP5A 2N9JA 2N9YB 3ZOOA 3L73D 2BCCD 4FA4A 3C2CA 3FWLA 1QKSA 2Q3EA 4N0KA 2JTIB 1MG3D 2QG4A 1I8OA 1NMLA 2B11B 4GYDA 2CA3B 5EXQA 3TGUD 1YIQA 2BGVX 1W2LA 2ZOOA 2ORLA 4H0JA 2GIWA 2FWLA 2BH4X 3VYMA 3DR0A 3TDKA 4FB1A 1CSWA 1NIRA 1MZ4A 3NBSA 4Q5PA 1RAQA 1BGYD 1IRWA 2Y0EA 1CTZA 1H31A 2RMZA 5DF5A 1CXAA 1GU2A 1CORA 3CX5W 4O1WA 2K9JB 3PLNA 3WFCC 1E29A 3M97X 1CRIA 4AALA 1N15A 1WEJF 3L4OA 1A2SA 1DVVA 5CIHB 4XXLA 4QAOA 3SLEA 1J3SA 1KX7A 1C75A 451CA 1CSUA 4WQEA 5TISV 3HQ9A 1BE3D 4YE1A 3X39A 1CRJA 2QJKB 3PRJA 1H32A 2AIUA 2LIRA 1DT1A 1YCCA 351CA 2QJPB 4LJIA 1DIIC 1L9BC 3TF5A 2YQBA 3HQ6A 4P4QB 5CIEB 2BH5X 4AX3A 1C6OA 1QYZA 1HZUA 2PCCB 4EIEA 2O3JA 3O1YA 4PW9B 2D0WA 5DJQB 4GEDB 2D0SA 4MU8A 3ORVA 5KKZB 1CSVA 1CIGA 1C7MA 1I6EA 4KMGA 1SQVD 3A9FA 3PHLA 1COTA 1LS9A 4FAVA 1GDVA 1DVHA 1KB0A 3NBTA 4H0KA 2KNCB 1VYDA 3KHUA 1I54A 4L1QA 1CIEA 2A06D 3H1JD 3ITKA 1M70A 5KAIV 2V08A 1C52A 2YIUB 5DJQC 3ZOXA 1A56A 3RMZA 4EIDA 2FYNB 2I8FA 1CXCA 3CU4A 3H1KD 1DW1A 2B10B 1RZ5A 5C9MA 1H33B 4L3HA 2VHDA 2C1UA 1FJ0A 2YK3A 2C8SA 5DFSA 1I6DA 3H1LD 1AYGA 1DW0A 4FA1A 2DGEA 3TYIA 4WQDA 5CYTR 1S6VB 4U3FD 1OAEA 5CIFB 2Y0CA 2QJYB 1C6RA 1QL4A 1HH7A 3BCCD 3PH2B 5E79V 1CTYA 2BLFB 1CYIA 2GB8B 3OCDB 1NTMD 1YNRA 4NFGB 1NMIA 4AAOA 4DY9A 1CHJA 2C1DA 4V2KA 1KB9D 2ZZS1 3CP5A 3CX5D 5TJHA 2CXBA 2N3YA 4WQCA 4WQ7A 2L91A 1GKSA 1MG2D 1NNOA 2XTSB 2JQRA 1CYCA 1LFMA 1LC1A 3GW6A 3L72D 5GTHV 1FI7A 1I8PA 1DIQC 1OCDA 3PXTA 5B66V 4K3IA 3OA8B 1EZVD 2L4DA 3VMAA 2C2CA 1FCDC 1M60A 2EXVA 5B6QA 1NTKD 2IBZD 1GQ1A 2N18B 1KIBA 1HJ3A 1KYOW 1WVEC 2OZ1A 1HROA 2ZBOA 5IY51 3PXSA 3ZIYA 4D6TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRG A;  4FA9 A;  4J20 A;  1EB7 A;  1SQX D;  1AOQ A;  4PWA A;  2GC4 D;  2MHM A;  2RN0 A;  3CWB D;  1KV9 A;  3ZCF A;  1CCH A;  5KLV D;  1GIW A;  1JDL A;  2JWA A;  1B7V A;  1HCM A;  1YEB A;  3MK7 B;  1ZRT D;  3L4M A;  4AAM A;  1RAP A;  2N18 C;  1M6Z A;  3WFD C;  1I55 A;  1H33 A;  1E8E A;  4IL6 V;  2ZON G;  1CHI A;  2N9I A;  3ZOY A;  2CA4 B;  2C1V A;  1W5C T;  1CTJ A;  1CHH A;  1C2R A;  1N9C A;  3WFB C;  2PCB B;  1IZL 0;  1AOF A;  3HQ7 A;  5AUR A;  2KS1 A;  3CYT I;  3A0H V;  4FA5 A;  1YEA A;  3SWS A;  1CNO A;  1IRV A;  4L3G A;  3MK7 C;  1FI3 A;  4WQA A;  4WQ8 A;  1H9Y A;  1SQB D;  1CED A;  5CIB B;  155C A;  2BCN B;  3RN1 A;  2B4Z A;  1HZV A;  1A8C A;  1H9X A;  3O0R C;  5KAF V;  2FYU D;  3OCD A;  1QL3 A;  1N90 A;  1CIF A;  1DW2 A;  1RZ6 A;  2LIT A;  1P84 D;  1L0L D;  5B5E V;  1HJ5 A;  4WQB A;  1ZZH A;  1AKK A;  1BL9 A;  1U74 B;  1K3G A;  1FI9 A;  1E2R A;  1C6S A;  3A0B V;  2AI5 A;  1YIC A;  3SJL A;  3PXW A;  1FHB A;  2N3B A;  4EIC A;  5KLI B;  2CE0 A;  1LC2 A;  3OA8 A;  1BCC D;  1L0N D;  2GC7 D;  4PD4 D;  1SQP D;  5CID B;  1C2N A;  4EDF A;  3RN0 A;  1PP9 D;  4A7P A;  1R0Q A;  1DW3 A;  1K3H A;  1LMS A;  5GTI V;  3WUI A;  1IO3 A;  1YTC A;  3CXH W;  1F1C A;  3ZOW A;  3CXH D;  2B0Z B;  4XYD B;  3WU2 V;  1SQQ D;  4Y5R A;  1QN2 A;  2DVH A;  1KX2 A;  5C0Z A;  4AAN A;  3L75 D;  3H1H D;  1H31 B;  2PAC A;  3L71 D;  3NWV A;  2C1D B;  1S5L V;  1U75 B;  1CRY A;  2YCC A;  1KYO D;  2CE1 A;  3HQ8 A;  1HJ4 A;  4RJT A;  3L74 D;  1NU1 D;  1F1F A;  4UB6 V;  2HV4 A;  1CRH A;  1H1O A;  1GJQ A;  3SXT A;  4WQ9 A;  3DMI A;  3WFE C;  1CCR A;  1H32 B;  3H1I D;  1IQC A;  2AXT V;  2V07 A;  3VRD A;  3PTZ A;  1L9J C;  5CIG B;  1HRC A;  1CC5 A;  4O1Q A;  1CO6 A;  1CSX A;  2ZXY A;  1NTZ D;  3RLM A;  2OZ1 B;  1I5T A;  3KZI V;  1CRC A;  3O5C A;  5CIC B;  1FOC A;  3VNW A;  2B12 B;  1CIH A;  1PPJ D;  3ZBM A;  2MTA C;  2Y0D A;  3SVW A;  2FRC A;  4RSZ A;  1ETP A;  4PJ0 V;  1YFC A;  3WC8 A;  3L70 D;  4FAN A;  2BPB B;  3JBT B;  3GG2 A;  1CYJ A;  4JCG A;  5H2F V;  1N50 A;  4UB8 V;  3O20 A;  4EIF A;  2C9X B;  3DP5 A;  2N9J A;  2N9Y B;  3ZOO A;  3L73 D;  2BCC D;  4FA4 A;  3C2C A;  3FWL A;  1QKS A;  2Q3E A;  4N0K A;  2JTI B;  1MG3 D;  2QG4 A;  1I8O A;  1NML A;  2B11 B;  4GYD A;  2CA3 B;  5EXQ A;  3TGU D;  1YIQ A;  2BGV X;  1W2L A;  2ZOO A;  2ORL A;  4H0J A;  2GIW A;  2FWL A;  2BH4 X;  3VYM A;  3DR0 A;  3TDK A;  4FB1 A;  1CSW A;  1NIR A;  1MZ4 A;  3NBS A;  4Q5P A;  1RAQ A;  1BGY D;  1IRW A;  2Y0E A;  1CTZ A;  1H31 A;  2RMZ A;  5DF5 A;  1CXA A;  1GU2 A;  1COR A;  3CX5 W;  4O1W A;  2K9J B;  3PLN A;  3WFC C;  1E29 A;  3M97 X;  1CRI A;  4AAL A;  1N15 A;  1WEJ F;  3L4O A;  1A2S A;  1DVV A;  5CIH B;  4XXL A;  4QAO A;  3SLE A;  1J3S A;  1KX7 A;  1C75 A;  451C A;  1CSU A;  4WQE A;  5TIS V;  3HQ9 A;  1BE3 D;  4YE1 A;  3X39 A;  1CRJ A;  2QJK B;  3PRJ A;  1H32 A;  2AIU A;  2LIR A;  1DT1 A;  1YCC A;  351C A;  2QJP B;  4LJI A;  1DII C;  1L9B C;  3TF5 A;  2YQB A;  3HQ6 A;  4P4Q B;  5CIE B;  2BH5 X;  4AX3 A;  1C6O A;  1QYZ A;  1HZU A;  2PCC B;  4EIE A;  2O3J A;  3O1Y A;  4PW9 B;  2D0W A;  5DJQ B;  4GED B;  2D0S A;  4MU8 A;  3ORV A;  5KKZ B;  1CSV A;  1CIG A;  1C7M A;  1I6E A;  4KMG A;  1SQV D;  3A9F A;  3PHL A;  1COT A;  1LS9 A;  4FAV A;  1GDV A;  1DVH A;  1KB0 A;  3NBT A;  4H0K A;  2KNC B;  1VYD A;  3KHU A;  1I54 A;  4L1Q A;  1CIE A;  2A06 D;  3H1J D;  3ITK A;  1M70 A;  5KAI V;  2V08 A;  1C52 A;  2YIU B;  5DJQ C;  3ZOX A;  1A56 A;  3RMZ A;  4EID A;  2FYN B;  2I8F A;  1CXC A;  3CU4 A;  3H1K D;  1DW1 A;  2B10 B;  1RZ5 A;  5C9M A;  1H33 B;  4L3H A;  2VHD A;  2C1U A;  1FJ0 A;  2YK3 A;  2C8S A;  5DFS A;  1I6D A;  3H1L D;  1AYG A;  1DW0 A;  4FA1 A;  2DGE A;  3TYI A;  4WQD A;  5CYT R;  1S6V B;  4U3F D;  1OAE A;  5CIF B;  2Y0C A;  2QJY B;  1C6R A;  1QL4 A;  1HH7 A;  3BCC D;  3PH2 B;  5E79 V;  1CTY A;  2BLF B;  1CYI A;  2GB8 B;  3OCD B;  1NTM D;  1YNR A;  4NFG B;  1NMI A;  4AAO A;  4DY9 A;  1CHJ A;  2C1D A;  4V2K A;  1KB9 D;  2ZZS 1;  3CP5 A;  3CX5 D;  5TJH A;  2CXB A;  2N3Y A;  4WQC A;  4WQ7 A;  2L91 A;  1GKS A;  1MG2 D;  1NNO A;  2XTS B;  2JQR A;  1CYC A;  1LFM A;  1LC1 A;  3GW6 A;  3L72 D;  5GTH V;  1FI7 A;  1I8P A;  1DIQ C;  1OCD A;  3PXT A;  5B66 V;  4K3I A;  3OA8 B;  1EZV D;  2L4D A;  3VMA A;  2C2C A;  1FCD C;  1M60 A;  2EXV A;  5B6Q A;  1NTK D;  2IBZ D;  1GQ1 A;  2N18 B;  1KIB A;  1HJ3 A;  1KYO W;  1WVE C;  2OZ1 A;  1HRO A;  2ZBO A;  5IY5 1;  3PXS A;  3ZIY A;  4D6T D; 
#chains in the Genus database with same CATH topology
 5TIS H;  1EB7 A;  1LTJ B;  4PWA A;  2JJL A;  3CWB D;  1GL2 A;  1LWU C;  3V2P A;  5KLV D;  1VDF A;  1YQ4 C;  1NTM J;  3L70 E;  1JDL A;  2ZAE B;  3SWK A;  1GZL A;  1VQ6 P;  3IF4 A;  1RAP A;  1LT9 B;  3I5C A;  3WFD C;  1AV1 A;  1I55 A;  2YKP A;  3MUD C;  1H33 A;  2A45 I;  1KB9 H;  4YPC A;  2O01 N;  1FC2 C;  2N9I A;  3L73 E;  1W5C T;  1CTJ A;  3H25 A;  1RY3 A;  3QWO C;  1C2R A;  3L72 J;  1N7S A;  5KKZ C;  4XA4 A;  2FFD B;  1N7L A;  1VPC A;  3A0H V;  1K05 A;  1A02 F;  3RK2 D;  4GT1 A;  3TNU B;  3B71 A;  2WPS A;  1S5L E;  4U3F E;  1H9Y A;  1KFN A;  3AE5 C;  1JY3 N;  3USS A;  3CCJ P;  1SQV K;  4W7Z A;  3SFE C;  2BCN B;  3M06 A;  5KTB A;  3BCC E;  1H9X A;  2FYU D;  3OCD A;  2ZYG A;  2D2C D;  3KYQ A;  1NGM B;  1QL3 A;  1BGY E;  1RZ6 A;  4D6T J;  1IZN B;  2M3E A;  1FAV A;  3CX5 E;  2BCC G;  3CCV P;  2XZR A;  5B5E V;  1HJ5 A;  1QLE D;  4DJG A;  1BL9 A;  1LTT C;  3EWK A;  3CXH I;  1E2R A;  1C6S A;  3A0B V;  2YKO A;  2XDJ A;  3H1J J;  2AEJ A;  5CCG D;  1FHB A;  3D70 A;  1IFD A;  2CE0 A;  1LC2 A;  3OA8 A;  4MN4 C;  1A02 J;  1SQP D;  5BVZ A;  1YHQ P;  2K3R A;  1KYO I;  3AE9 C;  1LMS A;  3RK2 C;  3B8E B;  5E79 H;  2WWW A;  1IO3 A;  5M1B A;  3GHG C;  1Q2N A;  2B0Z B;  5H2F E;  4XYD B;  1WT6 A;  4C7N B;  1KIL B;  1RF0 A;  4Y5R A;  1VQ7 P;  1SQB J;  3Q5R A;  3WMM 0;  3E7K A;  1NTM K;  3M91 A;  1IK7 A;  2C1D B;  2Z5H A;  1BE3 G;  3HQ8 A;  1SQV E;  1PZQ A;  1R5S A;  2OQQ A;  5KJ7 C;  3FX0 A;  4UB6 V;  5C39 A;  1CRH A;  2ITA A;  1N73 B;  1U7J A;  1L0L J;  4N78 E;  2WSC H;  1HWT C;  5B66 H;  1P84 H;  4R4M A;  1IO4 A;  3WFE C;  2XU6 A;  3VMY A;  1CCR A;  2G8Y A;  1DIP A;  1MZ9 A;  2KSJ A;  2YO3 A;  1QGK B;  2WSE H;  3R2P A;  5AW9 B;  2WSS H;  3M9H A;  3H1K E;  1S3J A;  3VRD A;  3Q1M A;  1L9J C;  1BCC J;  3LIE A;  3JCU H;  3RLM A;  2OZ1 B;  4C7R A;  5KLV G;  3H1L E;  3VNW A;  2B12 B;  2KOG A;  3IFM A;  2ZVN B;  1PPJ D;  3ZBM A;  1HJ0 A;  4H44 B;  2Y0D A;  1MV8 A;  5GTH E;  1YTZ T;  1ETP A;  4FAN A;  3HE5 B;  1JNM A;  2BPB B;  3JBT B;  1N2D C;  4JCG A;  3O8Z A;  3KDP B;  1H8A A;  4H13 B;  2OTL P;  1NTM E;  3DP5 A;  3L74 J;  1IFJ A;  1X8Y A;  4YXW H;  1Q90 D;  1JCD A;  2OYI B;  1PIX A;  1RE4 A;  1YJ9 P;  3FWL A;  1GU5 A;  2FKW B;  2PRR A;  4B86 A;  1XTC C;  2JTI B;  3CC7 P;  2QG4 A;  3H32 A;  2O01 J;  1VQ4 P;  3TGU D;  2FYU G;  3M0D A;  4QMA A;  2W6B A;  1YIQ A;  1VQ9 P;  3Q5P A;  4C46 A;  1Y8A A;  2HOD B;  2BH4 X;  2ZFC A;  3BCC G;  1AQ5 A;  4Q5P A;  3N7N A;  1IRW A;  2WSF J;  1CXA A;  1AJY A;  2B87 A;  2AEM A;  4DOJ A;  3M97 X;  5L8R J;  1WEJ F;  4D6T E;  1EDI A;  1L0L K;  4QAO A;  3SLE A;  1LTI C;  3A0H E;  2W8Z A;  1C75 A;  451C A;  2W6J H;  1FZB A;  4EI2 A;  3X39 A;  3PJS K;  1T3U A;  1YIT P;  2QJK B;  4LLH A;  3RBZ A;  4IL6 X;  1LWU B;  4KHX A;  2BCC J;  3AEF C;  2QJP B;  1NVO A;  3SWF A;  1HGZ A;  5AW7 B;  2W6A A;  3TF5 A;  3VOP A;  2IBZ G;  3CCL P;  5CIE B;  3WU2 H;  1L4A B;  1C6O A;  1KC8 Q;  2PP6 A;  2HPC A;  3WUV A;  4YTP C;  5DJQ B;  1SQQ K;  1G1I A;  5KKZ B;  1CIG A;  3A0B E;  1FBM A;  5CCH A;  4KMG A;  1PP9 J;  2IYP A;  1COT A;  1SLQ A;  3NBT A;  3CLQ A;  2LR2 A;  3RL0 C;  4H0L D;  1Q86 Q;  3P7K A;  2A06 D;  4I1L A;  3H1J D;  4K35 A;  1S9K E;  2ZT9 D;  3ITK A;  1GL2 B;  2E74 C;  4JF7 A;  5KAI V;  2V08 A;  2VRS A;  1YJN P;  3L75 J;  1RH5 B;  1L0L E;  3VMZ A;  1PL5 A;  1BE3 J;  2R3C A;  1DEE G;  2I8F A;  3CU4 A;  3P8C E;  2B10 B;  1RZ5 A;  3U1C A;  1H33 B;  1NU1 J;  2VHD A;  2IFN A;  2OAR A;  1FJ0 A;  1M90 Q;  3NMD A;  2YK3 A;  1T2K D;  3GF3 A;  1N86 A;  4JBZ A;  1I6D A;  3H6P A;  1JB0 J;  2NPS D;  1BCC E;  4UB6 E;  4Y99 C;  3MHV A;  3CX5 I;  3TYI A;  2QE7 H;  5CYT R;  5CCH C;  2KP8 A;  3CCS P;  3G4S P;  1KN7 A;  3M9Q A;  3P32 A;  4DCK A;  1QL4 A;  4BXL A;  1SFC C;  3PH2 B;  1SQQ E;  1CYI A;  2GB8 B;  3OCD B;  1ZW0 A;  3G71 P;  3GHG B;  4AYC A;  4AAO A;  4RO0 A;  1CHJ A;  2C1D A;  2ZT9 C;  1ZN5 A;  3PH0 A;  3TGU G;  1HH0 A;  1KB9 D;  2ZZS 1;  3CP5 A;  1JTH B;  3G9R A;  4IFM A;  1NAF A;  2XND H;  4GIF A;  4WQ7 A;  2IBZ I;  1G2C A;  3L74 E;  1MG2 D;  1NYH A;  3GMA A;  2JQR A;  1N73 A;  2C0W A;  3AEE C;  1DX7 A;  1QL2 A;  1FI7 A;  5AVR B;  1M1J C;  3CMA P;  1T2K C;  4TLF A;  4I7Z C;  3L73 J;  3OA8 B;  3JC2 2;  2L4D A;  5KAF E;  2NPS C;  4LC1 A;  1FCD C;  1M60 A;  2EXV A;  1NTK D;  2N18 B;  1FU1 A;  3L71 G;  3W68 A;  4KT0 J;  1KYO W;  1JY2 N;  5APQ A;  1WVE C;  2OZ1 A;  2E42 A;  2ZBO A;  4U3F J;  1YJW P;  2M8R A;  1SQX D;  1JEK A;  3N4X A;  4XE5 B;  3BCC J;  1KV9 A;  3HE5 A;  2BAS A;  4XFJ A;  2KZJ A;  1BGY J;  2Z5I A;  2JWA A;  2K9Y A;  3MK7 B;  1ZRT D;  4AAM A;  3A5T A;  2KLV A;  5AW3 B;  5GTI E;  2JKV A;  4IL6 V;  3ZOY A;  2CA4 B;  2BCC E;  1RE3 A;  2N1T A;  1CHH A;  2OYO A;  1N9C A;  2PCB B;  1IZL 0;  5AVW B;  1DEB A;  1ZLL A;  1HUC A;  3AED C;  1YEA A;  1CNO A;  1YQ3 C;  4WQA A;  4WQ8 A;  3MP7 B;  3HD7 A;  1CED A;  1HBW A;  1H0T A;  1M57 D;  1UII A;  3NXS A;  1NOH A;  3G3Z A;  4LGD E;  1A8C A;  4PJ0 H;  2WIT A;  1IK9 A;  1KV4 A;  3AE1 C;  1N90 A;  1CW5 A;  1URQ A;  1BDD A;  2LIT A;  5DJU B;  2Y9Z A;  4PD4 I;  4UB8 H;  2E43 A;  1P84 D;  3O6Q A;  1FOS E;  5APY A;  2E76 C;  1ZZH A;  4GKG A;  3BVH A;  1SQV J;  2H89 C;  2KSE A;  1FJP A;  3HTK B;  1ZR4 A;  1BE3 E;  1OFC X;  4IOI H;  1PGP A;  3MIW A;  4EIC A;  3D0W A;  3BRV B;  1L0N D;  5CID B;  4GDO A;  3H32 B;  4EDF A;  2LXB A;  1PP9 D;  1PGJ A;  4A7P A;  2FYU K;  3F5H A;  2IX7 C;  5KAI E;  2Q7C A;  3WUI A;  3MUD A;  3Q3D A;  1F1C A;  1T8Z A;  2E75 D;  3GLM A;  4OGQ D;  1URQ C;  2H8P D;  1KX2 A;  3L75 D;  3H1H D;  1U7M A;  3I56 P;  3NWV A;  4EOT A;  3CWB E;  2B87 B;  1DH3 A;  3SWY A;  5KLV E;  3SFD C;  3I55 P;  1NWQ A;  1NU1 D;  1OVV A;  1HVV A;  4AQR D;  3IR9 A;  3RL0 g;  2HV4 A;  4JYB A;  1JY2 P;  1GJQ A;  5CJ4 A;  1HGV A;  1UIX A;  3L4F A;  3SXT A;  3RL0 B;  2IZ1 A;  3C9I A;  3A3Y B;  2ZXE B;  3CD6 P;  3H1I D;  2E74 B;  2BEQ D;  1OW6 A;  4HB1 A;  1BSN A;  3PTZ A;  3M9B A;  1SQX G;  1FS0 E;  1NHL A;  1GDT A;  2R3S A;  1NTZ D;  2J5U A;  2E75 C;  3O5C A;  2HPC B;  1FOC A;  1R8E A;  1M8O B;  2Q3I A;  2MTA C;  2FYU E;  3SVW A;  1RF1 C;  4RSZ A;  2Q6Q A;  1N7S D;  3CXH H;  4PJ0 V;  1JY3 O;  3L70 D;  1OW8 A;  2YMY A;  3E1I A;  5APS A;  4I6M C;  3GG2 A;  3HRN A;  1N50 A;  4UB8 V;  3O20 A;  4EIF A;  3GHG A;  2GA1 A;  2PAJ A;  2C9X B;  2YKQ A;  2N9J A;  1SFC B;  1EDK A;  1KYO H;  1JTH A;  3L73 D;  1GTW A;  4N0K A;  1M1K Q;  1USE A;  1SQP E;  1NML A;  1XTG B;  2B11 B;  5KJ7 A;  2QM7 A;  2O01 H;  3V6I A;  2ORL A;  3WUU A;  1SP4 A;  2P67 A;  1VF5 B;  1DD4 A;  2M0B A;  1FZE A;  2ZVO B;  3M0A A;  1CSW A;  3AE3 C;  3NBS A;  1RAQ A;  1BGY D;  2IBZ E;  5DF5 A;  2KIK A;  4IL6 E;  3CX5 W;  2WSF H;  3PLN A;  3VYI A;  1CI6 A;  1KZU B;  1E29 A;  4AAL A;  2WTY A;  1AA0 A;  2WT7 A;  1DVV A;  5CIH B;  4XXL A;  1L0N G;  2D2C C;  4WQE A;  5TIS V;  3HQ9 A;  2R5B A;  3QH9 A;  2AIU A;  1G2C B;  3D6Y A;  1MFT A;  1EZV G;  5AVX B;  3W67 A;  3OJA B;  4P4Q B;  4AX3 A;  3H1H G;  3CCQ P;  3AE4 C;  1T3J A;  2PCC B;  5CCG C;  4PW9 B;  2D0W A;  3RK3 D;  4L76 A;  2D0S A;  4MU8 A;  3ORV A;  1C7M A;  3CWB G;  1SQV D;  4ZKP A;  3B5N D;  1LS9 A;  1YIJ P;  1DVH A;  2JDI H;  4H0K A;  4YXD C;  4L1Q A;  1OWA A;  5AW6 B;  2GUS A;  1SQQ J;  1KMI Z;  1C52 A;  2YIU B;  2AXT H;  1RHZ B;  1U57 A;  1A56 A;  1HF9 A;  2FYN B;  3H1K D;  1CXC A;  1KD1 Q;  1JY3 P;  3L36 A;  1J1E B;  2C1U A;  2E76 B;  3HTK A;  4WY4 D;  3KZI H;  3TGU E;  5BU5 A;  2C8S A;  3D6Z A;  2N1T B;  3H1L D;  1J1D C;  1AYG A;  3LW5 H;  4PD4 E;  3V2R A;  4EIJ A;  3OW2 O;  3RK3 C;  2Q1K A;  3L37 A;  1S6V B;  1LP1 A;  2UWJ E;  2Y0C A;  2QJY B;  2LKM A;  1C6R A;  3HD7 B;  3HE4 A;  1H0T B;  1GU4 A;  3CCU P;  2OYH A;  5E79 V;  1S5L X;  1CTY A;  4PV1 B;  1NTM D;  1ZV8 A;  4NFG B;  3L71 E;  4V2K A;  1URQ B;  1EZV I;  3VTP C;  5TJH A;  1LTA C;  1D7M A;  2CXB A;  1NJI Q;  4W80 A;  1OZH A;  3O6Q B;  2QM8 A;  2QSI A;  2ZXX A;  2XTS B;  3IN6 A;  1YI2 P;  1CYC A;  2IDB A;  2KZI A;  2R44 A;  1SQP G;  3GW6 A;  3L72 D;  1GW3 A;  4ZKU A;  2MKV A;  3AE8 C;  2RKL A;  2KLU A;  2O1K A;  5B66 V;  4IFD K;  1ZP0 C;  2FY8 A;  1PGO A;  1S2E A;  3F89 A;  2LXC B;  4L75 A;  4ASW A;  2V4H A;  3CCR P;  1FZG A;  2H7H A;  1GQ1 A;  2OYH C;  2L5G B;  1HJ3 A;  2CPB A;  1S4X A;  1HRO A;  5AVS B;  1K04 A;  5B5E E;  4D6T D;  1IFM A;  2KNC A;  2WVR A;  4OVN F;  2I1J A;  4FA9 A;  1Y9B A;  1S5L H;  1AOQ A;  2MHM A;  3ZCF A;  1GIW A;  2P1J A;  4EYY Q;  1B7V A;  1HCM A;  1USD A;  2WSE J;  3Q2Y A;  1K9M Q;  1FZC C;  3D71 A;  1Q81 Q;  1KQS O;  2E5T A;  1SFC A;  1AQT A;  2JR8 A;  3CX5 H;  3CCE P;  2ZON G;  1CHI A;  2C1V A;  1HJB A;  1LTJ C;  1E79 H;  4CPG A;  1VQP P;  3HQ7 A;  2G3A A;  5AUR A;  2KS1 A;  3CYT I;  3SWS A;  1PPJ G;  4M3L A;  1IRV A;  1SQX K;  5TIS E;  1VL2 A;  1SQB D;  1LT9 C;  1KQF B;  3OAK A;  1M1J A;  3RN1 A;  1EC5 A;  3ZDM A;  1S9K D;  3AE2 C;  1CIF A;  1DW2 A;  2NPS A;  5H2F H;  1HTL C;  1KB9 E;  2FBW C;  3RK2 B;  1W2B O;  1L0L D;  3CWB J;  4WQB A;  5KLV J;  2K1A A;  1AKK A;  4H0L C;  1ZR2 A;  1U74 B;  3CME P;  4BRY B;  1AVY A;  3L35 A;  2AI5 A;  1KIL D;  5DJT B;  3SJL A;  2D2C B;  3FWN A;  3S4R A;  1OVU A;  2N3B A;  1BCC D;  5AVQ B;  1C2N A;  3RN0 A;  2V7Q J;  4WWI A;  1DW3 A;  1K3H A;  1WMK A;  3R4Y A;  2P7J A;  1NTK E;  2QVA A;  1PV3 A;  3CXH W;  1YTC A;  1SS1 A;  3RGU A;  2HR3 A;  3CXH D;  3WU2 V;  1SQQ D;  4Y28 J;  1QN2 A;  2DVH A;  4AAN A;  1SQX E;  2C9N Y;  2PAC A;  3T97 B;  1JY2 O;  4KJM A;  1S5L V;  2FYU J;  3L72 G;  1CRY A;  1CI6 B;  2YCC A;  1KYO D;  2CE1 A;  2I1K A;  3L74 D;  1NKZ B;  1EXI A;  1F1F A;  2WT7 B;  5GTH H;  3II6 A;  1WRG A;  1H1O A;  1L0N K;  1Y47 A;  1OIP A;  1KIL C;  1JMM A;  4H44 D;  5E79 E;  2IYO A;  1IQC A;  1OW7 A;  2KI7 B;  2R5D A;  1OMI A;  5CIG B;  1R5L A;  1SQP J;  1CC5 A;  1CSX A;  4H13 D;  1MKM A;  5CIC B;  2W27 A;  1CIH A;  5AW5 B;  2FRC A;  1ZXG A;  2A06 G;  3H1J G;  4I2L C;  3AEC C;  1YFC A;  3WC8 A;  2QRX A;  2PGD A;  5KLV K;  3SSU A;  3CCM P;  5B66 E;  3CL3 D;  5H2F V;  4JYC A;  1E5W A;  3VMX A;  1IC2 A;  4WB4 A;  2N9Y B;  1X79 B;  3ZOO A;  2BCC D;  4FA4 A;  4ASV A;  3B4S A;  1VQN P;  1KQL A;  2WZ7 A;  3A0H H;  1SQB G;  3JCU E;  1MG3 D;  1L0N E;  1I8O A;  1FJK A;  4GYD A;  3PP5 A;  2CA3 B;  5EXQ A;  1H89 A;  1LNQ A;  2ZOO A;  2E5Y A;  4H0J A;  1AFO A;  5CMZ A;  2GIW A;  4H13 C;  4RES B;  3VYM A;  2YXQ B;  5EFW B;  3TDK A;  2CK3 H;  1EZV E;  4FB1 A;  1NIR A;  2IPP A;  1H31 A;  2OYI C;  1LP1 B;  3H1H E;  1COR A;  4O1W A;  2KUB A;  2WPV B;  3V5B A;  1VQL P;  3HE4 B;  3WFC C;  4OWF A;  2HFE D;  1N15 A;  2OYH B;  3L4O A;  3A0B H;  1L4A D;  1QVF O;  1CSU A;  5AVZ B;  2A45 H;  5KLI C;  3KXD A;  1BE3 D;  2KK7 A;  1RF1 A;  3MTU E;  1H32 A;  4GOF A;  4W7Y A;  1KTM A;  1DT1 A;  1PGQ A;  3AEB C;  2KYV A;  1SQP K;  1DII C;  1L9B C;  4DZO A;  1IFN A;  1NTK G;  2HYN A;  3CPW O;  1QYZ A;  2KB7 P;  4EIE A;  3EFF K;  3TGU J;  4N3Y B;  3O1Y A;  1GL2 D;  1BDC A;  3MD0 A;  2XNX A;  3G6E P;  2QJK C;  3VP8 A;  1CSV A;  1JO5 A;  1JOC A;  1I6E A;  2QJP C;  4UB6 H;  1GDV A;  3AE7 C;  4OGQ C;  1KB0 A;  2KNC B;  2SPZ A;  1I54 A;  3E1R A;  3P8M C;  1L4A C;  2QA4 P;  4Y99 B;  5DJQ C;  3L71 J;  2MJZ A;  3ZOX A;  3WU2 E;  2QEX P;  2WMM A;  1DW1 A;  2QIW A;  5C9M A;  4L3H A;  1GW4 A;  4BRY A;  4H0L B;  2M5A A;  1VQM P;  3A2A A;  3U59 A;  2ZT9 B;  2K88 A;  1DW0 A;  2DGE A;  1GL2 C;  2OGU A;  1KB9 I;  2KS1 B;  4U3F D;  1OAE A;  5CIF B;  4RKU J;  2OTJ P;  1N8R Q;  4GOE A;  1MFZ A;  2K9J A;  2B89 A;  1NKN A;  5KAF H;  1HH7 A;  5APV A;  3BCC D;  5KJ7 D;  1M1J B;  4NPE A;  3RBX A;  5CCG A;  4I7Z B;  3T97 A;  4HKZ H;  1G1J A;  4DY9 A;  2NPS B;  2C9L Y;  1CSB A;  1LT1 A;  1N7S C;  3CX5 D;  2N3Y A;  1L2P A;  4WQC A;  3AE6 C;  1KOR A;  3JSV C;  4ZMD A;  2Q5U A;  1QVG O;  1LFM A;  1LC1 A;  5AW2 B;  1T6A A;  1PP9 G;  1EDL A;  1I8P A;  2K37 A;  1DIQ C;  3PXT A;  1EQ7 A;  1M7L A;  5AVY B;  2O1J A;  4K3I A;  2OTK E;  5GTI H;  2YNY A;  1W2E A;  3VMA A;  2C2C A;  3RK3 E;  2IBZ D;  5AVU B;  3NFQ A;  3L75 G;  4L73 A;  1KIB A;  4K3A A;  3PXS A;  2I8D A;  4NPF X;  3V4W A;  2RH0 A;  1NU1 G;  1CRG A;  3S9O A;  4J20 A;  1PPJ E;  1GK4 A;  2GC4 D;  3WUT A;  2J59 M;  2RN0 A;  5CBN A;  1CCH A;  1YEB A;  2FYZ A;  3BRT B;  3L4M A;  2B88 A;  2N18 C;  3H1I G;  1M6Z A;  3TYY A;  3B5N A;  4N78 D;  1E8E A;  1RF0 C;  1NTZ G;  3WFB C;  1NO4 A;  1AOF A;  1IFI A;  1FDO A;  3TSI A;  4FA5 A;  1QX8 A;  2POH A;  1P84 I;  4L3G A;  3MK7 C;  1FI3 A;  2H43 A;  3K5B A;  1YYC A;  5CIB B;  155C A;  3L70 G;  1NTK J;  4WY4 A;  5CHX A;  2B4Z A;  1HZV A;  1QL1 A;  3O0R C;  5KAF V;  5KAI H;  1IJD B;  3GF7 A;  2NRG A;  1K8A Q;  3L73 G;  1SQX J;  1MUU A;  2YO2 A;  3B5N C;  1K3G A;  3EQ2 A;  1FI9 A;  3L72 E;  1YIC A;  4AUW A;  3PXW A;  4U3F G;  2FXO A;  1JCC A;  5KLI B;  1SQB K;  3OA7 A;  2W90 A;  5CBO A;  2GC7 D;  4PD4 D;  3AEG C;  3FXE A;  3V2N A;  1R0Q A;  5K5G B;  1FZC A;  1JM0 A;  5GTI V;  1BGY G;  2P58 A;  3HUS A;  4WY4 C;  4JPZ B;  2V7Q H;  4PJ0 E;  1IFP A;  1FOS F;  4R4L A;  1LTG C;  3ZOW A;  4UB8 E;  3RL0 D;  5APU A;  1LTJ A;  5C0Z A;  1YTZ I;  2KXP B;  1H31 B;  3L71 D;  1RE4 C;  2JEE A;  2E74 D;  3FXD A;  1U75 B;  1HJ4 A;  4RJT A;  2J58 A;  3M0D C;  1LT9 A;  3V4Q A;  2WSC J;  2E75 B;  3FGA D;  2Z4E A;  2A06 E;  3H1J E;  4OGQ B;  4WQ9 A;  2YMK A;  3DMI A;  2P10 A;  5AVV B;  1RF1 B;  1H32 B;  3HUS C;  2AXT V;  2FFD A;  2N9B A;  5CCH D;  2V07 A;  1KFM A;  1S1C X;  1GMJ A;  3TNU A;  2XKM A;  1L0N J;  1NTK K;  1HRC A;  4O1Q A;  1CO6 A;  4L74 A;  2ZXY A;  4ZNC A;  4OH8 B;  1I5T A;  1SQB E;  3KZI V;  1CRC A;  1SQV G;  1SFC D;  1QEX A;  2H88 C;  2Y9Y A;  4HH2 A;  1X0T A;  3LID A;  2YXR B;  3H1H J;  1CYJ A;  1M56 D;  1JMB A;  4IFF A;  4IL6 H;  1RQV A;  3EFG A;  3H1K G;  2HLO A;  1VF5 D;  2AEF A;  3KQG A;  1X22 A;  3CI9 A;  3C2C A;  1KIL E;  3LW5 J;  2FFD C;  5AW4 B;  1QKS A;  2Q3E A;  3H1L G;  1N7S B;  1RQU A;  5AW1 B;  3P8C D;  2M3B A;  3C8V A;  1DD3 A;  1YBK A;  2R32 A;  3H1I J;  2JO1 A;  2BGV X;  3CC2 P;  1W2L A;  1K73 Q;  2M5A B;  1LTS C;  3NTN A;  2FXM A;  1Z56 A;  2FWL A;  3CXH E;  3DR0 A;  1NH4 A;  4TT3 H;  4C7N A;  1KIL A;  1NTZ J;  2AXC A;  1MZ4 A;  4DT0 A;  1OVR A;  1TU3 F;  2WQY C;  2DW3 A;  2Y0E A;  1CTZ A;  1NTM G;  2RMZ A;  1GU2 A;  2ZJS E;  2K9J B;  5BU8 B;  3BAS A;  1FZF A;  2C0X A;  2CPS A;  1KYO E;  1CRI A;  4N6J A;  1W5C E;  1A2S A;  3L70 J;  2JP3 A;  3KPE A;  4GOD A;  1J3S A;  1KX7 A;  1JUN A;  1FZA A;  5AW8 B;  1VF5 C;  3CC4 P;  3C1L A;  1VQ5 P;  3TK1 A;  4YE1 A;  1CRJ A;  1CZQ A;  3IAO A;  3PRJ A;  1ZOY C;  1LGH B;  2LIR A;  1GK6 A;  1ZRT E;  4HJG H;  1YCC A;  351C A;  1Q82 Q;  4WVZ A;  2HG5 D;  2GUV A;  4LJI A;  2P2U A;  3A7O A;  2YQB A;  3HQ6 A;  1ZME C;  2ZYA A;  2B9B A;  2BH5 X;  1HZU A;  2O3J A;  3U1A A;  2ZYD A;  4O9B A;  2BEZ F;  4D6T G;  4GED B;  3MGN A;  1BSH A;  2WPQ A;  3A9F A;  4PD4 H;  3PHL A;  4FAV A;  1N73 C;  2E76 D;  1VYD A;  1NU1 K;  3KHU A;  1CIE A;  1J1D B;  2N1T D;  5CJ0 A;  3MZW B;  1M70 A;  1FDM A;  4BWN A;  1PFI A;  3RK3 B;  2OYI A;  1P84 E;  1FDI A;  3RMZ A;  3VN0 A;  4EID A;  3HD7 D;  1VQK P;  3B5N B;  1LTB C;  3Q5S A;  4PV1 D;  4H44 C;  4NPD A;  5DFS A;  2HOD A;  1NTZ K;  1J2J B;  4WBA A;  2A45 G;  1URQ D;  4FA1 A;  3ABV C;  4JQ0 D;  5APW A;  4WQD A;  5AW0 B;  2YIU C;  1PP9 E;  5APX A;  3UIA A;  1GD2 E;  2NZ2 A;  2Q9I A;  2FYN C;  1LJ2 A;  4WY4 B;  1Q7Y Q;  1J1E C;  2BLF B;  1L0L G;  2AXT E;  2IZ0 A;  1KQG B;  1YNR A;  1RE3 C;  5AVT B;  1NMI A;  2N1T C;  3L75 E;  1NAY A;  1FE6 A;  5B5E H;  1AVO A;  3KZI E;  3V2Q A;  1H88 A;  1LWU A;  2FXP A;  2L91 A;  1GKS A;  1NU1 E;  1EXJ A;  2GM4 A;  1NNO A;  1EDJ A;  2QJY C;  3BAT A;  1BCC G;  3HD7 C;  1S72 P;  1OX3 A;  3S1K A;  5GTH V;  2WPR A;  1L4A A;  3H1K J;  4PV1 C;  1OCD A;  1VQ8 P;  2IFM A;  3VP9 A;  1SVF A;  3H1I E;  1EZV D;  2JWD A;  1X9V A;  4U7J A;  1SQQ G;  2XV5 A;  3H1L J;  5B6Q A;  1FZC B;  2PFX A;  2W83 C;  3HUS B;  4Z1M H;  1NTZ E;  4HYT B;  5IY5 1;  3ZIY A;  3AEA C;  1VQO P;  3L74 G;  1OXZ A;  5APT A; 
#chains in the Genus database with same CATH homology
 1CRG A;  4FA9 A;  4J20 A;  1EB7 A;  1SQX D;  1AOQ A;  4PWA A;  2GC4 D;  2MHM A;  2RN0 A;  3CWB D;  1KV9 A;  3ZCF A;  1CCH A;  5KLV D;  1GIW A;  1JDL A;  2JWA A;  1B7V A;  1HCM A;  1YEB A;  3MK7 B;  1ZRT D;  3L4M A;  4AAM A;  1RAP A;  2N18 C;  1M6Z A;  3WFD C;  1I55 A;  1H33 A;  1E8E A;  4IL6 V;  2ZON G;  1CHI A;  2N9I A;  3ZOY A;  2CA4 B;  2C1V A;  1W5C T;  1CTJ A;  1CHH A;  1C2R A;  1N9C A;  3WFB C;  2PCB B;  1IZL 0;  1AOF A;  3HQ7 A;  5AUR A;  2KS1 A;  3CYT I;  3A0H V;  4FA5 A;  1YEA A;  3SWS A;  1CNO A;  1IRV A;  4L3G A;  3MK7 C;  1FI3 A;  4WQA A;  4WQ8 A;  1H9Y A;  1SQB D;  1CED A;  5CIB B;  155C A;  2BCN B;  3RN1 A;  2B4Z A;  1HZV A;  1A8C A;  1H9X A;  3O0R C;  5KAF V;  2FYU D;  3OCD A;  1QL3 A;  1N90 A;  1CIF A;  1DW2 A;  1RZ6 A;  2LIT A;  1P84 D;  1L0L D;  5B5E V;  1HJ5 A;  4WQB A;  1ZZH A;  1AKK A;  1BL9 A;  1U74 B;  1K3G A;  1FI9 A;  1E2R A;  1C6S A;  3A0B V;  2AI5 A;  1YIC A;  3SJL A;  3PXW A;  1FHB A;  2N3B A;  4EIC A;  5KLI B;  2CE0 A;  1LC2 A;  3OA8 A;  1BCC D;  1L0N D;  2GC7 D;  4PD4 D;  1SQP D;  5CID B;  1C2N A;  4EDF A;  3RN0 A;  1PP9 D;  4A7P A;  1R0Q A;  1DW3 A;  1K3H A;  1LMS A;  5GTI V;  3WUI A;  1IO3 A;  1YTC A;  3CXH W;  1F1C A;  3ZOW A;  3CXH D;  2B0Z B;  4XYD B;  3WU2 V;  1SQQ D;  4Y5R A;  1QN2 A;  2DVH A;  1KX2 A;  5C0Z A;  4AAN A;  3L75 D;  3H1H D;  1H31 B;  2PAC A;  3L71 D;  3NWV A;  2C1D B;  1S5L V;  1U75 B;  1CRY A;  2YCC A;  1KYO D;  2CE1 A;  3HQ8 A;  1HJ4 A;  4RJT A;  3L74 D;  1NU1 D;  1F1F A;  4UB6 V;  2HV4 A;  1CRH A;  1H1O A;  1GJQ A;  3SXT A;  4WQ9 A;  3DMI A;  3WFE C;  1CCR A;  1H32 B;  3H1I D;  1IQC A;  2AXT V;  2V07 A;  3VRD A;  3PTZ A;  1L9J C;  5CIG B;  1HRC A;  1CC5 A;  4O1Q A;  1CO6 A;  1CSX A;  2ZXY A;  1NTZ D;  3RLM A;  2OZ1 B;  1I5T A;  3KZI V;  1CRC A;  3O5C A;  5CIC B;  1FOC A;  3VNW A;  2B12 B;  1CIH A;  1PPJ D;  3ZBM A;  2MTA C;  2Y0D A;  3SVW A;  2FRC A;  4RSZ A;  1ETP A;  4PJ0 V;  1YFC A;  3WC8 A;  3L70 D;  4FAN A;  2BPB B;  3JBT B;  3GG2 A;  1CYJ A;  4JCG A;  5H2F V;  1N50 A;  4UB8 V;  3O20 A;  4EIF A;  2C9X B;  3DP5 A;  2N9J A;  2N9Y B;  3ZOO A;  3L73 D;  2BCC D;  4FA4 A;  3C2C A;  3FWL A;  1QKS A;  2Q3E A;  4N0K A;  2JTI B;  1MG3 D;  2QG4 A;  1I8O A;  1NML A;  2B11 B;  4GYD A;  2CA3 B;  5EXQ A;  3TGU D;  1YIQ A;  2BGV X;  1W2L A;  2ZOO A;  2ORL A;  4H0J A;  2GIW A;  2FWL A;  2BH4 X;  3VYM A;  3DR0 A;  3TDK A;  4FB1 A;  1CSW A;  1NIR A;  1MZ4 A;  3NBS A;  4Q5P A;  1RAQ A;  1BGY D;  1IRW A;  2Y0E A;  1CTZ A;  1H31 A;  2RMZ A;  5DF5 A;  1CXA A;  1GU2 A;  1COR A;  3CX5 W;  4O1W A;  2K9J B;  3PLN A;  3WFC C;  1E29 A;  3M97 X;  1CRI A;  4AAL A;  1N15 A;  1WEJ F;  3L4O A;  1A2S A;  1DVV A;  5CIH B;  4XXL A;  4QAO A;  3SLE A;  1J3S A;  1KX7 A;  1C75 A;  451C A;  1CSU A;  4WQE A;  5TIS V;  3HQ9 A;  1BE3 D;  4YE1 A;  3X39 A;  1CRJ A;  2QJK B;  3PRJ A;  1H32 A;  2AIU A;  2LIR A;  1DT1 A;  1YCC A;  351C A;  2QJP B;  4LJI A;  1DII C;  1L9B C;  3TF5 A;  2YQB A;  3HQ6 A;  4P4Q B;  5CIE B;  2BH5 X;  4AX3 A;  1C6O A;  1QYZ A;  1HZU A;  2PCC B;  4EIE A;  2O3J A;  3O1Y A;  4PW9 B;  2D0W A;  5DJQ B;  4GED B;  2D0S A;  4MU8 A;  3ORV A;  5KKZ B;  1CSV A;  1CIG A;  1C7M A;  1I6E A;  4KMG A;  1SQV D;  3A9F A;  3PHL A;  1COT A;  1LS9 A;  4FAV A;  1GDV A;  1DVH A;  1KB0 A;  3NBT A;  4H0K A;  2KNC B;  1VYD A;  3KHU A;  1I54 A;  4L1Q A;  1CIE A;  2A06 D;  3H1J D;  3ITK A;  1M70 A;  5KAI V;  2V08 A;  1C52 A;  2YIU B;  5DJQ C;  3ZOX A;  1A56 A;  3RMZ A;  4EID A;  2FYN B;  2I8F A;  1CXC A;  3CU4 A;  3H1K D;  1DW1 A;  2B10 B;  1RZ5 A;  5C9M A;  1H33 B;  4L3H A;  2VHD A;  2C1U A;  1FJ0 A;  2YK3 A;  2C8S A;  5DFS A;  1I6D A;  3H1L D;  1AYG A;  1DW0 A;  4FA1 A;  2DGE A;  3TYI A;  4WQD A;  5CYT R;  1S6V B;  4U3F D;  1OAE A;  5CIF B;  2Y0C A;  2QJY B;  1C6R A;  1QL4 A;  1HH7 A;  3BCC D;  3PH2 B;  5E79 V;  1CTY A;  2BLF B;  1CYI A;  2GB8 B;  3OCD B;  1NTM D;  1YNR A;  4NFG B;  1NMI A;  4AAO A;  4DY9 A;  1CHJ A;  2C1D A;  4V2K A;  1KB9 D;  2ZZS 1;  3CP5 A;  3CX5 D;  5TJH A;  2CXB A;  2N3Y A;  4WQC A;  4WQ7 A;  2L91 A;  1GKS A;  1MG2 D;  1NNO A;  2XTS B;  2JQR A;  1CYC A;  1LFM A;  1LC1 A;  3GW6 A;  3L72 D;  5GTH V;  1FI7 A;  1I8P A;  1DIQ C;  1OCD A;  3PXT A;  5B66 V;  4K3I A;  3OA8 B;  1EZV D;  2L4D A;  3VMA A;  2C2C A;  1FCD C;  1M60 A;  2EXV A;  5B6Q A;  1NTK D;  2IBZ D;  1GQ1 A;  2N18 B;  1KIB A;  1HJ3 A;  1KYO W;  1WVE C;  2OZ1 A;  1HRO A;  2ZBO A;  5IY5 1;  3PXS A;  3ZIY A;  4D6T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...